2MYPA

An arsenate reductase in the phosphate binding state
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin arsenate reductase
publication title A Hybrid Mechanism for the Synechocystis Arsenate Reductase Revealed by Structural Snapshots during Arsenate Reduction.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Oxidoreductase
total genus 47
structure length 131
sequence length 131
ec nomenclature ec 1.20.4.1: Arsenate reductase (glutaredoxin).
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mypA00
3K9CA 2MYUA 4Z0NA 3LUHA 3TD9A 4Z9BA 3A0RB 4LE0A 2FKAA 5KI6A 2N9UA 4XARA 5JNVA 4GPAA 3LOPA 2WJAA 2RJNA 5ABPA 1NTRA 1IIBA 2B1JA 2JVJA 3HZHA 3Q7TA 3HXMA 1TJYA 3DLBA 3KS9A 2VK2A 4GNRA 4MS3A 4E7PA 3NNSA 3HJFA 4G0OA 4MS3B 2L17A 3H1GA 3GYBA 2QZJA 1YMUA 3LUJA 4UHJA 1DBQA 2Q5CA 4N0PA 4Z99A 2WB4A 3MF4A 4YO7A 3ILHA 4QICA 3DBIA 3CTPA 3T38A 2YHBA 2FLWA 4NCBA 1QKKA 4TLLB 3TB6A 1F51E 1ZGZA 5KC8A 1D5WA 1DP4A 2L19A 2JVIA 3I5AA 1JHZA 2OENG 5CNKA 5TPZA 3RVOA 4RY8A 1W25A 2A9PA 2PJUA 4PEVA 3OMWA 4HNSA 3T8YA 1E2BA 2PAFA 3HM9A 4HNRA 3URMA 4UHKA 2CHFA 2AYZA 2GBPA 1E6LA 1SRRA 1BVHA 3C3KA 1PEYA 1ISSA 1JFVA 3G85A 1P2FA 1USGA 3QLVA 3OQNA 4RK1A 4RK5A 4JB2A 5IULC 1U8TA 3N6VA 3Q7RA 4RK0A 3EGCA 1EAYA 2FVYA 1MB0A 3RVMA 3E61A 3EULA 3KYJB 4KPYA 2RJOA 3ROFA 2MYTA 4RY0A 4IILA 1ZITA 4KVFA 7ABPA 1DCMA 1AB5A 5CNJA 3JVDA 4NQRA 1QMPA 2ZAYA 3GBPA 1KRXA 3HS3A 1ZN2A 3NHZA 5FBHA 1F4VA 3RVKA 4EYOA 2YHAA 3IP9A 1NXSA 1EFAA 3H5VA 2WJWA 1M2EA 1YK1A 2MSWA 5KWSA 2P9HA 4Q7EA 3T6KA 5FWXA 4YCSA 1Z17A 3KHTA 1DZ3A 1JDPA 5HM6A 5DLEA 5IBQA 2CD7A 4RXMA 2PKXA 4MQFB 1GCGA 1DBWA 2H3HA 3QLUC 3GWGA 4Z4HA 4KQ9A 2ID9A 4D6XA 2W42A 4EGSA 3JVIA 4XASA 4KZKA 1PNTA 2XDYA 1BAPA 3NHMA 2PL1A 1JWLA 1QP4A 3TMYA 2X7XA 2WY2D 2KYRA 4EY3A 3OMXA 3CNBA 3NNDA 3OQOA 4IGAA 4MGEA 3O1HB 2PUBA 1TVMA 1MAVA 2FMKA 5JNWA 3KLOA 3LUDA 4LZLA 4JA2A 1GLGA 4MR9A 2GWRA 4EVSA 3SQNA 1DC7A 1SD5A 1M2FA 1SXIA 5F64A 3DZDA 3BRQA 1NY5A 1YK0A 4HNQA 1E6MA 1JX6A 4JAVC 1BDHA 5BQ3A 3HO1A 2P4UA 4OBBA 1ABEA 3JS5A 4MS4A 4F11A 1T34A 5JS2A 1EWVA 4RKRA 3CG4A 1W9HA 3EODA 4EYQA 3H1FA 4MR8A 2E4XA 1NXTA 2A9QA 4F06A 4P98A 3CKMA 1K68A 3OO1A 5BRJA 1JYEA 3MM4A 3I45A 4G0QA 3UKJA 2F8SA 4Z4IA 3QLVC 2AYXA 3Q41A 2QSJA 1VPWA 2QVGA 4YV7A 1NXVA 4MYRA 4YS6A 5T7BA 3B2NA 1QNLA 3OQMA 3CZCA 1Z16A 4ZMRA 2L18A 5JNSA 3C3WA 2VUHB 3RVLA 3UUGA 5IC5A 3HVRA 1H9CA 4KK3A 1M5UA 2NT4A 2NZVG 4ML3A 4OG2A 2E4VA 4MRMB 2FEWB 1NXWA 4H60A 4W5RA 2BGGA 4YLEA 2LUOA 1ZESA 4RZSA 3I42A 5HKOA 1L5ZA 5T3YA 3F6CA 4NICA 4WT7A 1ZVVA 4MQEA 4RK6A 5E3JA 1DCFA 4XFKA 4ETIA 1GUDA 3N53A 4G0YA 3FFTA 1A2OA 3GV0A 4G0ZA 4JP1A 4MQFA 3M9XA 1SXHA 2RGYA 2LP4Y 4RY9A 2HSGA 1ZHHA 3QLTA 4IMIB 4EUKA 5TQ2A 5IEBA 4EYGA 4DN6A 3D8UA 3EJWA 4RWEA 4Z4CA 4G0MA 1CYEA 3MQ4A 4EYKA 2NUBA 3CS3A 1ZY2A 2DRIA 1RZRD 3A0UA 4KREA 1U2PA 5KC9A 3QEKA 4L85A 1D4ZA 3QLUA 1OXKB 1CHNA 3CFYA 3JPWA 4OLBA 1MVOA 2E4YA 4W5OA 3SY8A 2QV0A 1DBPA 3CZ5A 3FDFA 5DTEA 4JB0A 3LKBA 1VRVA 4N0QA 5FWYA 1D1QA 2JBAB 4Z9AA 2IYNA 1MIHA 1RXIA 1FFWA 4F3TA 2MSLA 2QXYA 2PUCA 1C0EA 4W5QA 2LPMA 2A9RA 2E4ZA 4RK7A 3JTEA 1XWWA 2PL9A 3TX6A 3CG0A 3IP7A 5IEJA 5HSGA 3KKEA 4YWHA 4KRFA 3N8IA 4FE7A 3N0XA 4MR9B 1FFGA 1DC8A 1PUXA 3KSMA 3N0WA 4MPTA 1Z18A 4MAAA 4RV5A 6ABPA 2IPNA 4G0PA 1JFSA 3H6HA 2L2QA 3CU5A 1USIA 2MSKA 3LFTA 1Z15A 3C3MA 1DG9A 1ZH4A 4WUTA 2PE5A 2R47A 1LBIA 3L6UA 3RVNA 1I3CA 4KK4A 3F7NA 5EWLA 1VKRA 5B3JC 1KGSA 1BDIA 4OLAA 3LTEA 4M88A 4Y9TA 5B3JA 5C5EA 1FSPA 4RXTA 3D02A 3GRCA 1RZRA 3OLXA 1ISRA 3BRSA 1ZH2A 1QQAA 1CEYA 1LJUA 4E7OA 3H5LA 2FN9A 2VUIB 4MLCA 2GX6A 4CBVA 1M5TA 3GA5A 3LUAA 3EDCA 2PUFA 3RQIA 1Z13A 4LRQA 5TPWB 1YS6A 3N0RA 4IF4A 3KG2A 4OTZA 2R48A 3BREA 5DCLA 4Q6WA 1DRJA 5KQPA 3IPCA 3O2QB 3QX8A 3SG0A 1DRKA 3H75A 4TN5A 3QELB 1ABFA 3KYIB 4MR8B 4Q6BA 2FW0A 3JPYA 5FBKA 2PUDA 1JDNA 2MYNA 1U0SY 2FEKA 2M1ZA 4O1IA 4NCAA 2V0NA 4MS4B 4G97A 3W9SA 3OM0A 3OM1A 4WXMA 4MLDA 3GT7A 4RSMA 1Z12A 3R0JA 1L5YA 1TLFA 3L49A 2B4AA 3M9WA 2IDMA 2IKSA 1UDRA 2TMYA 3K4HA 3EQ2A 2HQOA 3O2SB 1QP0A 1YIOA 3Q7SA 1MB3A 2IPMA 3DGEC 1VLZA 3ROTA 1GUBA 3NNNA 5JNRA 3OO0A 1ZGGA 4YRZA 1ZAYA 2FSPA 1B00A 3IP5A 2OQRA 4G86A 4JOQA 5KQGA 3ILYA 3LUKA 3VNAA 4F8JA 5HQJA 2GI4A 2M98A 2QR3A 3LUCA 3NBMA 5EWJB 4B09A 3CHYA 5I4CA 3O1JC 2JB9A 4G0XA 3OLYA 1OXBB 5JNTA 4N03A 8ABPA 1LK0A 2CWDA 3QELA 1PNRA 4FB4A 2FQXA 4H3KB 2IOYA 3UK0A 2PLNA 5TPWA 5EWMB 1AB6A 5TQ0A 3KJXA 5CNIA 3QK7A 3FMVA 2FN8A 3VNBA 1KMIY 2NT3A 4TLMB 1KRWA 3HDVA 5C5CA 4OATA 1WETA 1U2QA 2HJ9A 4LX8A 1QPZA 3H6GA 3LUGA 2F8TA 4IRXA 4YP9A 5BRAA 3LMKA 5IUJC 5IUNC 4W5TA 2FEPA 3H5WA 4MR7B 3RVSA 4HYEA 4YGXB 1QO0D 5EWLB 2E4WA 3QEMA 3EQZA 1XHEA 3T95A 1Z2DA 3RVPA 4N76A 2IPAB 4ZPJA 5BR1A 2I6FA 5TE9A 2WMYA 3H5IA 3BILA 3HCWA 3HEBA 2JCGA 1JFTA 3HUUA 4DQDA 4RKQA 3LUFA 4WWHA 3OLVA 3O21A 2ID7A 4XLTA 9ABPA 1NATA 4QYMA 3RVRA 4YR7A 2GKGA 1YS7A 2H0AA 4Z4FA 4FE4A 5PNTA 3RVJA 1A0OA 5ED4A 4S04A 1JBEA 1R8JA 1NXXA 3SNKA 4D74A 1E6KA 1Y1LA 4F12A 2VYCA 1FFSA 4EVRA 3HDGA 1JH9A 1EHCA 4XXHA 3MIZA 2E4UA 3BBLA 5FWYB 2ZWMA 1U04A 3O2JA 1XHFA 3HSYA 4D6YA 2QW1A 2FTKE 4IMJB 4XAQA 2HQRA 1NXPA 2R4QA 1D1PA 4ZMSA 5DKFA 2JVKA 2FXIA 3QEMB 1DJMA 2PUEA 2PMCA 3A10A 1LJLA 4JASB 4MR7A 5GOTA 3F73A 3Q9SA 2PUGA 3KTOA 4Z4GA 4MS1B 1EWTA 3RVQA 3SAJA 2IPLA 3FFWA 6CHYA 1QO0A 1D2AA 1JL3A 3A3KA 1NXOA 2HQBA 3EAFA 3JY6A 4S05A 4Z4EA 3CLKA 5IX8A 4P1ZA 4PE5B 4RK4A 3O1IC 3HUTA 4O1HA 2FQWA 1P6QA 5TQ0B 5JNUA 1BA2A 1URPA 2LIVA 3M6MD 3OLWA 2A9OA 1S8NA 2NZUG 3MMNA 4MS1A 1YVUA 4QPJC 3C97A 2WWVD 3G1WA 4DADA 1Z25A 2JBAA 4H3HB 4RS3A 4WXEA 2FMHA 3HK2A 5TPZD 1USKA 4LDZA 3H1EA 5D2CA 4LE1A 4KV7A 2RDMA 1APBA 2R25B 3TO5A 4MQEB 1RPJA 3S99A 3KLNA 3Q15C 4WZZA 5EWJA 3GL9A 1PHRA 4N47A 1EWKA 3MYYA 1RXEA 4TMYA 5DGCA 2JRLA 3I09A 4RU1A 2HPHA 1HEYA 2JK1A 1YTUA 2J48A 4ETMA 1JF8A 4W5NA 5JS1A 2LBPA 4PZ0A 1LBHA 2WRZA 4NV3A 4KNYA 3P9YA 4KFCA 1J56A 1JLKA 4LE2A 5KQMA 3QX9A 4QYWA 3FGZA 5TQ2B 1K66A 1C4WA 1TM2A 1QQBA 3CRNA 3H5TA 1QP7A 4PICA 3SM9A 2FMIA 5IUKC 1P8AA 3HV2A 5TQJA 1PEAA 1TMYA 2FQYA 2QU7A 3IPAA 3LKVA 2FLKA 5GQSA 3IP6A 4ETNA 3IDOA 1JYFA 3MA0A 4ZYLA 4RXUA 3F6PA 2QVCA 2MYPA 1P6UA 3O74A 3H5OA 2O20A 4KMRA 3C6QA 3FFXA 4LDAA 1Z2EA 5KQLA 2PUAA 3OLZA 1FQWA 3DLHA 3O75A 4O5AA 4MRMA 1BDJA 3GBVA 1GCAA 2FMFA 4L4UA 3RH0A 4N41A 2CHEA 1RNLA 4ZJPA 1A04A 4RDCA 5CHYA 5FWXB 3DGFC 3KCNA 4EVQA 1YMVA 4KQCA 3E3MA 1DCKA 5EWMA 5CNMA 1SXGA 4PYRA 3N75A 1ZDMA 1Z26A
chains in the Genus database with same CATH superfamily
1JNYA 1P9LA 1U8EA 1CZOA 1I4OA 2R6FA 4IMRA 4M87A 4Z9BA 1J6UA 3UQZA 3MWEA 5TEWA 3W6NA 2XNCA 3OQPA 3GK3A 4P3PA 5HIAA 1K2VN 1NJSA 2XV1A 1KFKB 2PLWA 1DFGA 3NV9A 4YRDA 2BH9A 1V35A 2O3QA 2OCDA 1B3BA 5AYVA 3NNSA 1A8HA 1T6XA 2ON6A 3AUUA 4DM4A 3LUJA 2VLIA 3EVFA 4ENUA 2OXIA 1XRNA 3V4SA 2A86A 3LDFA 3B6JA 1BXKA 3JYPA 1Y7PA 3R77A 4BV2A 2YJNA 2QUJA 1O0SA 2VYFA 1WZ2A 2PFKA 4UE3S 1BU5A 3VR2D 4BBPA 1F51E 3VMMA 3BORA 1I51A 2VBCA 2L19A 2ZJ1A 3ZOZA 4BLTA 2Q41A 2XUIA 2BBTA 3R5KA 4XSHA 4IL5A 3VDRA 2XBMA 1L2TA 3E58A 4YAKA 1VE3A 4D9MA 3URMA 4NPCA 2GBPA 1O87A 2E37A 1G5PA 2I5PO 4U7HA 4ZCIA 2B8NA 2ZU0C 4FFOA 2CBXA 1VJCA 2IP2A 3E84A 2RGDA 2B1GA 3WAKA 2I7CA 4IS2A 1FBNA 5JI3E 5IJ0B 1BN6A 1E2IA 3U7RA 5JH7F 3L7CA 4HGQA 4OMFG 3MRXA 4FN4A 5JRZA 2EFDB 3MUNA 3B2EA 3TN7A 4BJ6A 5DCYA 2GEDA 1O9HA 3N7AA 1JHMA 3AUAA 3KWFA 2OM2A 2B94A 4F2DA 3HA5A 4XSGA 2VUSA 1PR5A 1C0PA 5AKZA 3CUTA 3D7MA 4ZK6A 1W30A 4LC0A 1VLJA 5AK5A 4LHWA 3L4BC 4KE9A 1E7RA 1P7WA 4JLBA 2VS1A 1H42A 3ICPA 1W36B 2JIQA 1JHOA 1YR8A 2XMGA 2Z30A 3MGCA 3QU5A 1HQCA 1KK3A 1WRBA 2N46A 4IWXA 3KHTA 1DZ3A 4LY3A 4TS3A 3CW2A 3QUAA 3QG1A 4S1TA 5HKLA 2GJ8A 1PJLA 4GVPA 3LPNA 2J0EA 5LMUB 1EP1B 1W85A 2FPWA 3AJRA 2HU5A 3E0XA 1ADJA 3PTAA 1AVTA 4D6XA 5BOSB 2XVYA 1XCJA 4UU0A 3D7NA 1FSZA 1KRHA 1U3VA 3JWJA 2DY0A 3OPYB 1YA6A 4XGIA 1UBKS 4URWR 5HQ3B 1K6MA 3TE7A 3OKCA 3WYNA 3A3PA 3AFMA 3AFNA 3VVBA 4X66B 4AJHA 1Z83A 4G65A 3C7TA 3TQSA 3LDHA 1TAHA 2P3LA 3ICCA 3JQ7B 3JQAD 4PQYA 4REOA 3H4IA 3X1WA 2NU6B 5FYDA 3SOZA 3SX4A 4QKQA 1G59A 2RK3A 2RI6A 3G3EA 2BBWA 3C3BA 4NS4A 3UCFA 3VTKA 1CQJA 2V7EA 4ZOLF 1HETA 2RGBA 4CCAA 4JGBA 3PNVA 4LXGA 2DQSA 3UIEA 4EH1A 2GXUA 2Q3LA 1RWPA 5JU6A 2XUOA 3UG6A 1F7UA 2H5IA 1T2DA 4UNQA 3BRQA 5DXAA 3I62A 4B35A 3K5HA 1H2EA 4UEKA 3EVDA 4U6QA 5C9ZA 2TMKA 4KQJA 3LY7A 5FR1A 2VK1A 4W1RA 2Y66A 1RCTE 2Q62A 3ZW7A 1JX6A 2ZRHA 1DAPA 2XUAA 4E5VA 2Q7DA 2ZTSA 4BBAA 1PNOA 3CRW1 3HJTA 3SX0A 1GG9A 4OKNA 3TM4A 3E7WA 1T34A 3N3BC 2FG6C 1G5TA 1YA8A 2QQGA 5JS6A 4YJFB 4UMDA 4ND8A 2E4XA 4OP1A 4X95A 3DZKA 5C2JB 1EFVA 2B83A 4YAWA 4U2CA 4NOLA 4YJ3A 5D3ZA 4D25A 5ALVA 1DQNA 2NZWA 3OTOB 3LXRA 3KD2A 3RE1A 2WHQA 3FOFC 3I45A 2FP4A 1E77A 2XWQA 5A02A 3AY7A 2W2MA 3MIIA 1VJRA 3KQWA 1E3DA 3AL3A 2Z95A 5E6SB 4ALKA 5HOEA 1ADGA 1F6BA 1BW9B 4CMIB 1HTWA 2QD4A 3RAPR 2BEUA 5EIWA 2HL6A 2VA8A 3CZCA 4YJ2B 1DGQA 1H8HD 2XEDA 3ZXXA 4HG2A 4Q3NA 2J5QA 5MFZA 1T6ZA 5JJLA 3M3PA 3OHSX 4D8XA 1RYMA 1X39A 3LM8A 2XZPA 3SQDA 3H17A 1ZOPA 4MV1A 4HGZA 1PYDA 1B6TA 1O94C 1G66A 4RDIA 2IODA 2JHGA 2ZSJA 4RW0A 1SOVA 4MW0A 4PFJA 4ZQIA 1AJEA 2JZCA 1EFUA 2WIAA 4ECAA 4EIWA 3IESA 1YS1X 1GLVA 2P4QA 1GZDA 4RZQA 2FCAA 4QOHA 1ZM4A 2RC5A 1GUDA 1GUAA 1UBMS 3RJ9A 4E5DA 1EGHA 2PGLA 3FFTA 3LK6A 3TGWA 5B6PA 1L7RA 1RBZA 2C97A 1JHQA 1VKNA 4LNHA 3RS2A 4R7GA 3ZWCA 5BVGA 3GLFE 2QXTA 1ZMRA 5HUQA 2ZCUA 4YAGA 2X0DA 4Z3OA 3FYTA 4Q4JA 1D7OA 2VEOA 5FKJA 3IQZA 5BYKA 5L4SA 2QENA 3RFXA 2BRUC 1IY9A 1NX6A 3GRYA 4AN0A 1A9XA 4YI5A 1VIYA 2DGDA 2IEBA 3VAZA 1TZCA 4BLRA 4LGVA 3PGVA 4TKMA 4JYPA 3WNBA 2A1UA 4I1OA 4WY5A 4MCAA 4G5HA 4UZSA 2MOKA 4I9UA 4QUGA 5K51A 3ND6A 4LYGA 3E9NA 3GJ5A 3RU2A 4JP2A 4I4CA 1OXKB 2BE9A 5DVZA 4IVNA 2UDPA 1NBHA 3VZPA 2CVOA 4YDQA 4NMXB 4OB6A 4CE6A 2JHCA 3B1VA 5IC6A 2XOEA 1MPTA 4YRTA 2AK2A 2XDQB 2NSYA 1RABA 2AXQA 2REBA 4TSRA 4BC0A 1ND5A 2JPDA 4RVFA 2PM8A 3WBJA 1H2FA 1KIFA 2PG3A 2WNHA 4HWSA 1XX6A 5AKKA 1MX3A 2YIMA 1FFWA 3NJ4A 3BL8A 3RWBA 4HDKA 4C14A 4ENQA 1ZJZA 1Q3KA 3HKCA 4HNHA 2PL9A 3IQWA 4L75A 3BQMB 1LDMA 3DOHA 3AEZA 1HI9A 4JBNA 5LUBA 4K8RB 2QTAA 4JQOA 4EPVA 4Z54A 1ZJWA 1T0HB 3JQFC 3GEPA 4Q0MA 3WBBA 2OD7A 3BTOA 3EXAA 1SHLA 3IUBA 3KUUA 5C8YB 4G2NA 4RHCA 1YFKA 3OU7A 3OZAA 4PQFA 2WQZA 4PWYA 1N2EA 4Z8YA 3N2NA 4U2FA 3FMIA 3PPXA 3HACA 1A8QA 2L2QA 3BSFA 2R5WA 3GQBB 2XUJA 3OZGA 4HB3A 4JROA 5EIAA 5IMSA 5CJPA 5JD3A 4A8JB 5K99A 2PE5A 5A05A 5A5GA 3IMEA 2BKXA 5I4BA 4M9ZA 5DLQC 4YFYA 2HA2A 4IH1A 2XOKD 1KQOA 3WFJA 1EFCA 3ZZ0A 1O0CA 4AECA 1LWOA 1RZRA 1Q6YA 2FH5B 2EGUA 1HLDA 1IAQA 4YJGA 3ZCPA 3G79A 1T4MA 3KZNA 4R84A 3PXUA 1SD2A 2R8OA 4HP8A 3WJ7A 3WC4A 4TLBA 5J43A 5HFNA 4CBVA 1NJ6A 3FCUB 3X2FA 4AY2A 1EPUA 4FYYA 4TTIA 1Z13A 2XD4A 1CE8A 1DJQA 1HEIA 1KI8A 4IVPA 2R48A 4AMGA 3TUIC 1JIXA 2H52A 5DYTA 4FTWA 5EHIA 4C6SA 5A7GA 2O05A 2OC4A 5AO9A 1DQPA 1QHYA 3H11B 1GJRA 1PW7A 3SU8A 4BUCA 4OXYA 2X8JA 5AW5A 2C31A 2DPYA 5LYJB 4G9EA 8AT1A 1VFNA 1OIXA 4ZZ3A 3GG2A 4JSTA 5H1YA 5C34B 2G5TA 2HUNA 4BNLA 4C1BA 3ANNA 1QDEA 3CB4A 1LD3A 4RHUA 3K9HA 2PWBA 4YJDA 3GT7A 4AJ9A 4YC7A 2DEUA 1RJFA 1TLFA 5HS6A 2J0UB 5HJ2A 2IU3A 3TFQA 3ZC3A 4OMDA 3EZ7A 3G0DA 3O2SB 2W2PA 2G9NA 1BYIA 4D3YA 3TLGA 2WWHA 3FOWA 3WL5A 3WHLA 1OAAA 1JHDA 1B41A 1XVUA 2VA9A 4UCFA 4F21A 3FPHA 1SKUA 1B00A 2WJYA 4KNWA 4XGRA 5DRYA 3Q5GA 1KAGA 4CUKA 4JXXA 1Z5NA 4B34A 3IJRA 2OESA 5CAEA 5HF6A 4E12A 1HDZA 4CM4B 1NRXA 4NPHA 1E2UA 5LFAA 4DLVA 5JCXA 1GP2A 4O02B 4EG8A 5JEEA 2CLIB 1U8CB 3HYRA 3PC8A 4HNTA 1I30A 3PD7A 1WQ4A 3O3MB 3NDRA 2VP9A 2QTZA 3HJRA 3RW9A 1B93A 4IAOA 2XIJA 2W71A 2DH6A 1J0XO 1W88A 1EESA 1C1XB 2F9FA 2CNWA 3H2YA 4FR5A 1KYXA 3TDKA 1NNI1 3SBEA 3ESAA 3R0IA 3OESA 4EGCB 2UZ0A 1T5IA 2YS6A 3DYIA 3RROA 4H0NA 4LX8A 2R8RA 2JJ8A 1WETA 4EY5A 2BP7A 1DAMA 4HH1A 3LMKA 1IQPA 4KGXA 2OT3B 4X1IA 1R9MA 2WD7A 1J49A 1ODCA 2VSQA 1FW8A 1QO0D 3MINA 4UPDA 4IUCS 2NSDA 3BGWA 4BRSA 3CUSA 4JCCA 5D5HA 4UNRA 2VJMA 1X14A 3BE6A 3L18A 5E6UB 5EHGA 3W1VA 3SE7A 1FTSA 2VN8A 5HR5A 3NCTA 3AFIA 2PFGA 4C7BA 2AOUA 1XNRB 3S3TA 2ZRFA 1EK2A 1M8KA 1P7VA 3EPPA 3HVHA 2GASA 4WOBA 1IPHA 1U8YA 2VG8A 1T3GA 2ID7A 3QKTA 4Q00A 4ZZ2A 3T34A 1EK1A 1K5HA 3MTAA 4NG4A 4RYLA 1EUZA 2H0AA 4C5CA 1A5SB 1OVMA 2H1HA 4I3FA 1HL7A 2W9XA 3SNKA 2GN1A 4XZ3A 4D74A 4HI0E 4JBXA 4Q19A 4DM3A 2W2VA 2QZPA 2PV7A 1ZEMA 2XT6A 3PFKA 3IDFA 1UM9B 3DV0A 5BT8A 1OKKD 1EP2B 4H1VA 2B36A 4RD2A 4CKZA 4AKIA 3GP3A 2RAVA 5BQFA 4YQZA 5JALA 4HWTA 2VH2A 2D0PB 2ZT5A 1U04A 3QLJA 4OAPA 4CMHA 2Z2XA 2FFJA 3FVQA 3HSYA 4E30A 4CIYA 4DMCA 1G8PA 1WKBA 4OHRA 1JHPA 4Q9HA 3SN6A 4R8MA 3EVAA 5IM4A 5GM2A 5AKIA 3TH5A 3EGXA 3R0XA 3DDCA 3NB0A 2C5FA 4LGYA 1IN1A 3ERCA 1DO0A 1E7MA 2AW3A 4UNSA 3A6GA 2HZ7A 1PKXA 4RD4A 3ZK9A 3OAAD 3RVQA 4E2ZA 4G0UA 1NUQA 1DU4A 3I5YA 1WMEA 3AIKA 1JL3A 3CRZA 4IS3A 4QOJA 2OGUA 5CDUA 2PSFA 1KVSA 4NE9A 3EW9A 1V3VA 2VJNA 4PE5B 1L1FA 1OH8A 3O1IC 4TROA 4PSUA 2CFRA 3EA4A 4PY2A 4KYVA 2WWVD 2AT1A 3PXEA 4S04A 4O0LA 4AP9A 4PYLA 4NK5A 3ZKAA 2AG0A 2QTRA 1A27A 4OP2A 5CB8A 4JT8A 2BF4A 4F46A 3AY3A 1UIRA 1UAAA 4BN5A 3HB0A 3TLZA 4BCBA 5CYOA 1L7NA 2C9CA 2YV4A 3B1YA 2Y1GA 2HZBA 2B35A 2ZJ8A 5A4DA 4MCJA 3GL9A 4BVFA 3FUXA 4G1EB 1CNFA 4OXNA 1D03A 1LDGA 2R3SA 2PDAA 5DT9A 4L5CA 4OD0A 4PVCA 1B43A 2G08A 3CR8A 3ZS8A 3PLRA 2O8EB 4PLHA 2LBPA 4EL0A 4F92B 2ZBVA 4BQQA 1N0WA 2YWHA 2FFBA 4RMJA 2E1RA 3B36A 1E4EA 4QYWA 4EZEA 2NUAA 1BW9A 1TEVA 2OCKA 3LH5A 3MN1A 1QQ6A 4TKZA 4V1CA 3LQ2A 4E5SA 1P1IA 3B7WA 1P8AA 2BFCB 2HRDA 1G8JA 3G02A 3GRRA 1LI4A 2PSSA 4YCBA 4ITRC 3TZCA 1S1MA 1Z68A 3WDMA 2RG7A 2V7QD 1HYQA 3W1EA 1V26A 2QJWA 3UEOA 1BMTA 1R0YA 2MHCA 4QAQA 2D1RA 4DR4B 5IHPA 2EFJA 121PA 1XVTA 3C3JA 4PQRA 3RIEA 2AZDA 1KC3A 2IXAA 2FRDC 2X86A 3LLCA 4G5SA 3VR6A 3WDLA 1EIWA 3FPSA 1MH1A 4EKYA 3UWPA 5KTSA 3GLIA 3A32A 1MAAA 4BKRA 2WABA 1UFQA 1OYVA 3BTUA 3ZJTA 1DI0A 1NLFA 4JJAA 4LZOA 4DDUA 1Y3FE 2XYVA 1NM5A 4PRZA 3IOYA 1Z07A 1FY2A 2X3YA 1KI7A 1YB5A 4IP0A 5E2BA 2YJ3A 3NTQA 3AY0A 3EZ9A 3G7NA 3KDPA 5CLQA 5LZ2A 1S2MA 1G38A 3U4DA 5KDDA 4GUAA 4IZIA 1QYIA 3BXHA 2YV1A 3EK2A 3GR6A 3OX4A 4INAA 1KQPA 2AJBA 2FDRA 3QBTA 1NVEA 5CXXA 2FB9A 1NI4A 1NYRA 3LBIA 3A14A 2WJAA 1YJBA 1CLEA 4DREA 4JUDX 4GBJA 5I7UA 3AV0B 1XMOB 4XYMA 3ECSA 4V3BA 5K0JA 1AQNA 3UZUA 5AW2A 3I2IA 2AX4A 3VKGA 3C3DA 5E4FA 1E8MA 1ZJ4A 4MUBA 2PH1A 5JO0A 1YQ9A 2GSWA 1Q7CA 1WPRA 2L42A 2YVUA 4DR2B 4Q02A 3KR2A 4UTZA 5K0TA 3IIKA 1XQ6A 5BOSA 4JT9A 1I14A 2YHBA 3ADKA 1IUKA 2WZQA 4M8LA 4HDQB 4XJVA 5FNZA 1TK3A 3COWA 4GXNA 5CJJA 4LSMA 1O0BA 3GLGA 3INNA 3ESZA 3HB4X 1I80A 1RHQA 3HJGA 3IEPA 3G2LA 3ISJA 4DYVA 4R8LA 2WVJA 2Q4TA 1TPYA 3W05A 2VUUA 1Y82A 3T5DA 3W8DA 5GP1A 4Z4QA 2HHAA 1CZNA 4NIMA 4NFHA 2F3RA 1PJ4A 5HMMA 3STTA 2G9ZA 5F1PA 3ZHCA 1TJ3A 3DDSA 4DCJA 5L4NA 1MJFA 4XFDA 1P1RA 3FVVA 3ZCVA 1U6JA 3UHFA 4HB0A 2AQIA 3SIRA 1YTLA 3HCEA 4HS9A 4UU8A 2B92A 2P0YA 2Z5GA 4QPCA 4WESA 3T5CA 1OYYA 3I9V6 2WKSA 2B0CA 4QU5A 3QBJA 1SXPA 1HOXA 1EX9A 3AVQA 1NI3A 2WINI 1YF3A 2MYTA 2GQ0A 3AUYA 3O9ZA 4ARVA 1U28A 3OZRA 3P96A 1UADA 1CR2A 1KK2A 2KE5A 4JD5A 4TTJA 1A9TA 3VPXA 2LD4A 1F4VA 4J4BA 4N5DA 4C0KA 4UCXA 4GVLA 1GA1A 2MSWA 3QG5A 4R0NA 1RFLA 4H35A 2OZEA 5KUTA 4OH1A 4C4SA 3PZRA 4ZALA 1PWYE 3VDXA 2NP7A 3THSA 5FNVB 2ZS9A 3SR0A 3MEQA 2J8ZA 3RADC 1DBWA 5JATA 3WFIA 1SZDA 4B4OA 1GL9B 4TZ6A 2H07A 3AUTA 3N2KB 3EMDA 3RSQA 5K8LA 5F2KA 5CW1A 1JWLA 3VHQA 3TMYA 1SC3A 4NSNA 1Z73A 3KFXA 2KYRA 4FSHA 2D0DA 3C98A 2ZBGA 3T3OA 4L4SA 3ZV3A 4GP7A 1UJ6A 1U1CA 2VNHA 2YVQA 1W5TA 1VM6A 3IEKA 4MGEA 2GN4A 3R7AA 5B1IA 4KV9A 2IYPA 3IFSA 2CZCA 4D92A 3H3XA 3HUDA 3IUNA 3NIFB 4R5HA 1GDHA 3PBKA 4JH0A 1KBOA 1PGOA 3MWGA 4LSZA 4ZO4A 4E31A 1QRUA 4YJ3F 1GPJA 4PZYA 5IDVA 1TVCA 1XRJA 4RE6A 4RLFA 1K7CA 1K7FB 2AEJA 3F4BA 4OU4A 3KPVA 4M6WB 2HPVA 3P0JA 4PZZA 1M1YA 1DQYA 1U1GA 3FYUC 3AHEA 2UYCA 1A5TA 4K6KA 3QU9A 3FYCA 1IWOA 3UHOA 1N5LA 3A6KA 2DPLA 1FDRA 3AEQA 1JW9B 1G0NA 4LK2A 3EEIA 2C5GA 3E9EA 2OO7A 3D1VA 4Z0TA 4JLDA 1MDBA 2XA2A 5JS2A 5K01A 5IT0A 2D5LA 1HBJA 1ECPA 1R0KA 1QHFA 3ED5A 1X3SA 4LJ4A 4UE2A 5JSKA 1Y33E 1THGA 1S3GA 3G82C 3R3XA 5BWMA 5ICCA 2HNAA 5C46F 1QTRA 1LCIA 3F5QA 3UK2A 1C7RA 3M4YA 4G23A 1PNVA 4JQCA 4ONEA 3NIGB 2H85A 2AKAB 2WYWA 4OLHA 1TNDA 3MSCA 2W6IA 4B31A 2XCOA 4FZVA 4M9SA 1C9JA 1B15A 3AZOA 2P8JA 2CUKA 2HWKA 4H2DA 4A27A 3D0RA 2Z3VA 5CH5A 5K4GA 2H1RA 1V4VA 1L8XA 3DJYA 3G5MA 2QL6A 3MRSA 4DPKA 4KE7A 1I2ZA 4EVIA 4H15A 1QK5A 5IARA 3U09A 3V4LA 1RLOA 1Z6YA 1N6PA 1Y1SA 1Y9AA 2FEOA 1ZKDA 2QQEA 4LZWA 2A2ZA 1SBIA 2H7XA 2XGJA 1NR1A 3B3AA 3RLIA 1WVGA 2V54A 4D9KA 4DVGA 5JROA 3BMOA 4R7ZA 1C14A 2AOWA 4WBNB 2OAQ1 3EXHB 2OMEA 3HJBA 1G6OA 1PFUA 3BCUA 1OGIA 2JGFA 2JRCA 2V9ZA 3SHOA 2Y3IA 1AUXA 3JD2A 5JCOA 1VDMA 4MIEA 1OTHA 3QPBA 4WERA 4C2AA 4YDSA 4RY9A 5B2ZA 1KJZA 2ZSBA 3AOEA 2ZTUA 2VCYA 1GRCA 3EH2A 3H84A 1ACJA 2QRJA 3CSDA 4NZ9A 2A9VA 5D86A 4IMIB 1J2YA 1BE6A 3F9RA 4HX2A 3R8XA 4JJ4A 1KOLA 1YRWA 2VQFB 3AR2A 1S6YA 1ZA2A 4CL2A 3VDNB 1LLQA 1ZD5A 1H85A 2CEKA 2VF8A 4R98A 1SVWA 1XCGB 4NHOA 4JBIA 2H3EA 1X19A 4UW9A 3L0OA 5BWCA 3TCNA 4ND2A 1RW4A 4R1PA 4QSHA 1ISFA 1U2PA 4MW7A 3U3OA 1ZUHA 3K72B 5GVSA 4IIJA 2ZP1A 2A88A 3STYA 4CV1A 4DNXA 4EUEA 2VPYA 4EG0A 3NVKI 1UCFA 3CN9A 1Z29A 1LRJA 4E2FA 3I34X 3ONVA 4JI8B 2DF8A 2GSDA 5KB3A 5HP4A 3KVRA 3K5WA 1OE0A 2HF2A 3K6RA 4ECEA 5K8JB 1QBKC 1JLMA 4YEDA 1C30A 2YCBA 3CXRA 5G53C 4RA6B 1GCUA 1PSDA 3AY6A 3EUWA 4JJGA 2AJDA 2HCRA 4DV1B 4R41A 3U3RA 1WCV1 2QPAA 4QJ4A 1EVIA 1GUZA 3A4IA 3QHPA 4F9EA 2Y67A 3SQXA 5L9AA 2GZSA 3NDBB 2VSYA 2YIDA 1Z5VA 3GELA 4DLRA 2LCIA 1U81A 2ZSHA 1KPHA 1EFPA 3PWZA 3TIGA 1ISPA 4Y2HA 1AGYA 5KIAA 1RKQA 4X64B 1CCWA 5H4GA 5GV7A 5EIBD 3OEED 3H3JA 3KQHA 1KI6B 4TWIA 4YCLA 4MV5A 1AC5A 3WBFA 1KYWA 4KQ6A 2K4MA 4D0NA 1E18A 2CFSA 2IBTA 5KREA 1T26A 1U0JA 1YZHA 4Y0NA 2DJIA 1QRTA 3RV4A 2H4ZA 3H9QA 1WDKA 3HYNA 4OJMX 2D7DA 2FEMA 3F7NA 3ZLTA 1EGVB 3DTVA 2GEVA 2O07A 2PR7A 5G4LA 2X1LA 1Y42X 3G89A 1QIFA 2BTOA 4RXTA 1VXRA 4WKNA 1KP9A 2IOHA 2CB0A 3M1AA 4JP5A 3RO7A 1P19A 3DMHA 3TG2A 2BFNA 1GAXA 1DWQA 1V6CA 2ATCA 2GTIA 1ZM3A 2ODQA 1A4IA 3BJMA 2OPBA 3NHYA 4ESHA 1M5TA 3FETA 4HDMA 4WDQA 1QYCA 2IYFA 3TLXA 3KZOA 2DPXA 1LJ8A 4G89A 4JOSA 4DWVA 2DFPA 1WNTA 1RE1A 3C8DA 1GGEA 4PANA 4PLTA 5D8DA 3AF6A 1RRKA 2QLNA 1P4RA 5AKJA 4YRGA 1TRHA 3HY3A 1JPUA 4TN5A 1JPVA 4YBRA 1SBQA 3PCRB 2X4LA 3BXPA 1JUDA 1PX2A 2HMUA 2MYNA 3EISA 3OUUA 3T3GA 3FCOA 5AHOA 3NETA 4J29A 4AS1A 2DBQA 4OL9A 5KYYA 2QN7A 3ETLA 4LJ6A 3GLTA 3ZHZA 2Z58A 4DV0B 2HLDD 2HH9A 2IYLD 3R0JA 4IXMA 4UFOA 5JMOA 4G41A 1MLDA 4COOA 2FJPA 1RQPA 3ES9A 4BNXA 3MT8A 2IOQA 3K0AB 4MWSA 4R2IA 3R7WB 5JZOA 2YWEA 1SA0B 1VLZA 2O2IA 5A9SB 1RM5A 4E1AA 1L7PA 3PUKA 3I5XA 2WJHA 4G0WA 5AVSA 1O8CA 1KY3A 2YMMA 1R37A 1RRFA 1CUUA 2XE7A 3BDAA 3IEIA 3IQDB 2R79A 4UBNA 4KDFA 4AB1A 1JMVA 1Y1RA 4N8SA 4D41A 1USUA 3C0KA 4KX5A 4NBVA 4KPUA 5IABA 1EKXA 1J09A 3F6RA 4B09A 3E82A 1DTSA 2BCGY 4AO6A 1PZGA 4LNUB 2B1QA 4MTCA 1T4DA 2PYIA 4I4LA 4F9TA 3R76A 3KU4A 4A6EA 1ILWA 2QTMA 4F4DA 2RHTA 5BN1A 3SXPA 8ABPA 3ZCSA 1XCPA 1P5ZB 4OUKX 3ZDFA 1GNSA 1L8AA 3Q9NA 3UK0A 4LF7B 2WPNA 1GNTA 2C84A 3F2VA 3BXZA 5G0TA 1CZKA 4AICA 4ZKDA 2KWIA 2NV0A 5TQ0A 1P9OA 3A6EA 4KN5A 2BD0A 2DR3A 2OV2A 4KDEA 3R9XA 3EFHA 2YINC 3AESA 5K6TA 5AVJA 4URYR 4K6CA 3O83A 2GBFA 4GF5A 5KS2A 3VGPA 2A8YA 1VMKA 3ZHSA 3H97A 4HNAA 2B9EA 3G6KA 2SCUA 5BQPA 1LLDA 4V38A 2HDNB 2VZEA 2FJUA 3QUCA 3M6XA 4OQ4A 2NVUA 5CX4A 3WQBA 1IN6A 1EJ6A 2QNIA 2YZ7A 4RQUA 4UARA 2BMFA 5TVKA 3NDIA 1Z2DA 3W5VA 5FWAA 3TZKA 1BYUA 1XDGA 1NRJB 1PFKA 1UZLA 2Q5LA 3C2QA 3IOMA 4H6WA 3RVPA 3T9BA 4BLVA 4PC7A 1SXJA 4EY6A 4IDNA 3K16A 4OQZA 5EI5A 2OAGA 2GCIA 2XT0A 2XVZA 3PIIA 4NDNE 1MTZA 1IZ8A 5DBHX 2NWQA 5IBCA 4MKXA 2IIVA 5J1SB 4QXPA 5T4EA 3ZI7A 5KYTA 4UEJA 4WN9B 3WBKA 3JATB 1Y1LA 1TU3A 3F3MA 1ISJA 2FQ1A 4H27A 4KPGA 4F12A 3EQ9A 1FFSA 2SECE 4WH0A 1YKSA 4KQGA 1JIJA 3W2FA 1MA0A 2R2AA 3MJVA 4MW6A 5DWQA 2E4UA 5C7IO 4MYCA 1HT0A 2R5FA 4QDKA 2JD1A 1JV2B 2E6KA 3U6BA 3EGDB 4YUXA 4B5KA 3SHFA 4YQFA 2G7ZA 1S9DA 2FMXA 5BNIA 3PUVA 2VHYA 2GZ3A 2FFAA 1HF3A 1KO7A 1TD1A 1P4SA 5E6UA 3PKIA 5G3YA 1D1PA 4J3NA 2B34A 4ZMSA 2ZUBA 1VE9A 4U2EA 4YT5A 5FBZA 1Y8CA 4PCUA 2HFKA 3DBRB 1HEUA 2PUEA 4K9MA 4WK6A 1XVVA 3IURA 2YXNA 1E9SA 1LF0A 4D44A 3KHSA 1VHLA 5FBQB 3ELYA 3B6EA 3EVGA 2BP7B 3MLAA 4TSFD 5FB3A 1QO0A 3EZYA 5FIUA 3L1JA 3VMFA 1B1CA 4XVRA 5EAIA 5H7XA 2IYTA 4Q4CA 3BHMA 2EW2A 1XQXA 3AKYA 4YMLA 4BNNA 3G2OA 2QDXA 1AKWA 1W9MA 4R2JA 2Y1FA 1A95A 4ZCSA 5TT1A 2O1XA 3OLWA 3T7TA 3GVIA 3R3WA 1N3LA 2A9OA 2NZUG 2QSZA 1VYUA 4GKVA 4WHMA 2BZ1A 4C04A 3OQIA 2WTUA 1WDMA 4OLFA 4H3HB 4GEGA 4BGIA 4M38A 3WKEA 5EJ6A 1IVYA 1LDYA 1A76A 3ZQ4A 4HPJB 3T9CA 2CJPA 1E1NA 4TZ0A 4MQEB 5KU7A 2NTNA 3L77A 1X1SA 3ELDA 4CPDA 1KAHA 4J7XA 1Z0JA 1KDPA 2YRFA 3N28A 2DPHA 3A8TA 4J90A 4YRQA 1JSZA 2Y77A 2JRLA 3FTNA 1SUSA 2JGRA 3CLUD 3NVMB 2XODA 3HC7A 4JEUA 5T64A 3A6LA 1F9EA 2DJ5A 4PNEA 5L3QB 3IP3A 2V7WA 1UXGA 1SCJA 1VECA 3I1JA 1YTUA 2RFLA 5TF0A 1EQUA 1TYAE 1JF8A 2GBIA 2ZT6A 3AR6A 4FBLA 3HA7A 4RH1A 5BSRA 3T3IA 1NW4A 4UUQA 5D87A 3R8FA 3OHPA 1V8FA 3QFSA 3BGIA 1WABA 3V55A 4M7PA 1GTRA 2C4TA 3QUQA 3ADCA 1VI5A 2BHLA 2A3RA 3DVAA 3FXAA 4OQLA 1XD8A 1KR5A 3FB1A 4U7FA 3SM9A 3V80A 2AVDA 4D56A 5CXQA 9GPBA 3O2NA 1TMYA 1IULA 1K4YA 2H1SA 2LDXA 2GEJA 2FLKA 1JLSA 1CJTC 2AG6A 2Q4RA 1ZNWA 1UXJA 3G8CA 5DOVA 3L07A 4JWKA 4G8DA 4OQEA 4BFWA 3QJYA 1H8ED 2Q27A 3P2YA 1OREA 4HFRA 4YXWA 621PA 3WK7A 4XIYA 1LPOA 3M3DA 3PD0A 1I4EB 1I33A 1U2DC 3GRZA 5D3KA 3QPWA 3OURA 1ESEA 4PBSA 1E2PA 1TEXA 1PFVA 3UANA 4B7CA 1XZLA 2CYAA 4C05A 5JISA 4WCDA 3ZCTA 3G0CA 3DZIA 2JGLA 2XAAA 4RDHA 2PUAA 3OLZA 1Y9ZA 4MIOA 1PT9A 3F49S 3R9WA 2Q49A 4QUHA 3RRNA 3DD5A 3MZ0A 3CX7A 1RXVA 1TZJA 4B0PA 3FKQA 4N41A 2H4YA 4HZUB 4EA9A 2O8CB 4J94A 1RQ7A 1DT3A 3T3DA 1DHTA 5K2MA 1BA3A 4OL0A 1PYGA 3STUA 3HXQA 3AEUA 1T2UA 4E32A 1YMVA 4A1OA 4N9QA 1RYFA 4D3ZA 3ANYB 4L3WA 1NNSA 1ODJA 3OCWA 4LE0A 1ZD1A 2FKAA 4X61A 3BZBA 2VHQA 4Q9AA 4YP7A 1YDEA 2FLVA 1MTOA 1P1KA 1W76A 2G36A 2JVJA 3EN0A 2G3YA 1OIWA 2DTDA 3ILXA 2JZOA 3OZVA 3WL8A 3RAEC 4MPDA 4UD2A 2WKQA 4IJ5A 1JDVA 3OICA 5EUMA 4URVR 3OEWA 2RHCA 3L7MA 4PC6A 2ONYA 2P9YA 4LNUA 4YO7A 2XGMA 4LVOA 1DOHA 5B5SA 1WD7A 3OY2A 2NSLA 5LJIA 4RTSA 4NCBA 3V9AA 4B6SA 3JAMA 1FZTA 3RRFA 2W37A 4F6RA 3PC3A 4TS1A 2F1KA 3FVTA 4PX9A 4DUZB 1W25A 1Z08A 1ZWKA 4BV9A 4EKGA 3S8EA 3QNWA 1SM4A 3ZU2A 1E1LA 4RIEA 3QSYA 2ZBRA 4L74A 1P4JA 2DFDA 4HNRA 1LPBB 2M2IA 3R0VA 3AHHA 1UBTS 5EE9A 2RB4A 3HB7A 1OZHA 1ZUNB 1G19A 2BW0A 2A84A 5CYFA 1SUBA 2ONCA 3QLVA 4PYKA 1Q1BA 4YXFA 2O2CA 5F1YA 5IULC 3L8HA 4KYIB 3EXFA 2RBGA 1A9RA 1U7DA 3Q7IA 3I1FA 3E35A 2F64A 3MBOA 1UDBA 1ACLA 4HAUA 1NNUA 2IPOA 4KPYA 1QGZA 1CJBA 1Y80A 1P31A 2A1UB 1V8ZA 3ZYCA 4EB6B 4P32A 4Q9NA 4QG7A 2YRXA 3O8LA 4ZVVA 5DHFA 5F5NA 2QQ5A 1NQVA 3DXYA 3GBPA 1COWA 1KRXA 2QT9A 3FA2A 4MDEA 1SVNA 3CKKA 1KHHA 1E8NA 2WHXA 3IP9A 4IHKA 4QTUB 5DX8A 4N7BA 4I1SA 2IVZA 4BFLA 3OJEA 5J58A 1UKEA 5HK8A 1VDZA 4RAOA 2B4RO 4NU8X 1Z17A 4KFTA 2Q6LA 4H18A 5CT4A 4ZDJA 4IKOA 4MV9A 5DLEA 3O31A 4TKLA 5I7EA 2C20A 4Y7DA 3CZ9A 2WT9A 3MXOA 2HT6A 3PG5A 4KLCA 2ID9A 2O3RA 2PD3A 1PNTA 3G2QA 2BH2A 2NXEA 4HZGA 1ZCFA 1UFRA 3PX7A 1XLTA 4ZO9A 4F8YA 3FAZA 3JSAA 4M1MA 3H0EA 4N8DA 3SLGA 4FFVA 1J97A 1TX4B 4WASA 3NAZA 4NKRA 3OQOA 3DB2A 1IK4A 3GVXA 3PYXA 2XSZA 4KDRA 4OUDB 3TZ6A 3CF4A 5KNCD 2GETA 3LW8A 2GJAA 4CU5A 1KP3A 1YFJA 1EFPB 4OXKA 3LRTA 4C4PA 1N5OX 4DV5B 4H31A 16PKA 3P9CA 4PC3A 2GWRA 3GLKA 1F6DA 3Q10A 4EVSA 5C7OO 3D3WB 4IQ4A 1ZIOA 4U6SA 1C7ZA 5DP1A 2HMAA 1V47A 1BDMA 4B6JA 5IAAA 2D5CA 1RZVA 4M0KA 2G0NA 3KM0A 3T52A 3JYQA 4YJFA 5JUWA 1ODKA 2P4UA 3S1AA 5EIXA 1ABEA 3O0TA 1T24A 2Q0QA 2IW1A 2R7NA 1BXGA 1GNVA 2JFYA 3OZFA 4OBEA 1KZ6A 3D3NA 4Q66C 1XZBA 1NZFA 1Y8RB 4MQ6A 1LPNA 3C1UA 4NOMA 4EYQA 1TYZA 2WIFA 3STHA 4Y6GB 4BV8A 1U0FA 2G1KA 3ELBA 1U3CA 4DTCA 4EJ2A 3AHDA 3U1VA 2WVGA 4MVJE 3B3JA 3MJSA 4FLMA 3BSWA 4O4HB 4OXIA 4AG5A 5IC4A 4US1R 3ELWA 1E7YA 3JVEA 5JYDA 3A1UA 3D81A 4P58A 1SKYB 2R68A 3C1AA 5BR4A 1I7NA 1OT5A 2ZETA 3CEHA 1ZXXA 4ER5A 2LKDA 2OAEA 1F0NA 3KUCA 4EG5A 1GDDA 2J9ZB 3E4DA 2PL3A 2L18A 1GTG1 2WF5A 3T3MB 1UZNA 4Q3DA 5CGQB 3T5GA 4CLDA 5K8IA 4XA8A 4MVYA 5JXHA 1H6CA 3A1VA 2GDZA 2AN4A 5F12A 3ITNA 3K2BA 2R2GA 3AKEA 1JEEA 4BO3A 2A0KA 4WL0A 1I7SB 3UOAB 1G4HA 1L5ZA 1L7AA 4WNCA 1FVXA 1UWCA 2FPMA 2VKTA 5T3YA 3TNFA 1GILA 1FJXA 2IHNA 4WBNA 1E9BA 5DSXA 1ZI6A 3V2UA 4KGZA 5EKSA 3QOXA 4JL5A 1JP7A 4L0DA 5JTUA 2PGDA 2DYKA 2EYUA 1Z4NA 2O2GA 1IY8A 1KGDA 2WHEA 3GV0A 1W85B 3HY4A 2P5YA 3AU9A 4PZAA 5AM5A 2X40A 1Y3BE 3ENWA 4ZEWA 5BSMA 2BJVA 1ZCBA 2J46A 3AR9A 2QRGA 3WK8A 2EF1A 2ZSKA 2PAAA 1JDUA 4UU7A 3WO0A 4DV6B 3ZEIA 2FPLA 1CRQA 2JIBA 3EOZA 2IYWA 4IFEA 4LF5B 3RRBA 2WAXA 3NV7A 5AVYA 1T9GR 2EIHA 3NTXA 4RL6A 4BEWA 3P0EA 4Z4CA 3SCZA 5IDWA 4G0MA 4IO0A 1CYEA 4EMSA 1GXSA 1VHJA 4Y9RA 1M0SA 1CUGA 2CCKA 4CMJA 2CE7A 3H3FA 3PEUA 2YV5A 4LRUA 4P5PA 4MI3A 2HBRA 2VFAA 4L85A 4MV0A 5ALPA 2O19A 2NZYA 3SXUA 3AFGA 2QUBA 3GFSA 4KBGA 5I01A 3USCS 2ATXA 2RGNA 4ID9A 1CUZA 1GYPA 1V9LA 1YE8A 1TM3E 2GTHA 3HKDA 4RVDA 1K27A 1F20A 1L4NA 1X7HA 5D85A 2GZ1A 5JAPA 1T25A 5DNWA 3TW0A 4DTIA 5FUMA 2QM7A 4HK4A 2B3DA 4Q3BA 3HPRA 4M6WA 5F52A 4ZTUB 2PMDA 4FIDA 4O4IB 3RABA 2W2NA 1DZIA 3BCRA 3ESYA 3NWEA 5E2IA 5EG5A 2QN9A 3SFVA 3X43A 5IKMA 4OXRA 4WA7A 5TS2A 5J4HA 1EM8A 1OBCA 2G63A 3IP7A 4QRIA 3ZGXA 3VSEA 4HFMA 5EINA 4Y67A 3LDUA 1G8YA 1DWPA 5AH0A 5GJVC 1UXIA 3KKQA 3NRCA 5JO9A 3Q88A 1MGPA 3KB1A 5SYNA 3V2IA 5AW7A 3U6KA 4AIIA 2O8NA 4L4XA 4GMHA 2FZ4A 4UTXA 4GI2A 4J7CA 4WZAB 3RR2A 1TQ4A 3B60A 4YJ2F 3T9DA 3IDZA 1OSNA 2FG7C 3CT4A 9LDBA 1AXEA 4K88A 2CLKB 2XA1A 4J6FA 5EYPB 4G25A 4PLVA 4NH0A 1USIA 1DQRA 1PR2A 3DP9A 2JEYA 5K4AA 3N2KA 3B5IA 4BNDA 1RKVA 4IO1A 3IHLA 3ROKA 2M1XA 4JLPA 1IU9A 4BMZA 2SNIE 4ZI7A 2A7QA 2JH9A 2P75A 3IQFA 5C5EA 1RRGA 3UXYA 1IRIA 1SUAA 4IDDA 2TRSB 1LX7A 5LN1A 2IYVA 2XMDA 2ERXA 4F97A 4NP6A 1PS9A 5FP0A 1ZXBA 2YXPX 4GGOA 1Q7RA 5CA0A 3T7SA 2B5VA 4TT3D 1Z75A 2PN1A 3IVAA 3RSFA 3VGJA 4DWJA 1NBMD 4F3CA 2H2HA 2B1RA 4OJKA 2I7TA 1DX9A 3DXZA 3QIAA 4M1EA 5E7IA 2FPUA 1YZLA 1WXEA 1QH0A 4P5DA 3KC2A 3BREA 4M37A 3DMFA 5L3ZA 3G2MA 3QY9A 1S1CA 2CLEB 4G36A 4O0MA 4OSEA 4OYLA 2JGMA 2RIRA 4RVNA 4YBZA 3WIOA 4BKUA 1K5GA 3QELB 4JL8A 4K7JA 2BMAA 3OOJA 4ZODA 2DUWA 1VFPA 3BD6A 3GNQA 4KXYA 1U9CA 4RQAA 5CVTA 3F4LA 2PU7A 1FEZA 5EP1A 5ERGB 1ZZGA 4XLZA 3VOBA 1DBIA 2OKCA 3AF1A 3BWBA 1NG9A 4MWTA 4OB8A 4X97A 3OM1A 5I48A 1MNAA 3VVCA 2CXXA 3PPWA 4QG3A 4PINA 3IAXA 4AKTA 1SXJD 2ACKA 4L4ZA 4Z9YA 3W5HA 1KKLA 1HE4A 3PQ6A 5ERXA 1ODIA 3F7MA 1L9XA 3K4HA 3KZKA 3O7MA 3S28A 2NN3C 4RX1A 4NCHA 3DGEC 1XK7A 2WMNB 1QB7A 1L3BA 4Q16A 3BXXA 2WI8A 3A2NA 3DLPX 1HMPA 3EMBA 4X84A 4QTXA 3DZHA 3BWMA 3NYIA 4DUGD 3IDSA 5JEDA 4ND8B 3EG9B 2PX3A 3LUKA 3VXKA 2I66A 4C0BA 2NZXA 4RLSA 3GVHA 1S2NA 1HE8B 4ILKA 4KLZA 4GSYA 3SJ7A 2HQSA 5FPYA 4DDMA 2XQKA 1UZUA 3DBLB 1CZHA 3FPEA 2WU3A 3IR7A 3O1JC 3U48A 5BMVF 2Q8PA 2YCLA 2ZI3A 3ETJA 1PCXA 4FUQA 4W5HA 1PNRA 3SEAA 2AJCA 2IYXA 3EGWA 3TNYA 3UICA 5JYEA 3LLUA 1OA0A 1X1CA 3FPBA 3H5NA 3KOOA 4DQKA 4JB3A 3FNGA 1XAHA 4DKXA 1WXHA 2F3QA 2XE8A 4BMDA 1R4NA 4BE4A 4I14A 5IVPA 4QXOA 5JWOA 2VDWB 5L6MB 2RH8A 5ALGA 1D2GA 1KJQA 4TLMB 5DHTA 3U16A 4U2GA 2ZR7A 5I8ZA 2DFTA 5EZSA 1ZBQA 4QTYA 4MUNA 2YZ2A 3OH8A 3I76A 1E4OA 4JGIA 1JSRA 4P4SA 4EY7A 4H1HA 5ICGA 4CIDA 1Y3CE 1I3MA 2YHSA 5JWRA 4AMYA 3QVGB 2E4WA 4C5BA 3F97A 4I1VA 3K1TA 5TLSA 2JFFA 2VAXA 3BDVA 1PUIA 3IKLA 2VO1A 2XMRA 2R6R1 3C5HA 3OCXA 1NTOA 3OKAA 3TLMA 5BR1A 4H7HA 2UAGA 1PD0A 2ZT8A 2H2AA 1NNEA 1JAYA 1G8SA 1HLGA 3ZHBA 1UJ4A 3HVUA 1WHTB 4G8CA 1CEXA 4LCJA 3S1SA 4MAFA 4KO8A 3ZJ5A 5E95A 5ELMA 5PNTA 3JARA 2Q4BA 2W7TA 3A3YA 3JVUA 4A03A 4IV0A 4B4WA 5KDOA 5JAZA 1AXRA 4DE5A 1FRNA 2BN4A 1GPH1 1NUAA 1P0FA 5G41A 4AZ3A 3PEWA 4V1CB 1FB5A 2RK4A 3AXSA 3GX1A 3H2IA 1BS2A 1V7QA 1R5BA 3UJCA 5HYVA 3FE2A 1JVNA 3MWFA 3DA8A 4UNPA 2PQ0A 1KTVA 3K31A 1SKMA 1FXSA 2R85A 1G16A 3UENA 3E9YA 1F38A 2ODAA 3KHUA 1YDHA 4FR2A 1KQ3A 4H7IA 2FTKE 1HDXA 1GOTA 4IMJB 2BGRA 4J91A 1ZH8A 4JITA 5FI1B 2EQ5A 5AQEA 1EK6A 2HJSA 3ZEAA 3LL7A 2VSXA 5LVAA 3Q8XB 1K63A 3GLSA 1G1AA 1F2TB 1N6LA 1YJ8A 1SKYE 2WOOA 3O3NB 1NMXA 4P92A 4BZWA 4AWXA 4M1KA 5LA6F 4C87A 2F67A 3OJWA 4WOKA 1IVSA 4KQWA 3FM9A 3ZE1B 1CKEA 4I5IA 2VT6A 4HH3C 3TIXB 2PMWB 1H8HA 3FFWA 3PV0A 4Y6SA 4FGZA 4PIVA 2FW9A 2ZIUB 2FCRA 1Q20A 3BB3A 2ZUDA 3OFSA 5IZCC 3FCEA 1WIWA 1BA2A 3L1UA 1DJMA 4O29A 1OZFA 3VO9A 3PJRA 3QE4A 1S0UA 4XM1A 2F55A 1M6VB 1VSVA 4WXEA 1CP3A 3IKJA 3C39A 5DM2A 4Y2QA 4DSNA 4B3BA 4H7EA 4LE1A 4NZMA 1V7ZA 1WS6A 1ZUWA 2X6QA 3QFFA 1APBA 1G7RA 2Q9AA 2CB9A 3T94A 3T7RA 3W4IA 1J8VA 1WP4A 3LG2A 4YRBA 4ZI3A 4MQMA 1WXIA 3L4EA 3N74A 3ER8A 3N07A 2PEYA 5B1HA 1NBWB 3RYCB 1U0GA 4V0SA 4UZEA 3AT1A 2G25A 3WGIA 2D1TA 2DVMA 3GJ8A 1N9KA 4RKYA 1RWNA 1LLCA 3L0ZA 2GF9A 4OIMA 2O7VA 4P53A 4BNJA 4FQ5A 5KQMA 1G2QA 2W2KB 2WKPA 5I7VA 1K3TA 3A6DA 1BN7A 1UM9A 2QORA 3IYLW 2WU4A 1CEQA 2YYZA 4MW4A 1YZQA 2FEAA 1NE7A 1NVTA 1PG5A 2ZEJA 4G5XA 5AIAA 4DL9A 5JMWA 2OCGA 3OJXA 1Z6GA 4X60A 3PQ2A 5FA8A 1A8PA 1WZIA 3U40A 4BFVA 4ENRA 1RQLA 2AC7A 1SU8A 2VJDA 1U4NA 3B89A 3CLVA 2H11A 1J8FA 1O97C 2WK1A 4BLUA 2EBWA 4QYSA 2Y9PB 1XB2A 1AG9A 1NQAO 4XDGA 4ZOQI 2JD0A 3TZEA 3RYFB 3REFA 2XQJA 3N8KA 5A5FA 1ZVMA 3K7EA 3MMSA 4FMPA 3DCYA 3O4IA 4I50F 4RWZA 4KP7A 3H18A 3IP1A 3Q12A 1XWFA 4EA6A 5B36A 2PS3A 2HR1A 3DLAA 4YONB 1YDFA 4EG1A 4RZ2A 1TUEA 1YR1A 3PHHA 1PGNA 1I6WA 4I8DA 1AQYA 4HDSB 3UOWA 3KCNA 1Q3TA 2VHZA 3MRVA 2GZHA 4QQFA 4UEOA 4BU0A 3FPJA 2RHJA 2WYUA 1JNXX 2BFDB 4OU5A 2UUAB 1M10A 1T2EA 5HF9A 5JBIA 2OXTA 2I1LA 2P0EA 3HZRA 1C1XA 1W47A 4MZXA 2YJGA 3RHZA 4RVHA 1JKJB 3GF4A 1QRSA 1Y34E 2OY0A 4KXLA 5HIIA 2PLFA 2XIQA 4PZLA 4XR4A 1JIKA 1G9XA 2VZ0A 4E7PA 3U80A 1BX0A 1WPQA 1YMUA 4AZ0B 4EMBA 2C54A 1P6XA 2I2BA 3L4SO 4LMAA 2PUHA 2ORED 3CZMA 3K9BA 1YQUA 4TV9F 1V7CA 5GWXA 1D2MA 1GR1A 5J5VA 1O96A 4E88A 3CTPA 5IM5A 1L1QA 1R50A 2FLWA 4ZOEA 5CAEB 5FFFA 3E9CA 3KUKA 5KDLA 3E9ZA 1BXRA 3ZQUA 2BFDA 2UVPA 1JMKC 1I4DD 2CLLB 2ZXFA 4NNPA 1ZCZA 4CHTA 5CT6A 1GIAA 4HS4A 1LPAB 3FDIA 3MWJA 3PCTA 2GD6A 4C4AA 2PJUA 5B3LA 1T9DA 2HBYA 1S2OA 4MARA 2QNRA 1JS1X 2BRUA 2WM2A 4MK4A 2X2EA 5FTJA 1BXRB 4QULA 1RXUA 4DJEC 2OM6A 3RJMA 4OGWA 5KHAA 2QR2A 9ATCA 4P86A 4FYPA 5JNLA 3N2ZB 3V7WA 1OYWA 3TNLA 3D6NB 3QF7A 3SPXA 1NVWQ 1NVDA 2Q7OE 3HCAA 4EYSA 3GDOA 1JKMA 2BC9A 2X8JB 2EW1A 4KN8A 3L7LA 3WP0A 2DSNA 4CR6A 4RFSB 4PFKA 1AA6A 4Z49A 2NYUA 1DCMA 3QP9A 3KQNA 1QMPA 2ZJZA 5BURA 2NQTA 2KBEA 1ECFA 1BNCA 1M1XB 2IELA 1BFKA 2O2ZA 2JFOA 3L02A 4EYOA 3BPSA 5G02A 1NR5A 4EHJA 1SJ9A 2EHJA 4K9QA 4ENTA 2W2KA 5HX7A 4Q7EA 4XQ9A 4DLTA 4HD8A 1VCOA 4AYXA 4YCSA 1F1BA 1Z7EA 1RLIA 2CFTA 3Q3VA 5YASA 4BNYA 3DDZX 3NX4A 1NPYA 1U0RA 1TKCA 2C2BA 3CONA 4UAVA 3S29A 1C50A 2FN3A 3GWGA 1PE0A 1JG4A 3V8MA 3TGLA 4UNNA 5HNKA 1WR8A 2HJHA 2OBMA 1KL7A 3B1WA 3H8JA 3JVIA 2VR1A 3NWPA 2F2TA 3D4BA 3QMPA 1MIOA 4KACA 5FHRA 5EJ7A 2WY2D 4FZJA 5TPWB 4DG5A 5CK4A 5E0OA 2R11A 4DNPA 5KNCH 4M0DA 4FEYA 5DGHA 1BRTA 1I5EA 5EPUA 4BMXA 1E89A 2UKDA 4NCXA 2OYSA 5L3SB 3AU8A 1GDTA 2HDHA 4MV4A 4H1UA 1W1WA 3NOXA 1GTSA 4C7MA 2BFFB 2YFQA 3KBBA 3OZIA 4FWTA 4CIBA 1K4MA 3M1LA 2IH2A 3FNFA 1QF6A 2SKDA 1GLGA 1NLMA 1XJ5A 3I8OA 4EW1A 5ER9A 1OASA 3MAAC 4E14A 5IDXA 5IWAB 3BG5A 2QD2A 3T4UA 3TS1A 4HLDA 4WBNF 2G5PA 4D9FA 2H31A 2HNBA 1V9CA 3LI2A 1UZMA 4ZWNA 4HAYA 3BWXA 4LC1A 3DE3X 4TL7A 1SZJG 3CF0A 1RADA 3PIDA 2DH5A 3TD2A 4V24A 3EHDA 4MGYR 4X44A 4P81A 3WADA 4CL3A 2HY7A 1BDHA 1MD9A 4BVJA 4L50A 1FQKA 4OBBA 1XUOA 1FW6A 1F2TA 4JIMA 3G2KA 4DUYB 3FI9A 3RARA 2H5LA 1WV0A 3KEFA 3VU9B 4CKBB 2OO3A 2B99A 5T4FA 2PUJA 4MI1A 3M6IA 3A9CA 1HE2A 1VPLA 5LIPA 5FRDA 2QUZA 2A9QA 4F06A 4Z5XA 2DHDA 4P98A 1N5KA 1KIAA 4JX8A 4J3JA 4L2IA 3T12A 4CXMA 3UJNA 3WI7A 4F4FA 3VR5H 4QDOA 1CUDA 2QVGA 4L6IA 5DGDA 1FUIA 1DRWA 3B2NA 3GJXC 3IAHA 3W2TA 4PN7A 1VLQA 1U7HA 4BGVA 1A9XB 3UC5A 4ZVNA 2IIQA 2DLDA 1ISIA 4F5YA 2E1PA 4ZZIA 2NU7A 3C5EA 2NZVG 2J9YB 1SFRA 4NV1A 1N7IA 2JAWA 5CIWA 4C4ZA 4MRMB 1WHTA 3CLTD 3ZDXB 2QRPA 4X8OA 4DYDA 4WZBA 4XUEA 1LSSA 1HGXA 1R9JA 3JYHA 5C53B 2RK6A 1JDZA 2MINB 1PRYA 4M99A 3IVCA 4YO8A 4QUDA 4FW9A 4RK6A 5DK6A 4GOOD 1DCFA 5E3JA 1MC1A 1JDJA 4BUZA 1EWQA 1VPDA 2VOJA 2W43A 1A2OA 3NT4A 3PP8A 4G0YA 4P38A 4UAJA 4EHIA 3M9XA 3AX6A 3IE0A 3FF1A 1W44A 4J4TA 1SULA 5B2FA 2IEIA 4GOXA 1QUFA 1ZPDA 2AMYA 2GN9A 4N6OA 4RQBA 2VQDA 3B9RA 2XDAA 3AF0A 3WLMA 4AURA 4EA7A 1V48A 4X3PA 5DPMA 1DKPA 2OXRA 3GNTA 3LSTA 5TQ2A 3UT0A 4MWEA 5IEBA 1SOWA 1XE3A 3KPWA 5U1PA 4A6DA 4CMIA 3AETA 1R4NB 5FOTA 5LDHA 4U00A 3BEDA 3CO0S 1Q22A 3U62A 3LGXA 1CY7A 2DWUA 1WEKA 1FU7A 3M3HA 4HEA1 5D1HA 1ZSVA 3TJRA 4DEXA 4OHPA 2WG0A 2ZIGA 5EJ4A 1B23P 1X87A 2RIPA 2BUCA 3DBLA 3ZUGA 1EXDA 1I2AA 3GJ7A 1UK7A 1BCSA 5TT0A 5AUOB 4YUVA 1XEWY 2A5JA 1VPEA 4I4NA 5AESA 3VH3A 1ZOOA 1KDRA 2ZI9A 4ZHQB 1JU3A 3I64A 2FSIA 1KSJA 1LVHA 1NJGA 1YGPA 3EG5A 5FUBA 3ST7A 2DQ4A 5DM1A 1Y6JA 4ANFA 1U4SA 4JEHA 5DNEA 5KTPA 1DKMA 4G5RA 4KKVA 4DJDC 3D7SA 2BMWA 2HYDA 1CQJB 3P8ZA 4FC6A 4C76A 4YAUA 2ZJ0A 4XUGB 4CUJA 1YJ5A 3FHJA 3ZE0B 3LBNA 3ETEA 2QWXA 4FILA 4MKZA 5HMLA 2IKQA 2VDOB 4HTFA 4ZT7A 1JFLA 3ESBA 3IELA 2ZGVA 2W70A 1LKZA 3PF8A 4KQ2A 2G4LA 3DOFA 1TQDA 2OGSA 2B5OA 3KUXA 4ZAXA 1UFOA 3LHSA 1WO8A 5K05A 3CZAA 4Q1FA 1K8QA 2FUG6 5HOQA 5LQKA 2NMVA 3D0QA 3HKEA 4LXTA 4TPKA 2TMDA 2UU9B 2P3QA 3N2EA 2FW7A 2V3VA 2ZWAA 4KIUA 1XA3A 1AK9A 1VKRA 2P65A 4W6QA 1FL9A 4Y98A 1N8TA 3M70A 3TYXA 1BDIA 2BDUA 5B3JA 3AR4A 4GD3Q 1FFXA 1Z82A 2CNKA 2FPXA 2J9FB 4N7RA 4XTRA 3WTBA 1MEJA 4EJSC 3W6PA 3LRXA 2V9CA 4CQMD 2OLEA 2PEZA 1SQ6A 1VE1A 2PQMA 2ZAIA 1UWKA 3DVSX 4JLVA 5F23A 3PKJA 2QHXA 3Q3JB 1XN1A 3MMZA 4GRDA 4MMZB 4BDSA 3KZCA 4MMXB 1P33A 1J25A 4CF3A 2PUFA 3N6RA 2P77A 4RL4A 3MJHA 5DTRA 3WKBA 3OVMA 3AEYA 4IDCA 3PNSA 3IPCA 4GP9A 4X1KA 4GNKA 1QSGA 2Q1XA 1DRKA 1EK0A 1R6DA 5TR9A 2B21A 3SQMA 2HF7A 1LNQA 3MCVA 1ABFA 4M9RA 4L0QA 1N32B 1KJWA 2F7SA 3O4FA 4Q6BA 2CVHA 3GJRA 1EE1A 2PUDA 3A25A 1UPUA 1KEUA 3TXYA 1UEIA 3JALA 4UUAA 3W9SA 4CMEA 5WRFA 1XMSA 4O2AB 5FORA 4WXMA 3O26A 3PR1A 4RSMA 3S5JA 4TN1A 1GLNA 1OFGA 5FLXA 1TAQA 1ZFNA 1HFKA 1WEHA 3HNRA 1GM5A 4B3MB 1YIDA 2HQOA 2MTBA 2F8MA 3S1LA 3EWSA 4FGWA 3BH6A 4X65B 1KEVA 3EBPA 4FONA 3C4VA 4OGLA 2YY5A 4QU0A 3ULKA 5REQA 2CXUA 3MFYA 1T0BA 2YW9A 3C5WP 5C1PA 3NBQA 1IPFA 2CFCA 2FX3A 3N7UA 4UBIA 2PS0A 4UUBA 3VNAA 2HU8A 1LI5A 5CFOA 3U19A 5BR7A 4EO4A 4NECA 3ZS9A 3CWCA 1YCDA 3CSSA 2J3IA 4MDHA 2YDYA 1LK0A 3R5SA 5ALOA 3FZEA 1QTQA 1TF5A 1N7JA 4OJTA 4AJEA 3BZWA 4XGQA 5CH3A 4X1KB 5EYPA 3R1IA 1S96A 2CEAA 1CIVA 2HDWA 2AXEA 1KU6A 1MCZA 5CLFA 3Q8WA 2O8FA 1X7YB 3TM5A 1L4YA 5TMPA 1ZVQA 3QVVA 3ZDDA 3HCRA 5BSUA 3VYSB 2K7ZA 3OSZA 5E3IA 4D98A 4TKVA 1B73A 2FN8A 3QPDA 5IF3A 2FWRA 1XDWA 2R6DA 4JENA 2NYAA 2J6IA 1EM8B 2O2SA 1RPZA 2DCUA 2ZIAA 1CZLA 3P0HA 1L7BA 1G291 3NGXA 4H4EA 3L8GA 4WINA 2R87A 1NVXQ 4Y2XA 3R3UA 1TA0A 2ECPA 1N77A 4RMNA 4YMGA 3AP3A 3IBCA 1CB7A 5DE3A 2UZAA 2OFPA 1MV5A 4E03A 1F4PA 4L57A 3SYLA 5SZKB 1U7WA 4IOLA 5DWVA 4AUKA 5J47A 5KTKA 4RH3A 1J8DA 2WSIA 3AVPA 4AT1A 3L7NA 4FYHA 3TAXA 2O0HA 1C3EA 4HBGA 2IOFK 3E15A 2GKGA 1YS7A 2VRCA 2YL2A 3HFRA 1NXXA 2KBFA 2ZRCA 2XCIA 2OPHA 1KJIA 1N1EA 1ZOSA 2H5JA 2R65A 4C08A 2PRSA 821PA 2JLZA 1Q91A 4RPCA 3NFYA 2CXTA 1T5TA 1M2NA 1WUTA 1XF9A 1C3JA 2J9FA 2J3QA 4WNIA 2HN9A 4AJ2A 1XC7A 1N75A 1COWD 4NPAA 1SU4A 1ZK2A 2LRHA 4O4HA 4WI1A 5BSFA 1T3ZA 1M83A 2XEXA 5IJ9A 5HIMA 5KVAA 3OHMA 3VHLB 2LE0A 4XAQA 3OOWA 3KZVA 2PX6A 1A77A 1TA4A 3O4RA 2FZWA 3LP8A 4TSFA 5DKFA 2JVKA 3E8XA 3ZVLA 3NQ41 3O03A 2YHUA 3S1AB 2QAGB 4W8OA 3Q9SA 1KMHA 1R8XA 5ADWA 4Q01A 1EWTA 4M8IA 2JA2A 3IA2A 3ZZMA 5KJFA 3SAJA 4LYHA 1P1FA 2UZ1A 3UC9A 2PZLA 2ZATA 2Z09A 4CHGA 2XB4A 3VC2A 3A3KA 3EAFA 2GBCA 2GEFA 2J33A 3C48A 1NNLA 3OFNA 2JH8A 4IEFB 1R6VA 5BSHA 2QMEA 5KTTA 1OD6A 2LIVA 3T3HA 2ZUUA 4E08A 3G1WA 2EZ9A 2CJXA 1BTOA 1BU8A 1CUHA 1A98A 1KDOA 3LT5A 1FYVA 3LVFO 1P2DA 1VBFA 2OSVA 4XB2A 3H4TA 5I45A 4LGCA 4GKBA 3EXIB 1PV4A 3TUJC 1XTUA 2VBIA 2RDMA 4RAQA 5TV2A 3CNEA 1JH8A 2GYWA 5BUZA 3UM9A 3JQ8B 1K92A 4DC1A 3G9QA 4QEKA 2JAPA 4HGNA 1Q17A 4XPZA 3L4KA 1U9ZA 4TMYA 2V7QA 4BZQA 1U0OC 4KXNA 3I2FA 1J2TA 1O5IA 3D2BA 2I6XA 2IWRA 3VPGA 1B2LA 1S7GA 2ZZNA 3IBTA 4X1OA 3ZKWA 3JQQA 1Q3HA 3PXBA 4FMCB 3OUTA 4I6GA 4PVDA 2GKOA 4YRPA 4YCJA 2IV7A 2HF8A 1QC5A 3DUFB 3AOEC 4RFLA 1T6BY 4GLJA 4J0CA 1VE7A 3U1BA 3WO1A 5EZ5A 1W75A 2LV8A 4ZDKA 4WKOA 2Y0PA 5HTOA 4UAUA 2JKZA 4L2IB 2YRWA 4TTRA 5AHKA 3UW1A 4EGJA 5A71A 3PHIA 2Q0SA 1DO2A 2ZM5A 1RHKA 4YDHB 4OUDA 4YIKA 3A37A 1EJBA 1KTIA 1L7MA 3MTGA 5D3MA 4K8OA 3QVJA 4HADA 4ROTA 4QBTA 4OAOA 3K94A 5AI9A 3ZDQA 5LB2A 4DVJA 3BYZA 4BRZA 4C88A 4PGAA 2C7QA 1JAZA 2XNHA 4XJSA 2JLUA 4IJVA 5KCMA 2GCEA 3L7AA 4O5AA 3GLFB 2FW1A 1GAEO 3HU2A 5F3RA 3OQHA 1A2BA 2XMCA 4HDRA 3AKZA 3RB8A 3PVSA 3D8HA 1I3OA 1PV2A 1Z62A 2PVSA 4MW5A 4N5NA 4ZVLA 2AMLA 1EA5A 2I80A 2JLSA 5ULLA 2DPMA 3DGFC 3EA0A 4BS9A 6PFKA 1DSSG 1DCKA 3DBVO 3TBHA 1W19A 3QJGA 4WZ6A 5EA2A 3EFEA 3NORA 3L7DA 4G1UC 1S3SA 2JIPA 1OBOA 2VWHA 3SFTA 4CZ2A 1N92A 2RHBA 2C5BA 3EASA 1STOA 3M82A 1LF5A 5AI0A 5EJGA 1EG2A 1L5FA 1U5BB 1U7XA 2RJNA 3IA7A 4I2NA 4NBLA 4R1MA 4YRRA 3VKWA 3Q7TA 4ER0A 3HVKA 4J1TC 5LXTB 2WVHA 3FW1A 3PC4A 4D9GA 2P8SA 1PFGA 4ZC8A 8ATCA 4B3XA 4O4IF 1KA9H 1G5RA 4UMVA 5HKKA 1KI2A 2NQ2C 4JBHA 4CKBA 1DBQA 2Q5CA 3H2KA 3MF4A 2NU9A 3PGA1 3I30X 3PK0A 5A0FA 3X1ZA 4HQLA 1WB6A 4QICA 1E4VA 5F4BA 1HQKA 1QJ4A 1JQBA 3ETDA 3NHJA 1CC1S 2HV9A 3I53A 1H3FA 5JCOC 1DOAA 4MULA 3SP1A 3T5AA 1DP4A 3I5AA 2LR0A 4A8TA 5AXCA 2OBNA 3V7NA 3HDHA 1AKRA 4A82A 1KO5A 5FXMA 4WE3A 4HAOA 3HXOA 1JZQA 1G5IA 3AG6A 4NFSA 3K9QO 2MCFA 4Z8XA 4HZUA 3CRRA 1RJDA 1WJGA 5IAOA 1DTEA 1E3TA 1E60A 4KXUA 4Q39A 4WFIA 4EI7A 1W93A 3OQNA 3GQVA 4P3OA 4RFSA 5HK9A 3AEXA 4YGYA 2PUVA 3CUEF 4IF6A 3UMRA 5A4AA 3F0TA 2XMPA 2SKCA 3UAWA 4Q4DA 1MB0A 3P2KA 5A2GA 5H81A 4DR6B 4EGAA 3P94A 3AFHA 5A9RA 2ZTVA 1MKYA 1NUSA 2E9SA 3AB3A 3ASYA 1JWAB 1WTAA 3BGVA 2JATA 3OPXA 3Q1KA 4UUOA 3DZFA 3ZNNA 4DR5B 3AIMA 1FS4A 3ITDA 1IJBA 2VQ6A 1NDQA 1ZEJA 3I12A 1M2VA 3ZDYB 1I24A 5TY0A 4COKA 4DR1B 3OEEA 3HNPA 3RAFC 4OGGA 1SCBA 4NJMB 5DLDA 3K53A 1WZCA 4FYMA 2GK4A 1HQYE 1UMKA 2JAQA 2O8VA 2Q45A 1Q1GA 1QYVA 2JEOA 1KDVA 1ONOA 2IBMA 2PKQP 3GD7A 1LRKA 4BKOA 1H3EA 3NRBA 5K3AA 2UXCB 4CMCA 1D2HA 2UVPB 2V6BA 1I6LA 1RIFA 5LBIA 4BO0A 2OG2A 3Q5EA 3R7NA 3ZNQA 1KWKA 3TG8A 1GCGA 3QLUC 1YA4A 4OQQA 3GLHA 4EGSA 4M1YA 1BEUB 4C2BA 2VYND 4FJ1A 1X1DA 1ZGAA 2Y92A 3GVCA 5JC1A 5L3QA 3J81k 1P29A 1VLVA 5M2QA 3KOZA 4DOMA 1JG3A 2GNAA 5JFGA 3CM0A 4JBLA 3R75A 1GPYA 1P3JA 1FP4A 2VNAA 4U9HS 5A4JA 5DW0A 3D7KA 4BYMA 5JIBA 4M8KA 5FBRB 3N86A 3DOCA 4TTTS 4EI2A 1O54A 3PNLA 4CM4A 4HDNA 3V8EA 2PUBA 4CQMA 1TVMA 3JQ9A 1M73E 4ZC1A 3V33A 2WUFA 4GYKA 3A1DA 4KHZA 4M55A 5EKDA 3VOAA 4FNMA 2XZLA 4M2LA 1T8SA 2WTMA 3OP1A 3ZWNA 4MR9A 1K7YA 1Y98A 2XSZD 1HL3A 4HDSA 1TRKA 2IWHA 1BE8A 1XJWA 1IM5A 1EZ4A 5CM9C 3TLGB 1KS9A 3NPMA 4BQSA 1QQ5A 4IHQA 2WD9A 1BVHA 2J5XA 1KYIA 4HMPA 1FDTA 4I9NA 4JDPA 4DA7A 3QGMA 2FJ0A 1WXWA 1WMAA 3COYA 1O96B 4GG1A 2D0IA 2OE2A 4I0WB 4NS1A 4AQYB 2TMGA 2WJ6A 1QS0B 2BBSA 2VDKB 3PJEA 3GPDG 4CDNA 4ND7A 4BB5A 2I91A 4QQNA 4XD7D 2IU6A 1DAEA 1DTWA 4RGBA 4UHFA 2V6MA 3K0EA 2BGIA 3CLRC 4RKRA 3BFVA 3TPFA 2PT5A 5J23A 2EL9A 1Z5GA 4Q34A 3IBYA 1UXHA 2VJYA 4RJIA 5JQGB 4X24A 4CM8A 3EGDA 1T4GA 3BE8A 3I6YA 3PCXA 1TEZA 1B1AA 3FDXA 4G0QA 4D9EA 1V5EA 2W93A 2WP8J 3J7TA 4D0GA 3HWSA 1LDNA 4RACA 3TQRA 1ZM7A 3IBGA 1E1RD 3GAFA 4QJIA 1ZX1A 3AINA 2ZYVX 2ZIVB 4QHSA 4TLDA 4POOA 1H2HA 4JODA 3L05A 3SZMA 2YVAA 4P54A 2Z0MA 4DBZA 1H2BA 2Z9CA 2BOVA 3S2SA 1R3DA 4A2QA 4DT1B 1H9CA 3MILA 2ZJ2A 3DKPA 4ML3A 4P3KA 1OZGA 4EFMA 1GZ6A 4ASUD 2AOTB 1QHXA 4R3WA 3P5SA 3C1OA 1UL1X 1B8UA 2JZNA 3B6KA 5A2QA 2GPBA 5AR1A 5IK2D 1V1RA 3T99A 4BMVA 5FTLA 3DEIA 1FS5A 3FSJX 4TX1A 6YASA 5DCWA 2H2IA 3R9IA 4AF7A 2V45A 4UUMA 4GSKA 4HH0A 5F2EA 3MUOA 2VPIA 3NONA 5DMHA 4G0ZA 3F78A 4AJ1A 1QR2A 3J7AC 4IFBA 5KHOC 3ODPA 2GPSA 2IIBA 3F3YA 3OQJA 2VCHA 4GGPA 1EX1A 2OHIA 4P7BA 2JFHA 2TSYB 3K1JA 3LGSA 4JOBA 2JLWA 1XYGA 4YCNA 4D4HA 4RKEA 4CLRA 5DHSA 3IQXA 3FKJA 2GFHA 4RHYA 3THXA 4KR2A 4WLEA 2I1QA 3BAFA 5J4KA 1SELA 5JTTA 3A6JA 4CEHB 2A5FA 4YMIA 4K9KA 3P71T 4A6PA 3CGGA 2ONZA 2IOFA 2M6SA 3EGVA 3D8BA 5JBQA 5JZVA 4AAYA 1TZBA 2FSHA 4Y6RA 2WT4A 4LAFA 1I2DA 3GJ4A 2VXYA 3DAYA 2NW6A 3RUIA 4HYTA 4L5JA 3UYKA 3R20A 4PZEA 1O4WA 2ZR8A 3NAGA 5DTEA 5AIBA 3D8RA 1YNOA 3UMGA 4XM2A 3U3MA 3WWEA 5DLPA 5EUCA 5EP2A 2VNSA 3CVOA 1GT91 2C94A 2X5XA 2QE7A 3QKRB 1M6VA 4FHGA 4WFJA 1ORHA 2IYNA 1NRWA 4BAUA 1XPRA 3S68A 2F4VB 4UC0A 1GG8A 1IEVA 5A9SA 3MOSA 4N7MA 2ODBA 4NRDA 2C7GA 3ANTA 3OOYA 3QW4B 3U9TA 1ZN9A 2GA9A 2QMYA 2I4OA 3JTEA 1E9RA 5DMXA 4F2GA 5KZMB 3EGEA 5HSGA 1NVGA 1Z38A 1REQB 2OMKA 3FNIA 4R4JA 4XIJA 1N2OA 1WUHS 3B2QA 3V42A 1JG1A 4JDUA 3ZDEA 4BQPA 4UHBA 2NU9B 2E6UX 4KL8S 1PQWA 5FO0A 5CFMA 2JIZD 1HDRA 5EPOA 2WJGA 1H2YA 6ABPA 1KY2A 1ZW6A 1WKCA 4O2AF 3KUDA 2QYOA 1FZQA 2R8ZA 3DDWA 1J5EB 1YVDA 1N5RA 2F1HA 1ESDA 3SYKA 5HJEA 5L53A 3HN2A 1WE2A 3MHTA 4F5WA 1YZYA 4JX9A 3BICA 1JWBB 4OYYA 3UV7A 4C0AC 4YUAA 3RVNA 3C6MA 1S02A 3ZU5A 4AY3A 2DLNA 1U2GC 1OFTA 2VTEA 2C59A 2O6LA 1XTRA 1IXZA 5B2EA 3HXTA 1T36A 3PFCA 1OCEA 2XYPA 3VSCA 3N0VA 2VP2A 3DOEA 5JZ9A 4LZZA 1UOOA 2H9YA 4RMGA 1CIPA 1QCYA 2D3WA 4YJ2A 1A4XA 1XCBA 5CVDA 5T4BA 5KYKA 2QRMA 3BUSA 1ZR2A 3CLTC