1LPMA

A structural basis for the chiral preferences of lipases
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpmA00
2H7CA 1GT6A 2HU7A 3F9CA 4Q3KA 3KDAA 4DNOA 5HQ3A 3WWDA 2OLEA 3HEAA 4P9NA 2WUDA 1C7IA 1XZAA 4L3WA 4AQDA 4C4ZA 1USWA 2O2GA 4PV7A 2OGSA 5AM1A 1VZ3A 3D3NA 2WILA 4J0DA 4KJXA 4FLEA 1XZMA 1UKAA 4DSZA 4Y2TA 3I1IA 1ZD4A 3Q0TA 4W9RA 2C4HA 2JGEA 3BDIA 5IVHA 3R3VA 5IVKA 4MJ3A 4UHBA 2HU5A 3R3UA 1XKTA 4AMYA 1XQWA 3G02A 5A2GA 3YASA 3BXPA 3HJUA 3OURA 4BE9A 2Z8XA 2Y2VA 1EK2A 1QGED 2WTNA 1U4NA 3MUNA 3B12A 3K6KA 3QBJA 4KAAA 5HK9A 1WHSA 1ACLA 2QJWA 1THGA 5ISMA 1W76A 2R11A 1AZWA 3AIKA 3BF8A 5JAPA 3I28A 4K2AA 3ILSA 5EHQA 3LS2A 1J1IA 1H2XA 4H7JA 3W04A 4B84A 5D3ZA 1QFMA 3G8YA 4JEIA 4EY4A 2BUCA 5JD4A 5EFZA 3SC2A 3I2HA 4F21A 5E4TA 3HACA 1KU6A 4A23A 1OCEA 1WM1A 3R3XA 2XMSA 2JGLA 4H7IA 2PL5A 4LYDA 4F0JA 3FAKA 5D6OA 2PM8A 3QPDA 1ZD3A 2Z5GA 5CXXA 1A8QA 2CZQA 1DWOA 4KYVA 2HADA 3D2AA 4DTCA 4QWWA 1CEXA 4WY8A 1QIHA 3K9BA 1DU4A 1ZI8A 3O4HA 1CUCA 2WG2A 1CQWA 4I3FA 5HFAA 1A88A 5K3FA 1EDEA 2VJDA 1DQYA 3A2NA 1JMKC 5FPPA 2B9VA 4LKOA 4W1SA 3H0CA 4QNNA 3LLCA 1ZGBA 3IBTA 3VJMA 5ALJA 4CG3A 4BATA 4Q3OA 3F98A 4QDZA 2YH2A 1UK8A 2OCIA 2PUJA 3GROA 2PSFA 1W52X 1H2YA 2PU7A 2OG1A 4UBMA 3H2GA 4XWGA 2WTMA 3LIIA 4OB7A 3B3QA 3DDUA 2PVSA 4FLMA 3TRDA 1EX9A 2GBGA 4X95A 1JU4A 1XZBA 4BTVA 5D3KA 5JZBA 4XX1A 1BRTA 4OPMA 3QYJA 4I4CA 4LYEA 3DS8A 3BIXA 2ACKA 4HXEB 2ORYA 5ALLA 4C89A 4BCDA 1XRPA 4XJVA 1X2BA 4RE6A 5AKJA 1BS9A 7YASA 4DNFA 3IURA 2AJLI 3C5VA 3DEAA 1VJ5A 4Q1VA 1QO7A 5JD5A 3I6YA 4QEKA 1TRHA 1EXWA 1LZLA 4FNGA 1VE7A 2QRUA 3F8SA 5CMLA 1GPLA 1UOOA 2JGMA 2WG0A 4Z49A 1EA5A 3I2IA 4MXDA 4C4XA 4WFIA 2VSQA 3G9XA 4W1PA 1QIMA 3H19A 1JKMA 2JGFA 3RM3A 4KE6A 3FYUC 2Z8ZA 3PUHA 1CRLA 3O0DA 5AI8A 3PF8A 5HKBA 1QE3A 4W1RA 1EDBA 3STXA 4WJLA 3WL7A 1Y7IA 2PSJA 1YSCA 5E2IA 2XUQA 5HKAA 2WLSA 5JAUA 5JADA 3PFCA 4DMHA 3G0CA 3F96A 3ICWA 2XMBA 4EZIA 1CV2A 1R4ZA 5AI9A 4QE3A 1R9NA 1EI9A 3ANSA 3C5WP 3GBSA 1AQLA 4FWBA 3IULA 3AIMA 3VJKA 2WIDA 3WIOA 1T4MA 3BE8A 1XRQA 2PBLA 1MX1A 1MAAA 4X85A 3MGAA 5JYCA 2DFPA 5ALYA 2J3QA 1XZJA 2AXEA 3CCCA 3GUUA 3OM8A 5LZ8A 4H7FA 1LZKA 4JUIA 2FUKA 3DQZA 1XZLA 1FSSA 1R1DA 1X2EA 2QXUA 2BJHA 5ALSA 3C8HA 1JMYA 3QPCA 5AKXA 5K3DA 4FBLA 2XI4A 4UHDA 1EH5A 3OTQA 3R40A 2JGKA 4B6GA 4FOLA 4PSCA 1W6RA 5AKZA 1CUUA 4UUQA 5AKHA 1FFDA 1XKLA 1F0PA 4LXHA 3G9TA 1CUDA 1BEEA 1O6FA 1K63A 2WIJA 3E3AA 5FRDA 4DNQA 2W22A 1F6WA 2WU3A 1QO9A 3NGMA 4G4IA 3STTA 3V9AA 5AI0A 5CH3A 4FFVA 3FWHA 5IH7A 3TJMA 4OU4A 2XUHA 5JASA 3I6ZA 3W9UA 4EY6A 2IIVA 2V98A 3WKCA 1TCBA 4AZ3A 2WG1A 1GPKA 3ZLTA 5HF5A 1GKKA 5K3AA 4BDSA 1LPNA 5CXUA 2OXEA 3C87A 2V9ZA 1XZIA 3I2JA 4GEGA 4W1QA 4GWLA 4KRXA 1XZCA 2Y6VA 1DX4A 4DM7A 2O7RA 2DQYA 4MYDA 1PV1A 3IUNA 4G1FA 5ALVA 5ALWA 4IO0A 2B4KA 2QJRA 4CCYA 4G4GA 5JARA 4EA6A 1UKBA 1BU8A 2DHEA 1EHYA 1S8OA 1G5FA 2QXTA 5EIHA 2FJPA 1GQRA 1EK1A 1QIKA 4P08A 2XUDA 4MQMA 1YR2A 2ONCA 3IA2A 5ALDA 4F60A 5ALFA 4Y2JA 3WYDA 3VKFA 2PKYX 4V2IA 4EBBA 1DX6A 4OYLA 4BP9A 5I9IA 4Y2PA 1P0PA 3E0XA 3TGLA 4GW3A 4ZREA 2I78A 4AB1A 4FMPA 4DMKA 2C0PA 4EUSA 3STYA 3WKAA 3I2FA 3IIIA 3L1HA 4OUKX 4KAFA 2XMCA 5ALOA 3UUFA 1IMJA 3PE6A 1EVEA 3B5EA 2LIPA 2V97A 1QJ4A 1GPNA 4LXGA 4PW0A 3PDCA 4TVKA 1L7AA 1A8UA 3H17A 5FPQA 2OPHA 2RHWA 3WMRA 5AHXA 1HPLA 4KE9A 1DT5A 2C58A 4FBMA 5LZ5A 2B61A 2G63A 3TEJA 5JAOA 1JU3A 4BC1A 1G4HA 5EHXA 4UBNA 2C0QA 2BUAA 1K8QA 4X00A 4X91A 4G9EA 2CB9A 3FNBA 3V1LA 2QS9A 1R3DA 2ZYRA 2PSHA 3ED1A 3FCXA 4Y2QA 2HA6A 5ALTA 4UFOA 4K6GA 5FXMA 1Q84A 5ALIA 4UBIA 1Q0RA 4UBLA 1YA4A 1UK9A 5JAHA 3H2HA 4M0EA 4J3JA 4LIPD 5AI6A 3O4JA 4DYHA 1YAHA 1XFDA 4MYSA 4BCCA 3MUOA 1AMNA 2X5XA 4GDMA 3HZOA 2VAXA 2XLCA 4GECA 3OPMA 4RGYA 2WJ6A 1WB6A 3DKKA 4K5QA 2PPLA 1AURA 3WWOA 4X6UA 5ALNA 3D0KA 2XE4A 1CUGA 4H35A 5CTAA 5ALKA 2OAEA 1VA5A 5AIAA 4ZWNA 4CG2A 2HRQA 4X3CA 2FX5A 1Y7HA 3P2MA 4UHHA 3EIOA 4WFJA 1WOMA 4HXGA 3E4DA 1L7RA 5AM0A 3U1TA 4XVCA 3SK0A 5LIPA 1CQZA 2BCEA 1Y37A 2G4LA 3STUA 3FLAA 3C45A 2C5FA 5C7YA 2C7BA 1ACJA 3WJ1A 1ZICA 4Q05A 5AH0A 3BJMA 1TCCA 1TQHA 1WPRA 4U2GA 3WK8A 1UT6A 5A7HA 3GFFA 5KWJA 3H1BA 3R3ZA 1IZ7A 2J4CA 4FDMA 3FLEA 3DOIA 1HKHA 3LP5A 5C8VA 2VAVA 4UBOA 5AKGA 5ALZA 1E66A 1KEZA 3WZLA 4BTLA 2XMGA 4O08A 4KE7A 5LKAA 4MEAA 4WCVA 1GKLA 2VJAA 3ESAA 5FV4A 4BAUA 4ETWA 3QM1A 4WDQA 5ALQA 2Y6UA 5CT5A 2XQIA 4BYMA 2QUBA 4FTWA 4GHWA 3H1AA 4JYPA 1TKRA 3SX4A 1XLWA 4G8BA 1CUJA 1ZJ5A 2QKYA 5T4EA 2WFLA 1P0QA 2B20A 4QZVA 1YB7A 1BN7A 4X93A 3SWWA 1SFRA 3KWJA 1MTZA 3O4IA 1MJ5A 1AGYA 1IUNA 2QMQA 2YXPX 1W75A 3WJ2A 2QM0A 1CUIA 2XQGA 5KBYA 4W63A 2ZYSA 4QWMA 3H18A 3WWCA 2JEZA 2GZRA 2I3ZA 2RIPA 3QH4A 1AKNA 1BN6A 2XUPA 2W6CX 1CUBA 1HL7A 5BOVA 5YASA 2ZYHA 5K3FB 3AIOA 2BGNA 4DIUA 3WA6A 4KACA 3K2IA 4C88A 1F0NA 3I6MA 2VA9A 5E4YA 3QMVA 3WK5A 4N8EA 1QTIA 1T2NA 3D2BA 5AM4A 1BCSA 1JI3A 2HFKA 4Y2RA 2VT7A 1W4LA 3IB3A 4I19A 5AO9A 4E14A 3F67A 2WHRA 3DLTA 5DNWA 5ALPA 3QVMA 5D7BA 5EGNA 2H7YA 3L1JA 4BVLA 4B7ZA 2QTBA 1PFQA 4YPVA 3ICVA 3QPAA 4U2BA 4DMCA 5CT6A 4RNCA 4MWSA 1QTRA 2P8SA 4EHBA 1NU8A 5AOBA 2XUJA 2RGUA 3W9BA 3N2ZB 1KU0A 4OU5A 1A7UA 1AC5A 2XMRA 4X92A 4U2DA 1MX9A 5DNVA 2OCGA 1E8DA 1SOMA 5LYYA 3LIPA 3RK4A 1MPXA 1RWQA 1CIJA 1K5PA 2WM2A 1BCRA 5DJ5A 1R9MA 3KSRA 4QA9A 2UZ0A 4ZV7A 3A2MA 1ZI9A 3STVA 5AP9A 3G7NA 4ZXFA 4KE8A 4HS9A 1M33A 2VATA 1IZ8A 4S0XA 3AZOA 4YK7A 4N8DA 3R3WA 5K3CA 5C81A 3QMMA 1NU6A 1JJBA 2WIFA 5T4BA 5CBKA 1D07A 1F8UA 1E5TA 2H9YA 2ZJ7A 3NOXA 4CCWA 1QOZA 3FYTA 5BWBA 1LPOA 4ITVA 1B41A 1UK6A 1WPXA 2QVBA 3DOHA 1J06A 1K6EA 4DLNA 1ISPA 3AJAA 1XZKA 4OB8A 1UZAA 4GLBA 3VXKA 4Q3LA 5AM2A 1VKHA 3GELA 1MU0A 4A16A 2PUHA 1HLGA 4WFKA 5K3EA 1Q83A 4X90A 1LGYA 4NS4A 1LBSA 2CJPA 4QLAA 5AOAA 1XLVA 4LXIA 3G0GA 1MN6A 4Y2XA 3DJYA 1YS2X 2WHPA 4FNMA 2ZYIA 5DLPA 4KEAA 4X97A 2R8BA 4G8CA 5FUMA 5FP0A 2ZJ6A 3G9UA 4FFWA 2WKWA 3STWA 1QIEA 4BAZA 1QLWA 2J3DA 4BB0A 4OYYA 3T52A 4AO7A 4Q34A 3R0VA 3O4GA 2C5GA 2HU8A 3D5EA 4ZRDA 1XRMA 1L7QA 1YASA 3UUEA 5AI5A 1CUXA 2ZSHA 2G5PA 3NWOA 3NUZA 1XQXA 3DCNA 5EIEA 3M3DA 3PFBA 4G4JA 4LHEA 1Z68A 5ESRA 1BEZA 1E8MA 5C8ZA 4OD0A 3HXKA 3WA7A 3WKEA 3G9ZA 3WLAA 3EQ7A 3M81A 3WKDA 4BZWA 1SCQA 2XUGA 2HIHA 1IUPA 4CI9A 3BIWA 3V48A 3C6YA 2H1IA 2OQIA 2JBWA 2IITA 4ROTA 3IVMA 3VVMA 3C8DA 2GZSA 2YYSA 3IUJA 4BVJA 4U2EA 3ZLVA 3BJRA 1N5RA 5HZGA 1J07A 4AO6A 5J3JA 1UKCA 3O95A 4NVRA 1ZI6A 3ZV7A 1BE0A 4H7DA 5HF9A 5C8XA 3S8YA 3AFIA 4MWTA 1MAHA 2HHAA 4D9JA 5DTIA 1SC9A 5AK4A 3WL6A 1TIBA 1ORVA 1E8NA 3QITA 4L72A 4FLFA 5KWIA 1TAHA 5DYYA 3EBLA 2OGZA 2XQJA 3WIBA 4UFPA 4QDTA 1ORWA 4J0IA 5CT9A 2OQVA 4XIIA 2AJBA 2D0DA 3AILA 4BZZA 3JWEA 3C70A 3WL5A 1H2ZA 1XQVA 3W05A 4HRXA 1LBTA 3V1MA 2QT9A 4P93A 3VVLA 3FVRA 4GI1A 4HRYA 1FFAA 1R88A 2PSEA 3V1NA 2CBGA 4N5HX 1WB4A 1UFOA 5DYWA 1O6GA 2XUKA 5DWDA 1MT3A 3DD5A 1ZGCA 1LPBB 2V96A 2VJBA 1FFBA 4EY7A 2XUAA 2O2IA 3EQ8A 1DT3A 2BUBA 1P0IA 5AICA 2HDWA 3U0VA 2WU4A 3H2IA 4H7KA 5LP1A 4OB6A 1UK7A 2RAUA 2Y1KA 3R3YA 4E11A 5BV7A 5DTJA 2RHTA 3EF3A 3O9MA 1VXOA 2DHCA 5CH8A 3HI4A 2BGRA 5IVDA 4NMWA 1JFRA 2VJCA 4G9GA 5SYMA 4EY8A 3AINA 3WL8A 4X71A 2YASA 1BROA 1OILA 4RPCA 3JW8A 4P92A 5ALMA 4OSEA 1U2EA 1J2EA 4A5SA 2HA3A 1P0MA 2PX6A 1TK3A 1RYYA 4PSDA 4M0FA 3FVTA 3DL7A 1XZGA 2EDCA 3PI6A 1EINA 3OG9A 4UPDA 3W06A 4H77A 3KXPA 3EQ9A 5SYNA 3ESCA 2O2HA 4B81A 2XLBA 4BDTA 2PU5A 5LZ7A 3QMWA 1UOQA 1H22A 1CUHA 2H7XA 3ZPXA 4ARAA 2VT6A 3KOOA 1GQSA 1NX9A 1IVYA 2X76A 1XZEA 3WI7A 1PJAA 2WUFA 2DR0A 1XZHA 2GBIA 3WWPA 1QZ3A 4HXFB 1QONA 5AKEA 4UBJA 2WHPB 5FDFA 1CR6A 1VLQA 5EHNA 4CFSA 3S2ZA 4BVKA 1HQDA 1UWCA 4B9AA 1VXRA 3UMJA 3N0TA 3E1GA 3WK4A 2OCKA 1AUOA 3G0BA 4Y2VA 4HTAA 5JANA 4IH4A 1ZJ4A 3A2LA 2CEKA 3H2JA 3D4LA 3DL4A 2JIDA 3BDVA 4ZGBA 3WK7A 3HLKA 4C87A 1FFEA 4WDRA 3WKBA 1XROA 2EDAA 2D5LA 4JH0A 3BF7A 2WSLA 4QDXA 4B0OA 1HBJA 1EB8A 2Y2UA 4J0JA 2XUIA 5E4JA 3A6ZA 2I3DA 5DNUA 5AKLA 4INZA 5LZ2A 2Z3WA 2HA2A 3C6ZA 3L1IA 4EY5A 2ROQA 3ANTA 5ALEA 5JD6A 2CKMA 4F5ZA 2K2QB 3AZPA 1R50A 1YCDA 3PUIA 5FKJA 1C4XA 2HL6A 1JJFA 1GZ7A 5ALHA 1THTA 3M83A 5CH5A 2Z3ZA 3AUKA 3WK6A 4UFNA 2ZSIA 4E15A 4BRSA 2WJ3A 4ZV9A 2CUTA 4QLOA 5A6VA 4B85A 2QR5A 1GXSA 4CCYB 2ZJFA 3AZQA 4J0CA 4KRYA 3ESBA 4PSUA 5K3BA 3RKSA 4H18A 5IVIA 1ODSA 1YB6A 2DCMA 2O7VA 3D59A 4RE5A 2RI6A 4X94A 1FFCA 2PSDA 3IUQA 2XT0A 3V1KA 3HABA 5CT8A 2I03A 1QIDA 2WFLB 2E3JA 3OOSA 3I1YA 2OAGA 4AXBA 3HRHA 1LNSA 1C7JA 2VEOA 1XLUA 5AOCA 2VF2A 1IUOA 4MEBA 3PICA 1DWPA 4B9EA 2HRRA 4DNPA 3BWXA 1E89A 2ACEA 4JNCA 5EHZA 3CN7A 4YX9A 2XB6A 4QDOA 4BBZA 2ECFA 1LPAB 4CG1A 4AO8A 2WJ4A 1LPMA 1SCIA 4C01A 1MX5A 3H2KA 4AX4A 4J0GA 4N5IX 4GXNA 1OXMA 2GBFA 2HA0A 3JYHA 4OCZA 4U2CA 2HFJA 3M82A 4HAIA 1TCAA 2ES4A 1QIGA 1U8EA 4G8DA 3RLIA 2DQZA 3RARA 1CUEA 5AK6A 5AIBA 5AKYA 5AI4A 5ALRA 5BWCA 1HDEA 3R41A 4DSAA 1QIIA 4Y9SA 3Q8WA 4B82A 2XQKA 1CUFA 3C43A 2JF0A 4JYMA 5T4HA 2QUAA 4CIAA 4G5XA 4K6HA 1VZ2A 1K4YA 3G0IA 2BAGA 1QFSA 1XZFA 3X3HA 1JT2A 3FBWA 1XZDA 4AZ0A 5A7GA 3FSGA 2XDWA 2WUEA 5CURA 2XQFA 5AM5A 5EI5A 2XMQA 1ZIYA 3VDXA 2HA5A 2NW6A 2FJ0A 2XMZA 2DHDA 4AMZA 2X8BA 2BFNA 5HK8A 4Q82A 1CPYA 2WIGA 3CXUA 3ZLUA 3DKRA 1A8SA 5A62A 2AJCA 4PQEA 3VISA 5IKXA 2GYWA 4UHEA 3FLBA 3I2KA 5CW2A 5DYTA 4C4YA 4K6KA 4U2FA 3HSSA 5JATA 1CUYA 4NZZA 1XRLA 1ZD5A 4J0KA 2Q0XA 3C6XA 1YA8A 5LLSA 1EDDA 4L9AA 4AN1A 2J4FA 5ALUA 3OC0A 1WHTA 4M0MA 5KREA 3KWFA 4B80A 2GYVA 3KD2A 3WQHA 1XRNA 1ZD2P 5EIAA 5JIBA 2WQZA 4IQ4A 4DMFA 2BKLA 3PF9A 5CT4A 1N1MA 1VE6A 4BP8A 4Y2UA 4CIBA 4H7EA 3FCYA 1ODCA 1X70A 2XUFA 1MNAA 3GA7A 2HA4A 3GZJA 4QDUA 5CRIA 3ZI7A 4UHCA 4C6HA 2QOEA 3QZUA 4GBGA 1WB5A 4L0CA 3IDAA 5FOQA 5AM3A 1MO2A 3I2GA 4EB0A 1I6WA 2WUGA 3W2TA 5AJHA 5HFNA 1YS1X 2WFZA 1FJ2A 4B0PA 3WK9A 4WY5A 2G5TA 2VQ6A 4IH1A 4ZI5A 3VJLA 1MNQA 4FHZA 5HF6A 4DGQA 4PO3X 3O9VA 2GYUA 1CUSA 1DINA 1VOTA 3FYUA 3C6BA 5HCUA 5HQ3B 1JJIA 2AJDA 5HF8A 4N8SA 4BAGA 1DWQA 1DQZA 5AK3A 2GBCA 3LCRA 1N8SA 3WYNA 4IH9A 1VA4A 5ALGA 3FYUB 3G0DA 5I7UA 4UBKA 2HM7A 2XMDA 4Y2SA 4J7AA 4TPKA 5JZ9A 4BE4A 2EEPA 5AK5A 5T4FA 3MVEA 2WIKA 1DTEA 2XUOA 4BCBA 5AKKA 1CFJA 4AN0A 4TGLA 5LKRA 1CUAA 5K5EA 1CUVA 2JEYA 3CCBA 3BL8A 5AKIA 2IX9A 4PNZA 4H7HA 3IUMA 5JZSA 1EVQA 1EB9A 1AX9A 1GGVA 1ODTC 1QIJA 1RP1A 2WHQA 4X6YA 3DNMA 3DYVA 3FOBA 4BRZA 5JALA 2CMFA 4PF1A 1G42A 2AJ8A 1H23A 1SCKA 4X6XA 1H2WA 1ETHA 2DSNA 3HYSA 1W1IA 5I8PA 4HVTA 1XRRA 1CUWA 4ARBA 1YAJA 1ZOIA 1Q0ZA 5A7FA 1CLEA 3F97A 3A70A 4E46A 4FKBA 2WFMA 1G66A 1LLFA 4H0CA 4X7BA 5H3HA 4MQLA 5ALXA 4UHFA 3CN9A 1ZIXA 3D7RA 5LZ9A 4J0HA 5LZ4A 4B83A 1U65A 1E3QA 5F4ZA 2RONA 4HZGA 3T4UA 3D2CA 5FLKA 3HC7A 2HA7A 4KAJA 3ZWQA 1XQYA 1QIFA 4YASA 3WWEA 1N5MA 4Y7DA 2JGJA 2ZVDA 2OGTA 1LPPA 2QZPA 2JGIA 1WCYA 3H04A 4IHAA 4KR0A 3DYIA 1B6GA 4BC0A 1LPSA 1UOPA 3WZMA 2VTVA 4Y2YA 3ESDA 2OCLA 3FSGD 1CUZA 1CVLA 6YASA 5A71A 4J03A 1UXOA
chains in the Genus database with same CATH superfamily
2H7CA 3IQXA 4YGYA 1NW5A 1GT6A 3PUKA 4AUNA 2XWQA 1YJ8A 3AY7A 3TD2A 4ARZA 1D04A 3PEVA 2JLUA 2OP1A 1YUNA 1NR5A 2Y66A 3KKPA 4R7ZA 3VU9A 3WAJA 1WVMA 4X54A 1FY2A 1OBCA 1Q16A 4OMFG 2QNBA 2PMEA 2EKBA 1M2JA 2HPHA 4Z51A 2B6NA 2X9LA 1RIIA 2IU4A 3GNLA 3JQDA 1BX3A 3KZOA 4KLAA 5TMEA 4AI6A 5TQJA 3GY0A 3QFTA 3UJ8A 1Q7RA 3PXEA 3H99A 3WRYA 1L9XA 2YQZA 4BMCA 3HEAA 1U9IC 4O25A 5KTTA 4P9NA 5FT9A 4JEHA 4KTVE 3T7DA 5B1EA 4MKGA 1J0BA 1XZAA 4AQDA 2ORED 5HQTA 4HMPA 2LKCA 1UZUA 1VMDA 4TZKA 2WW8A 4CR8A 4KIWA 4BGIA 2G9VA 1IM5A 3CM0A 1VZ3A 4Q7MB 6Q21A 2B4QA 3D3NA 5FI3A 1FQWA 3D4IA 4J75A 4KO4S 4PCLA 1CQXA 2G4CA 4TSFD 2IF2A 1M3SA 4PONA 3KJIA 3QSYA 4WZAB 4FLEA 1QNLA 1XZMA 1XPRA 1K8YB 3G8AA 4M1MA 3REQB 2XNSA 1GKUB 1IBRA 2IYUA 2GPJA 1OAOA 3K9NA 4ROSA 5AVJA 3EY9A 3WZ2A 5EZ6B 1ZD4A 3Q0TA 4W9RA 5IUNC 3VAAA 3R3VA 4QU8A 3RUFA 5IVKA 4MJ3A 3BRWD 3CRMA 4UHBA 3BSSA 4YFYA 1S9HA 2F9MA 2HU5A 3SZMA 1R74A 2IOYA 4B4OA 3K0SA 1OTXA 2SKCA 1YJXA 2BH9A 1WR8A 3G8DA 3OUUA 4AMYA 4MRSA 1U9ZA 4V3BA 3K0CC 1I3LA 1X80A 1RWMA 1D2MA 3OECA 1OZHA 1G1AA 3QI2A 2P9JA 2P4SA 3EULA 3IAS1 2JVIA 4HWRA 4TTTS 4ZVUA 3OURA 4OX9B 4KODA 1H2HA 4CKCA 4LWQA 1E1RA 4UE2A 3D8NA 3B1ZA 1MFPA 4DV3B 1J23A 2XGSA 1SC1A 2YHIA 2Y2VA 4I1OA 4WN9B 4M9QA 1J8DA 1LK7A 3RHFA 4M0KA 4DQUA 3U13A 1RDFA 3P9CA 2WTNA 2OZEA 3PSAA 3PQ3A 3NWPA 2CLDX 1W29A 1LJ8A 3B12A 4QGBA 4IDQA 3X44A 3RS4A 5HK9A 2EL9A 2NSHA 5JCXA 1RHQA 4HWSA 3DFKA 4KMSA 1G3IA 1ISJA 1HDCA 1XDGA 4WNIA 3OZVA 1QQ5A 1ZLXA 1WETA 5IXYA 4DYVA 4OMUA 2V5AA 1JLLA 3B1FA 4CNBA 1FDOA 2FSPA 1JPUA 2FZVA 2R11A 1QUEA 3THOA 5A3SA 1V3QE 2BCJQ 4MR9A 2R0QC 1P4GA 1ZVMA 4QGGA 1LVGA 5FPYA 1GZSA 4IUDS 3B78A 4CYMA 4D9IA 4G37A 4QOHA 3I28A 4K2AA 2HNAA 3GZTB 5JCPA 1KEWA 4MIEA 5EN4A 3RBXA 1WUIS 3LFUA 4CW7A 3KEGA 1X9GA 3V4FA 1U28C 3EXFB 1PJ8A 1GAEO 2WDZA 1IHPA 4PLGA 3O3NB 3F3YA 4DFDA 1R8YA 3U3KA 5K8CA 1R0XA 4FILA 1NOKA 1XTIA 2FWAA 3G8YA 3GG9A 3K6JA 2PXAA 3ZGLA 3AV0B 1DKQA 1ZU5A 3WNCA 2AUMA 5FBWB 2ZYAA 1EGMB 4I9HA 3ZU4A 3VI3B 4EUKA 2HIGA 3SC2A 1EWRA 2ZTMA 3FPKA 3IBSA 4REOA 1SQFA 3R5FA 1Q1QA 4RZ2A 4AJLA 4F21A 5B6IA 5ICEA 3BRSA 4PHGA 1K0UA 1Q1ZA 5E4TA 2SCUB 4AKEA 5KDOA 2V6GA 4G0QA 3HACA 2D1TA 1USUA 4ARIA 1KU6A 4CIYA 5HS4A 2QVCA 2V7VA 4YVFA 4EX6A 2O8FA 1L5YA 1ODIA 1OYVA 2I2CA 3JAWB 3ZHRA 3TNFA 1NRWA 2JGLA 4H7IA 2PL5A 1KMHB 1T3HA 2QG4A 3QHQA 4LTMA 1RYHA 3DP7A 2JJ1D 1TCVA 3FAKA 3D4PA 1MOSA 2PM8A 3MSCA 1G38A 2O3QA 4XARA 1Z3CA 4KYUA 4AT1A 5CXXA 2YZKA 4IXTA 1ZNXA 4D0RA 4ER3A 4TMXA 5L4LA 1L5OA 2HADA 1XA0A 3TZBA 1H1TA 1T0JB 1L5SA 3PEYA 4N0QA 3C6QA 3D2AA 2WD7B 1VKNA 4AU1A 3NGLA 1L3BA 3EVTA 4JVOA 1GZ4A 3HEMA 5DSXA 1CEXA 3AL3A 2QI9F 2CJFA 3LHDA 4URZR 4I4NA 5JWRA 5DYIA 4ALIA 1Y4ZA 3IKMB 5EP3A 4EF4A 5H4GA 5HZHA 1ZI8A 4J6FA 3O4HA 3P9SA 3PR2B 3TUIC 3F6EX 3VMMA 2YWBA 4FCCA 3GH1A 5JNVA 4M6WB 2WG2A 5DHUA 5ADVA 1GGHA 4JP1A 2WSSD 3WQQA 2CNKA 1H8HD 1CQWA 1LSUA 2IW1A 1SKUA 2OLJA 4JC4A 3BSYA 2VUTA 1NIPA 5HFAA 1ADFA 1EDEA 3TAHA 1DQYA 1E79A 2V5UA 2QPAA 2W4IA 3GV0A 4CMBA 1JMKC 4DNXA 1WWKA 2O7SA 2VF7A 1XEFA 4OJTA 4F93B 3L4KA 4LGMA 1QRTA 5INTA 3GJ5A 4LKOA 2E48A 3IP7A 4OGKA 4W1SA 4WNAA 3GYBA 4HAXA 4QNNA 4YJFA 4ZQBA 3V80A 5EJ4A 1RRFA 4BXOB 5DHFA 3VU3A 3PI7A 1M6HA 4XWWA 3LGXA 3RBVA 2QNIA 3R7WA 3SXJA 1J21A 3VJMA 2JIRA 4BATA 2HPVA 2Z4SA 1PFWA 3M1IA 3O5AA 2OM2A 2ZSEA 5CIYA 2H17A 5TLSA 1JAXA 1I5EA 3I6BA 3WHLA 5B36A 4FPXA 2OCIA 4TLAA 3RS3A 2RGXA 1K8XB 1W52X 3R5TA 1Q0TA 3KLBA 5I7OA 2PU7A 2Q07A 1GA1A 2ZDQA 3AEKA 1YZUA 4FKZA 3Q2KA 4G0OA 5JO9A 1WBJB 3K32A 2RHHA 3T5DA 4FNAA 5LMNB 2O3UA 2UU9B 4REMA 4QFCA 1TJ4A 4OFWA 3FMPB 4FE4A 2WTMA 3IDZA 3Q3VA 2GQ0A 1P74A 3NQ41 4COOA 3LIIA 4BECA 2O19A 2D54A 4I4IA 3VHXA 3WWZA 2DLDA 2IPNA 3H7IA 4KLCA 3TRDA 3PHJA 2OV4A 3I01M 4LNHA 4N5MA 2G72A 1EX9A 1N5OX 4YCLA 2C9DA 5EFOA 2NQ8A 1GUYA 3BMCB 5FTWA 3WGNA 3QKUA 3OFSA 3LXMA 4MLZA 4BP1A 3I05A 4INPA 4EG3A 4FOTA 5G40A 3KSAC 1E0DA 2OPBA 4F2HA 1XZBA 3NHKA 4A3SA 1PHPA 4AF7A 2O8FB 3DDHA 4MGHA 5LC1A 2ZETA 4E4RA 4KXYA 4P38A 5JZBA 2YN4A 2XZTA 2J31A 2XOKA 4EH1A 1AQNA 2Q62A 1GR1A 1GPYA 3IT0A 4XR4A 4DDVA 1KDOA 4M0DA 3WGVA 5JAQA 3E22A 4BMOB 1YULA 3DS8A 5UKDA 3WDLA 3BIXA 3SC2B 1N34B 1B1AA 4A27A 3ONVA 1NVVQ 4BCDA 1RQ7A 1W4BA 3DUWA 1ZC3A 1XRPA 3HCEA 2H2WA 3D31A 3JWGA 2I2BA 1FP1D 3QNMA 4M9RA 4R9SA 4NNJA 3MCWA 4LY9A 2PZAA 1V1MA 1BH6A 1L4FA 3IILA 3FCEA 1G7SA 3F7TA 4OHPA 5KTYA 1Q77A 3BORA 2DKNA 5B4VA 3DE2X 1KFCB 1TD9A 1KERA 3Q8XB 1KMCA 4GGOA 4J6EA 4Y9RA 4F8EA 4L9WA 2WLTA 4MVXA 1IN7A 4WN3A 1VJ5A 1G21E 4Q1VA 3FDXA 3OFKA 2WT8A 4WY2A 2HK6A 1QO7A 2O7QA 3L0IB 3BXHA 3G7UA 3DW3X 2CFOA 3GW8A 4AQ7A 2WQ7A 1G8JA 1MRSA 1P9OA 1TVKA 3EZNA 4IHQA 4L0DA 4QEKA 1PR0A 1VMKA 4MRNA 5FA6A 4OLBA 1Z0DA 4MCIA 3RVJA 1IOLA 4FNGA 3AKCA 3CNBA 4B8WA 2C3YA 3OFJA 3P5BA 3CYFA 4WADA 5CMLA 5DNDA 1GPLA 4UTNA 5JAIA 1IUKA 2Q5IA 4TMWA 1LLUA 4E51A 2WG0A 4M9CA 2EKQA 2XRMA 3DVLA 4ENSA 2FFAA 2RG1A 2QROA 4FFRA 4GZ5A 3MRVA 4PFSA 1B0ZA 2WMDA 1YC5A 2QQEA 2HSEA 4FKMA 3G9XA 2OAQ1 1T2EA 3ENWA 3MJHA 3H2ZA 3KVVA 2QZ4A 3R74A 3QLUA 2Q3DA 3EZFA 4KE6A 1U0BB 2W93A 3KL2A 1NI3A 1C41A 1NYQA 1WF6A 2VZ8A 4S1OA 3FYUC 2Z8ZA 3DW1X 3F3SA 4WK2B 1RWWA 4IF4A 3O0DA 3MGGA 1ZH8A 4BQPA 3IP3A 3KZ1E 1UDWA 3OZFA 2CL5A 5K8TA 2GCGA 5JH7B 1NT2A 4QBGB 5A02A 4OOEA 4F8YA 2AEFA 3B85A 3P0EA 1Y7IA 4B7CA 3LXUX 1N9KA 2L0XA 1TTHA 5E2IA 1L4KA 4V02A 4XWTA 1N2CB 1SRQA 2XUQA 3F8WA 4LVUA 5EMLA 4CKEA 4MWBA 3S1SA 3IP8A 4M49A 3A6DA 5HXAA 2X8AA 5T67A 4E08A 5EJ5A 5DW0A 2ZSJA 2ZE6A 2WTAA 2QF7A 3GEBA 3I83A 1E20A 3F47A 2ATIA 3IS3A 3ZWYA 3V4PB 5LYJB 4ZCQA 2W2XA 4MB6A 5BRAA 2PUEA 2CNWA 2P6RA 4EITA 3F96A 4EHAA 3O4VA 4R0VA 2ZRNA 2E4WA 3BWDD 5E6UB 4D7AA 4EZIA 4YRIA 1X7DA 3SHVA 3PPIA 1WEHA 4AMGA 3A36A 4FYPA 5BRJA 1COWD 3U4QA 4HAWA 5F76A 3WV4A 4FWBA 3P19A 3L4BC 4RK1A 1GTRA 1XJQA 1ZS9A 2X0RA 3GK3A 3ENVA 2YRXA 4HYQA 1NW4A 3AK4A 1KYVA 1ICIA 1QLJA 1YIAA 2HRCA 2JFUA 3OT1A 2GFIA 2R2GA 4HNTA 2BHLA 2GKGA 3R7SA 3RJZA 1T4MA 3U3XA 3AYXB 2G1JA 4AY4A 2HMYB 3BULA 2HH9A 1E9FA 1OT5A 3HH8A 4NSNA 4Z6KA 1HG0A 4X85A 1L1EA 2H9AA 2FF5A 4GPEA 4J16A 2E4AA 1VCIA 1FDVA 1XZJA 5JNLA 3VR5H 3GUUA 2NN3C 4IDGA 1P6UA 4PZPA 4AFNA 4NCAA 1SIOA 2YZMA 4UCQA 1R27A 3QKRA 4DR6B 1TOAA 5EYPA 4IDNA 3F78A 2ZAIA 1FP2A 2VPQA 4Q9NA 3THYB 3DQZA 3K4HA 2IQ5A 1CE8B 1Y5MA 4FOPA 4NBSA 4BNIA 3D64A 5FPKA 2Q4EA 5DEOA 1TX4B 1K8RA 2QXUA 2CXUA 4WBNF 2JCBA 1OSNA 2BEUA 3BMCA 3NHPA 2HIMA 4LTDA 4D8WA 2RHOA 1Q57A 1ZM4A 1RHUA 5BVHB 2XITA 3H84A 1N0HA 3LMKA 5DWVA 1XDSA 2H1WA 1FBTA 2Q2OA 2RAPA 4FFMA 5KPJA 1G8SA 4KGXA 3CFYA 4UNSA 2AMVA 1O6BA 2JBHA 3RT1A 2IYWA 1GZHB 4FQ5A 2I67A 1YDWA 3SYNA 3S5UA 2XI4A 3I53A 4TXMA 2FK7A 2XWSA 2FMTA 3M4ZA 1T4BA 5REQA 5B58C 4JB0A 3AVPA 1Z73A 2IDKA 3AUYA 5HMLA 3ZE9A 1BG6A 4PSCA 4QEDA 4RTJA 5F52A 4NU8X 2BR5A 3JX9A 1CUUA 3OQ6A 5M2QA 5AKHA 2ZS7A 5JUWA 4U3JB 3EMKA 4ARVA 1O97C 1ODLA 4OO3A 1F0YA 2FPUA 2XUZA 4ND1A 3ROEA 4P4TA 4HH1A 1IOWA 5C1PA 1U8FO 4ESOA 3W2IA 4GKJB 2IH4A 3QFRA 2COUA 1Q21A 2OFXA 5I9MA 1LJLA 2W37A 3ZGYA 5A5EA 2AB0A 1VJTA 3OU2A 1ZD8A 1S0UA 3LDGA 4R98A 3SAJA 1VB3A 1F6WA 2W22A 1CF2O 2WU3A 4KMMA 4EVRA 4HWOA 3HLYA 4QVGA 3SFVA 1CG6A 5AW8A 2BZ1A 4FGLA 4G4IA 5HCIA 3STTA 1FYXA 3UHOA 1KOFA 4L8LA 5CH3A 3H5VA 2C9BA 1FPMA 4LW8A 4XJSA 2I6XA 3TJMA 3UMSA 2C97A 1NI4A 2AFIE 2JJ8A 2WJPA 3IAHA 4IFBA 4ZOCA 4YWJA 5TX7A 1RC8A 4F4HA 3LPLA 1UFRA 3IVGA 3QNUA 4UAUA 5JASA 4R51A 1WOYA 2BM1A 4GSKA 2C29D 3VU8A 4D8UA 1BDIA 5FOSA 1KQGA 2HLDA 1TQDA 1JIQA 5T3YA 3LCMA 4NE7A 1TPZA 2HW8A 2XDAA 5K3AA 1GKKA 2BVNA 3ESYA 3NR2A 4HQLA 3MN1A 4OBXA 3R7FA 5ICGA 3HXMA 2C5BA 1F6DA 2A9QA 3EAQA 5F23A 3C87A 1FFSA 1WQ1R 3CPEA 3OHSX 3R6TA 4KMOA 1P81A 2NXCA 4RD3A 2IGBA 3O8QB 5L7TA 2BLNA 2IXFA 1E2EA 1ZFNA 3KJGA 4KKXB 1QBGA 4MB0A 1ZA2A 1A7KA 1XLTA 2P7IA 1RFGE 1WSBA 2GZMA 3R0XA 4LI0A 1DL5A 4TVBA 4EFKA 3LZDA 5CLJA 1XZCA 5KTNA 1W4CA 2JFNA 3H05A 4G2NA 2Y6VA 2GEKA 3P9RA 3ZWBA 1E62A 1QHIA 3A0RB 1UFQA 4NBKA 3KIPA 3TXXA 4LMPA 2AXNA 2XODA 4X44A 1U0NA 5ALVA 1H4VB 1Y6JA 4WXEA 5CX1A 3ZY4A 1NAHA 2QJRA 5EP4A 4NBLA 2QX9A 2ZRGA 3LYUA 4G4GA 3VGJA 4AZWA 1SZJG 1JWAB 3N7TA 4RTNA 3R6WA 2PMBA 1X8KA 4GYKA 1RFLA 3AONB 4OBEA 1BU8A 3A8TA 1NUUA 2DHEA 5GQSA 3RLFA 3ROMA 1Z7EA 4YUVA 2RB4A 2KI5A 1QRSA 1Z63A 2JB9A 3OIFA 1DAOA 1TYCA 2O3TA 1TO1E 4KBYA 3VSAA 1GQRA 1EK1A 3DBHA 3L84A 4CM9D 3EXFA 4PZZA 1C0PA 5MF6A 1WTCA 4LISA 5CNKA 4ZGGA 3TUZC 2JFYA 2VYCA 2H07A 3IA2A 3FHJA 3IV7A 2WF9A 3JATA 1I1HA 1GQ2A 2ZBEA 4M1EA 1R8SA 4WQMA 3C4QA 3CEJA 9ATCA 4GP7A 4R2XA 4TX1A 4W7SA 1XEWX 4LFCB 2UYQA 4MRMB 3ESRA 4GSYA 4Y2PA 1PJQA 2YV3A 3FVVA 5CK5A 3TGLA 4GX0A 3RV4A 1PLJA 3ETHA 3UK0A 4GE0A 2PWPA 3M4YA 2I78A 4PYNA 2CXTA 1U7ZA 3K5PA 4AB1A 5DRTA 4E7OA 2DY1A 4GR5A 4QELA 1UF9A 4AKSA 2HMTA 2AD1A 2C0PA 5JQGA 4P3NA 1KEKA 3TOVA 1N6NA 1YKFA 3M5CA 3AI1A 4TRRA 1C30B 4MVJE 2DCUA 3WKAA 1TAUA 5KJCA 1FYWA 1JZQA 4EB6B 4TXHA 4ESEA 4EVSA 1GN9A 3IIIA 4RQUA 2QUJA 1I3MA 3JR3A 2JLWA 3UAGA 1J0CA 1N3LA 3FH0A 1YJQA 4N5DA 5COBA 3OF3A 5L4NA 4LUCA 4FYKA 5ALOA 2HNKA 3TNYA 3K9GA 1AIPA 3PE6A 1CY7A 4JOCA 5ECDA 3PK0A 4GL4A 1QJ4A 3WHPA 4FXPA 3D6UA 3HUFA 3RGWS 4JU8A 4RVNA 2D2EA 1E2GA 1ZM9A 1G291 3WLIA 2VNKA 3C7CB 5EA2A 3OE1A 3PDCA 1HEIA 4TVKA 3B2NA 1KHHA 2AZDA 5BWMA 2YHAA 4B34A 4LXXA 1L7AA 1EVLA 4LQCA 3B5JA 1S01A 1A8UA 2BIFA 2XDQA 1E1NA 2ZP1A 3KOUA 1ZJ6A 1IOZA 3Q9UA 4TXJA 4GVLA 1JZTA 2BEUB 4I66A 5L7YA 3U7JA 1Z5OA 1NLYA 3KKEA 4OXQA 4ZAXA 2VPZA 3DWEX 2PMCA 1X6VA 1GARA 5F64A 5B55A 2Q5EA 5FUBA 2I6GA 3AEUB 2Q3HA 3D81A 3HJBA 5FEUA 1XB2A 5AVRA 4Z8XA 1K6IA 1I5RA 3LC0A 4BC1A 2PZBA 2IUYA 4JGBA 1RAFA 1P33A 2GPTA 2VP2A 3VR3A 4XWOA 4LHYA 4WPGA 3OAAA 1HMYA 3W7AA 3M7IA 4Q48A 1YFJA 1QYWA 4GUDA 2PBZA 3U4CA 1ECPA 2UVPB 1W4AA 2GTPA 1G9SA 3KXDA 3ELYA 3MBKA 3ORHA 4R1NA 2YHSA 3KOWA 2C07A 2QW1A 3M1YA 2OB2A 4GKAA 5EWLB 4CT4B 3LTNC 3PGVA 2X0FA 1LS6A 1VPDA 2O2DA 1I0ZA 1C8BA 1QANA 3SDZA 4NZPA 5LNK1 2YWGA 1KYTA 4KRFA 2BGKA 3ZY5A 3HCPA 3WGGA 5IF3A 3ED1A 3A4LA 5GOTA 5JLJA 3QELB 2PL1A 4FE7A 3FCXA 1S8NA 3DO8A 1YL5A 5ALTA 3CY6A 2X9NA 1YVRA 1NLFA 2PPVA 3TKAA 3TOCA 4UFOA 3RASA 2VLIA 4LK3A 1OXKB 2F62A 1G5TA 4MUKA 4IRUB 4NEQA 5SZIA 2MTBA 1Y7TA 2GPAA 3FE2A 4K6GA 3TE7A 3WIEA 4XE5A 1DC8A 3CZ4A 1SCJA 1W2GA 3G1TA 4UBIA 4A82A 4QDJA 3RREA 4EHFA 3UMYA 1NXXA 2PJUA 1KPGA 3VQTA 2IXAA 4EAAA 1UK9A 4XH9B 2FSUA 3DAPA 4P4LA 1NBHA 3U3DA 3OIGA 3JQPA 4M0EA 1H1LA 3CSDA 2O6HA 3HNOA 3P0RA 4H1WA 1ZITA 1XVLA 3R7LA 3ASYA 3O4JA 3O7MA 3MINB 1JIUA 3QHAA 1YE5A 2Z2JA 2POQX 4EW6A 4QGSA 3PFWO 1M0SA 2G7MC 3EMDA 1V39A 2WAAA 3DE7X 1ECFA 2CMDA 1F3OA 1TC2A 1YZGA 1YAHA 2PS9A 1NXOA 4NZ9A 4XVRA 2RJOA 2P11A 4DA0A 4IDCA 2G6TA 4PR3A 3EPHA 3JTMA 4I8IA 2E85A 3PEFA 3QENA 2Y99A 1RTTA 4ZOQI 1KMQA 5KYTA 2IL1A 1SKQA 3MUOA 4NF2A 5HX7A 3UWDA 4UPEA 2HNBA 2GDZA 1IXSB 2GN0A 3ZKWA 1OREA 3MHTA 3A37A 5E9WA 2CB0A 2WYIA 1MGPA 2V45A 1O03A 3IVRA 4RQTA 4YRQA 3D0RA 4AL4A 4MINA 4LEIA 1NVBA 3M3PA 1P1JA 2QMYA 3P4XA 1A76A 3E6AA 1RXIA 4TLDA 3GX1A 4MUAA 1QOPB 2XLCA 2V3VA 3E18A 3O31A 1S8FA 3PQEA 3UJNA 4KNYA 1USIA 2IYAA 5J59A 3FUWA 4EP1A 2WJ6A 1WB6A 4DCGA 4H1VA 1UBJS 4O2BA 1O94D 4KQ6A 4JVMA 4DA8A 5DRYA 3K92A 4ITUA 1PFYA 4ZCSA 1W85A 1S2NA 2H16A 3WWOA 4N5NA 3OZUA 3WQBA 1IBKB 3CLSD 1G8AA 2BEVB 5ALNA 1AGRA 4OHUA 1P1IA 3D0KA 1GVNB 2XE4A 4H35A 3S2FA 4QXOA 4CHTA 4CLRA 2I55A 3T38A 2J59A 1FXUA 3EHDA 1JHXA 1JA0A 4C0LA 1FQKA 4IXMA 3OOWA 2Y1FA 4S35A 4DLZA 4XSGA 1GNSA 2FOIA 2VHVA 1N75A 2F1JA 4ZYXA 2GXSA 2JIOA 3V1YA 1I1OA 3GP3A 3L77A 3T35A 3WRXC 4JLOA 5BY2A 4V3CA 1SZDA 3UMRA 1ZG3A 3FOFC 1AZLA 3L05A 3PC4A 4MQFB 4I5DA 3P1JA 1WOMA 4PZAA 2NV0A 2Y0PA 5TR9A 1L7RA 3KQHA 1O96B 1RLMA 2J4DA 3LW8A 3OH8A 3U1TA 2B25A 2LPMA 3ABIA 5J2UB 1FMFA 4KXXA 5I7AA 4DUGA 4CKBA 1NURA 3QVGA 4LJSA 1TFRA 5KYYA 3E03A 3NPMA 4LXYA 1ZMOA 2C84A 1XDDA 4G6ZA 2DTDA 2FY8A 2OESA 1SBNE 2BCEA 3QEOA 4NDNE 1GEGA 2INGX 4OGWA 1D0VA 1NBMD 3C45A 4XWAA 3U4AA 2C5FA 2FMFA 1V7PC 4YRTA 1G2QA 5TQ0B 1DOAA 1JNYA 4GMKA 3KV1A 2ZJ4A 3VX4A 1R0YA 3EVZA 5HM6A 2NMVA 2IIQA 4BNWA 1W19A 3KQMA 1OFUA 2HRDA 5KIAA 1E59A 1VE1A 3L9XA 3O4FA 2Z9BA 3CUWA 4R6WA 1TQHA 1KI2A 2V7TA 3WK8A 4UM9B 9MHTA 1UT6A 4RHCA 4ZO9A 3ZU2A 2ARKA 1IZ7A 4HEJA 1JMVA 4OQPA 2I29A 3L18A 1HKHA 2I1QA 3LP5A 3RHSA 4NENA 1VYTA 2VTKA 4UBOA 5ADHA 5J23A 2XYVA 2I6UA 4XEHA 4ARSA 1D1SA 3AC0A 2PXHA 3T3EA 1JLSA 2W48A 1U94A 1D5CA 3JARA 3TZLA 4OHYA 2ZIUB 5F1OA 3CWQA 3NAMA 3V7YA 1U6KA 3CPSA 3LBNA 2G71A 1JJAA 1R0KA 4IIFA 3EH2A 3ZDDA 1HYHA 5EESA 3EXG1 4QO7A 1YZQA 1CETA 4CF4A 2XB2A 1NXTA 3I9MA 4KG7A 4PNEA 1MORA 4B5LA 1G3UA 2C9ZA 3U60B 1WEKA 1Q0SA 2CJYA 3C7KA 1DIRA 4DEXA 1GKLA 1O9HA 1RW4A 1U0GA 2C5HA 4M3NA 3AVTA 2JIQA 3Q4GA 2BYTA 2Y1XA 4AVYA 3SVTA 4UTZA 2YN2A 4XYMA 2AI2A 1JBKA 1W44A 3SSNA 1M7BA 4M99A 4ZT3A 1C81A 1J22A 2G4VA 3MS4A 4ETWA 2BGUA 5J5CA 1CSEE 3U26A 4ENVA 3DFMA 5ALQA 1B0PA 5CT5A 5F5LA 2H48A 2BKXA 2BMWA 3KXKA 4BYMA 4D9NA 2H63A 1T2VA 2EFCB 3CONA 1QG0A 4MV9A 1TQ6A 2GO7A 4JYPA 4TM7A 4D92A 2EVWX 1OTHA 2XF8A 1BX1A 1SO8A 2R751 3OQNA 2AFVA 2IKSA 3JPWA 3JQAD 4M9UA 1KH2A 5THKA 4RORA 5IXSA 4JLSA 2C4UA 2XD9A 4K88A 4FZVA 2I7CA 2QLMA 5T4EA 2WFLA 4ZODA 1P0QA 1JHDA 1SU6A 1JAHA 4KWTA 3BMNA 2PD6A 3GDGA 4LVCA 1POXA 4GR4A 3TD9A 3TXAA 5BSHA 4NAHA 4Q24A 4KPFC 4QZVA 2DUMA 4P2GA 1J2YA 3SJ7A 3AR9A 2XCRB 4E5SA 2ZUBA 4X93A 5F77A 3P9PA 2IZ0A 2IPAB 3O4IA 4ZDJA 1IN4A 1AGYA 1IUNA 1NKVA 2YXPX 4RHEA 3V4OA 1B6TA 4PGAA 2QM0A 2QU7A 1RQRA 1RLJA 1NP6A 2VWQA 3DV0A 4DLBA 4BWYA 1KC3A 2ZYSA 2BBWA 2ZIVB 4QWMA 1A5TA 1YU9A 2GVZC 3AXTA 3H18A 5FLYA 4FMDF 2I3ZA 4LYYA 2RIPA 3AETB 3QH4A 4B74A 1SBCA 2AD5A 4ASUD 2JFOA 1OFGA 1AKNA 1BN6A 2GRJA 2PRIA 4JJIA 1RM4A 1Y6FA 1CUBA 4I1PA 2PXCA 3TRHA 3L4JA 1COWA 3C24A 3EDCA 1ZK1A 2A14A 4A0QA 2W0MA 4URWR 3A26A 2ZYHA 3LA6A 5TXGA 5K99A 2ZU6A 1YZYA 5K3FB 3C3YA 2JGDB 3OBIA 5HILA 3QVUA 3KT0A 1KYXA 3LP6A 4CLRB 1JRLA 2DPYA 3MTQA 4FEAA 2R7LA 3WA6A 1CTQA 2QL9A 1GZVA 3I6MA 3GI1A 3IXMA 5HJEA 4JGIA 2GAIA 3VTKA 5I51A 3WK5A 1S9DA 4N8EA 1LFDB 1JHYA 1T2NA 3OIYA 1GPAA 3UGTA 4UUOA 2HMWA 3F7OA 3WNZA 2HFKA 2PZ8A 1J5XA 1M75A 3FUTA 1PQWA 1A5SB 2ZVJA 3HRIA 4PTYA 5K8JB 3KUUA 2QL5A 2HMVA 3HBAA 3KZKA 4QPZA 1R8QA 1U04A 2A59A 3LQKA 4GI2A 4HBGA 2NM0A 2VNIA 3LLMA 2J6CA 3FHOA 4I19A 2NX2A 4GYYA 4QSMA 3JD0A 1TJNA 1GCIA 1JECA 4EKIA 2YXEA 2X19A 4CR7A 4E14A 5DXAA 4PINA 2I7DA 4E07A 4KO2S 2DKOA 1C1DB 4M54A 4O4IA 2QTZA 3N8HA 3DLTA 1K0FA 3KSMA 3NP9A 2REXB 5DN9A 5ALPA 5ARDA 3GQVA 3RT9A 3U40A 5JRZA 3LUKA 3MM4A 4CDGA 4D4HA 5IRCD 3V8BA 1L1RA 3B9PA 5EGNA 2H7YA 2CLHB 4ICIA 2E1PA 3L1JA 2PY6A 2ZSUA 5IBQA 5LJLA 1M8GA 2QTBA 1WP4A 4PC2A 1FDTA 1PL0A 1QX3A 1YT5A 2LBPA 1MQ8B 3QPAA 4B6QA 3BE4A 1IY0A 1KAMA 2CK3D 1EVKA 1Q44A 1IHDA 2P9BA 4U2BA 5E6RA 4F38A 1GZUA 4IVRA 3LUBA 3GD7A 4ZDKA 3TQIA 1HDRA 5AVQA 2QTVA 2RH9B 3P2KA 1QTRA 4YRCA 2P8SA 3MJCA 5IDVA 4BJHB 2AFHA 1HE4A 3IQDB 1SN7A 3MCVA 1P5ZB 1Z0JA 2YWHA 1Z9BA 1SXJC 5DI3A 4G56A 3W9BA 2FH5B 5AOVA 1JEYA 1TZCA 4OI2A 1K75A 2OC4A 5C1IA 4UHJA 4B6OA 1UBTS 1A7UA 4URUR 2PRJA 1O08A 2ODAA 2ZS9A 1O4WA 4KDFA 1AC5A 1ZCAA 5K8UA 3AKZA 1TM5E 1MX9A 4X6LA 1C0LA 5GJVC 2AE1A 5LP6B 4S05A 3ZWWA 2OCGA 5BOSB 3GRCA 3H3JA 2W7TA 4TTQA 5DOVA 5FFNA 5BW4A 3EZGA 2WSIA 1KKLA 2WM2A 4NONA 3OMLA 4QPNA 4RGBA 4Y2GA 3RSGA 5EMKA 5KEIA 1JEEA 3H3FA 4M98A 4IKEA 4QA9A 4K7JA 1PR2A 4R1MA 3ZQJA 2CWDA 3D7KA 3STVA 3WBFA 5AP9A 5JMPA 2FE1A 3E27A 3UIEA 5IZCA 3QBDA 1E5DA 2FSGA 2ZT5A 4EW1A 4X3OA 4HS9A 4HPWA 2VATA 1IZ8A 4MS4B 1WUHS 2AOWA 3AZOA 4Q3BA 1MZVA 3AUFA 4YK7A 3ONWA 1T5IA 1KJQA 2PYDA 3CUVA 4WCDA 2F3RA 3M6IA 1GYPA 1DRKA 1DTWA 2CXRA 2OD2A 3R3WA 4QBKA 4BLQA 3QMMA 4EWLA 1JDBB 2VIIA 3M8KA 2QRKA 4DCMA 4X41A 3P5SA 1L4YA 3PZBA 4JA2A 4AULA 1AHIA 3PDJA 2RK4A 2WIFA 1I7LA 3H4VA 3IJEB 3ZHVA 5H7XA 1CQIA 1F8FA 5FTJA 3UFXB 1YACA 3KAKA 4CQLB 1C7EA 1LQ2A 4P36A 3K9FC 2H9YA 4BHTA 2QN3A 5L3ZA 2IXGA 4NYMQ 4R9VA 1XAJA 5T7BA 1HTTA 2ZJ7A 4RUKA 3U0BA 4AWXA 4WKNA 3EMBA 4QICA 2A92A 4B3DA 2ZRFA 3NOXA 2YWRA 4ZYWA 1I32A 2Q27A 3N8GA 5GGXA 1I01A 1NN5A 1UK6A 4UM9D 1GAWA 3TMYA 2W9XA 3H86A 5EKTA 2MSDB 3FM9A 2IYPA 2XTJA 1M6WA 4WLFA 1DVRA 5I7EA 3P32A 1GFIA 4EUEA 4YCSA 2A0WA 3V7UA 4HQ0A 4KUGA 1B6SA 3JWJA 3H9EO 1IWBB 4OA5A 4C05A 4MDFA 2AKYA 3E8XA 4L28A 3AWDA 5BNFA 2XEXA 2DRIA 2WM8A 3K30A 3ROKA 3LUPA 3BBLA 1ZGJA 4E5PA 5J4KA 2DTEA 1SA0A 4ISCA 4U7DA 3DEZA 4ILEA 5B37A 3VDRA 3WOVA 4WKCA 1UODA 3C3PA 4C5CA 3E82A 2XCQA 2QPOA 2V6MA 3JALB 2Q9AA 1OI7A 3T1QA 4NXMB 221PA 1UKEA 1N6IA 2ASEA 4XJTA 1VKHA 1ONOA 5ICMA 1D2EA 2DHRA 4R81A 1F20A 4PIMA 4WFKA 4Q3EA 3HU1A 4KXWA 3WDMA 4WLUA 1ZXLA 1Q83A 3S28A 3TLYA 3DE0X 2KLHA 1T9CA 1MEEA 1TM4E 2X9GA 3AUAA 3GRZA 4NS4A 1AA6A 5A4IS 1LBSA 3LF2A 4QLAA 4BX8A 2FA9A 2XNCA 1RYBA 3RVDA 3ZDFA 2CJWB 4U2KA 5D5QA 3AVOA 4NFHA 4WEOA 5CDFA 4D82A 4D9MA 4EJ6A 3FPAA 3DJYA 4QBTA 2OMKA 5HNKA 5ICSA 4FNMA 1E5VA 3OLVA 4JXJA 1T9AA 1XNGA 1PJCA 2ZYIA 4OXXA 4KEAA 4MUGA 5DLPA 5G3YA 2NXJA 3U44A 4WK6A 3QXGA 1SQGA 4WERA 4G8CA 2WD9A 3RC8A 3LDUA 1RAIA 4GO1A 2BZ0A 4GZ3A 2JS7A 2B69A 2PO5A 1QYXA 1V0JA 1JKFA 1KORA 2QUIA 2XSZD 2ZBUA 3EVBA 3FW1A 5SZHB 3UGKA 3E3OA 3SQDA 3GO4A 4BAZA 4H1TA 4W9MC 3QUAA 3RYCA 1JFSA 2ZRCA 3K35A 3PQ6A 5G41A 2YQ5A 1SZCA 3ND8A 4AO7A 3GJ4A 1EZ4A 1ZD1A 3HKBB 4Q34A 4U7TB 3SZRA 4A6XA 3C3CA 1OGJA 2W2OA 3ZVKA 1Y7PA 2PFSA 1K86A 3JQ9C 4IGIA 1V5FA 4YXWA 3URMA 4NICA 2HU8A 2VPPA 2C4TA 4M7OA 3WGTA 1L7QA 1OGYA 1ZP6A 4CTNA 1KSGA 2FP3A 1HXHA 4M1TA 3JQAA 1L5ZA 2DBYA 4DJDC 1PAUA 2CFTA 3GH3A 1WXWA 3K5IA 4DL9A 3U56A 1VRVA 4LZLA 3EZ2A 3QYAA 4BEWA 3K71B 2GJSA 3KPJA 3KB6A 4P86A 1Z68A 3PJDA 4LHZA 2AKAB 4D80A 1OBVA 1KQPA 2ZRHA 3D6FA 4BWGA 4C7OA 2PNFA 3VR2A 1R0LA 3DZBA 3T7TA 1UJ4A 3ZDQA 1V5GA 4NR0A 4I4LA 4LG1A 3W5CA 3R9XB 1N5KA 3ORFA 3G49A 2OYSA 3RYHB 1ZJWA 1IJKA 1MZPA 3ANNA 3JQAB 3WNBA 3ZWOA 1EXDA 4Z1MD 4A10A 4U7GA 4P3OA 5IWCA 1CYEA 1P60A 2VHQA 3V9PA 3EQ7A 3L7CA 2RGEA 4JWTA 1Z47A 1I7PA 2HWKA 5KNCD 4BZWA 3FB4A 3TCXB 3IPRA 3MG9A 3WLNA 1C3EA 3P7MA 1EP1B 5BNZA 1B0UA 2VQDA 3V48A 1M1UA 3ASVA 5HKOA 4PLVA 1WB9A 1CJTC 4MI9A 1DJNA 4LX8A 3NHSA 4FHFA 5GAJA 2X42A 2IYEA 1O97D 1Z6TA 4RIGA 1X7WB 1NSYA 3LO8A 1PG5A 2OQIA 1KSHA 2VJNA 3RAEC 4CCSA 2CMGA 3GLHB 3KYCB 1TEXA 4XVQA 1E2NA 1GSOA 3R3HA 2GZSA 4NG5A 3W2GA 2YYSA 3IUJA 1PVDA 3FA2A 1X1RA 4TTSA 4ZV4A 4M8NE 1RMQA 3R7NA 2DE0X 2I4RA 4C0SA 5CX4A 5EEHA 2IXTA 3CVOA 3ZE1B 1VLMA 2FX2A 5D1NA 4IL5A 3U09A 4Z4GA 2COKA 3BJRA 1IJEA 2VCYA 5GONA 1YV9A 1J07A 4YJ3A 4P5PA 1UZLA 2J3MA 4KLRA 5FNVA 2F3TA 5JVDF 3N0XA 1YCFA 1GOTA 1RWXA 1Z6PA 2EV9A 2R4TA 1YB1A 3O95A 1XXHB 1ZXXA 1H69A 1QPBA 3OHPA 3IKLA 1QKIA 4O4JA 4C7MA 4K3VA 5L4SA 2CHQA 5G0SA 1FIUA 1E4VA 3IAFA 2ZWPA 5C8XA 1LDGA 4D9BA 3S8YA 2ANBA 1AS2A 4ZAYA 3TQFA 4LTNA 4MWTA 2FDRA 1TZBA 3SYKA 3TSOA 3SICE 4UE6A 3B60A 4G5SA 1ZD9A 5FL3A 1ZIPA 3CVYA 2WE8A 1MB0A 4A6PA 5F9MA 1XD2B 1ISGA 3RCBA 3E7FA 3B13B 3RW9A 2AMLA 2IOFK 3GFPA 3WL6A 2A0KA 5IN4A 1V9LA 3KPUA 1AUVA 3NRJA 4FLFA 4CIDA 3FI9A 2CNBA 3E15A 2AL7A 3EBLA 2OGZA 2XQJA 3BGOS 3DMGA 4IDAA 4NEHB 521PA 3D6TB 2KW5A 5J2TF 1QZUA 2AR0A 2BONA 1I14A 5CT9A 1KGDA 3OP1A 4OG2A 4XIIA 4N01A 5FQOA 2D0DA 1YZVA 4B35A 4B46A 2B30A 1EK0A 2AOUA 4LDRA 4A1OA 4F71A 4ZQGA 2VAWA 1H2ZA 3DC7A 2AN5A 2VSFA 3KQWA 3R4CA 4B71A 4ENUA 5FBVB 1CZNA 5JH7F 2GFQA 4PNHA 4WNYA 2NO0A 2YHIB 4RSHA 3U6KA 1ML4A 3LYHA 5JZVA 2WICA 4G0NA 4IOKA 4DV6B 3G5TA 3A3OA 3JVEA 4E32A 4GKKB 1FFXB 3IUYA 4ZMBA 2P9YA 3F5FA 4JZKA 4L16A 2NU9B 3V7NA 1CXZA 1TU3A 3ZHSA 5JISA 1JAIA 3FVRA 2O8EB 1PEDA 3ADBA 1RI5A 2VDMB 3ZJUA 3U3ZA 4KWEA 3SZGA 1ORIA 5CAEB 4HVCA 2NUPA 3V1NA 3QHPA 2O5CA 1B73A 3ISTA 3KJFA 3L43A 4OSPA 4PX2A 1UFOA 5E9QA 3RRXA 3V2GA 3V2UA 1Z07A 2QMHA 4ACBA 1O6GA 3VR6D 5DWDA 1GPWB 1OZGA 4F3YA 1M9NA 2XX3A 3A6JA 3T9AA 4ZZ3A 1L8AA 4J2TA 1ZGCA 1PZFA 5CJJA 4MMZB 3ZGXA 3EVDA 2UXDB 3BB4A 3PU6A 1GG5A 3NNNA 4HG2A 1PX2A 3OQIA 4JDPA 4D9EA 3QE2A 3AHJA 4YV1A 2XNDD 5L9AA 1AK1A 2PE5A 4IILA 5LYJA 4ZK2A 1VQ1A 2WNIA 5ECYA 3W5AA 4ZHSA 4CLOA 5KSZA 2OR3A 4JD5A 1Y3DE 3ZDEA 5D3MA 4PBSA 4YUZA 2FPKA 1DT3A 2BUBA 1O3YA 1VYVA 1P9LA 5I9NA 1DBPA 2HDWA 4M88A 2H4WA 2D3WA 2OQRA 3UG6A 1P1RA 5I4BA 2F67A 1IQPA 1WV1A 3U4QB 3RNLA 3U19A 4C7KA 1HEYA 2GZAA 2C42A 4JX9A 3TIGA 3WJ7A 2OHJA 2R79A 3AETA 3H2IA 5LP1A 4J4HA 4OB6A 2Y1KA 5KJEA 1NQXA 5C32A 4KVZA 3O03A 2NAFA 4DLLA 2GK7A 4NYIQ 5KVSA 1PWZA 1OX5A 5AWFC 2H9IA 4C0AC 4NV0A 3T61A 5K6TA 5KYUB 2DHCA 2F9LA 3ZCXA 4CF6A 3TG8A 1XXLA 3F73A 1LJUA 3UKJA 1OB2A 3K0AA 2OO3A 3RJ9A 3A4YA 2W98A 3FKQA 4JQOA 4X1IB 5K3OA 5E7MA 2AX4A 2BFDB 1J70A 1MJGM 2VJCA 3BREA 3SC6A 4NV1A 1O6CA 3ZWCA 1LRKA 2EZ8A 4O02B 4P84A 1OILA 4L8YA 4MQ6A 1EM8B 4IV8A 4RPCA 4X7PA 3ZU3A 4P92A 1ZUIA 3K96A 1ESNA 4CI0B 4BNHA 1NM5C 2YIDA 4CEJB 3TR0A 4GM4A 3OZGA 3FNRA 2X4IA 4Z4FA 1BE1A 3PRYA 3DFUA 4A5SA 5B6JA 4N9QA 4UVEA 3KUKA 3Q3IA 4MGKR 2HA3A 2G36A 1FFGA 1GGMA 1I3CA 1MVLA 1TK3A 2GRUA 4W8OA 2FZLA 1FTNA 1VI2A 3FVWA 3TD6A 4U1RA 4FFDA 3D4OA 4XRRA 3WXBA 4Y9UA 1V95A 4DLTA 2D0IA 1E32A 3FVTA 3PKIA 1EXVA 3NMUF 1JDVA 1XZGA 4CKEB 2IYYA 2YJTD 1XAHA 3OG9A 5B3AA 1XKXA 1T8UA 1ZCZA 3DMFA 3VTAA 3TB4A 2WPDD 4Q4CA 5CDFE 3W5UA 2F6RA 3B9BA 1YDGA 4PC6A 4HY3A 2GBLA 5AVKA 4JSYA 4B3SB 3RAPR 1NMYA 1T35A 2HTEA 3AFGA 4K9PA 4ZA2A 4OLAA 5J43A 5FOXA 3RS8A 5SYNA 1DDGA 1FLDA 4NP6A 4OYHA 1UMCA 2XLBA 4BDTA 1KQNA 2D1SA 2UKDA 3QMWA 1X38A 4W8HA 4QNMA 4RZIA 4KXNA 3ZPXA 4BNZA 2VT6A 2EG9A 4H0NA 4PYQA 4RBNA 4DDKA 2WWFA 2IS1A 1GQSA 1CVRA 2NO4A 1QRDA 2VDWA 3MEQA 2R6FA 4GI7A 5IYZB 2NU8A 1DC7A 3IESA 4MUBA 1PTJC 1Z13A 2OCDA 4YJGB 4IDDA 1SAYA 1RE1A 1XUOA 3K4PA 4DSOA 4ZTUB 2WUFA 3RS9A 2E0IA 1GAXA 4MARA 2VNHA 2IP4A 2A33A 3DE3X 1QZ3A 3A7EA 4HNRA 1DJMA 1Z7YA 4NK5A 5AKEA 5DPMA 5E7IA 4UBJA 2EKLA 3VVBA 1JU9A 1EJ0A 1J2TA 1FNCA 1MB4A 1CR6A 1WL8A 1VLQA 1OTYA 4CCAA 2Q7XA 1RWKA 2CHGA 2Q3BA 1E2MA 1U0TA 3G6WA 4YLGA 4DR2B 5CFRA 4XM1A 3L6EA 3OLXA 4BVKA 3T7IA 4OHOA 3RABA 1VXRA 1E2KA 3BICA 3ZXXA 1OWMA 4WXMA 3GT4A 3AP3A 3VOSA 1KF0A 1RM0A 3DZDA 3MMZA 2ADOA 3KEOA 1OQAA 1GNVA 1Z38A 3GZNB 3LUAA 2HXYA 1YRWA 3ZIAA 1KFKB 2HRBA 4LDPA 1T6XA 3H0KA 4P0TA 1UC5B 3G2QA 3AXSA 4HB3A 1T1EA 5BQ3A 4CMHA 5TVKA 4DGSA 2OCKA 1NC1A 2QN2A 4IJUA 4RA9B 3UMCA 3INTA 2C3UA 1GLNA 4EFDA 4IH4A 3KQTA 2I3GA 3GEIA 2QD4A 3ZIUA 3WRYC 3BXFA 4HDRB 3OLQA 3RFVA 3CA8A 4D0LB 3JRWA 3G2PA 1QM5A 1JFLA 4KQEA 3WJAA 2J0VA 1MC1A 1JBEA 4LRSB 2BFEA 2MINB 3BDVA 4N3GA 2ZIEA 1JIJA 5LBIA 3HLKA 1FMTA 3CZ9A 3BB1A 3MTEA 3JY6A 4KH0A 3PXDA 3I5XA 1GRQA 4FR0A 2NV2B 4WD3A 1IVSA 2Q4RA 1N2IA 4CV0A 5LXTA 5E4FA 1E3TA 2Z58A 4U9HS 2PJDA 1XVTA 2DWPA 3AVXA 4EJSA 1FQOA 4Z3OA 4C0BA 5EZYB 1HBJA 1NKSA 1N0WA 1NRJB 2FPPB 2IELA 1J2UA 2MYNA 4GE3A 3WNVA 3MK31 2AI3A 2B2CA 5DSZA 3CPHA 1FU4A 5LDDC 2WJHA 1EFHA 4P3PA 3GWGA 1U8XX 1S2DA 3FG9A 3I09A 4Z8YA 5EMJA 1U0FA 2JA2A 4HD8A 4KN8A 3ZKWB 2J5QA 5AW9A 2Z3WA 1U7PA 2W2PA 1JTFA 3L1IA 4QUIA 2ROQA 3ANTA 4PS0A 2HZ7A 5ALEA 5BUQA 1Y1LA 3IODA 1WLSA 3HR8A 5JBNA 5LIRA 4MVJG 5B4TA 1RLOA 1KI9A 2AQKA 1KL7A 2PWZA 2YBEA 4TKLA 5CD9A 2QLTA 4DMGA 4MDYA 1UXKA 2A1UA 5KTMA 4V0SA 5KNLA 5FA5A 2YIMA 1B8VA 3AZPA 4BP3A 1I9GA 3PUIA 1EP2B 4JLPA 4E30A 2EYUA 3G88A 3N5CA 4I9NA 3OTWA 4U63A 1EHIA 2DUJA 1PS9A 1LC3A 2HL6A 2XGJA 3GJSA 5I48A 5DCLA 4ZVKA 5ALHA 5I7SA 2X2OA 2XCTB 1HSOA 3M83A 5KYUA 2IS2A 5DNAA 1DRUA 2QK4A 1V71A 2Z3ZA 3OJXA 2W00A 1VJ0A 2GNPA 3PXGA 3QEAZ 1HZZC 1IH8A 3VPCA 2WJ3A 3PYLA 4BRSA 1A9XA 4PG7A 3H11A 4DDTA 4OQQA 1EXMA 1T9GS 3H42B 4KN6A 2N42A 2ZQYA 4FE3A 2QM7A 2XYHA 4ZVPA 4YRDA 3T12A 1MMFB 3VZBA 1QFJA 2ZJFA 3SCZA 3DTNA 3H1FA 4CT5A 4QHTA 3GCZA 2PWAA 4NZYA 3RKSA 2PJRA 3PPVA 3ICOA 2B92A 3VUEA 1U4OA 4H18A 1ADJA 4GIBA 1ODSA 2QQGA 3SNKA 1Y34E 3AI2A 4C7JA 1CP2A 2BH2A 1AF7A 3BRCA 4YV2A 3IIMA 2RI6A 2A9PA 4M83A 3IUQA 2XT0A 3MGBA 4PGHA 4BL5A 4Q18A 5EAIA 4MR8B 4ND7A 2FWPA 3LPAA 4H59A 4A2QA 3QEMB 3CZPA 3I64A 4KQ2A 4MVJH 5KTKA 3LKVA 2CUZA 4GBED 5K6RA 2IYVA 3EEBA 3EIUA 5KYNA 1YDEA 2C2KA 3FOWA 1FSPA 1W59A 2MSEB 4IV5A 2WZCA 3HRHA 1LNSA 2AN1A 3OFVA 3N2GB 1JLLB 2CVPA 2M32A 1SG6A 1CNFA 2NO7A 2Q6TA 5DGCA 1T6BY 3HUUA 1AZTA 3X1JA 3N6RA 2FW6A 2VF2A 4PWZA 2R1VB 4GD3Q 1XF9A 2TSYB 3AM4A 3PYMA 4MIYA 4MVJP 1DWPA 2IHZA 4Q5IA 2R6DA 2BPOA 2HRRA 5GONF 1XE3A 2DFKB 3SS8A 3QX3A 1CR2A 2IY7A 4JNCA 4I4TB 3GLQA 4ECEA 3KBBA 4LWZA 1O58A 4ITRC 3ZHOA 4G1EB 1EK5A 1F2VA 3LUGA 4OXNA 1CEYA 2XB6A 2HEGA 5BR8B 1ID8A 1A69A 3RVQA 3VPDA 1F4VA 4DM4A 1UJ5A 3A0UA 4QDOA 1A3CA 4HS4A 4CL8A 2PSSA 4BIMA 1CJSA 4L9RA 1TM2A 4IIYA 2AIRA 2ZCUA 4BUCA 4IFEA 1KJJA 1OVMA 3KPVA 1BD3A 1DBWA 1X80B 1N1GA 5C80A 3IXQA 4J0GA 4N5IX 2VUUA 1JKXA 2OBMA 1W0KD 3BWEA 1JIKA 2HA0A 4MS3A 1ZOPA 2IEBA 3JYHA 4C4RA 4E3ZA 2GJKA 1YVUA 3EEOA 2DR2A 5F1PA 3OWHA 1IXZA 1K4MA 4XPIB 2BEWA 1XD2A 1Z37A 3RK1A 2XYGA 1TCAA 3RLIA 1GLVA 2QL7A 1W0JA 2DUUA 2X0IA 1FTSA 3PKJA 5AK6A 5AKYA 3U4GA 5AI4A 5ALRA 2XB9A 2G40A 5AIBA 5BWCA 3SJZA 1HDEA 4N03A 5IEJA 1WLYA 4PO8A 2OBXA 3QWFA 4RH0A 3IIEA 4X0EA 1UWLA 4YAWA 2VHCA 4L5YA 1PYGA 3HFRA 3W4KA 1QIIA 4TYNA 4O3FA 4IQGA 4Y9SA 4B6RA 4M1SA 4YJ2A 4TL8A 1KZYC 2X5KO 2AOUB 4CLHA 1QFZA 2C1EA 5CA0B 2WKPA 3GEGA 1CUFA 4QM7A 5F2NA 1QMGA 1ZAKA 1T0UA 2F1RA 4C4AA 2IJGX 3THWA 2VP4A 4A0SA 3M89A 4F6RB 4J9UE 4F97A 4YQYA 1NYTA 2PT7A 3TPCA 1N2OA 3V97A 2N75A 3H87A 1U0HC 3HS3A 1GV1A 5DBHX 2BAGA 5B1DA 1MC8A 3CT4A 3UGQA 5F7OA 5ES4B 1BC5A 1KAHA 1FNSA 3COVA 1Q1GA 3DBRA 4B2LA 4GPD1 5KNCH 1MOPA 4FYIA 2I8LA 2Y05A 1I6MA 1VJDA 3BKWA 1Y4AE 2HPZA 4MYTA 4PLHA 4Q02A 3GARA 5K0LA 4MSUA 1Q95A 4R8MA 5C51B 2YY7A 3LPMA 2QN1A 3ZXUB 3NTLA 4G84A 3L04A 5J5AA 1PJ3A 1SURA 1MRZA 3V1TC 2BKEA 1W0JD 1TGYA 1A82A 1KE1A 2XMQA 4XLLA 5AXDA 1ZIYA 2JIZD 3MTIA 1TT5A 3N2KB 4YI3A 1AS0A 3GDWA 3WBJA 2HA5A 5BOSA 4QM6A 2X8BA 2ATXA 4LGYA 2DVMA 2BFNA 1PT7A 5HK8A 5D3QA 3UANA 4BMDA 1DKOA 1GGNA 2HV8A 2Z6UA 1VECA 4WL0A 3WFIA 3O9ZA 3CXUA 3D3WA 1VPVA 3CRZA 5EE3A 3ZLUA 5CB8A 2CJXA 4XIGS 1QX4A 5LB2A 1BMQA 2BFCA 3LBHA 1MF7A 3RI3A 4CTMA 1OF1A 3B1WA 3OU6A 4KDRA 2J7KA 3R9XA 1BA3A 3PPXA 4BX2A 1WCXA 4PQEA 1AQ6A 2C9MA 2ZANA 4HSGA 4WFQA 5HFJA 5TT0A 5A04A 3DP9A 2I8AA 4DR5B 1CVIA 5FR2A 2ZB3A 5KCMA 2JFGA 2ODEA 1HI9A 1RNLA 3CF2A 2FR8C 2PGAA 3L2OB 4G0XA 3FLBA 2XT9A 4AMVA 5IC4A 3C1AA 4ZVTA 3UJDA 1PF7E 3QPBA 4Q9DA 4QQFA 2IHVA 1NDQA 3HSSA 3IJ5A 3IT3A 3P2YA 2Z1DA 3EQ6A 1YVDA 1XRLA 5FULA 1ZD5A 3HP7A 4J0KA 1L7OA 3GFRA 2Q0XA 4MA4A 5ENVA 1HNZB 1YA8A 4DTIA 1R6BX 2PNJA 1LA2A 5LLSA 3KU4A 4L9AA 3OC6A 1T15A 4HLQB 4L0MA 5PNTA 4AN1A 3HNPA 3SHOA 1XP8A 1FEZA 5CHYA 3ZDXB 2QRNA 3HB0A 3H9CA 1WHTA 4J1SA 1WQ3A 4JJ8A 3ZV3A 5JSUA 3KJXA 4O2AA 4NE2A 1ORRA 5A9SB 2PK3A 2L69A 1W5AA 3KYCA 3NC0C 1JJ7A 4NNOA 2A5LA 2ZRLA 1MVNA 4UVHA 5CEFA 4AKIA 1VBNA 5BURA 2ZYTX 1W4ZA 2P2GA 2H8GA 3I4FA 3PKZA 1PYDA 2NQ2C 4PANA 1GU1A 2E21A 3CRNA 1EGVB 4BO3A 4DDUA 1MJGA 3BYZA 3DLPX 3TKYA 3MIIA 2GFHA 4W1PA 1OH8A 1CEQA 3AM5A 4FNOA 4R8LA 5C4IA 4DMFA 3TZ6A 3I61A 3DZFA 4FGUA 1VIYA 1KVSA 3FD8A 2BKLA 1JHPA 2NNWB 2VQ3A 3L0OA 4TT8A 4XLTA 1N1MA 3AESA 2XRFA 4WLEA 3AR3A 4UDYX 5IDYA 4YDSA 4RD6A 2MMGA 1YQ9A 4H7EA 3K09C 1PRYA 1OYWA 2P9CA 3Q87B 1W8IA 2XUFA 3GRRA 1W88A 4HNSA 4NDAA 3W7BA 1B3BA 1JQKA 3DAFA 4YAJA 5E8JA 3UOWA 2IEDA 1I13A 5H16A 1QYIA 2WI8A 2NU6B 3GZJA 3LDHA 3VAYA 5KYXB 1V43A 2YOFA 5KVAA 1UQTA 3QIVA 4KQ1A 2C4VA 4UHCA 2PDAA 4WE3A 2MSWA 4C6HA 2GK6A 2GHIA 4P33A 1O77A 3PVCA 1AGXA 1IL0A 2PWYA 4E5KA 2P2LA 1WB5A 3KOXA 3QLVA 4NJEA 1DGQA 2VNSA 4D74A 3UK6A 1MO2A 3VHQA 3KJQA 4ND4A 4EA8A 2VBIA 5EZYF 2Q5OA 3ADKA 4FHCA 5EZSA 4D44A 2WUGA 3DLBA 2IZ5A 3CXRA 3W2TA 2QAIA 5G0WA 2VTEA 3UK7A 4RLHA 1W5SA 1FJ2A 2HSZA 4B0PA 3WK9A 1M83A 3MHPA 4RA6A 4WY5A 1EJBA 1V3TA 1GPJA 1SY7A 3RUHA 1X15A 4A26A 4DPKA 1X3LA 3R0IA 2ZCVA 3U7QB 1DFIA 1TYBE 1YF3A 2PL3A 3IAEA 1J56A 1T8SA 2DPGA 2LW7A 4TL6A 4ZI5A 3VJLA 3AEZA 4KIGA 1ATIA 3CLUC 1GGKA 1R2QA 4DGQA 4K9RA 3ELWA 5DFAA 5J40A 1OLOA 2ET6A 3EDRA 1SCBA 2GYUA 1R0ZA 1CUSA 3E3MA 3FZYA 3EPKA 5FQNA 4EECA 2MCFA 2WT4A 4QUHA 2QTNA 4P6VF 4ZHQB 5IFKA 3E7PA 3PWSA 2C4WA 4PIVA 1RRVA 4XYLA 1OI3A 3ZCTA 3BCSA 5DCUA 2MSNA 1EWYA 2VPTA 4F4UA 5JI3E 2AEEA 2NU7B 1DWQA 5FI5A 4S24A 1Z74A 1SHUX 2M9MA 3DFIA 2W6ZA 5CM8B 3HYCA 1SD5A 2GBCA 1WXQA 1N8SA 1WMAA 2SICE 3LCRA 3OTGA 2X0EA 4D9KA 3ZGZA 4MW0A 1VE9A 3RC7A 4E5DA 3BRWA 3E53A 3WLFA 1QF6A 2O8BB 1KYIA 2AW5A 3FYUB 5I7UA 2CVOA 3AT1A 5DSTA 1SU8A 1U6IA 1PSDA 1QDUA 1Z7GA 4DSUA 4D8VA 4KXQA 5B53A 2IYRA 2ZULA 5EUQB 1U81A 2XMDA 3LBFA 4FS3A 3TCKA 3I32A 1DKPA 2DHQA 2HDNB 4PHTA 3GPBA 4RYLA 1AKRA 1EEXB 4W82A 2YWEA 2M6SA 1A96A 3FETA 3LYLA 3DCIA 5C34B 4K1LA 1KO1A 1EJ2A 3VPBA 1V26A 2EZ4A 4BE4A 3LOUA 5FTLA 2V0NA 1IPFA 1CD5A 1R64A 5ENDA 1E1DA 2OZLB 5T4FA 5DNYB 4M36A 2FPIA 2RCYA 3COJA 4K8OA 3U9LA 3C48A 3S1LA 1Z4MA 5DASA 4Y1FA 4C22A 2F48A 2YZGA 4QECA 3QVVA 3RNOA 4A0GA 5JFTA 5LKRA 3KZCA 5IDXA 3WGUA 2FQWA 3V8RA 3V4ZA 3OBBA 1QP7A 2HCTA 1T26A 4C0KA 3AL0C 1RHJA 1MO4A 1DRVA 3IP5A 3L0ZA 4H08A 3LBYA 4G0MA 5E0KB 1IMOA 1US8A 2QGZA 1FMJA 4H7HA 1OFUX 2ZIZA 3INNA 1TUBB 2IYLD 1DBRA 4CM9A 3BK2A 1E2UA 3HWWA 3SIPA 1GPMA 2X41A 4GOXA 1AX9A 1RP1A 1ODTC 3RTBA 5KZMB 1F1JA 1XK6A 3A1DA 3ZE7A 1K4KA 2QM8A 1QHGA 4URXR 5K0TA 3K0AB 3W8EA 1CZKA 1IN1A 4YRZA 2YJ5A 4PPNA 5EJFA 2AJ8A 3A9WA 4X6XA 1NOIA 4OI4A 4AN4A 3KWMA 3ZZ1A 3ZWPA 4YV0A 2HWWA 5LQCA 1YB2A 1C1XB 3BJIC 3MMPA 4XQ0A 3ZK8A 4DR1B 3W3AD 1ZM2A 3IHKA 1UMBA 3A58B 4B2IA 4D3DA 2JDIA 4D4MA 1AN9A 1MB9A 4M0UA 2YJ6A 4RCZA 1NMSA 3NTRA 3SFTA 4DZZA 4G1MB 1ADGA 1LK5A 3LDFA 3V8QA 3FTNA 3T99A 3N1UA 3HHEA 1XGKA 3A1SA 1PGNA 3RIMA 3SOPA 4Q7LA 3B6EA 2CNNA 3HSYA 3E22B 4ZJPA 4E46A 2FXIA 2ZI7A 3KNZA 4K9OA 4NCKA 3ZHBA 4QGFA 3GEEA 1G66A 1NUAA 4M7PA 2AK3A 4EYSA 4GRDA 3OWXA 2X7JA 3CEPB 5CVDA 2JLQA 5ALXA 4KQGA 1X3SA 2MT9A 4E5VA 2ZDGA 3GLSA 3ZNPA 4JSTA 1HYEA 4LPKA 1NNEA 1VYUA 3GF4A 2ZBDA 1W5FA 4FZJA 3UEOA 5LZ9A 6ABPA 1BVHA 1XQ6A 1AZSC 1T6YA 1JS1X 3UT5A 3F6BX 1TB4A 4MIOA 3STHA 2B8JA 2X4DA 2H2DA 2YMMA 4EENA 2VYND 1YCHA 4DR3B 3O8BA 4D5GA 1HLDA 1PZNA 2ENUA 5K0CA 4WECA 2HA7A 5FLKA 4QQKA 3EC1A 2BI4A 1BU5A 4CKYA 5CAEA 2C7VA 2UZ1A 1NFQA 1QIFA 1RQPA 2L2QA 2EZ9A 2FQQA 4BY9E 3SOZA 3GRUA 4NBUA 1R5BA 3ITEA 3TAXA 1PCXA 1CRZA 2LVBA 1N5MA 2EARA 3ZDYB 1Z6GA 3ZNOA 3RGGA 4Y7DA 4HWPA 4JLWA 1ZSNA 5HP4A 3NU1A 1TMKA 3DTVD 1XMQB 1MC4A 3LUDA 2HXGA 1BGXT 3M2PA 3TI7A 5LYJF 3VU9B 3IVCA 4L4UA