3OFSA

Dynamic conformations of the cd38-mediated nad cyclization captured using multi-copy crystallography
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
236
structure length
234
Chain Sequence
WRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLADTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGEDSRDLCQDPTIKELESIISKRNIQFSCKNIYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Dynamic Conformations of the CD38-Mediated NAD Cyclization Captured in a Single Crystal
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 79
structure length 234
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 3ofsA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ofsA02
1LSUA 2B4RO 4UVGA 5DDIP 4MINA 4BNYA 4BUCA 3EY4A 3PK0A 4RF4A 4HV4A 3U4IA 4WPGA 1QP8A 1ARZA 2NU7A 4BV8A 1J6UA 4RVFA 1HXHA 3W8EA 1R0SA 2RAFA 3I9KA 4EEXA 3KYDA 1ZJYA 4MIOA 1UR5A 4CUZA 2EP7A 3TZKA 2VYVD 3OICA 2QRLA 4OIMA 1Z82A 4KTTE 3I1JA 3WTCA 1NR7A 5EERA 5F1PA 1DC6A 1OC2A 4Y8VA 2VWGA 3ROPA 2NVWA 1LRKA 3ADPA 4XR9A 3AM5A 2CVZA 4W7HA 3QVSA 3KLMX 1HE3A 1NQAO 1I2ZA 3DR3A 3CMMA 4D0SA 3IJRA 1E7YA 4JX8A 4DIOA 1E6UA 1DPGA 4NBVA 4YT2A 1NVTA 1XDWA 5IZ4A 1R0LA 1MXHA 2Q50A 3E18A 4UVIA 2BFAA 4XZ3A 5DBGA 1QXSA 1YH3A 5HTOA 4KP7A 1LDGA 3RC9A 5KJ6A 3KXDA 3JQAA 3PWSA 2BI7A 4UVHA 4XD2A 4N7RA 3WQSB 2X0RA 2NWQA 4NH4A 3WSVA 1LI4A 3LU1A 2AEJA 3OEWA 1ISGA 1D7OA 1P1IA 3RASA 3VDQA 2IYPA 1WW8A 4YWJA 2HCTA 4CQMA 4F6LA 3HN2A 3O8QB 4AJ2A 3LT0A 4FFPA 1E7SA 4XB1A 3C8MA 4A03A 4W9NC 1CRWG 2DTEA 3AJRA 2YDXA 3BHIA 3KYCA 4XWYA 1Z75A 1C1DA 4ZD6A 3T7EA 1AUPA 5JDCA 4E5KA 3IIEA 4BKRA 3JQ9C 4L4XA 2J3JA 2XXBA 2YW9A 3BTUA 4A26A 3DZGA 4P4NA 1BVUA 4RQTA 2ZB8A 4CMEA 2YQ4A 1TI7A 3ZU3A 2I5PO 2TMGA 1IHYA 2P9EA 1UUFA 5FYDA 1HSZA 2FRDA 4G65A 1VJ0A 4K28A 3K30A 2UV8A 4IDDA 5FEUA 2B37A 3QVTA 5JO0A 4E2XA 3GC6A 1JAYA 1E3SA 3GR6A 2GPTA 4FJ0A 4R68A 1SOVA 4AJJA 4O63O 2AHRA 1H9BA 3AK4A 4EUFA 5MGBA 5HS4A 4PN3A 2W2KB 3NEPX 2VZ8A 4FW8A 4IMRA 4UREA 2FP4A 1UAGA 3F4BA 4C7JA 5CDGA 3PQDA 2GASA 4YJFB 1MXFA 4NBUA 3D4NA 4IM7A 4Z9XA 4BO3A 2BKAA 1X13A 4CM4B 1GYRA 5DCUA 2A9FA 5KJCA 5GY7A 3UN1A 3TZCA 3BZUA 5IF3A 1XG5A 5JDIA 4AJ4A 1AXGA 1IOLA 2NU6A 1H5QA 2JFHA 1U4SA 3NTRA 2LDBA 4WCFC 2GD1O 3EMKA 4XB2A 1GCOA 3DOOA 3LQFA 4KMSA 1A4IA 1EQUA 3GRKA 4IINA 4D42A 2AG8A 3ROMA 3C24A 4ROSA 2FOIA 2FPPA 1CQIA 2P91A 4MJLA 3RCBA 4OYRA 1ENZA 3OQ6A 2NQTA 3TZHA 4LVCA 2OOSA 1W6UA 3I9MA 5L7TA 1GYPA 3GLQA 4FQ8A 4MKXA 4CMCA 1HYGA 5T64A 1HF3A 2B5WA 5DBIA 2Y1DA 3ZWAA 1ADFA 1LXCA 1KY4A 3H9EO 3NAQA 3NT2A 3QLJA 4WOJA 4BKQA 2C2XA 2EF1A 5F1KA 1SEPA 2Y1OA 1A27A 2PV7A 3AI2A 3QWIA 4ALIA 1TA4A 2D59A 1NPYA 1R16A 3C1TA 4MO2A 3FWNA 1NBOA 3M2TA 1GU7A 1PL6A 3ITDA 4F3YA 1QYDA 3GZNB 4NDNE 2DBVO 3HJAA 4KUEA 2WE8A 1SB8A 2AQ8A 1WDLA 4OSOA 1A4UA 1UDCA 3NT5A 1XYGA 2NLOA 3B1JA 3GT0A 5BNTA 1Y9AA 2NTJA 3K96A 3KBOA 5JCJD 4BMVA 1YQXA 3ST7A 3GGOA 1EMDA 4AG3A 2JAHA 3H9GA 4H7PA 4IMPA 4PLZA 3K9QO 5JY6A 2EKPA 3AUSA 3IDSA 1O0SA 1ZNQO 3RKRA 2V6FA 3O9ZA 5AQ1A 1HT0A 4JLWA 4BNKA 2CF5A 3ZWVA 1Q7GA 4R41A 4RVDA 2Z1MA 4XDYA 4BNNA 2YV2A 5I7VA 1EBUA 1Q2XA 4WEQA 1UP6A 3TN7A 3SC4A 1KVUA 5C7LO 1JQBA 1Y8QA 1QKIA 3UICA 3FTNA 1Q7BA 1UXGA 2ZB3A 2DM6A 1C0KA 3AOEC 4NI5A 2FSVA 4YQYA 2GDZA 1KYQA 2X0NA 5U9CA 3QVXA 2I76A 4RLSA 1U3TA 3DHNA 3U4DA 3V2HA 2VOEA 4HBGA 1A9ZA 1ZSVA 1BGVA 3C1AA 3GF4A 3NGLA 3ZV4A 3JYOA 2EIHA 3E48A 4M54A 1O89A 1WDMA 3W6ZA 2DUWA 1XU7A 2AMFA 1L7DA 2PD6A 2D2IA 1PL7A 4DMLA 3GGPA 3A9WA 2RBEA 4DA9A 4OO3A 4YAEA 3PEFA 4AJPA 1U2DA 4JBHA 1HLPA 3JQ7B 3Q1LA 2X23A 1YBVA 4FIZA 3LZ6A 3DZIA 2ZB7A 3ZHBA 1C0IA 4QFCA 1U7HA 2BFMA 4CM6A 1AXEA 2NVUA 5BNIA 1ZK4A 1PU2A 2HMSA 3RC2A 1GZ3A 2XXJA 1DJNA 4O6VA 1UZNA 3H5RA 4LSWA 4KZPA 1Q0QA 1I3KA 3OECA 2ZB4A 5DT9A 3V2GA 1KVSA 1U5AA 2VRCA 3V1YA 3VVBA 1MG0A 4IGFA 3VZQA 3WMXA 3WQRA 5I8ZA 3BMNB 3QV1A 3K2BA 2D1YA 3HB5X 4Q9NA 5B4UA 5CDTA 1J49A 2QQ5A 2PKQO 4GVLA 2OXIA 4QTZA 3TF5A 4HUJA 3F9IA 1ZZEA 2O7QA 4Q3DA 3EZYA 5T57A 3A1NA 4FFOA 4UEKA 3HADA 4G2NA 4MP8A 3RD5A 1KVTA 2W2LA 3I4CA 3V1TC 1SPXA 3M1AA 2PGLA 4N5MA 4A73A 4KOAA 3L9WA 5DCYA 3FR8A 3PPIA 3A28A 3FNFA 4NR0A 1E5LA 1M67A 2R6JA 3K73O 2YUTA 5JAMA 5HWSA 4XJTA 1EEHA 2YHIA 3GGGA 3PHIA 2BF7A 3S2IA 5KVCA 2BD0A 4L4SA 1RM5A 3SBOA 1I3LA 4IIUA 2VUSA 3I9OA 4BKUA 5TC4A 5HM8A 3GVPA 3UHAA 4D41A 1BG6A 3ZWWA 2HQ1A 1TXGA 3WWYA 1V8BA 4N54A 1Y5RA 3WDSA 2Y0DA 5DBFA 3F1LA 3QWFA 4H3VA 1MG5A 4E13A 1CETA 3ITKA 4EJ6A 1C1DB 2VNSA 1EZ4A 4I5GA 4NK5A 4DIBA 1QG6A 1HZZA 3MJCA 3WG9A 4RPKA 4ZN6A 1ENOA 1GTMA 4GX0A 1FDTA 3OFSA 2HK9A 2WE7A 3DTTA 3ETEA 3VPXA 1CYDA 3ZGYA 2DFVA 4L74A 4I5EA 1P0FA 3ETGA 4KUGA 1E92A 5CPFA 3PQEA 2O48X 2HU2A 2P4QA 3BMCA 3GVIA 1G0NA 2YV1A 4R69A 2DC1A 4ILKA 4RVSA 3S2GA 5JAIA 1BXGA 4DIFA 1GFSA 3AOGA 4GGOA 3W8DA 4Z3DA 5CDYA 4OSPA 4DC0A 2YV3A 4LMRA 1A5ZA 2IYOA 2X0IA 4I5FA 3TRIA 1WXDA 3AWDA 4IS3A 2HLPA 2GERA 3OJFA 5I9NA 4L75A 2UVDA 3WGZA 3WMWA 5IG2A 4WLFA 2PZJA 1P74A 3QIVA 2JCYA 5A03A 1Y5MA 3EAGA 1HEUA 3H2ZA 5K6AA 1NP3A 2Z5LA 3H7AA 2H9IA 1KVQA 1EUZA 2HRBA 1E3WB 1HE2A 3DAGA 3Q2KA 1H93A 2Q1SA 4JBGA 1I01A 3HDJA 1ZSNA 1NFQA 3EVNA 4OAQA 3WJAA 3N7UA 4CODB 5JBIA 4TRRA 3RBZA 1XGKA 1T2DA 1XQ1A 2NQ8A 3TL2A 3B20A 1E1NA 5BSHA 3G0OA 2ZTVA 5BSGA 3EVTA 2Y93A 1R37A 1LSOA 2P4HX 2YFHA 3IC5A 4JROA 1ZK2A 4GLLA 4GX1A 2EKLA 4YR9A 1Q0HA 3MJEA 4HY3A 3BTVA 4DYVA 3OMLA 1JVSA 3JD1A 3DDNA 2OP0A 3ZDFA 1YQGA 1UP7A 4TVOA 1HDGO 3M1LA 5EPOA 2RH4A 4PG7A 1B8VA 2TMDA 4Q3EA 4CLRA 5TT1A 4RDIA 3RBVA 3G3EA 4XQEA 4YDRA 5KJ1A 1Q1NA 4KWHA 3CSDA 3RROA 1PEDA 4WJZA 3F5QA 3TWOA 3HHPA 4B4OA 2CD9A 5A3VA 2FR8A 2EG9A 4JCOA 4PRKA 1NQ5A 3LT2A 4D45A 3ZWCA 4A27A 2RHCA 5IDWA 3HNPA 1Y7TA 1UXHA 2PK3A 2Z1NA 4J4TA 4ZHSA 3R1IA 1UZMA 1O8CA 1Z74A 2O7SA 3NJ8A 4UVDA 3GNTA 3JYLA 3OETA 1HDYA 4TVBA 1QYVA 5G0VA 4E5NA 1H6DA 1DEHA 1WMBA 5I7EA 1DDOA 2Q46A 4EJMA 1IYZA 1LSJA 2H1SA 2E4AA 2Y1FA 4G81A 4GWKA 2F1KA 4DBVO 4UEJA 1I2CA 5A3JA 3AU8A 4U7WA 2QIOA 1UP4A 3QJ5A 4PLVA 1R4NA 3RU9A 3G79A 4IBOA 3INGA 1R4MB 4K26A 1LDYA 3VH1A 4RPLA 2C5AA 4E31A 3JQGB 4J1SA 2HMUA 4UUPA 4E5PA 2W4QA 1FF9A 3O8QA 3WQQA 4GGPA 4B7CA 2AG5A 1OC4A 3MZ0A 4H15A 4W7IA 4HFRA 4MVJH 4BNVA 3GAZA 3H4VA 4LISA 4Y6PA 5A5EA 2DAPA 2BGMA 1I0ZA 1ZK1A 5L9AA 3OSUA 4L9RA 2Q1TA 3PWKA 3KSZO 4NMHA 1P45A 2VHWA 1I8TA 3IP3A 3ZWOA 1LU9A 3H9UA 3JQCA 1I30A 2J5KA 2X6TA 3OBBA 4JIGA 3TNLA 5DNAA 4TZKA 3GPIA 1A7AA 3OIGA 1B8PA 3PIDA 3JV7A 2IE0A 3JQ7A 2PFGA 2CNBA 3E82A 1GQYA 3FBTA 4J1NA 5BT9A 4DLLA 4J1TA 1DAOA 2X9GA 4UVEA 4WECA 1O6ZA 2HK7A 1S6YA 1SC6A 3F5SA 3OJ0A 3JD3A 5A1TA 4IS2A 4A0SA 4DQUA 4LVUA 3PGJA 4IUYA 5ADHA 5DOVA 5CDUA 1LLCA 2PZLA 1PS8A 3L0DA 3U09A 3FPCA 5MDHA 4F6CA 3IUPA 4ND1A 4ZQHA 1IZ0A 4RCVA 4ALJA 3ICCA 3WGIA 5HRUA 4CM9A 4MP6A 3WX0A 4D3FA 1WP4A 2NACA 3V2UA 2PH5A 1GY8A 4XQGA 2DBZA 3RC7A 1P0CA 3COSA 3GAFA 1TB4A 4MKZA 4YEDA 3F3SA 1DIHA 1NPTO 3OP4A 4E33A 4TROA 3JQ8B 3WYCA 4GVXA 2JCVA 2UYYA 4NHEA 2O3SA 5F21A 2Z95A 3L6OO 1ULSA 1PQWA 3T4XA 3VHRA 4RGBA 1C0LA 2W98A 3M2PA 4NBWA 4XYMA 4E30A 5BNFA 2I66A 4YRBA 3DWFA 3PZBA 1B0AA 4F45A 3C7AA 2G1UA 3Q11A 1XIVA 2VCYA 3PGXA 1BVRA 3UGKA 1XSEA 3PTZA 4QSMA 1RKXA 1B3BA 3FNHA 4GSKA 4D46A 2FMUA 1B16A 4K6FA 3VZPA 3FWZA 1T2EA 3AFNA 1ZK0A 4OL9A 3PJFA 2D4AA 4J2HA 4BGEA 1L7EA 1LC0A 2D8AA 3GUCA 4HWKA 2DT5A 2I9PA 4RVUA 5ES3A 5JDCC 2A35A 2B83A 1RM4A 4IZIA 4R9RA 4HFMA 2VTDA 1RM0A 2FPIA 1GPJA 1XKQA 4R51A 5AYVA 4W9NA 5H83A 3I3OA 3ASVA 3DXFA 3S2EA 5IZCA 2PZKA 3GHHA 4RL6A 1K3TA 2D5CA 1GDHA 9LDTA 1WMAA 5B12A 4JGBA 5CEFA 3ULKA 5C7OO 3G49A 3JQBC 4MOWA 3W4IA 3P5SA 3PJDA 4MIYA 1M75A 2R00C 3HQ4O 2D3TA 1O9BA 4FN4A 4RVHA 1JVBA 1C1XA 4XGKA 2Y05A 1BW9B 4DUPA 3ZCXA 1YOVB 1ISMA 5FFFA 5KVVA 4QECA 3PJEA 3RUEA 3X2EA 2C0CA 4B8ZA 4D79A 3PDJA 2X8LA 3L4BC 4MVJP 1BMDA 5FF9A 5JCJA 5L3ZA 5A9RA 2VTEA 4XR4A 3RVDA 2IZZA 2LDXA 3DBRA 2GO1A 2Y99A 5H81A 1T2CA 2HJRA 5CEJA 2JFGA 2VYNA 3DFUA 5JYEA 2NTVA 1E1KA 1WAMA 2X0JA 2OUIA 3C3XA 4U8GA 1EFLA 4MVJE 4W6ZA 2YFQA 4IJVA 3VH3A 1NHWA 3IL2A 5L53A 2VNAA 4BOYA 4YAKA 4WCFA 1MUUA 2PY6A 3PIIA 5ER6A 5JFOA 5JY1A 1U2GA 1PGJA 4R1SA 3ZI0A 1LSSA 4KUHA 4XX0A 2UAGA 3DEYX 4CMBA 1HDOA 1PIWA 3R6DA 4WNIA 5K9ZA 3TZ6A 3S8MA 1DLIA 3GEDA 5JAZA 4NJMA 1K6IA 2EKQA 5ITVA 4CMHA 3FNGA 3MTJA 3LYLA 5B1YA 2CVQA 4PZCA 1DIBA 3ADOA 4DLBA 3DFZA 4WNCA 3DZHA 3DL2A 3L4BA 4J1QA 3WTBA 1FDWA 1P31A 3JQBA 4J7XA 5JW6A 4FC6A 3KSDO 4OGWA 5B4TA 3U0BA 4LCJA 3GZ4A 4II3A 5AXCA 1KVRA 3VVCA 4CLXA 4CLRB 4U5QA 1E77A 3IUSA 3I5MA 3ZV3A 3O26A 1K89A 4FJ1A 3LSYA 3JQDA 2GN8A 2O2SA 1YKFA 3RFTA 1NAIA 3WYBA 1ZXBA 3ZU4A 3P7MA 3DOCA 4BGVA 5CG2A 3ANMA 3RUFA 2VUUA 4W82A 1ZUD1 4J7CA 5IFLA 4OQZA 4RF2A 3M6IA 4HADA 4R1UA 4CMKA 3BYZA 4N5LA 3CPSA 4DXHA 1WNTA 2GCGA 3MJ4A 4NFHA 4XGIA 5A9SA 1IB6A 3UFXA 2JL1A 4IDEA 4NBRA 3AY6A 2AE1A 2V6GA 2ZYDA 4EBFA 4AICA 1N9GA 3EZLA 3C85A 1JA9A 1T4DA 2OBNA 4ITUA 4BO2A 3BMNA 4E0BA 3N74A 4DRYA 1YBMA 2V7PA 1PTJA 1SO8A 5T6BA 1N92A 3ZNQA 4R5MA 4I9HA 1YDEA 1H9AA 4Z3KA 1EK6A 2D0IA 2C29D 5TSDA 3VOSA 3B70A 3AI3A 2G76A 3NV9A 2H6EA 4CV2A 2AQKA 1OBFO 3ZWNA 5EL0A 1IL0A 2WTBA 9LDBA 2NADA 1VRWA 4XYGA 1ZJZA 3H8VA 4YYZA 1PZEA 2AA3A 4CM4A 2AQIA 5CEEA 1SB9A 4UAGA 4WLNA 4YTEA 2C5EA 4FB5A 4L0QA 2EJVA 5KCZA 2X1HA 2EJWA 3NDRA 4BB6A 4I8XA 1GZ6A 1P1KA 2V6BA 1QLJA 2VRCD 4HNHA 1LNQA 3B1FA 4BNXA 2BLLA 1YL6A 1ML3A 4ESOA 2IZ1A 4RQUA 1PJTA 4FC7A 2OL4A 5A5FA 3JYNA 4UEOA 4RZHA 3RUCA 4XYLA 1CERA 3GRPA 1KS9A 1OFGA 1P77A 2RHRA 3DMTA 3GDFA 5IDXA 1I3MA 3DZFA 5B4VA 4Q3BA 3HG7A 1C0PA 4ND5A 2OMEA 2NNLD 3D7LA 2ZTUA 3BMQB 3LLSA 5C7IO 1V9LA 4BO0A 3X2FA 4RORA 1QRRA 3FTPA 3KHUA 4A5OA 4ND2A 1FXSA 3D0OA 3S55A 2Q45A 5EQDA 3G17A 3C1OA 1PR9A 4WCDA 5L95A 4PLGA 3WOHA 2X86A 2DBQA 1UDBA 1ZKMA 2AEMA 2J3HA 5EN4A 3ZV5A 1GZ4A 2DFDA 2XPCA 4YQZA 4FFNA 3D3WA 3L6EA 3TOZA 3AW9A 2PLAA 1M6HA 4CM9D 1ISIA 1YO6A 1C3VA 3L6DA 2UUOA 3DBHB 3JQFC 4Q3NA 2BELA 3K8ZA 4J9VA 2PTGA 5GZ6A 4LRSB 1N8KA 1JKJA 3JSAA 7ADHA 5L7WA 3ZHYA 4PLWA 1LLQA 4NZ9A 3EDMA 5F1OA 1EE9A 1EVYA 2EP5A 4J0FA 4RPJA 1OOEA 3VH4A 5ICMA 2DVMA 1ISFA 3WS7A 2QYTA 2HO5A 4ALLA 4CPDA 1H6BA 3QWAA 3F46A 4OJNA 3LF1A 1PJBA 4EZBA 3Q6IA 2GN4A 3TDKA 1ISJA 3EC7A 3OA2A 1D3AA 4BGUA 2Q2WA 5A04A 3GPDG 2Y68A 1X1TA 5TJ9A 3SJ7A 1VKNA 3SXPA 4CM5A 3ROKA 3VTZA 4BNIA 4WK6A 3JCZA 2GR9A 3DAFA 3VDRA 2VYVA 4GX2A 3DO5A 3W8FA 1BDBA 5CHEA 3AI1A 1QYCA 2SCUA 1M76A 5EQFA 4BNMA 4MVJA 4CUJA 4B3IA 4ZQGA 5JMWA 5IDYA 4HKTA 3JQEA 3L4SO 4JP3A 2GZ2A 3WGTA 4EDFA 3GMDA 2Y0EA 2YZ7A 2QYSA 4BO8A 3DB2A 3TL3A 1NM5A 4RV9A 3HDYA 3KYBA 2AQHA 1I2BA 4NPCA 2IEBA 2X4GA 3KYCB 4PCVA 2VHVA 3NTQA 1H6CA 3QY9A 4M86A 4B3JA 4IJUA 4AJEA 1YXMA 3P2YA 2QRKA 4II2A 3WICA 3MOIA 4J7UA 1MX3A 1YB5A 1TT7A 1NX6A 3PYLA 4W99A 1DRVA 1NFRA 4INAA 1CIVA 1X7DA 8LDHA 4CJXA 1TVEA 3H5NA 3DOJA 3K31A 3KM0A 4JP2A 4YJDA 3LC1O 4E4YA 4I08A 4JBIA 3H6KA 2VWHA 2G17A 1V0JA 4PLHA 1LX6A 1NWCA 3MEQA 3P19A 5BR7A 4J90A 3UOGA 4FGSA 5A4DA 3UCEA 4BKPA 1J4AA 3FF4A 3T4EA 5DP1A 1CF2O 1E6WA 4FOOA 4D44A 2PWZA 4Q3AA 4JNKA 1PJLA 4PGFA 4CR6A 1RYDA 5DP2A 3PHLA 1L1FA 1VSUA 4NQZA 1LRLA 1MA0A 4M87A 1KBZA 3FNEA 5TS3A 1DSSG 3ZU5A 3FCOA 4MVJD 1ENPA 1OMOA 5IN5A 1ISHA 1X7HA 3IS3A 4MVJI 1XQ6A 3VC7A 3H9JA 5FI3A 5C3MA 2VHYA 4QFDA 1PQPA 1X1EA 4O0LA 4L76A 4A2CA 1ZIDA 1BXKA 3NDJA 4OQYA 4EGFA 4J2OA 1HZJA 3ANLA 1PS0A 2VQ3A 4NU6A 4ZRMA 5A9SB 3FSRA 4BO9A 1PL8A 2O4UX 5AOVA 2B36A 1V3VA 4E3ZA 1I32A 2E37A 2DTDA 3QWHA 2P9GA 2Y1GA 3LC7O 4PZDA 1ZH8A 4CMGA 1U28A 2Y0CA 4E32A 1MC4A 1AGNA 1ZBQA 4XQCA 2VOJA 1X15A 1FMCA 3IOYA 3E03A 3I83A 4W4TA 5HA5A 1QYWA 3DONA 1YJ8A 1E6EA 3ZWXA 1YL7A 3VPHA 1KEVA 5IXYA 1NASA 3A4VA 3BA1A 4WLOA 1P1FA 4LCEA 4Z0PA 5DZSA 3CEAA 1T1RA 1Y8QB 3PLRA 1JN0A 3Q9NA 1SBYA 3WBBA 1MV8A 5JCXA 1F17A 2CUKA 2XAAA 5I8WA 4AL4A 3OIFA 1EUCA 2JCXA 2WSBA 4QXMA 4ZQBA 5KWEA 1XCBA 3ICPA 1GCUA 4CM8A 2F00A 1ADGA 2FWMX 4JJIA 1JTVA 1RPNA 4FR5A 2PKRA 3NYWA 2A92A 4OXYA 3S1LA 1U3UA 1Z45A 1DO8A 1GAEO 3ZNPA 3KLPX 3SC6A 3OHSX 3NGXA 2PNFA 3U62A 1PGPA 1WLYA 4E2ZA 2JJYA 4TWRA 3KOUA 1IY8A 2HJSA 1D1TA 2Q1UA 4S3MA 5L7YA 6LDHA 4CV0A 4ZQFA 1PX0A 1WVGA 3ZN2A 1QYXA 1MC5A 5L4LA 1GV0A 2EV9A 5COAA 4ZQEA 1J5PA 4UULA 3WBFA 3MJVA 1SZJG 1R0KA 2VT3A 3DAPA 3IP1A 3PP8A 4M55A 4TSKA 2ZCVA 3SLGA 5JC1A 3GDGA 3MWEB 4KQWA 3ON5A 3TOXA 3GNSA 3KZVA 3PHHA 1LTHR 5KJEA 3JQ9A 3ONEA 1K6JA 1YB1A 3AUTA 3DMYA 4AJIA 4YRDA 3KO8A 3RUAA 3HDQA 3NKLA 1VM6A 1GUYA 1MB4A 2GN9A 3JQFA 4IQ8A 1FK8A 4BNWA 2R2GA 2I3AA 1XEAA 1GYQA 4IDCA 1YWGO 1Z7EA 4B4VA 2NVUB 1TT5A 1U3WA 2H63A 3C7DB 4NIMA 3JQAD 1BSVA 5FWNA 5C37A 1YL5A 1ZMTA 4PG5A 3GG2A 2PGJA 4BO6A 1LQTA 2ILTA 1EVIA 3BMOA 1OAAA 5DF1A 1K2WA 4PZEA 5EJ2A 1P1HA 3GEGA 4NK4A 3BTSA 5A02A 1DXYA 1GQ2A 3ZWBA 4RPHA 3DC2A 1YRLA 2J5QA 1DAPA 3JQAB 2CY0A 4DVJA 4XQ9A 3HN7A 1D4FA 4PLPA 4PIVA 2DLDA 4GLOA 1YJQA 4MVJF 2PD3A 1PS9A 4K1LA 3GUYA 1HYEA 5KJFA 2O3RA 1B14A 2FR0A 2P5UA 2YY7A 4CQMB 5ITWA 1T26A 2PZMA 4AJLA 1P33A 2B35A 2OO5A 4TKMA 1M66A 3TPCA 5BSFA 2ZJ1A 1PJCA 1HRDA 3JYQA 3T7CA 4QUKA 5IZCC 1E7MA 1VJ1A 3SLKA 3H65A 2E6UX 3VPGA 4KWIA 5L4SA 1NVMB 5JAQA 5T5QA 2C7VA 4BQPA 2C54A 4RPGA 4NNJA 4ZVVA 1F0YA 2ZYGA 3SX2A 2O3JA 3V1UA 2E49A 4H16A 4CLOB 1I24A 3BMCB 1WPQA 4CMAA 4ZA2A 5A06A 4XKJA 4PG6A 1R12A 1ADCA 1SOWA 3ZW9A 4Z0HO 2C07A 3HWRA 1E7RA 1N7GA 4O59O 3AFMA 2I67A 1VE9A 2BI8A 1ZO8A 2NU9A 1GR0A 4P22A 5EINA 1YONA 3VKVA 4B4UA 3OA0A 1PGOA 1Y8RA 4D7AA 5TLSA 1SMKA 4YPOA 4IY1A 1HTBA 4K6CA 5JS6A 4R01A 4Q39A 1QORA 4GBJA 4YBZA 3MOGA 4WKGA 2BGKA 1NHGA 1ULUA 5LDGA 4CQLA 4YACA 1ZFNA 2FN7A 4XEHA 3TJRA 4FJ2A 3PI7A 4J49A 3DMTC 1E3WA 5TF4A 2C7GA 4BMNA 1PJ4A 3UKOA 4M1QA 4I9UA 2ZIZA 4IXTA 4L8VA 3ZH2A 1EQ2A 2O23A 4M89A 1KY5A 1KOLA 4WGGA 2X5OA 1BRMA 3ZV6A 4D43A 5H82A 4S1VA 2IDZA 3WJ7A 3DZKA 3LF2A 3RUDA 4FSHA 2WWRA 2IXAA 1GADO 3QVOA 3LT1A 3DTYA 4IQGA 4IGEA 2A4KA 1ORRA 4DQXA 5IN4A 3D5QA 1XELA 3V8BA 4R5HA 2O50A 1IPFA 1GEEA 2AEFA 1Y81A 4QX6A 4JQCA 3RAJA 3EHEA 2GGSA 2H5LA 4C7KA 3ROQA 1PR3A 2OGUA 1JDJA 2WYVA 3WGOA 1NPDA 4M8SA 4TZTA 2HKIA 2WD7B 4YJHB 2WYWA 4KQXA 2HMTA 4WLUA 1NQTA 7MDHA 3L9XA 1K6XA 4IXWA 3Q9UA 1H94A 4J4BA 5DCWA 1XU9A 3ONFA 1GQQA 5DULA 1XA0A 3OF2A 2EHDA 1W4ZA 2IXBA 2DTXA 4JN6B 4AJHA 3G1UA 1T2FA 4ZICA 2QHXA 1VKOA 4J16A 4J9UE 4TQGA 1F14A 4DREA 1YGYA 3OH8A 5TT0A 3OEYA 1QV7A 2EW8A 3HZZA 4ALMA 3D4PA 5F5LA 2B5VA 2FPGA 5L4NA 3FI9A 3UF0A 4P38A 4P4GA 3F1KA 3KEQA 4JJGA 4CLEA 1U5CA 1MGOA 1LLUA 1R4MA 2IODA 4RF5A 4U0JA 3RU7A 4YAJA 4YT4A 3FR7A 3Q3CA 4XDZA 2ZQYA 3D1LA 4NJMB 4HX5A 3Q0EA 1KERA 3D64A 4CL8A 4R1TA 4YVFA 3B6ZA 1ZCJA 4FFMA 2Q2VA 3L07A 4BNHA 1LDEA 1KEPA 2XOXA 1PZFA 1BXZA 1BXGB 1PZHA 3A06A 3KVOA 3CKYA 1D1SA 5A9TA 4YA6A 2JAPA 1E1MA 1T24A 4PVCA 4Y6SA 2ZJ0A 5T8KA 3O38A 1H2HA 3ENKA 2P5YA 3ZHXA 2Y1EA 2Q4EA 3E6AA 2W2KA 4YB8A 3JD4A 1VC2A 1B2LA 1HDZA 1U8FO 1BWSA 3GDOA 4CV3A 2IRWA 4NJOA 1UXKA 4IDAA 3WIDA 1X14A 4J43A 2PKQP 2GUGA 1P1JA 2FY8A 3GVXA 1DLJA 1WZIA 1EFKA 1CWUA 3WB9A 4LGVA 1UAYA 4BNLA 3IMFA 2JHFA 1ZSYA 5TX7A 1XWFA 3NDIA 8ADHA 1HE4A 1PWXA 2GSDA 3QE3A 1Z7BA 4OHUA 1JWAB 1LDNA 1PGNA 3VPSA 5CAEA 5L51A 3RQSA 1HDCA 2DQ4A 2G5CA 4L73A 4OKNA 1DHRA 1QR6A 4DWVA 4DGSA 1EDZA 3UVEA 3QW2A 2VHZA 3HFSA 1DHTA 2CDBA 2QX7A 2DUUA 4RF3A 1N5DA 1N2SA 3GZNA 3TQHA 4J4HA 3NX4A 1WWKA 4J6FA 4HXYA 4Y67A 5G0SA 3RC1A 5DN9A 3JQ8A 4E5YA 2W8ZA 1F8GA 4Y9DA 4CLDA 2YHUA 4OXKA 4BNJA 1DC5A 3AM4A 4BS9A 1HL3A 2AW5A 1B26A 2YQ5A 1AHIA 3WGYA 1MP0A 1VI2A 4OKIA 4Z9YA 3H3JA 4CQLB 3D3WB 1E7WA 3PRJA 3U3XA 5IAAA 3PFFA 1B3RA 4Y98A 3FN4A 4A7PA 3PHGA 4TRMA 1ONNA 5L45A 3TZQA 2O3QA 4L4RA 3ZU2A 3WWZA 2X9NA 3AY7A 1HDRA 2PA3A 3PVZA 1A71A 1NR1A 1Q7CA 2P2SA 3GNQA 4GKVA 4B7UA 3ZZNA 3CH6A 3MCVA 4PLCA 3LDHA 4A10A 3IQDB 3K6JA 1PZGA 1TLTA 1Y1PA 1NVGA 4IDFA 1DIGA 3H5AA 3VH2A 2V65A 3GH3A 5I9LA 3N58A 3RJ9A 1LQUA 5KTKA 1DIRA 4CM8B 1NXQA 1R66A 1B7GO 3LLVA 4FS3A 3ZWPA 4WCFB 5EIOA 2CFCA 1U1IA 1WDKA 3CMCO 3GQVA 4R1NA 4OH1A 1CEQA 1NWHA 4WLEA 5KKCA 4EUEA 1VSVA 3RUIA 4R16A 5THKA 4ZGWA 4CLOA 1O5IA 4I9NA 1SEVA 4CL3A 3KB6A 2HUNA 3GY0A 4DPLA 4R9SA 3WGGA 1XHLA 1BTOA 1HKUA 3CE6A 3INTA 2HMVA 4MKRA 3JD0A 1D8AA 2AXQA 2DBRA 3ENNA 4DL9A 1K5HA 2VWPA 2BGLA 4DPKA 1GL3A 5F3RA 4E2YA 4OOFA 3AUAA 2NM0A 4DQVA 1HE5A 2EW2A 4MDHA 1Y8RB 2GLXA 4I1IA 4DTIA 3ZW8A 3NUGA 4BKOA 3U49A 3WLFA 3NJ4A 5AXAA 2RH8A 5HS6A 3WSWA 1C14A 1U8XX 2PD4A 4FPXA 1ID1A 1YVEI 4CV1A 2UUPA 2VZ0A 1YBAA 1YQDA 1DC4A 4PG4A 4CUKA 1PSDA 4J0EA 4MPDA 2FHSA 4U6SA 2JD2A 4R3WA 2WYUA 2B69A 3HFGA 5ILGA 3RI3A 4XYBA 5AXBA 5JSFA 5AXDA 1QMGA 2NVBA 1TEHA 2BH9A 5EMHA 4ID9A 1LLDA 1K0UA 3DBRB 1M6WA 4BO1A 3DBVO 3E1KA 3MWDB 1IZ9A 2VRBA 4R3NA 2PR2A 1Q0LA 3IKVA 2HK8A 5G2OA 1N9GB 2HDHA 3CZMA 5F5NA 2FSSA 1U3VA 1NNUA 3EYWA 3I4FA 4BNTA 3BXXA 4I5DA 1Z73A 1G1AA 3EUWA 3UH1A 3VTFA 4CQMD 2RCYA 4Z6KA 1DOHA 1JLLA 2Y66A 1FDVA 4MVJM 2NUAA 5KVQA 3ZNOA 3K92A 3KRTA 1R6DA 2GYYA 3UXYA 5I7SA 4U6QA 4IQ0A 2Q4BA 4RO0A 4TRJA 2Y1CA 1KEWA 3RSHA 3H9QA 2Q3EA 3RIHA 1YS4A 3H2SA 1DJQA 2PH3A 4IIVA 4CMJA 4XRRA 2E48A 5EESA 2Q49A 4E12A 5IDQA 3CTMA 3OJLA 1NFFA 1PJ3A 1ZXLA 2X7HA 1LJ8A 3E5MA 4ND4A 3WLEA 4E6PA 2Q1WA 4E2WA 3MJSA 3AU9A 5GZ1A 4D3DA 4XA8A 1JAXA 1ZK3A 2OORA 2X58A 1SNYA 1E3JA 1T2AA 3CIFA 3CINA 2JKVA 3AOEA 3LC2O 4RDHA 2UDPA 1DFHA 2ZATA 1XR3A 5COBA 1A7KA 1DFGA 3QHAA 4Z9FA 3WNVA 5T67A 1W0CA 1ZMOA 2CZCA 2X22A 4GPD1 1DFIA 1RM3A 5CPBA 3ZHZA 4ZRNA 1RYEA 2QW8A 4O1MA 5JO9A 3UCXA 3E8XA 3I9NA 2JD0A 1X0VA 2W2LD 1G6KA 3ONDA 4IDBA 2HMWA 2P9CA 1BDMA 1GEGA 4C4OA 1PGQA 4DMMA 4D0RA 4GQAA 2CMDA 1JKIA 3JQGA 4RVGA 2FR1A 3HB4X 3TFOA 4BO5A 2NV6A 2NTNA 1HETA 2OBYA 4Q3CA 3OM9A 1T25A 3MJTA 4GMGA 3K5PA 4IJKA 1BW9A 1YDWA 2DPGA 4WLVA 4CMEC 3JYPA 3WFJA 4JK3A 5T8KC 2X5KO 4HFNA 1E3EA 1DRUA 5G0TA 4FGWA 4PVDA 2BFOA 1MFPA 3R3JA 1QV6A 1LEHA 4XGNA 2X5JO 4J91A 3KTDA 4PLTA 4AVYA 5G0WA 1W8DA 2JHGA 2ZTMA 3KYDB 3D3EA 1GUZA 5GZ3A 3PDUA 3GHYA 3GA0A 4FFLA 4QQRA 4TMFA 1WZEA 1Z6ZA 1ADBA 3ASUA 4Y6RA 4URFA 3SVTA 3H3FA 4BQRA 1QLHA 1HWYA 4K9DA 5FI5A 2OHXA 2CDAA 3PQFA 5JPIA 3UUWA 4CMIB 1P44A 1KEUA 5TNXA 5HBRA 4U0KA 1FDUA 1RWBA 3GFGA 1DBVO 1DB3A 1P3DA 1B15A 2HRZA 2GZ3A 5BSEA 2GN6A 4RLHA 4EJ0A 2G82A 3I52A 1SAYA 3D5TA 3CXRA 1JU9A 1N1GA 5JE8A 5JXWA 4KDFA 2I65A 2J6IA 2BMAA 4NFSA 4BNFA 4HNGA 2C20A 1GD1O 3QQPA 2CDCA 2EGHA 1LUAA 1XLTA 2WD7A 4YJHA 2EWMA 4B79A 5BQFA 4BIIA 3WGQA 1LC3A 4GWGA 4GI2A 4BHTA 2J5RA 2G0TA 5G0UA 1EBFA 1UXJA 4GX5A 4EI2A 1DIAA 1BHSA 2O2YA 4ZU3A 3LK7A 3VZRA 4EEZA 1CDOA 5LDHA 4WEOA 1H0KA 4E5MA 4EUHA 4FD3A 1MLDA 2HAEA 3ANNA 3UAGA 1T1SA 4P8RA 3GVCA 1C1XB 1VL0A 1J0XO 4OXNA 2EXXA 4HFJA 1P9LA 4AJNA 3BHMA 2ZK7A 2D5AA 4NG5A 2C82A 3PJGA 4WE3A 5C5IA 3QA9A 4LMPA 5CDSA 4ALKA 2I99A 1R4NB 4WUVA 5TJHA 2WJPA 2BRUA 3BIOA 4YJGB 4BMSA 1X7GA 3F6YA 2OZPA 2R00A 3PHJA 5J23A 2B0JA 2JD1A 3GVHA 3STHA 2EGGA 3WIEA 3E9QA 5TQVA 4OMUA 5LCXA 5JMPA 2YDYA 3ZNNA 2OP1A 1JWBB 2AE2A 4XYEA 2WM3A 3GK3A 2A94A 1VJTA 3NRCA 4KTVE 5KOIA 4BV9A 5IXSA 2VWQA 3MTGA 3W1VA 1OI7A 3OIDA 3F4LA 3HE3A 2O3UA 3IAHA 3ABIA 3E5RA 2YJZA 3PWZA 3QSGA 1N1EA 4N18A 4DPMA 2BHLA 3GN2A 2O3TA 1PQUA 2J8ZA 3JQ6A 4CLHA 3FPLA 1B8UA 3QP9A 5I7FA 3PFWO 4ONEA 3KETA 2PGDA 1UXIA 2FZWA 3TFQA 1E1LA 4OM8A 2OFPA 3KEOA 4GH5A 2BFPA 3PYMA 1LBEA 1EVJA 3CZRA 1DRWA 2VYND 2Q99A 2I3GA 3NT4A 4BO7A 3BTOA 5AVOA 4GSLA 1ZEMA 3DHEA 5JC8A 2X9VA 1JKFA 2RIRA 1UZLA 2NSDA 5CFZA 2DPHA 2V6MA 5ENDA 2CVOA 3K2EA 2QG4A 3E9NA 1NQOA 3V5NA 3G1TA 3PZRA 3HUDA 1IULA 3EK2A 4YAGA 1ZW1A 5JDIC 3RJ5A 5ER9A 1UDAA 4DBZA 2EERA 2ET6A 3Q2IA 4QT0A 3DBLA 5CP8A 5GMOA 5TRTA 3DBLB 3PXXA 5JNLA 4DLAA 4B8WA 4LK3A 1P1RA 5B37A 4P4LA 3FHLA 4CR8A 2WMDA 4N5NA 3UW3A 3BMOB 1CJCA 3KV3O 1PJ2A 2VHXA 4YRAA 4BNZA 5IJZA 3GFBA 3S2FA 4B4WA 4YJFA 4IJWA 3GN1A 4TRNA 1I36A 3E9MA 3I23A 1Y9EA 2ZKLA 4PRLA 5TGDA 5CG1A 5A05A 5G4KA 2ZYAA 1IHXA 2VUTA 4BL5A 1VPDA 1YOVA 3ZWMA 1HYHA 1IE3A 3U4CA 1A9YA 2QRJA 4YXFA 3GMSA 2DU8A 1PJQA 4DC1A 2WD8A 4X54A 4E21A 3HDHA 4IPTA 4ALNA 3D4OA 1I3NA 1M2WA 4FCCA 3RUHA 4F46A 3QRWA 4UUOA 3AUUA 4LRTB 4PFJA 1X0XA 3KSUA 5JLAA 2J3IA 3OQBA 2DKNA 4FBGA 5KNLA 1V3TA 4OOEA 2O4CA 2QZZA 1IPEA 5KIAA 3FBGA 3WR5A 2B4TO 1HLDA 2FZEA 2VN8A 4GKBA 4DYDA 4EW6A 5DOZA 3U9LA 4GL4A 1PJSA 4JXKA 4CM3A 4AJ1A 3DQPA 5KKAA 1EK5A 1H2BA 4XJSA 1E5QA 3AY3A 4BGIA 1AE1A 3SEFA 5ILOA 1N7HA 4ND3A 1V6AA 2Y67A 3B1KA 1VLLA 4XIYA 5ICSA 3DBHA 3R0IA 1YE3A 1O94A 1HDXA 3W4KA 4Z0TA 1CQJA 3SJUA 2ZCUA 3OQ1A 3ORFA 1F8FA 4PLFA 2GZ1A 1EE2A 4D3SA 3GOHA 4M49A 4CM7A 4KDEA 3W6UA 3AM3A 1FJHA 4FDAA 1VL6A 1SCUA 1UH5A 4YT5A 1E0DA 3OJOA 3GEMA 1RJWA 2Q2QA 1EVZA 3RBXA 4YJGA 1OZAA 4QEDA 4CM1A 1GPDG 3FD8A 4NFYA 1MFZA 1KC1A 5LC1A 4AJOA 1H6AA 3OJEA 3ZWYA 3WYEA 3CUKA 5K6AC 4NBTA 1ENYA 4QO7A 1NTOA 3I6QA 1V3UA 5JYDA 3DZBA 2ZQZA 1G0OA 4BNGA 3A14A 1QSGA 1UJMA 2GNAA 5L40A 4LN1A 1IUKA 3TSCA 1U7TA 2VT2A 5U1PA 1KIFA 4QO8A 3PYXA 4ZJUA 2E82A 4FOSA 3I6IA 1ZVMA 2P68A 3RWBA 4WASA 2B4QA 1AN9A 4IDGA 1GV1A 4MP3A 4UUNA 3R3SA 2CF6A 1YB4A 1E3LA 1NYTA 4G5HA 1F12A 2ZTLA 3O03A 1I10A 3P2OA 4PG8A 3U4HA 3JD2A 2I6TA 2GRAA 1NAHA 2NU8A 2C59A 5G4LA 3EW7A 4XCVA 2J3KA 2YHIB 3U5TA 4B3HA 1ONOA 1T4BA 1DC3A 4TKLA 2VZ9A 1EDOA 2WEKA 2C2YA 2JFFA 2QZ9A 4IZHA 5ENVA 2WDZA 3JTMA 4EYEA 4RZIA 3F47A 3KUXA 4J3FA 4LSMA 4WOKA 5COQA 3FRJA 4BO4A 3RFVA 3QVWA 3RFXA 5KVSA 1KC3A 4RJTA 3DZJA 5U4QA 1I5RA 1LRJA 4LW8A 2XF8A 1TT5B 4PLYA 3W4JA 1W73A 2GF2A 3WXBA 4YT8A 3BHJA 3QWBA 3I9LA 4CR7A 1A72A 1ONPA 3ETDA 4JJFA 4GAEA 1R15A 3VAZA 4EITA 1ZEJA 1U4OA 4AJKA 6ADHA 5G4KB 4BB5A 1VL8A 3INRA 1E3IA 2POQX 4XIJA 1PWZA 4NU5A 4YAIA 1E7QA 1FDSA 1LA2A 1S7CA 3HSKA 3PLNA 4AFNA 3BAZA 1Y6JA 1GUFA 1U9JA 4B7XA 3VPFA 4MIEA 5I9MA 4BVAA 3IJPA 3NTOA 2EEZA 4HP8A 4FFRA 2YYYA 4R54A 4O5OA 3O4RA 3LVFO 4YCAA 1O95A 3I9JA 3WFIA 2IEDA 1KETA 3DHYA 1JW9B 4GMFA 4BNUA 3IKTA 3VKUA 1HSOA 3UCFA 1F06A 3RKUA 5K0ZA 3C7CB 3BMQA 1V35A 3VZSA 4CMIA 4MVJG 2CSUA 4XRGA 1LDBA 1AHHA 2IZ0A 1LDMA 1I33A 2HSDA 3WNQA 3EGOA 4UUMA 1EUDA 5TIIA 3WGHA 3LT4A 3GG9A 3L77A 4R4JA 5THQA 2W90A
chains in the Genus database with same CATH superfamily
1NYRA 1YB7A 2VQEB 5K01A 1A50B 2B4RO 1YCFA 4C14A 3QEJA 4NEHB 4D9CA 3OMWA 3QX8A 1U81A 3WLJA 4OX9B 2AZDA 2NU7A 3G8DA 3JZDA 4HQ6A 1JPNA 1OQAA 1J6UA 1XQYA 2IH2A 4NBLA 4EIWA 4DV4B 1X77A 2V03A 4KX3A 4CDGA 1JFRA 3DE2X 4EEXA 2O5EA 5JAHA 2V54A 5HFNA 5K2MA 3LXRA 5IX8A 1XZIA 1UR5A 4CUZA 4C6SA 1I5EA 1WS6A 5AVZA 5H3LA 2EP7A 3TZKA 1C3OA 1W34A 2VNHA 2VYVD 2NZ8A 3FSGD 1JG6A 5DN6D 4JHLA 4G4IA 3EARA 4KTTE 4MK4A 4MWEA 3W6NA 4IEIA 3OLYA 5DSXA 3K1JA 1A5BB 3NI2A 4ESEA 1NV8A 1CIPA 3BFKA 5KSYA 4C88A 4M53A 1I9CA 2Z9BA 1DC6A 2PS1A 5TMBA 2QG6A 5CLIA 4BWFB 2PZ8A 4AS1A 2VG8A 1B73A 1AA9A 4JODA 2WAXA 3TXYA 3UB3A 1X8JA 3ZE7A 3ADPA 3F74A 1V8FA 2EBWA 3KLMX 3LRTA 3NBQA 2VKTA 4X92A 3SOPA 1U90A 3NYQA 4JX8A 1K8ZB 4DIOA 2AN9A 3KQHA 1MT3A 3AQIA 3E3NA 1E69A 1ND5A 3OEED 4N12A 1K7CA 3UJ3X 2G80A 1P9RA 2A1TR 2Q50A 4N7MA 4UVIA 4BPRA 1QXSA 5HTOA 4WVFA 2W00A 4NZMA 3RC9A 2FX5A 5KJ6A 1O94C 1TCVA 3L46A 5CVCA 5A4AA 1YTUA 1QHFA 2AEJA 1WXEA 3CISA 3G59A 4MUNA 5EE0A 3RASA 2VJYA 4B3FX 5IM4A 1FRZA 2C9YA 2GBPA 2QUJA 1WW8A 2V5UA 2HCTA 4I4TF 4AJ2A 3KSRA 2PSFA 3V00A 1WJGA 3VZDA 4TV8A 3ZGNA 3RJTA 4XB1A 3TIGA 3OIVA 2ZE7A 1H8HD 1E59A 3AJRA 4RHFA 2GPSA 3BHIA 3K3PA 3KYCA 1O6FA 2ZRNA 4IHQA 1Z88A 2WTEA 1C1DA 4ZD6A 4R2IA 3DTVD 5FL7A 5JDCA 1PFUA 5ENZA 1Z2NX 3M3PA 4BKRA 1FP4A 2ON6A 4GKKB 3A36A 4DLXA 1WU7A 1XYYA 2OAP1 2HF8A 4CTOA 1W1IA 4X1IA 4A26A 4HWSA 4RQTA 1GARA 3AERA 3JU3A 4KW7A 4C1NA 4HT3B 3AYXB 1MRNA 2TMGA 2XH8A 4M9UA 2I7VA 2FRDA 2OXRA 1S2OA 4OXIA 4PZYA 5E7JA 1YC5A 4YP1A 4DCOA 3K30A 4F06A 2UV8A 5FEUA 2ZI4A 4F8EA 3QVTA 2Z58A 4M36A 3ESXA 4LK2A 4E2XA 1RMQA 3D6TB 5JO0A 1HL7A 4JGIA 4FJ0A 3FBWA 3E3OA 1RP7A 4R68A 3KXIA 1XZLA 4QM7A 1H9BA 3KZNA 1W7AA 2W2MA 1OYVA 1YIDA 4BCCA 1FW6A 3RF6A 4XPIA 621PA 3NEPX 1ZU5A 2VZ8A 4IMRA 3WK9A 1TUGA 4NYIQ 4D6XA 1FDRA 3F4BA 3MCZA 4JJAA 3EOBI 4MV8A 1N2CB 5CDGA 3IH5A 1U0RA 2GASA 2MMGA 3KT6A 4GIBA 1YC2A 2AN4A 4NZYA 2YVUA 3KTFA 5J2UF 5ED4A 5SV2A 1D2HA 1JQEA 1IZYA 2VDPB 2YASA 2BKAA 3DT8A 4MS3A 1GYRA 2H2FA 2V8OA 5DCUA 4C7OB 4FP9A 5D1NA 4JJZA 2RBGA 3BZUA 2FEPA 4A0FA 2D0PB 1XG5A 2PM8A 1ZL2A 5EHIA 1AXGA 5FTNA 3MS4A 1QDEA 4CG1A 4P7BA 3HVIA 3EIHA 4Q9AA 1HYBA 4TSFA 2GD1O 3NIBA 1Z2DA 4DEVA 1XRLA 3DOOA 3ES9A 4QBKA 3GLFA 4DSAA 3G2OA 4MUJA 1EQUA 3UANA 1T1IA 3B3JA 1MIOA 4LE0A 3SQWA 3KZKA 1LBHA 2JK1A 4ROSA 5K3FB 2FPPA 2C61A 4MPRA 2QPOA 5KX5F 2JLXA 5FCDA 1D0IA 4BAZA 5FTMA 1W4AA 1K08A 2CV1A 4EO4A 4LVCA 3W2TA 4W5JA 3KKKA 1EXDA 4QYMA 1GYPA 4FWBA 3F0TA 3KUUA 2MSWA 2ZXEA 2HLDD 2WZBA 4JENA 2VT7A 4S1PA 4YJ3F 5CH5A 2BSXA 3DFKA 1QGZA 1WHTB 1XRMA 2B5WA 3LTEA 4YMVA 5BN1A 3STYA 2ZBEA 3E15A 3ZWAA 4BUJA 3RC8A 3KKQA 3QLJA 4WOJA 2EF1A 2HA7A 1VRCA 4PZUA 1LY1A 1QC5B 3IIKA 1WV0A 4ALIA 1XCOA 2A67A 1NPYA 4MO2A 2DYKA 3NWBA 1NBOA 1RADA 2I2AA 2XUDA 3FUCA 1PL6A 4V1CB 2YBEA 3ITDA 4NDNE 3RU3A 4LDQA 4RVCA 4Q9IA 2HU8A 3EXFA 1IBRA 4M8IA 5HF6A 2E4VA 2JH3A 5ALUA 1MA3A 3T5PA 5IT9A 5CLLA 4E88A 4I1SA 4LXHA 4E5VA 1A4UA 1GGFA 4ZCRA 3E7FA 3ABZA 4RA6A 2NLOA 3GT0A 3P9NA 2BONA 5F5XA 3A2KA 1GXSB 2IUYA 1M6EX 2NTJA 2RAVA 2Q3JA 5KQRA 2VA9A 1AKWA 3K96A 3KBOA 4UASA 3VU0A 4EG7A 3ZXXA 2AD1A 1W87A 1K4YA 2FUCA 4IMIB 4L57A 1K5PA 4PPGA 5TE9A 4AG3A 2JAHA 3K1YA 1TU0A 1PFWA 1QZXA 2QV7A 2HBRA 4H7PA 4RYDA 5DM2A 5GWXA 1OAKA 3U39A 3BWEA 4HGNA 1J39A 1V8ZA 5AQ1A 4DR7B 1KMMA 4JLWA 3W9UA 4ZCIA 3QMVA 2LIVA 3UGTA 4ARCA 4R41A 2X9LA 3NBAA 1QH1B 1L5VA 2MJLA 4LDAA 4RVDA 2XT9A 2YV2A 3KXPA 4BNNA 2H7YA 1EBUA 1Q2XA 4MYDA 4WEQA 4L8LA 3W3AA 4M8LA 1P0PA 5DHRA 1EE1A 5FHQA 4D8YA 4DS3A 1JQBA 1PP4A 1XNJA 4YV2A 1BO6A 3K0CA 5CDFE 3KOYA 1Q7BA 4RY0A 1I4DD 3T7IA 3R5XA 4DNOA 4YQYA 1UBEA 5U9CA 4DA0A 2JRCA 2H57A 2I76A 2QTFA 4D99A 4QBFA 2RHDA 2REQA 4M3NA 3BK1A 4RVOA 5JD6A 2VQFB 3CUUA 2G06A 2OY0A 3CF4G 2GX6A 3H5TA 4PAGA 4B2PA 3GF4A 3PEUA 3I5XA 3NGLA 4EF4A 3RQIA 3B1VA 2EIHA 3VVMA 2P6MA 1ORDA 1SBCA 1XROA 2CJWB 1IZZA 3L04A 4IILA 4LJ6A 4M54A 1YQQA 2CUTA 1O89A 4QRIA 2DUWA 1DX4A 4ZFNA 1L7DA 3PXAA 4ZO7A 3PA6A 1PL7A 1N3YA 1E58A 3CZAA 3P0HA 2KJQA 4N8DA 3RRJA 1B43A 3VOAA 3WP1B 5F23A 4OO3A 4RGYA 1X87A 3BEOA 4F60A 3EIEA 3NCHA 5MN6A 4NAUA 5JXGA 1ZW6A 2F8SA 5FWYA 4FIZA 4FGLA 4HLQB 1MABA 2H65A 4GZMA 4RMIA 3UBTA 4QFCA 1MB3A 3SSAA 4K9KA 4DAEA 3C6KA 1WSWA 1ZK4A 4JLPA 4AQYB 4YASA 5EVJA 1P19A 1XB2A 2GN2A 4MI9A 1NC3A 3RC2A 1GZ3A 2XXJA 4O6VA 4YQEA 2X41A 5J58A 5JD5A 4KZPA 2RARA 1JFFB 2L18A 2AS0A 2YZKA 3OECA 4N1AA 1ILEA 1W48A 2Q41A 3DTVA 4UFOA 3VZQA 1KEEA 1XK6A 1M2EA 3FYDA 3LWZA 4IRMA 2GAOA 1WCV1 3HB5X 3VR5H 5B4UA 2RI6A 2ZJ4A 2PX4A 1QQ6A 2QQ5A 2YJNA 2AYYA 2PKQO 5I7UA 1JQ5A 1GTVA 4GOKA 4OBEA 4OFBA 4QTZA 4RGQA 3WK6A 2P6OA 3UK2A 3F9IA 3JVDA 3GZTB 3C70A 4F96A 3EZYA 4PYQA 3SE0A 1ZX1A 3MJFA 2Z3WA 3UWPA 3GMTA 4RXTA 4TGLA 4D4LA 1INLA 2W2LA 1KXZA 4KVGA 3KPUA 4QBHA 3RD5A 3M1AA 4PQRA 5LQAA 5DCYA 1NNSA 2FK8A 3PPIA 4Z7QB 3ZHOA 3OY7A 4LHSA 1FRNA 1KYZA 3AVUA 4QHSA 3FNFA 3E27A 4H7FA 4NR0A 1M67A 2R6JA 3K73O 3HVUA 4GPAA 4REQB 3Q7SA 2PRYA 3DF7A 5JAMA 1YR9A 3EHDA 4XJTA 1EEHA 1V7ZA 2MINA 3A7DA 3RODA 1RRPA 2BF7A 4BVHA 1YRQA 1JE0A 5D85A 4V0ME 4AD8A 4KWTA 1KI7A 2B8NA 1GNSA 2QTNA 4L3WA 4DMRA 5H1YA 1RWNA 4PIMA 4TQUS 1IWPB 1CJTC 3CX4A 2VDNB 4NATA 2VUSA 4J3NA 4YCSA 4LYJA 2JCSA 1BG6A 4DOMA 2GCIA 3FFAA 4GUAA 2UU9B 3HFJA 3WDSA 2IL1A 2V0GA 1AF4A 3F1LA 5DBFA 1VE6A 2H2AA 4K2AA 2HSGA 2JLSA 3U81A 1JIVA 1VZ2A 4H3VA 1CE8A 4ND8A 2IS1A 4RSMA 5ALNA 1OUMA 2BMEA 4LHVA 1SFRA 4EJ6A 1C1DB 1KHTA 2B7LA 3EMBA 4O4HA 1QG6A 1X8LA 3W77A 1ZISA 5KYXB 3IP7A 5CK5A 5LXTB 4WFQA 1OKKD 2PO5A 4GX0A 1FDTA 3HKBA 4YMTA 3EZFA 5H59A 4BB0A 3HHEA 1JLKA 2DFVA 5CYOA 1P0FA 1GRVA 1COWA 1LZKA 4CN9A 1P6QA 3S5JA 2OCAA 4B6PA 1G0NA 1F20A 4TZ6A 2XJ4A 4US1R 3AP1A 1YK1A 1OHHA 3IQZA 4X1IB 3TTVA 1LBIA 2FAXA 3RS3A 3SZUA 2H1VA 5J2UA 3CC8A 3S2GA 4AZ0A 1BXGA 3O7MA 4TTQA 5AI4A 2QROA 2W6ID 3PQ3A 4M1ZA 2F8TA 2JAQA 1VYHA 5CDYA 4WK4B 4PQFA 4DC0A 3I8XA 2I9KA 3DW1X 1A5ZA 5FPPA 1N8SA 2X0IA 2Z08A 1WXDA 3TRIA 2WAYA 4IS3A 4MUBA 2HLPA 4P2BA 3ZKWA 2RE8A 3OM1A 2AZTA 2GK4A 2IFTA 2AVDA 3KDSE 5L3RA 5DWDA 3LCVB 3M0EA 1P74A 4BZWA 1FTNA 1VI6A 3PQ6A 2Q5LA 4HG2A 3H84A 1XQVA 1C7IA 3VZCA 5A03A 4C7OA 3E7PA 3H2ZA 3U80A 1KZ7B 3Q0IA 1JHPA 4G1UC 5NLLA 4EJSA 2BH2A 3ODGA 2X40A 1KVQA 3MD9A 3RVMA 3ZXSA 3T5TA 5FLYA 1R8XA 4F4IA 5HIAA 2FW7A 3HKCB 4MCHA 1ZJ6A 3OOEA 2NG1A 1I01A 3OE1A 4JBGA 4F85A 2R751 3HTXA 4CODB 3DB1A 1G3IA 4GICA 4B32A 2AL7A 1TMYA 3B60A 3P0JA 3RBZA 1BS2A 1KDPA 1XTKA 1JIKA 1N3BA 4N3GA 1NDHA 4L50A 1SZDA 3L5OA 3OM0A 4DDWA 1TVCA 2QV0A 2Z1DA 3RHFA 5F7OA 1FU8A 5E7QA 4B35A 5BXQC 2Y93A 4UMVA 1ECLA 1R37A 4XWGA 3VPCA 1LI7A 4PY2A 3H1GA 5G53C 3IC5A 4XD7D 2WUWE 4DUGA 5BWCA 1B0UA 5AK6A 4YR9A 3HJFA 2D7CA 4TYMA 3K0SA 4DYVA 2GJ9A 3QG1A 2QZJA 4JFRA 3W3AD 3JPYA 4MWZA 1M74A 2C4NA 3LPLA 4L6AA 4LX0A 4U1RA 4KO8A 1MOSA 5I7OA 1SUSA 3S40A 3WWCA 1L4EA 4ZREA 4PG7A 4Q3EA 4M9CA 4COKA 1FE8A 5KTNA 4D3XA 1LVGA 3B89A 5A4JA 1JEJA 5B55A 3RROA 4AWAA 1PEDA 2PUBA 3G89A 4MLCA 4WJZA 3VYWA 1WQ4A 3U7QA 2CD9A 4MLPA 2GTIA 2ALJA 3BJRA 3HM2A 4MRMA 3VNSA 1XK7A 1T6YA 2FMIA 5E0KB 4LHYA 4D82A 1CRZA 4K1XA 5CM2Z 1ULZA 2F3PA 2GJKA 3WZMA 2V55B 5IDWA 3JRNA 3CM0A 1BWRA 1Y7TA 2VJAA 3D3QA 2A9QA 2PK3A 3HNPA 4ZHSA 5ICEA 4MYCA 1FP4B 1UZMA 2WAAA 2XDQA 1KK0A 1SQ6A 4CEJB 1XZCA 4UVDA 2Z8YM 5YASA 3OETA 2GMWA 3K7EA 4TVBA 1I9GA 4OHOA 5G0VA 3SLRA 3TBHA 2RC5A 2ZWAA 3PC3A 4JOQA 3V46A 2JVKA 2VUHB 5BXYA 2VAXA 1D4ZA 2YVQA 3QGMA 1C29B 1DDOA 1X19A 2OCYC 1IYZA 1RXEA 3OHPA 4RBNA 2E4AA 7AT1A 3USCS 4UEJA 1GRNA 1XNGA 5IJAA 2AI1A 3AU8A 2WU0A 3VX3A 4URWR 2RI1A 4QOIA 4U7WA 5JS8A 1E0AA 2C9CA 1UP4A 2PMBA 1UFOA 1Z17A 3IT1A 1SBNE 3GPCA 4KQ2A 1NSYA 4ILEA 5AW3A 4YY3B 1RFGE 1NF3A 2EVWX 3INGA 1G8KA 4DWOA 4P93A 2HHJA 4K26A 4RPLA 2JK0A 4PHFA 4R8RA 5DK4A 2HMUA 2W4QA 3KK0A 3O8QA 3M6XA 2HH9A 4ZV7A 2I4OA 1GNVA 3VHXB 1MENA 4I36A 1FLNA 1VQ1A 3HXTA 2WTAA 3W2IA 4BNVA 4QEZA 2QS9A 5A5EA 3T35A 3REQB 2QZ4A 4A0QA 2JLQA 4PCLA 3URMA 4A0GA 4QQFA 3QHQA 3GRYA 4XCXA 3LUKA 2VLBA 5JEEA 3WNCA 4AZVA 4L9RA 3UMFA 3PWKA 1QAOA 4DY6A 1PDWA 3D31A 2ZZMA 4NMHA 4Q5IA 2IYUA 2XUKA 1OV4A 3X43A 3IP3A 1LU9A 4V0QA 4QJ3A 3H9UA 1I30A 4D9HA 1PWEA 2X13A 2OESA 3HZRA 3N1UA 4EG0A 5C2JB 1ODFA 1A7AA 2NGRA 1F2DA 4HLDA 2OGTA 4MQLA 3TBKA 4G41A 4QUJA 5JISA 3DEFA 1KPGA 1N34B 1QTIA 2IE0A 2OGSA 4PZAA 2HHHB 4ADSG 1GQYA 3FBTA 5GTDA 4J1TA 1NY6A 5EYPA 4M76B 2EEPA 3TUIC 4MXDA 3ZYZA 3KYJB 3TGPA 1MEEA 2ACEA 2X9GA 3AUXA 4V0NA 4EI8A 3MRVA 4M0FA 2H5JA 4DKXA 1T4GA 5KC9A 3AILA 3GA7A 3OJ0A 2AMVA 2P2NA 3PXCX 4FE3A 4GR5A 4IS2A 4RD0A 4MPJA 5A4MS 3UM9A 4DQUA 4Z4HA 3PGJA 4IUYA 2CGEA 3EMDA 3LGAA 5KWEA 1JR3A 1QRDA 4OGKA 4OQ4A 3NATA 4F6CA 2BVNA 3IUPA 3T1YB 1A82A 3RRXA 2XF2A 5DT2A 1WPRA 4TWJA 3WGIA 2VUIB 2WT8A 1CVRA 1YZFA 2CCJA 2P9QA 3A4NA 4JUDX 4Y6OA 1WP4A 4JX9A 4L51A 1AKNA 2NACA 4HK4A 3RVOA 1BJTA 1RAIA 2RAUA 1EFPB 1GY8A 2DBZA 2GJAA 4MAMA 2WIDA 3RC7A 2J9ZB 3COSA 4AYWA 4EKGA 5J3JA 1CUJA 1B0ZA 1FFAA 4I6EA 5C8ZA 1NPTO 1Z8NA 3OP4A 1IWBB 4M1WA 2DP4E 4MVCA 2RB5A 4G9BA 1CJMA 2FE1A 3JQ8B 5A3SA 4FEEA 4KO3S 1HFEL 2G1AA 1M10A 4OH7A 4ZARA 4NHEA 3TLBA 5IT0A 5DNVA 1VRVA 1OLUB 1L7XA 1ULSA 2H16A 2J0EA 2LW7A 3LX5A 4ZVNA 3T4XA 1MX5A 4BNDB 4WV3A 1NNLA 3OLZA 4FXOA 5BNFA 5E9QA 4YRBA 1KKUA 3PZBA 4FMPA 4TXHA 4MQ5A 5EXSA 4MUYA 3FPKA 1X39A 3IOMA 3CWZA 3Q7IA 3Q11A 2VP5A 2G7MC 4D80A 1CUBA 5FTJA 4KBYA 3U1BA 1Z0UA 1V26A 4YRPA 4K86A 1BVRA 3WYGA 2BMDA 2PAFA 5KCMA 2VNIA 2XNDD 2C2GA 3FNHA 5JTUA 4GSKA 2DUNA 4I55A 2YCBA 4NMMA 3ZDEA 2FMUA 2QUZA 4FQ7A 4K6FA 1JIQA 5AMXA 4BZXA 3VKHA 3FWZA 1GLVA 3CT4A 4XGRA 4QQKA 1T0HB 2WV7A 2C5SA 4BJ1A 2L69A 4OL9A 2L2QA 3NHMA 1HDIA 2D4AA 3EBLA 3PJFA 4UXJA 4V3BA 5FO1A 4BGEA 1KAQA 1Z4NA 1LC0A 2C3OA 5CNKA 2PNJA 4JC0A 1VZ3A 4RVUA 4MW0A 5JDCC 3WYNA 3U9TA 2A35A 1OASA 3FY4A 1Y6QA 3GGDA 1NLZA 3QU2A 4HFMA 1T0PA 1XP8A 4R9RA 1PFQA 1RM0A 5HEKA 1QQBA 4YCMA 1TMGE 1GPJA 2FFAA 1NLMA 1ZM9A 3ASVA 4CL0A 4FYWA 1BH2A 1QQTA 2JIMA 5AVTA 3S2SA 2Q0SA 2W6QA 2CLSA 3OSZA 2O0MA 5B12A 2BCJQ 3ROZA 3L8EA 3SZGA 3ULKA 5F78A 1NXWA 3G49A 3JQBC 5H0IA 5C7OO 1NJFA 2O5VA 1KFKB 1M6VB 1PVVA 3JASB 2R00C 1D2EA 1ZUHA 3HQ4O 1O9BA 4FN4A 5EHQA 1C1XA 1TM5E 2IE8A 1BW9B 2HPAA 3T3DA 3IXMA 2VDUE 2GBGA 4V0LA 3KSAC 2CFRA 3WB2A 3ZLVA 2Y92A 2IS6A 2JB9A 3ETJA 1ISMA 1SVLA 1ONBA 3CLSC 1I4EB 4GM0A 1OX5A 2VAWA 3H11B 3RUEA 3JVIA 2C0CA 2QXUA 1DCFA 4LSGA 3W34A 2ZYTX 3W6OA 2G4LA 3QKSB 1BMDA 1TQHA 3TDMA 1E4EB 1W8IA 2VXOA 4XR4A 4LOLA 1MOPA 1PR2A 2JFBA 3D6AA 4CDNA 5EE5B 3DBRA 5KMGB 4TV9F 1DS6A 4M6WA 3ZI4A 3R6TA 3AEYA 3VSEA 4ZGGA 4B6JA 2WJYA 1E1RA 1K4MA 5KNBD 4QG3A 4HB0A 5DI9A 1CUDA 2HJRA 2XUQA 2A9OA 2I2CA 2JFGA 3G5UA 4ASUD 2F4NA 4XFDA 1OILA 1RACA 3P9YA 2XRMA 1JSZA 3C3XA 2BFFB 2X0JA 1Q91A 4W6ZA 1FP2A 2FN8A 3OX1A 4HAYA 4Q15A 1JKXA 4J0CA 1T3TA 1SCUB 3Q87B 4NDAA 16PKA 1U3DA 4O29A 4OJYA 3RYHA 4YAKA 2PY6A 3RK0A 3UQZA 1AHPA 1U2GA 4D9KA 1RNLA 5EKSA 4CF5A 4TT3A 3SJZA 3FGZA 1OGIA 2B20A 3ZJ4A 1DAGA 5C8XA 1QZ3A 2ZITA 4G36A 1FMJA 2FWJA 1E2EA 4V39A 3V3KA 4YFYA 1BNCA 3FNGA 1DXHA 3E3MA 2DBYA 5B1YA 4P4TA 1J5XA 1BQEA 3DKKA 3IDAA 2O2EA 4RU1A 3T3GA 4P31A 2ZANA 3AC0A 4UM7A 3UJ8A 1S2GA 3T1NA 2ZE6A 4AMUA 4IOJA 4WNCA 4RJKA 5TMDA 5LOVF 5B3AA 3TLZA 1PTJC 1RAEA 1U1DA 4B73A 2OB1A 4ZHQB 3IOEA 1YI0A 3WTBA 2FSPA 3GIDA 1FDWA 3IV6A 4J7XA 4QLOA 4RSGA 4YGYA 5JNSA 5JW6A 2E0IA 1SHTX 1TQ6A 3I0NA 1USIA 2BTEA 5AXCA 2V97A 1E20A 1MTOA 2Q2OA 4CLRB 4XWWA 2IGTA 2YWDA 4YP7A 3IUSA 5EJMA 1DX9A 3MIZA 3O26A 4LC9A 1SOAA 3RFTA 4ENUA 1T3SA 4H7JA 1YB2A 1ZXBA 3WYBA 3IP5A 3SR0A 3LA8A 1MB2A 5DNDA 4QTYA 3TNDA 4MHSA 2JFPA 1ZM3A 3ANMA 5K3FA 3RUFA 4W82A 4H4EA 3LIPA 1ZUD1 1GZVA 2V5VA 2Q5HA 1NUTA 5LIRA 1E9RA 1VE7A 1JUDA 1U2QA 3PC4A 4N5LA 4DXHA 1T34A 4L5BA 1GJRA 2HB6A 3VSCA 1G8JA 3HI4A 5GJWC 2BWJA 1LQ2A 1G3MA 4BVEA 4YUWA 2H3EA 2ZRGA 1USKA 1C7FA 5C4GB 2J9YB 2AE1A 2QE7A 1O57A 1L5QA 2X4IA 1MX1A 1OKKA 3LL4A 5J47A 3QTTA 5H8WA 4X20B 2DQYA 1ULHA 4RHUA 3LL7A 2NAFA 2V7PA 3ZNQA 1EXVA 4JJ4A 2R96A 4C4TA 2MYPA 4P2GA 4IIGA 3KE9A 5AKLA 1T5OA 4C87A 1FSPA 5LUBA 3EQ8A 3FPAA 3ONNA 4KVAA 3B70A 2R8YA 2EZ4A 3VOSA 1XVUA 5MHTA 3AI3A 3I6ZA 3I8OA 5F77A 3S1AB 3K0CC 1EHYA 3NV9A 3O3MB 3CRZA 1A7UA 5AVQA 2XYVA 1HZZC 1I1NA 2FP4B 4Q34A 4X7RA 4CTJA 1QR2A 4CV2A 3KJXA 4TX1A 5AT1A 3S1SA 4GPBA 2CCKA 3PHCA 4MUEA 3RIGA 1MC8A 3LNTA 4TKVA 1G8GA 3G6WA 3H8VA 5EKTA 2Q3LA 4YYZA 2AA3A 1U0FA 3MTIA 1SB9A 3R6GA 4WLNA 4H35A 2C5EA 4YTEA 2ATXA 3WRYC 2OCBA 3X1MA 1EVKA 3U4MA 4RKFA 5DXAA 3LDAA 5ALQA 1KIAA 1FY2A 4BBJA 3NDRA 4E09A 2WU4A 5GINE 1SXPA 1CZNA 1KO1A 1DBRA 1Z7GA 3U16A 4Y6QA 3PNBA 4HNHA 1LNQA 2JFQA 4JI3B 4K9OA 1NRIA 1OIXA 1R2QA 1LJLA 1MAHA 1T43A 3DMPA 4RQUA 4ESOA 3BGIA 5LD2B 3OWOA 1G5HA 4FC7A 2CXUA 4OREX 2BMWA 1ZD1A 2OL4A 3OQHA 3NEAA 3OPMA 5HFAA 3JYNA 3S5UA 1N77A 4B6QA 3RGWS 1V37A 1XN4A 3OPYA 4MB6A 3HBLA 4CKBA 3ZD6A 3IHLA 2RHRA 3A4LA 3WLNA 1I3MA 3DZFA 2K5UA 1KHHA 3QG5A 2OMEA 2NNLD 3A3PA 2VSFA 9MHTA 4N0PA 2XBLA 3B3QA 5DLQC 3DFIA 1V9LA 1JG2A 1P72A 3WLMA 5KYUA 2IUFA 4UPVA 4ND2A 1O9GA 3EXHC 3F96A 3INNA 4KR6A 5JH7A 1KQPA 5EQDA 4BXOA 1YZQA 2G25A 4I4LA 2JARA 3SYKA 4CTMA 4XPZA 4IUBS 5ALHA 4M88A 1X7ZA 1KFBB 1CPYA 5E8RA 2AEMA 5TGZA 5B36A 5BN5A 3OZAA 2IHJA 3DV0B 1CZUA 4JT8A 4PSAA 4JA2A 1GZ4A 2JATA 8OHMA 4YQZA 3AFHA 2QN9A 3IBFA 1NSTA 5AVKA 1RI5A 1M1YB 3EAQA 5E8JA 1IK6A 4WCVA 4Y7CA 3ELYA 3BS4A 3B1ZA 4G5QA 1ISIA 1YO6A 1C3VA 1Z0DA 2WILA 3GFVA 3L6DA 2ZJOA 4X8MA 2APJA 1KPIA 1QGED 1ZM2A 4AF6A 1TC2A 4FBLA 1BA3A 4XDHA 1KY3A 2YYAA 3LKVA 4J9VA 4UXIA 4UM9B 3BRCA 1DWQA 2PTGA 3WLOA 1QFZA 3BJEA 3UJPA 2D3WA 5I4CA 1AJEA 3UMMA 1UMDB 4JC8A 2XA1A 4PONA 2ZSKA 3ZHYA 3L7DA 1GQFA 2NYAA 3G5LA 5EE3A 1F5SA 4NZ9A 2OCLA 2G0AA 3EDMA 3DTVB 3PUZA 4D9EA 1KY2A 5EMKA 5BQ3A 1AS3A 2I1QA 2AKAB 1NF9A 1EAYA 4LJSA 1VKRA 2HO5A 4A2WA 4CPDA 3HCWA 1ZYUA 5EC8A 3ESDA 3DHWC 3QWAA 3F46A 3GJ6A 3ZEIA 4EZBA 2GN4A 1GA1A 5EP2A 3V1KA 1TX4B 1OZHA 1HT1E 2GCNA 1RTKA 1EDEA 3FOCA 3LQQA 4Q7LA 1YJBA 2PRSA 2Q2WA 4REMA 3DQQA 3R44A 2FXVA 4OKSA 1CVLA 2NYUA 3D7KA 2P9YA 5TJ9A 3MAAC 1FTWA 1OR8A 2Q62A 3SXPA 4CM5A 3OCUA 4O3MA 1H4VB 1JNXX 2R8EA 3O93A 5A0FA 3JCZA 2WQ7A 2AZ4A 3DAFA 2IPMA 1R3DA 3PDWA 1NDUA 2VYVA 4G5XA 3HPQA 5DGIA 4YRMA 4ZAWA 1SUBA 3UG7A 5CHEA 2F64A 4Z4IA 3AI1A 2BEUB 1FYWA 4J76A 5EQFA 2ONJA 3QFFA 4IDHA 4O4JA 2XEXA 2NU6B 5SZKB 2PSHA 1T6XA 2O8NA 5LQKA 5KNCH 1PR4A 7ABPA 1KZGB 4F6RB 1JHAA 1US8A 4JP3A 4P92A 3L4JA 4OI0A 3BVPA 2QYSA 3URKA 1OTYA 3QI2A 3SC2B 3M5DA 2UZIR 2C83A 3TJMA 1SC1A 1JHYA 2G6TA 3KYBA 3Q4GA 4QDJA 4RV9A 5D1HA 2PQ2A 2AJTA 4KO1S 3CZCA 1Z13A 4KMMA 5D5PA 1LD3A 4H7IA 3ZZUA 2PGOA 1EU1A 5LU9A 3GAAA 4KH0A 2Z4SA 3QY9A 1A2OA 1KOJA 1UM9B 2YC4C 1QG4A 3FJ1A 3EVFA 3LUGA 3QF4B 3AVQA 4NC9A 1VG9B 4BQOA 1BCRA 1MX3A 1FUEA 5B1DA 1BGWA 2ZRPA 4RKRA 4WA8A 1MDFA 1Z4OA 3PYLA 2W48A 2BEJA 5TVKA 4DG9A 3LLMA 2RHMA 1A7JA 1CIVA 2VRWA 1ZJJA 1X7DA 3K35A 3N6XA 4IG9A 4CJXA 3BIWA 2KBEA 4YJDA 4EFNA 1E1RD 4ZCTA 5FA6A 1KP2A 1L7RA 1THMA 2Y4NA 3GEBA 4MW4A 4R84A 4C21A 4WBNF 4O2LA 3FNQA 5CT6A 1IMJA 5LZ9A 3O9MA 1GT6A 5KTOA 3MEQA 3V7NA 2DF8A 3C87A 3P19A 4WA7A 3C7TA 1P3JA 5A6SB 5BR7A 4Q7JB 2D62A 4FGSA 3HBNA 1SU4A 4B40A 1Y6RA 3HO8A 3LY5A 3FF4A 3T4EA 5CLQA 4PO9A 2XTMA 5H80A 4UNIA 3PUWA 1ODLA 2AFIA 5REQB 4JNKA 4BP3A 1SD5A 3RT7A 1UJ5A 4DA7A 1H22A 1RYDA 3O8NA 1PDVA 1UBLS 1UOOA 3KT0A 3OOYA 4L4ZA 4J29A 1RWKA 3BEDA 4NQZA 1W25A 2RDMA 4M87A 1EXMA 1FXWF 8ATCA 1OX6A 3DT6A 4MVJD 1OMOA 5IN5A 3BD6A 3L5KA 1EUYA 2AJDA 3T38A 1XQ6A 4XIIA 4Q9HA 3WGVA 1EPUA 2J9XB 2A5GA 5T4EA 4G4JA 5FI3A 3UW1A 4C06A 5AVVA 4PO1A 3SDBA 1EZZA 2QLFA 3BK7A 2VT6A 3GGJA 3YASA 1FSGA 1DWOA 2QX4A 1QNFA 1X1EA 3NBYC 1WCYA 4OI1A 2BFDA 2O1EA 3LA6A 3AB3A 2PKEA 5K3OA 4B3TB 3I9FA 1RIIA 4P7GA 5EFZA 4MCJA 4JJ8A 3A1FA 3Q72A 4J2OA 3DE4X 4HYQA 1S3IA 1ZCBA 3DL7A 3IE2A 4DFDA 1SIUA 3LD9A 1QTRA 2CHQA 4LNHA 5KSWB 2IEGA 4LTDA 4BBZA 1L3IA 1WCIA 5AOVA 1PR5A 2OE2A 3U6BA 2E37A 3L92A 1J20A 2JIZD 3QWHA 2N3ZA 4RW0A 2P9GA 2Y1GA 5ALSA 1RWVA 1ZH8A 5JZSA 2ENWA 3BRWA 4DXAA 2Y0CA 1AGNA 3VGJA 2FQQA 2Q3DA 1DGQA 4TTTS 4QOGA 1WCXA 5IJ9A 1Z63A 4ID3A 3G85A 3U7GA 1L5KA 1JYFA 2H1HA 3TQSA 4DJFC 1HC7A 1QYWA 1EDBA 2ZVQX 4MNTA 3DONA 1E6EA 2PGNA 3ZWXA 1JIXA 4OLHA 3AR7A 1A8HA 3VPHA 3L7KA 1Q44A 4J0GA 3SQMA 1KEZA 4D6YA 2H3HA 1NASA 1A77A 3I73A 5IXJA 4GMHA 5EJGA 1L9XA 4LCEA 4ISCA 4IEFB 4L07A 1Z4MA 1Y8QB 2R6ZA 1KRXA 1JN0A 2IHZA 3NH9A 1SBYA 1MV8A 3ECSA 5JCXA 2CUKA 5I8WA 1L4HA 3OIFA 3TG8A 3WWPA 1RWXA 2R7KA 3RARA 4CM8A 4E03A 4KSCA 2F00A 1ADGA 2AZMA 1JEOA 4G5GA 1E9EA 1VCMA 2CKMA 1JTVA 1JT9A 1QIFA 1QO0A 2PKRA 3FSGA 3GW8A 3NYWA 3PGVA 3S1LA 1DCTA 1E89A 3PTAA 3ZNPA 5GIOE 2XUGA 4C3ZA 3SC6A 3NGXA 2CNWA 4WKBA 3U62A 2FPKA 2C4UA 2PN1A 4LQ4A 1DINA 3GCGA 4TWRA 2Y6VA 3U37A 3KOUA 1IY8A 1BS1A 3AEKB 1Q20A 3P32A 5DHTA 4ZVOA 4JVOA 4MO9A 3RBXA 3FRIA 1NOJA 6LDHA 3T3EA 4R05A 2O2JA 1SHJA 3ZN2A 1PX0A 221PA 3OT1A 1UL1X 4RE6A 3ZVMA 2PUFA 1CBUA 2R9VA 3TSZA 1MC5A 4G8JA 5L4LA 4W9RA 1GV0A 2EV9A 2RHOA 5COAA 4FZ3A 4A8JC 4EY3A 3T95A 4C05A 1GPMA 5KYUB 1WUTA 1FQWA 1R0KA 3BRQA 4TLEA 2H8GA 4O2RA 5HMMA 5BV7A 3E2MA 3MMZA 5HKOA 4UNNA 1UBJS 2B98A 3MWEB 3PTLA 1K88A 3UUGA 1PYOA 3OOSA 5BV2P 3D0RA 3CLRD 1E4VA 1GFIA 4O4HF 3AR3A 3LQ2A 3WQBA 2HBYA 4R2WA 3ONEA 1IATA 3BPSA 4N9WA 4R8MA 3DMYA 4US0R 5DTQA 4AJIA 5HDBB 5K0BA 3WA7A 3G9ZA 3IA2A 4NU0A 3C3MA 5LA6B 2CXQA 3WIOA 1PFGA 3JQFA 5HOQA 2C5BA 1ORHA 4X95A 4GYKA 3BD7A 1FK8A 1VIYA 4D5EA 4EELA 1BU5A 3NNNA 5KNDD 2I3AA 5E7IA 1NR5A 4UATA 2EWWA 3SNHA 1JILA 4AROA 1HI9A 4IDCA 4PPQA 5CLGA 3FMPB 5DLYA 1J1ZA 5ARBA 1RAGA 1YBHA 4J0KA 2Q8PA 2NVUB 3C7DB 2I2BA 1KZHA 4NIMA 5EKXA 1BSVA 1L5GB 1ZUIA 3OC0A 5C8YA 3WLQA 1FSFA 1REQB 3ZW7A 4ICIA 3AF6A 3A1DA 4RH1A 2W37A 4PG5A 1AQ6A 3DYBA 5TS2A 3HBJA 1E79D 2O2DA 4QYXA 4BO6A 2ECPA 3MSCA 5F3WB 5E4TA 4UKDA 1ZBDA 3ERCA 5EJ2A 1P1HA 3DLHA 2V1UA 1Z5NA 2HLDA 1SVIA 4L7VA 4NK4A 3KHTA 3A3NA 4Z4QA 3S28A 2B78A 3TW6A 4K9QA 5C53B 1XNQB 4DUZB 1Y3HA 2C2BA 2IIBA 4PPNA 2XCIA 1PF7E 1D4FA 2JASA 4PYNA 4XQ9A 1P81A 3P0RA 4AX4A 4BLSA 4Z49A 4R2JA 4GLOA 4LVOA 1YJQA 2WHQA 3GUYA 3Q7PA 4ZZIA 2OD7A 5JAOA 3WWOA 3GCXA 1XKXA 1O0CA 1RLMA 2HRQA 2Q8QA 4CQMB 2QL9A 3ZCVA 3R0VA 2ZUCA 1P8AA 3JZFA 3KVNA 4QUGA 2B4KA 4JOBA 4RESA 3TPCA 5BSFA 3HCBA 1XJWA 1HRDA 3TSWA 5EYPB 2C5FA 1YZ3A 4H9GA 4KWIA 5K6TA 1V1RA 1D8TA 1L4BA 1R9GA 1NX9A 2DWPA 5JAQA 2C7VA 4BQPA 2C54A 4I1RA 4HI0E 4RPGA 2P3QA 2HCJB 1FFBA 1FYXA 2XMPA 2ODAA 3F6BX 4U7GA 3OM8A 4W5NA 2ZYGA 1WSAA 2CWDA 1XBTA 4S1NA 3SX2A 4J6EA 3ZCRA 1BH6A 1A2QA 4CLOB 2IH4A 2PXCA 3MTEA 3TMYA 4N41A 1R88A 3T5DA 3NOXA 3G23A 4PYMA 2ZBRA 3E9CA 3C3DA 4PG6A 3RTDA 2O1SA 4GWLA 1SOWA 3ILSA 3GEHA 2C07A 3E35A 3LSTA 3MTDA 4GRAA 4KIJA 2Y76A 3AFMA 1SVWA 4MW5A 4O8CA 5IM4F 1VE9A 1ZD5A 1ZO8A 2B1QA 2R8BA 2ZYUX 3KHSA 3VKVA 4B4UA 3OA0A 1VP9A 1Y8RA 5CDFA 3KKZA 4AKEA 1BCRB 4YPOA 1FYDA 2XYQA 4IY1A 5JPCA 4R01A 1SXJD 2OO5C 2I8AA 1FBNA 4WKGA 2QYOA 3SNKA 1WY7A 1U7WA 4H6VA 5LDGA 3HB0A 3UT5A 4AMYA 3DV0A 2YHSA 4WZBA 4YACA 1YRWA 4NZOA 1XV5A 4FVTA 3SJBA 3TJRA 2BW0A 3TSAA 3PJRA 2WJVA 2ERYA 4C76A 4D97A 3MELA 3SMQA 3E61A 1LWOA 3N05A 3N8GA 2K7FA 4BMNA 1QRUA 1PJ4A 3UKOA 2EJTA 4I9UA 2FH5B 3GUVA 5IUJC 4L8VA 4XTRA 1JFSA 1ZXXA 3EWNA 1V95A 3ENZA 3G7UA 3EWSA 4QICA 4ER0A 1WOYA 2MYNA 3NB0A 4QKQA 4ECEA 3EA5A 4NBSA 3CONA 1OFUA 3SYTA 1BRMA 2FSFA 1XVVA 3ZV6A 2P2YA 4UJ3A 3IXLA 3DZKA 3LF2A 1OIWA 3M3DA 3TLCA 3WNDA 1V25A 2YZGA 5JQGF 1C8LA 1OCEA 2CUNA 3PSAA 1SG6A 3QVOA 4X1YA 4B4KA 2A4KA 1ORRA 5IN4A 2UZ1A 4LMAA 2C9MA 2DPXA 4KAAA 3ROXA 4E1AA 1XELA 4KN9S 1WCWA 1TK9A 3H19A 2O2ZA 4R83A 2XTAA 1XO1A 3ORHA 2KYRA 5C8DA 4IUCS 3RAGA 1IPFA