4KUEA

Crystal structure of 3-hydroxybutylryl-coa dehydrogenase from clostridium butyricum
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
280
structure length
280
Chain Sequence
MKKVFVLGAGTMGAGIVQAFAAKGCEVIVRDIKEEFVDRGIATITKSLSKLVAKEKITEADKEEILSRISGTTDMKLAADCDLVVEAAIENMKIKKEIFAELDGICKPETILASNTSSLSITEVASATKRADKVIGMHFFNPAPVMKLVEVIRGAATSQETFDAVKEMSESIGKTPVEVAEAPGFVVNRILIPMINEATFILQEGVAKEEDIDAAMKLGANHPMGPLALGDLIGLDVCLAIMDVLYNETGDTKYRASSLLRKYVRAGWLGRKTGKGFYDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-hydroxybutyryl-CoA dehydrogenase
publication title Crystal structure of (S)-3-hydroxybutylryl-CoA dehydrogenase form the n-butanol sysnthesizing bacterium, Clostridium butyricum
rcsb
source organism Clostridium butyricum
molecule tags Oxidoreductase
total genus 117
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.157: 3-hydroxybutyryl-CoA dehydrogenase.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4kueA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4kueA01
5C37A 5BSFA 4K6FA 2YW9A 1ZK3A 3QSGA 2BGLA 5G0SA 3RUIA 4W7IA 2CVOA 2P4QA 5EN4A 4D0RA 1GQQA 1Y9AA 1PQPA 2Q2VA 4R51A 2WJPA 2PK3A 3EVNA 5G0UA 1YRLA 1X14A 1PGOA 2AG5A 4FFNA 2C7VA 2DPHA 4KDEA 3DB2A 1K2WA 5KVSA 3UKOA 1H9AA 2CF5A 4R1SA 3VVBA 1MLDA 2PZMA 3GMSA 1BVUA 3FHLA 3JQGB 1BXZA 4BO2A 1FDSA 3PYMA 4DIFA 4IMPA 3C7AA 5CDTA 1R16A 5IZ4A 2WM3A 2CSUA 4J2OA 5ENVA 3WMXA 4J7CA 5IDWA 5JAMA 3WLFA 3ANLA 1P1FA 4IJKA 1X7GA 1S7CA 2PLAA 1R4NB 1FDWA 1NHWA 2QG4A 4HWKA 3KOUA 4ALKA 1H93A 2AEJA 1T1SA 4W99A 3GPIA 3MWEB 3C1AA 2AQIA 5C3MA 4L4SA 1WDLA 2O3QA 4U6SA 1CQIA 3BMOB 3JQ9A 2WYVA 5THKA 4LK3A 2ZTVA 1P33A 2VRCD 1F14A 3D4PA 4KWHA 1U3TA 3SLGA 1IUKA 3QVXA 4IJVA 2BD0A 4OKNA 3K2EA 1I10A 3TF5A 3RFVA 4QECA 1SMKA 5CAEA 3JYQA 1PJSA 1NPTO 3OSUA 2JD1A 4XZ3A 3ZWWA 1ZSVA 7ADHA 3GT0A 4PVCA 4I08A 3AI3A 4GMGA 5ILGA 1E7WA 4R1UA 4FR5A 4KP7A 2QW8A 5LDHA 3WBBA 4BO6A 3G0OA 5JYDA 3JQEA 1WZEA 2EXXA 3U5TA 1JKFA 1ULUA 4IDEA 1I30A 3LDHA 4BL5A 2BI7A 3TL3A 3N74A 3KSDO 4RVDA 4RCVA 4TKLA 3F6YA 4L9RA 3I6QA 3IP3A 2VYNA 4J1NA 1UZLA 1E7YA 3ICPA 4CMIA 3PHIA 2WD7A 4J90A 3GR6A 4GSLA 1Q1NA 3DZBA 4EBFA 1CRWG 3G17A 1GUFA 3GVPA 2A4KA 2EP7A 3QVTA 4YAKA 3QVWA 3GVIA 4JBHA 3U3XA 2GN6A 2YHIA 1EFLA 4DUPA 3AI2A 1YOVB 3BTUA 4QFDA 5B1YA 2FPIA 3K92A 1QORA 2PZKA 1T25A 3H65A 5EL0A 1I2ZA 1R15A 3R3SA 5I7EA 4IDDA 2QZ9A 2Z5LA 3DZJA 2B5WA 3KBOA 1TA4A 3NRCA 5CPBA 3RC2A 1BXGB 4I5GA 1U7TA 4CQLB 4DC0A 1LX6A 4LSWA 3M1AA 1UXIA 4YYZA 5KJEA 2C5AA 4CQMB 4R9RA 1E3EA 1PR9A 3ZU2A 3RUEA 3H9GA 4Y98A 1ZZEA 4C4OA 5A9SA 3ORFA 1G0NA 4BB6A 2D0IA 3R3JA 4NBWA 4KUHA 4JNKA 2HU2A 5DZSA 2JCVA 1JU9A 2HMSA 5TIIA 1IPFA 2GERA 2W8ZA 1ISHA 1R4MB 3EGOA 1I24A 1CQJA 1QLHA 3B70A 2ZIZA 2HO5A 4P4GA 4DYVA 4JJGA 3DOJA 5A9RA 2BFPA 5TNXA 2I5PO 1HDCA 1PGPA 3LVFO 3GNQA 3NX4A 5BSGA 5GZ3A 3TZ6A 4CLEA 2VNSA 4YVFA 1YDWA 4DBVO 5C7IO 1VRWA 4CMEC 1KS9A 1MA0A 3DBRA 1V9LA 4YJFB 1FDUA 3WWZA 2X5OA 5CG1A 4OM8A 1PZHA 2EIHA 4TRNA 4CLHA 4WLOA 1JW9B 1MC5A 4UULA 3JYPA 4MIYA 1KVQA 4RZHA 1LDEA 3TZKA 3H3JA 5AOVA 1I01A 2W2LA 3EZYA 5A5FA 4FOSA 4OSPA 4EJ6A 3GGGA 3PQFA 1XQ1A 4UAGA 4QTZA 3ZWBA 4EDFA 2X0NA 1MFPA 2GRAA 2HK9A 2DUUA 2X7HA 4NIMA 5TGDA 4WLVA 4IQGA 3X2EA 3BMCB 1CF2O 2ET6A 3OQBA 2YV2A 2J3KA 3DFUA 1LDBA 5L3ZA 3ZHBA 1HE2A 1WW8A 3EMKA 1N9GA 3MJSA 4RLHA 1GDHA 3QVSA 1R37A 5A3VA 2RH8A 4DPLA 2FWMX 1LC0A 4XIJA 1O95A 2VYVA 5I8ZA 3TL2A 4WNCA 3UFXA 4HADA 1XGKA 2JD0A 3KSZO 4PLYA 2G0TA 5EMHA 2CY0A 3V1UA 2OORA 4BUCA 3DWFA 1QLJA 4CM4A 1XQ6A 4DPKA 4KMSA 5JC8A 3GG9A 4FC6A 4RVGA 3BTVA 1DIBA 2C20A 1M6WA 3ABIA 2EHDA 4TROA 3KEQA 3FTNA 4JXKA 2E37A 3D4NA 1BG6A 1XKQA 3L9WA 1XU7A 3MJVA 4MIEA 3GA0A 3DBLA 1W6UA 3H2SA 4MVJF 3ULKA 3HDYA 3CINA 4UUMA 2NU6A 4HKTA 3NTRA 4CMEA 2HDHA 2YHIB 3FF4A 1BRMA 3GG2A 1R0KA 5FI5A 1HYHA 1HE4A 1ZJYA 2Y1FA 4IPTA 3GH3A 3U0BA 4BO9A 5JAZA 4N7RA 4ESOA 3VPSA 5DF1A 1V35A 1D1SA 2EJVA 3ENKA 1NNUA 4YACA 2FPPA 2E6UX 4Q3NA 3PYLA 3COSA 1NQ5A 4ZVVA 4PLTA 4CQMA 1LDYA 4E4YA 4DQUA 3QRWA 1QG6A 2WDZA 1YQDA 3RROA 4DLLA 2FN7A 1Z75A 4M89A 3MJEA 4E5PA 4FDAA 4JJIA 1G6KA 4CMCA 5ITWA 1WWKA 4BNZA 3WWYA 2VWGA 3JD2A 1P1IA 4CM4B 3CMCO 4LSMA 3L4BC 2B4TO 2JD2A 2DM6A 2GCGA 3H2ZA 1FF9A 4E5NA 4MVJG 2X9NA 3LF1A 4IINA 3FN4A 4XEHA 4YJDA 4BNWA 5CEFA 3AOEA 1JWAB 4A26A 5DULA 3DOOA 1MG5A 2X5JO 2DLDA 4MVJE 2ILTA 2VUTA 3V1TC 3QY9A 4I9HA 3HHPA 3GZNA 5K0ZA 1LDGA 2VHVA 3S2GA 3LYLA 1NFFA 1P3DA 4FB5A 3RKRA 4EJ0A 1P44A 2D1YA 1T2DA 1V3TA 3PJEA 3PRJA 4AJIA 3HFSA 4GLOA 4I5FA 3DTTA 1YONA 1LI4A 2B4QA 5ICMA 1BW9B 3DO5A 1DOHA 4MJLA 5CDYA 2EJWA 1LLUA 2YV3A 4MO2A 5I9LA 5JBIA 1X15A 1RYDA 4GX1A 4K1LA 4B7CA 1LTHR 1BMDA 1IHYA 2H63A 3A9WA 5F5LA 2PFGA 3B1KA 4WCFA 4P4NA 5J23A 2Z1NA 4DYDA 1E77A 3E1KA 4GMFA 4EUHA 3ROKA 1PS9A 5IF3A 1KVRA 4WLUA 1A7KA 3C1OA 3VTFA 1K3TA 2R00A 3C85A 4XYMA 4DBZA 4CJXA 2VHZA 1MB4A 5A02A 4CM3A 4PG8A 1XDWA 2BKAA 1LLCA 3K5PA 2YZ7A 3ZWYA 4CMKA 5TT0A 2C0CA 3MTJA 3QWIA 3VH1A 4E2YA 4FFRA 2G76A 4ZQFA 1NQTA 4NDNE 2HJRA 4AJLA 3FBGA 1MFZA 5JY6A 1IOLA 3CPSA 4OYRA 2BGMA 1KETA 1WLYA 4BKUA 1A9YA 2YFQA 2WWRA 3H7AA 4UEKA 4IDCA 1TB4A 4CLRB 2ZJ0A 1YBMA 4G81A 4BMSA 3M2PA 3JQBA 1CERA 4E33A 1IZ0A 4Z6KA 1LQTA 4GPD1 4B79A 2C2XA 4GH5A 2NU9A 4KDFA 3QW2A 5FYDA 4K6CA 4U8GA 4D3DA 4MVJH 5AVOA 4MINA 3E5MA 2PKRA 4YAEA 1M75A 4LRTB 1NX6A 3AWDA 1AE1A 2W2KB 4MP6A 5FI3A 1B15A 3OHSX 4CV0A 2GZ1A 1AXGA 4D3FA 5GY7A 4E32A 3W8EA 2AA3A 2P5UA 2IZ1A 2B35A 1T2FA 3OF2A 1PJ3A 3TSCA 3H3FA 5ILOA 1YE3A 3RI3A 1SCUA 3HWRA 1H9BA 4OO3A 1VPDA 1HXHA 4PLVA 3AY3A 5CEJA 1GAEO 2H5LA 1N8KA 4B8ZA 2Q1UA 3W4JA 4D79A 3PDUA 2O3JA 4TRRA 2FSSA 3V2HA 4BOYA 4YXFA 5A3JA 4D0SA 4KWIA 4GVXA 1ENPA 1G1AA 4BO4A 3WS7A 1K6XA 3DMTA 4XR4A 4O6VA 3KV3O 1DJNA 2Y68A 1QRRA 1C14A 4BNTA 3BMQA 4NJOA 2C7GA 4DIBA 4UUPA 3IJPA 1IB6A 4CPDA 4R5MA 5IZCC 4GX5A 5EPOA 4P8RA 1O89A 4BS9A 4R1TA 2QRKA 4J2HA 1E7RA 3WGZA 4XCVA 2VRCA 3I9LA 4ALIA 3AK4A 1HWYA 1GL3A 4EZBA 5IDQA 3FNHA 3FNFA 3DDNA 3CIFA 1WZIA 2Q4BA 1EVZA 2PWZA 1VI2A 5AXDA 5K6AC 5BR7A 1PGJA 3PLNA 3TOXA 2Q1TA 3TJRA 4ZRNA 4AJNA 5CG2A 4YDRA 1V3VA 3PJGA 3ZHYA 2VZ9A 4WASA 3L6OO 4IUYA 5CP8A 4CM9D 2AEFA 2AXQA 4CM1A 1PZFA 3H9UA 1HSZA 1UAGA 1UUFA 4RF4A 1UDCA 2CDCA 3OEWA 1GZ4A 3D1LA 4RPKA 2A35A 1I3MA 4BNIA 2VT2A 3OQ6A 3SC4A 1ZKMA 4EUFA 4FQ8A 3ONFA 5IJZA 1PZGA 1BSVA 1C3VA 4PG4A 5JDCC 4CM6A 1YKFA 2XPCA 4FBGA 2GDZA 2ZQZA 1XSEA 2NV6A 4YBZA 1WDMA 4CM9A 3SVTA 2PTGA 1E5QA 3X2FA 2PGDA 1P77A 2RIRA 3PJFA 1X0VA 4N54A 2VWPA 3CTVA 1OBFO 1ENOA 3AJRA 4WOKA 1W8DA 2Y67A 1ENZA 2Y99A 4CV3A 3L77A 3PFFA 1E6WA 1I2BA 2D5CA 1T4DA 3DBRB 3N7UA 3G1TA 2BHLA 3TZCA 3IKTA 3JYOA 2YV1A 3AUAA 5KJ6A 3KXDA 4D3SA 2O7SA 4OQYA 1TT7A 4FD3A 1PSDA 2GN8A 3GAFA 3FCOA 5BNIA 1A71A 3TZHA 3W6ZA 3ZV6A 2BFAA 4L73A 8ADHA 1XHLA 4R5HA 4WNIA 1W73A 1SPXA 2FPGA 1T4BA 3RD5A 1ORRA 4RZIA 1JN0A 2YDXA 1NWCA 3T7EA 1YL7A 4WLEA 1X13A 3MWDB 1U8FO 1SOVA 5HRUA 4J9UE 3U49A 3QVOA 5JC1A 3OJOA 4OH1A 3F5SA 4TWRA 4XYLA 1UR5A 4DA9A 3GFBA 1EE9A 1GZ3A 3KEOA 3RJ5A 2Y1DA 5TLSA 2C82A 2VTDA 3ETEA 2ZJ1A 5HBRA 1UP6A 5TX7A 3Q2KA 3AM5A 3HJAA 3I23A 4KUGA 4Y67A 1TLTA 5H83A 4P38A 3IC5A 2DBRA 3RU7A 3MJTA 5L51A 3AUUA 3BMQB 4YJGB 2PKQO 4L4RA 3JQFA 2EW2A 5JPIA 3JQAD 4R1NA 1DAPA 4M54A 3TFQA 2ZB3A 4FCCA 3ZW8A 2RBEA 1DDOA 2CF6A 5ICSA 1B8UA 3I4CA 5BSHA 5A9SB 2PD6A 4XJTA 1VE9A 1PR3A 4ZGWA 3GN1A 4OMUA 3QE3A 4WCFB 4JN6B 4WPGA 4PLZA 4D45A 4RL6A 4ALJA 5A03A 1K89A 1N7GA 4NBUA 1M67A 1JKIA 4CL3A 1OMOA 2NQ8A 4B4WA 2YYYA 5L4SA 2D59A 5LDGA 3Q9UA 3HQ4O 4DTIA 4RPGA 1XG5A 2VTEA 4B7XA 4EI2A 4NPCA 3TDKA 1O5IA 2B0JA 3IJRA 1H5QA 2VT3A 3ROQA 3LT0A 3JQ8A 2OBNA 4QQRA 5A9TA 1Y5MA 4E5MA 5L4LA 1GPJA 1LBEA 4A73A 1H6CA 4II2A 3QIVA 4J1SA 2W90A 3C8MA 1ISIA 3IQDB 1IPEA 1L7DA 1NPYA 1X1TA 1DAOA 4IDBA 4IY1A 4WK6A 4XX0A 5JFOA 1RWBA 3ZWXA 4TKMA 4YT5A 1UXKA 1BGVA 4WOJA 4MVJI 5KIAA 3O9ZA 4D46A 3PJDA 3S2IA 5DOVA 3H8VA 3I9KA 3GF4A 4QEDA 4JBGA 4TRJA 1GYQA 1E3WA 2J3JA 1BXGA 1EK5A 4NU5A 3WTBA 2OO5A 1E1NA 1HL3A 5JDIC 4NHEA 4WEQA 2DKNA 3GNSA 3MCVA 3PDJA 1O8CA 4IQ8A 3NT5A 4RQUA 1Q7CA 4J1TA 3KSUA 1JTVA 1KBZA 2SCUA 1MX3A 3IAHA 3M2TA 4MDHA 5HA5A 1OI7A 4IMRA 4JLWA 5BQFA 4FFLA 3D5TA 3PIIA 2IZZA 3E9QA 3JCZA 1CEQA 1O9BA 3KLMX 5AXBA 2ZYDA 1N1GA 3D3WB 2FSVA 3CUKA 3JYLA 3PP8A 2X0IA 4F6LA 2IYOA 1ZMTA 3DAPA 4M87A 3ZWAA 4CUKA 1K6JA 2CDBA 2VWHA 3D0OA 4NJMB 3GZ4A 4N18A 3DZGA 4DQVA 4H7PA 1MV8A 4ND2A 5THQA 1SAYA 3NV9A 1EUZA 2D3TA 1K5HA 3PEFA 4WCFC 3NDJA 2DTXA 1KEPA 5G0WA 1PJQA 3F3SA 2BELA 3I1JA 3V1YA 4ZN6A 1HETA 5B37A 4I5DA 3AY6A 2ZCUA 3HB4X 3DEYX 3EC7A 4XQGA 4CUZA 1YQGA 2P5YA 1VSVA 3DHNA 4L74A 5L9AA 5IN5A 3RAJA 4J0EA 1PIWA 2DTDA 4CR8A 2IE0A 3VHRA 1FJHA 4PLFA 4XRRA 2NM0A 2XF8A 1EZ4A 2QRJA 4G2NA 5BT9A 1H94A 2OXIA 1AN9A 3GGOA 3IIEA 4UVEA 5DBFA 1SEPA 1TEHA 5JAIA 5TS3A 2FY8A 3F5QA 3I5MA 3UCXA 4M49A 2I99A 2Q3EA 1DRUA 4QUKA 3B1JA 1UAYA 2EGHA 3VZSA 4XDYA 4CLXA 5IXYA 4KQXA 1DLJA 3JYNA 3OH8A 3ZV4A 4JP3A 5I7VA 4O0LA 3B6ZA 3NDRA 1C1DB 2P9CA 3MOGA 2OHXA 5G4KB 3WYCA 4LMPA 2IXBA 1VJ0A 1NASA 2GZ2A 3K9QO 2P68A 3RBZA 1GR0A 1UZMA 1GADO 1O0SA 1Z73A 2DBVO 2P9GA 3DXFA 3KRTA 5DCYA 3Q3CA 3R0IA 1K6IA 2AQHA 2OGUA 5C7OO 3TPCA 4BV8A 2ZCVA 2J3IA 3DBHA 4O1MA 2ZTUA 5T57A 2J8ZA 1YOVA 5COQA 3WQRA 3RUAA 2AG8A 2Y05A 3AU9A 4KZPA 2DU8A 2I66A 1R6DA 4U6QA 2A94A 1BDMA 3BTSA 4BKRA 2HAEA 4WEOA 1DO8A 1VSUA 4XQEA 5JCJA 2ZB7A 4PG5A 3MJCA 1PJCA 1ZMOA 1DRWA 4MKZA 1IE3A 1F06A 1ZW1A 4WGGA 3MZ0A 3CXRA 3RC9A 4RPHA 1U5AA 3G1UA 5ES3A 5L7WA 1ISFA 4U0KA 2EW8A 4D41A 1JQBA 3VDQA 4AG3A 5MDHA 1B2LA 4YA6A 1NXQA 1NPDA 4YT2A 2X4GA 4RJTA 5T8KA 2V6GA 1V0JA 1I0ZA 1VL0A 5ER9A 1LU9A 3Q2IA 2ZK7A 5F5NA 2NSDA 2YY7A 4NNJA 5DBGA 4BKOA 2O3RA 4Z9FA 2JFFA 3W8FA 5T64A 4EITA 3GUYA 4Z9XA 3IS3A 2FR8A 2YHUA 5KVCA 1XWFA 3RCBA 3DZFA 1GCOA 3DAFA 3ADPA 2WD7B 1LRLA 2FOIA 1NAHA 3H9QA 4ILKA 3ENNA 3PIDA 2VQ3A 3GOHA 4BO7A 3KO8A 3NKLA 2HRZA 1P0FA 3WGQA 2CDAA 2H1SA 1R4NA 2VUUA 2FHSA 2UUOA 3NAQA 4OGWA 2VCYA 3GGPA 3JQDA 2Q2QA 3PHGA 3ZHZA 2GO1A 1CYDA 4IM7A 1PJTA 1E3JA 2DFDA 4L0QA 1JAYA 4QO7A 1HDZA 1P31A 2BMAA 5DCWA 2GLXA 1GYRA 3VH4A 1KVSA 3F1KA 2J5KA 1YB1A 4LVUA 4MKRA 2HK8A 4UEJA 5ER6A 2B36A 3AU8A 1TXGA 3K6JA 2NU8A 1TT5B 1LLQA 4YPOA 4I9UA 4I9NA 3R1IA 3WXBA 1KOLA 4JCOA 1U3WA 3H9EO 2RCYA 4KOAA 1ADFA 3W1VA 3BTOA 3E03A 1Y7TA 3CE6A 5F1KA 1Y9EA 3GDOA 3KTDA 1YH3A 5TF4A 3PVZA 4GGOA 4BIIA 1LJ8A 3WYEA 5BNTA 4XQ9A 2IEDA 3OBBA 4BKQA 4CUJA 4NI5A 5CPFA 1IZ9A 3ONDA 6ADHA 2WTBA 3NGLA 1PJ4A 2Q50A 3I4FA 1JAXA 1DPGA 1DXYA 1ID1A 3H9JA 4F6CA 2B5VA 5EQFA 3OIGA 4J49A 3GEDA 4FN4A 1L1FA 3K31A 4TZTA 4Q3EA 1QYXA 4RDHA 4JX8A 4L75A 5I7SA 4PIVA 2EWMA 4BNFA 1NFQA 5B4VA 1B26A 1C0IA 2JAHA 3HFGA 3TFOA 4D42A 2Y66A 4ONEA 4YJGA 3FR7A 2CMDA 1LA2A 2UUPA 3ZWMA 3AFNA 2OP0A 1O6ZA 1SC6A 3BMCA 1P1RA 2NVUA 4BGVA 5FEUA 2IRWA 4CMIB 4OL9A 2V7PA 3A28A 3D5QA 4CMHA 1SEVA 1ML3A 5JW6A 4YJHA 4D7AA 1DLIA 1T24A 3BMNA 1LSJA 3E9NA 2J5RA 5HS4A 2HRBA 3DR3A 5KVQA 1GD1O 2VNAA 4ZRMA 4J7UA 1I3NA 3GRKA 4A0SA 5I8WA 3KVOA 3QQPA 2HSDA 4BQPA 1DIRA 5T67A 2NVWA 3EUWA 5HS6A 2DBQA 3S8MA 2I3GA 4N5LA 4IBOA 1A9ZA 3L4SO 1T2AA 3PQDA 3GMDA 4OIMA 3CTMA 4XWYA 1UZNA 1ZSNA 2D4AA 3PI7A 1LSUA 4B3HA 1HTBA 1DIAA 5EQDA 5JDIA 1TI7A 1Z45A 1VJTA 4PLWA 3SBOA 1LDMA 3AUTA 4E5KA 2RHCA 4HX5A 1ZEJA 3EW7A 4N5NA 1DFGA 1PL8A 4MKXA 3ZV5A 1W4ZA 3UICA 4MVJP 2EERA 4XYBA 3HNPA 5LCXA 3G79A 1DHRA 4NK4A 1E3WB 4DREA 1NBOA 2X22A 1HE3A 1YQXA 2I67A 3I9OA 5JXWA 3M6IA 2C54A 1ZO8A 4HP8A 4MP3A 3TN7A 5IZCA 2V65A 5C7LO 1IL0A 2DBZA 4FIZA 2ZYAA 4ID9A 3CKYA 1ZCJA 2CD9A 4FPXA 3UH1A 3DMTC 3VVCA 1DFHA 4CM8B 3RUHA 5T6BA 2UDPA 1NAIA 4E13A 1ZVMA 3DHYA 3RBVA 3UCFA 4S3MA 1EBFA 1PWXA 1KEWA 1ZIDA 3JQGA 4XYEA 1IY8A 3I52A 3F9IA 4HXYA 1EUDA 1YXMA 3IOYA 3FTPA 1P45A 2VUSA 1R0LA 2O2YA 4XRGA 3DHEA 3BZUA 3LT4A 2JL1A 2PY6A 3F1LA 3HSKA 3PHHA 1E1LA 2Q46A 3V2GA 1LRKA 4YT4A 5ITVA 4XGIA 1ARZA 1DB3A 4ZICA 1A27A 3VZQA 1X1EA 4YRBA 2EF1A 4HNGA 3JSAA 4J9VA 3O8QB 4YAGA 1QXSA 1XR3A 5B4UA 3KM0A 2AE1A 1E0DA 2D2IA 3EZLA 5JYEA 1RM3A 4Q3AA 4XJSA 4E2XA 2GF2A 3GVXA 3WFIA 2BFOA 3P7MA 3WDSA 4TZKA 2NVBA 1P74A 2JFGA 1PZEA 1Y8QA 4ITUA 4Y6PA 1YL6A 1E92A 1YWGO 4CMAA 3JQ8B 1KEUA 1Y8RB 5DDIP 2I3AA 2Y1GA 2X0JA 3BHJA 3O03A 3P19A 4RVFA 1U7HA 1GPDG 2HKIA 4E3ZA 1C0PA 3GLQA 5H81A 1B16A 3I3OA 3FD8A 2R00C 2NADA 5L95A 5DP2A 4J91A 1AGNA 3BMOA 4RDIA 3UAGA 1U3UA 4TQGA 3WGTA 2PNFA 4FGWA 4AJ4A 3WG9A 3WJAA 4WECA 2YDYA 5IDYA 5L45A 3U4DA 2O50A 3OQ1A 1F8GA 1YO6A 1VJ1A 1VM6A 2EEZA 3WGHA 4MP8A 3NEPX 1B8PA 4RPLA 1A7AA 4EEZA 1F12A 5TSDA 4JQCA 5I9NA 3AM3A 4NJMA 5EIOA 5KJ1A 2D8AA 4K9DA 1JLLA 3PPIA 5F1OA 5TT1A 4N5MA 5U9CA 1KERA 1LUAA 4XYGA 1Q0LA 4MVJA 5L7TA 3VH2A 4BGIA 2DUWA 2YUTA 3I6IA 3FWNA 3GVHA 1OC2A 4R9SA 2PKQP 2YQ5A 3WJ7A 4CMGA 2DAPA 3RBXA 3S2FA 3FWZA 5FF9A 2LDXA 4M1QA 3RC1A 4PLGA 1P1KA 4NR0A 4MVJM 1N5DA 2C2YA 4CM7A 1WMBA 4BMVA 4ZA2A 3STHA 1EVIA 5JE8A 3AOEC 3OFSA 1KY5A 3WX0A 2GN9A 3ZNNA 4NFSA 3UXYA 2EV9A 2GNAA 3LC2O 9LDBA 4KQWA 2IZ0A 2G5CA 3L4BA 1N9GB 4ND4A 2YJZA 5A5EA 4Y8VA 4AJOA 3RC7A 4PZCA 3ON5A 4OHUA 1QYVA 2GR9A 2X1HA 1AUPA 3F4LA 3IMFA 4IZIA 3DAGA 1XA0A 1Z7BA 2JCXA 2Q2WA 3WNVA 1H6AA 1RKXA 1GQ2A 3UGKA 3K73O 2UYYA 2E4AA 2VOEA 2Q4EA 2W2LD 2Y1OA 3HN7A 1FDTA 2XOXA 3ZU5A 2ZYGA 2G82A 4HY3A 2FZEA 4D43A 3AI1A 3LK7A 3PYXA 4DLBA 3V8BA 4WLNA 3D64A 5HTOA 2O4CA 3GHYA 1AHIA 4X54A 1I32A 3DC2A 4P22A 1E6EA 3E48A 1L7EA 3ICCA 3D7LA 1QYWA 4GX0A 3U09A 3RUCA 2O4UX 4IJWA 4U0JA 5KJCA 1SNYA 1I3LA 2I9PA 3JQ9C 5IG2A 1GV1A 1ONNA 5JMWA 3PHJA 3TZQA 4DGSA 3FBTA 4ALMA 1I36A 2YQ4A 3KUXA 4BO1A 5EINA 5KOIA 2FP4A 1UP7A 4DL9A 1FK8A 3ZI0A 2TMGA 1YS4A 1EQ2A 1ENYA 1HZZA 3S55A 1KC3A 4CQMD 5CEEA 1OOEA 2NTNA 4XKJA 3D4OA 2V6FA 1Y6JA 1OAAA 2X8LA 2JKVA 5GZ6A 2UV8A 4WJZA 4YJFA 3WTCA 1O94A 4A7PA 1YGYA 2B4RO 3A1NA 1KEVA 2PH3A 4R68A 4XB1A 4K26A 1GQYA 3MJ4A 2O48X 1E3LA 3ZWCA 2CZCA 2Y0DA 4GLLA 4GX2A 1RM4A 5DN9A 1HT0A 1GFSA 1EVJA 1VKOA 1LC3A 3A06A 3E8XA 3T4XA 4DVJA 1MXHA 1K0UA 3WGGA 2QHXA 3SLKA 2V6BA 3ZU4A 3LC1O 2EG9A 4UVHA 4IZHA 2NQTA 4W9NA 3H4VA 1QYDA 5IXSA 4R01A 2VHXA 1UXHA 4B4OA 1YJ8A 2F00A 3ITKA 5JMPA 4H16A 3JD1A 4RPJA 3PWKA 4U7WA 3ANMA 3LC7O 4CV1A 4O5OA 3ETGA 1HLDA 3ASUA 4NG5A 3NT2A 5MGBA 4YRDA 2OBYA 4JJFA 2O2SA 3QJ5A 1UXJA 5EESA 1FDVA 3G49A 3HDQA 1EBUA 2I76A 4QT0A 1EQUA 3QP9A 4EW6A 5G0TA 2OMEA 3JQ7B 4MVJD 3TNLA 4HFNA 2NTJA 3EY4A 3KZVA 1HDOA 1BW9A 3ADOA 1N1EA 5B12A 3Q0EA 2DFVA 5KKAA 1BVRA 1VL6A 3DFZA 2EGGA 5G0VA 3IUPA 1NFRA 4IDFA 4IJUA 4B3JA 3WFJA 3QWFA 4GWKA 2IYPA 3FPCA 2RHRA 4DMLA 7MDHA 3A14A 3SJUA 3VPFA 1DRVA 2QIOA 4CR7A 3I9NA 1XLTA 3FPLA 4GAEA 3KYDB 3UOGA 1U3VA 3HG7A 3WQSB 1WPQA 1RM5A 2X0RA 4G5HA 4BNLA 2Y0CA 2QX7A 3KYBA 1I5RA 4INAA 2AHRA 1CIVA 1DC4A 1KY4A 3GQVA 3JD4A 4BNNA 4F46A 2PR2A 1GUYA 5KTKA 3RWBA 3OJLA 4JGBA 3ZCXA 3K96A 3E9MA 3PXXA 4CL8A 3GUCA 4WCDA 1QKIA 3F46A 2GSDA 1I2CA 1Z74A 5ENDA 2O23A 1A4IA 3H5RA 5FFFA 5T5QA 2A92A 4JIGA 4R41A 1ULSA 3WOHA 3W6UA 1G0OA 2WYWA 3FNEA 4RVHA 4FS3A 4BNXA 4BGUA 3U4IA 5BSEA 1PU2A 1D3AA 4UVDA 1DIHA 1ZK0A 4QXMA 1RM0A 2B37A 1A5ZA 3WB9A 1BTOA 1SZJG 4Z0HO 4URFA 3JTMA 4Z0TA 4BQRA 1E1MA 2J3HA 1GTMA 3GN2A 3AW9A 2ZKLA 2O3UA 4H3VA 3WYBA 1DBVO 1U1IA 4YTEA 1R12A 1OZAA 4M86A 5JY1A 2RH4A 4ALLA 2CNBA 5A4DA 4HFMA 3DOCA 5HWSA 1M76A 2DTEA 2NACA 4BNGA 1QYCA 3U4HA 3CSDA 3FSRA 1E6UA 3H5AA 3VAZA 4ZQEA 4CM5A 1PGQA 1GCUA 2Z1MA 1N92A 5A05A 4YJHB 2EKQA 1E1KA 4YR9A 3K8ZA 4LN1A 3W8DA 4YEDA 3I83A 5TQVA 1MP0A 1F0YA 4R4JA 1RJWA 1UJMA 3WR5A 5GZ1A 5L40A 3Q6IA 3GRPA 1XIVA 4LGVA 1YBAA 5COBA 4AVYA 3DQPA 4RVUA 3MTGA 4PLCA 1EUCA 1HRDA 1T2CA 3M1LA 1P0CA 4RGBA 3CZMA 3P2YA 1E7MA 1X7DA 1HLPA 1MG0A 5TJHA 4Q39A 5JO0A 1CWUA 2WE7A 2NU7A 1R66A 3E18A 1F8FA 1Z6ZA 1HSOA 2CFCA 3BAZA 2I65A 3DTYA 4OSOA 4UUNA 1KC1A 3IP1A 3CMMA 4NBVA 3WGYA 1J49A 1P1HA 4B7UA 1LDNA 3CZRA 4FJ1A 1PQWA 2NWQA 2VRBA 3NYWA 4PVDA 3RUDA 2DC1A 1NM5A 2ZTLA 1H2BA 1LEHA 2OFPA 1P9LA 2O3TA 3WNQA 3CEAA 3DZHA 4OAQA 1ISMA 3WGOA 4ZJUA 3CH6A 1ISJA 4J7XA 3WSVA 4XDZA 3BXXA 5DOZA 3EYWA 3RKUA 1SB8A 4W9NC 1MXFA 1WNTA 3TOZA 4FW8A 1Y5RA 1GU7A 3BHMA 3ZWOA 2AQ8A 1HDXA 4NQZA 3L6EA 5H82A 3OIFA 1X0XA 2X9GA 1W0CA 2NUAA 1EDZA 5AYVA 1DC5A 1U9JA 3PTZA 4FJ0A 1Y1PA 2W98A 1CETA 1GZ6A 3C1TA 4W6ZA 3TQHA 4IIUA 4J0FA 4YB8A 5BNFA 4B4UA 2W4QA 1MC4A 3Q9NA 5T8KC 3AOGA 3GEGA 4ZU3A 1D4FA 1LSSA 2FMUA 2ZB4A 5TRTA 4CMJA 1U2GA 1V8BA 4J4HA 4XQCA 1XEAA 4R54A 1JWBB 2PD3A 3GDGA 2A9FA 3E82A 1J6UA 4J16A 1D1TA 4RF3A 2V6MA 4Y6RA 1C1DA 4CODB 3B20A 4FOOA 3OA0A 5L7YA 4WUVA 3HE3A 4IS3A 3NJ4A 2PGJA 2AW5A 4IXWA 2IODA 4AJJA 2FRDA 4O59O 3UW3A 4LISA 3DBVO 2P9EA 4E2ZA 4L8VA 4YRAA 1Z82A 1XELA 1NP3A 4LCEA 1JA9A 1DC6A 1YB5A 3ZV3A 3KLPX 1WP4A 2POQX 2IDZA 1DHTA 1TVEA 4WKGA 3L0DA 3QLJA 3HUDA 3DBHB 3H5NA 3ETDA 5G2OA 1C1XA 1BWSA 2HMUA 1QP8A 1YL5A 3JQ7A 1ZK4A 1ZUD1 3A4VA 3HB5X 1FXSA 1CDOA 4HV4A 3V2UA 2OZPA 4UVIA 4OQZA 4W7HA 4DMMA 4W4TA 1EDOA 1ZBQA 2VZ8A 4GI2A 3GNTA 4LCJA 3UVEA 1U2DA 2X23A 1NWHA 1IHXA 3OMLA 1ADBA 3W4KA 1T26A 1IULA 3O26A 4BKPA 1R0SA 2FZWA 4YQZA 1Y8RA 3MEQA 4IS2A 2NLOA 1JKJA 2X58A 4MOWA 5IAAA 1Q7BA 4HFJA 4RV9A 4TRMA 1Z7EA 5U1PA 4DC1A 2WE8A 4F45A 4AJPA 2FR1A 2Q1SA 4MPDA 4I5EA 3C7DB 1MGOA 3WMWA 5L53A 1P1JA 4D44A 3OM9A 3AFMA 4B8WA 4JBIA 3UN1A 4GQAA 4E31A 1X7HA 3L6DA 2DPGA 3OA2A 2IEBA 5AQ1A 2JJYA 2HUNA 3HDHA 5A04A 4ND3A 1UXGA 4UVGA 3RSHA 2D5AA 4NZ9A 3INRA 1Q7GA 3DBLB 2CVQA 1U5CA 1GUZA 1RPNA 3E5RA 4BO3A 2FR0A 4ALNA 3VOSA 2BRUA 3VPGA 4EUEA 4YT8A 5JO9A 1QMGA 2GPTA 1HYGA 3ZNOA 4R3NA 4E6PA 2P91A 1KIFA 2Y93A 2CVZA 1OFGA 4NFHA 3KETA 4UREA 4DIOA 2AEMA 1HF3A 1VC2A 5CHEA 4W82A 4HBGA 3EAGA 2O7QA 5A06A 5JDCA 1GV0A 1PWZA 3FI9A 4DWVA 2E82A 2Q1WA 3E6AA 3PGJA 1M66A 4AL4A 1UDAA 4XA8A 4ZD6A 6LDHA 1E7QA 4ND1A 2NVUB 1JVBA 4A03A 3PWZA 1GEGA 4OOFA 1GY8A 4M8SA 4TMFA 3UUWA 3VPXA 4EJMA 4AJHA 1ZXBA 1PJBA 4J1QA 2C59A 5FWNA 5IFLA 3ANNA 1E7SA 3EDMA 4Q3BA 1Q0QA 4E30A 1NQOA 4AICA 4GSKA 4PG6A 3QWBA 2BH9A 1EK6A 3AY7A 5CDGA 2JFHA 4XR9A 4B3IA 2W2KA 4IIVA 4PZEA 4XGNA 1M6HA 2P4HX 3D3WA 3HN2A 1VLLA 2VZ0A 4GVLA 4JROA 4Y6SA 3WGIA 3HZZA 3EK2A 4FJ2A 4O63O 3PWSA 4UUOA 2X6TA 3VH3A 4BMNA 4FFMA 1ZNQO 4C7KA 3NGXA 3ZH2A 1GYPA 2PV7A 4CLRA 1LQUA 3GZNB 5CDUA 5DT9A 3SC6A 4R16A 3T7CA 2DT5A 2GASA 2VN8A 4OJNA 1NVGA 2XXBA 1N7HA 4U5QA 4XB2A 4A2CA 4IGFA 3PHLA 3C3XA 1A4UA 3JQAA 3H6KA 4IQ0A 4HUJA 4DLAA 4E2WA 3S1LA 2GN4A 1PL7A 4Q3DA 4PN3A 3OJFA 2AE2A 1DEHA 2Z95A 5AXAA 4UEOA 4Y9DA 3SEFA 2C07A 2JHGA 1U8XX 2PGLA 4GWGA 1HE5A 4NMHA 4FGSA 5EERA 3DMYA 4BNHA 1NVMB 2JCYA 5F1PA 4NU6A 4M55A 5GMOA 4FFPA 4K28A 1Q2XA 3ZW9A 4OXKA 2Q45A 3DL2A 3GFGA 3BMNB 4RORA 3ZHXA 3DZKA 3PK0A 4J4TA 4TVBA 4H15A 3ST7A 3WQQA 3C7CB 3AUSA 5DP1A 3G3EA 1C0KA 3JQBC 4PGFA 1PJLA 2YFHA 4Z3DA 5F3RA 4XGKA 1PS0A 1T1RA 1E3SA 1B7GO 2DQ4A 3UF0A 4BB5A 3BA1A 4YAJA 3ZDFA 2QYTA 5F21A 5I9MA 4EGFA 4ZQGA 4KTTE 1HYEA 1MUUA 2HCTA 1EE2A 3BIOA 3INGA 4GBJA 3JD0A 3B1FA 3WIDA 4C7JA 4TVOA 3PZRA 2UVDA 1QR6A 1PQUA 4S1VA 4BNYA 3O38A 3QWAA 4RF2A 1H6DA 8LDHA 3I9JA 1DC3A 4AJ2A 2Q99A 5KVVA 1WDKA 1Q0HA 1ZXLA 2HJSA 3JV7A 4ROSA 4BNMA 4IGEA 4OXYA 2QQ5A 3JD3A 3EVTA 2Q49A 4RF5A 4JK3A 2VOJA 4YQYA 4YCAA 2NNLD 2XXJA 3RU9A 3LF2A 4GKVA 3U9LA 4EEXA 3P5SA 3WLEA 3DONA 1VL8A 3SJ7A 2PA3A 1QV6A 3GHHA 4OXNA 1KVUA 4R3WA 2OL4A 3IL2A 2PH5A 3RFXA 5IN4A 1N2SA 3WIEA 4A5OA 5TC4A 4LRSB 1ZH8A 4BNVA 1NHGA 4XD2A 4NFYA 3IUSA 2BLLA 3OIDA 4Z0PA 1UP4A 3VC7A 2XAAA 1J4AA 1JVSA 4ZHSA 5G4KA 3T4EA 1NR7A 1NVTA 2LDBA 3D3EA 3KB6A 3NDIA 5EJ2A 2WEKA 2Y0EA 3FRJA 1U4SA 4BO8A 2HLPA 2GYYA 4PG7A 1HEUA 4CMBA 1EFKA 2X9VA 4B4VA 4PRLA 2VYVD 1QSGA 3GDFA 5JLAA 5JNLA 4OKIA 4PLHA 1AHHA 2C29D 1PX0A 1B8VA 2HMWA 4PLPA 3GC6A 4Q9NA 1QV7A 4YWJA 2IXAA 1U4OA 2VWQA 5DCUA 5B4TA 1LLDA 3IDSA 4LMRA 1ZFNA 2OOSA 4P4LA 4PCVA 1TT5A 3JQ6A 3F47A 4ZQHA 2JAPA 1WVGA 4QO8A 2AQKA 2QRLA 3RUFA 1EVYA 2OP1A 1ADCA 2HQ1A 4II3A 1YB4A 2HMVA 2ZATA 5U4QA 3VPHA 3QV1A 5KNLA 1B3BA 4NBTA 2Y1EA 1C0LA 3V5NA 4BO0A 1ZK1A 4ZQBA 3RIHA 2HK7A 3ZNQA 1PEDA 5L4NA 3PQEA 1ADGA 1NTOA 3W4IA 1VKNA 1JDJA 1BXKA 5A1TA 4E12A 2GGSA 3VKVA 3WICA 4Q3CA 1PL6A 1YBVA 2R6JA 3SXPA 2GUGA 1PS8A 4NBRA 3ROPA 2ZQYA 4JP2A 3GVCA 5G4LA 3I9MA 4Z3KA 2JHFA 1HKUA 3L9XA 3MOIA 3LLSA 2WYUA 3JQCA 3GAZA 4G65A 3ZWVA 3UCEA 1ZEMA 3LLVA 1SO8A 3O8QA 3VKUA 4CM8A 2E48A 5IDXA 3F4BA 4BNUA 3SX2A 3LT2A 4IDAA 2O3SA 3UHAA 3L07A 3N58A 4PFJA 1B3RA 3ZN2A 1R4MA 2VHYA 3ZWNA 1DSSG 1XYGA 1PTJA 4CLDA 3FNGA 4AFNA 5C5IA 2DVMA 3OICA 3LSYA 5KJFA 4OOEA 1H0KA 4I8XA 5JAQA 2X86A 3K30A 2CUKA 4BV9A 4FFOA 3INTA 4IDGA 3ITDA 3HADA 1KVTA 4J6FA 2GD1O 3EHEA 1ONOA 4I1IA 1E3IA 4J43A 5DNAA 3NT4A 4GGPA 3JQFC 5AXCA 9LDTA 4CLOA 5JCXA 1J5PA 2J5QA 2J6IA 2WMDA 3BHIA 3KYCB 3NTQA 1HDYA 3ROMA 3VDRA 4A27A 4L4XA 3QHAA 1XU9A 1AXEA 4E21A 2F1KA 4Z9YA 1YVEI 5KKCA 1H2HA 3WSWA 1B14A 4WE3A 1UDBA 4IXTA 3LT1A 3PFWO 3Q11A 1V3UA 1Y8QB 1CJCA 3HDJA 4LVCA 5COAA 1DIGA 1A72A 1KYQA 4RQTA 3RVDA 3R6DA 4WLFA 2I6TA 4A10A 3BYZA 1LXCA 1BDBA 2G1UA 4MIOA 2BGKA 3LU1A 2H9IA 1ZJZA 3NTOA 1WMAA 2QZZA 3AM4A 5CFZA 3ZGYA 1I3KA 3GK3A 1NYTA 1S6YA 4BNKA 4RLSA 3LQFA 3ZWPA 4DPMA 2BF7A 1V6AA 4KUEA 1FMCA 3QA9A 5DBIA 2RAFA 5LC1A 4CQLA 3S2EA 3NJ8A 4YAIA 1Y81A 2QYSA 1WXDA 1HZJA 3PZBA 1NQAO 3GEMA 1M2WA 1RYEA 1ONPA 5KCZA 2ZB8A 3RFTA 1SOWA 3RASA 1UH5A 1XCBA 1HDGO 3ZZNA 1GEEA 1T2EA 4CR6A 2VYND 4HNHA 4E0BA 2C5EA 3C24A 5JS6A 3OP4A 4GKBA 1U28A 2X5KO 2B83A 4L76A 4F3YA 5JSFA 4QSMA 4E5YA 1NR1A 3VZRA 4CLOB 2B69A 5KWEA 1LRJA 5JCJD 1PJ2A 2PZLA 4AJEA 4BNJA 3Q1LA 1B0AA 4GL4A 4LW8A 3ONEA 4HFRA 2H6EA 3FR8A 4CV2A 4XIYA 5HM8A 1D8AA 3GPDG 3TWOA 1EEHA 3RQSA 2BI8A 3PGXA 5CDSA 4DQXA 2NTVA 5ADHA 2G17A 2EKPA 5K9ZA 1PGNA 2P2SA 1WAMA 3OEYA 1I33A 4J4BA 4FSHA 4NH4A 4QX6A 4PZDA 1J0XO 2TMDA 4AJ1A 3O4RA 2WSBA 1LSOA 1SB9A 3JQAB 3OJ0A 3OECA 3TRIA 4BHTA 4BO5A 3OJEA 4NK5A 3KHUA 2Y1CA 1F17A 3WBFA 4RO0A 1YDEA 4DXHA 3OETA 3QWHA 4TSKA 2UAGA 1EMDA 1ISGA 2PD4A 2VHWA 3K2BA 1SBYA 3VTZA 2HMTA 4PRKA 1OC4A 4J3FA 1ZK2A 5K6AA 1IYZA 3RJ9A 2AMFA 1LNQA 2OUIA 3IKVA 4RVSA 3LZ6A 2GZ3A 1HDRA 3KYDA 4KTVE 3P2OA 3ZNPA 3PLRA 3ASVA 4FC7A 2ZTMA 5I7FA 3U62A 3GY0A 1DJQA 2BFMA 2PZJA 4BVAA 1E5LA 4ND5A 4AJKA 3DZIA 1BHSA 2WD8A 4BGEA 4DRYA 4QFCA 1ZSYA 1D7OA 3KYCA 3VZPA 1C1XB 4EYEA 4R69A 1YJQA 5TJ9A 2EKLA 1DFIA 3U4CA 3ZU3A 1I8TA 1H6BA 2R2GA 2EP5A 2E49A 3NUGA
chains in the Genus database with same CATH superfamily
5BSFA 4K6FA 3F90A 1TYCA 3ZCRA 1OI4A 1ZRHA 4C03A 5DHRA 1ZK3A 2ZRBA 4QULA 3D43A 4W7IA 3H1TA 4HAVA 4JC5A 3L2OB 1I1HA 4D0RA 3OO1A 1PQPA 5CT9A 1W19A 3EY9A 4WY2A 1CUUA 3HJUA 4I50F 1X14A 3DMNA 1ZOIA 4PC1A 4K05A 5CT6A 3UGTA 3NVAA 1LFDB 3OESA 1Z5VA 3PPWA 4GMHA 2QL9A 1IY1A 4HJRA 1UJ2A 4B2PA 1M2OB 3H7IA 3IIJA 1UBOS 1H9AA 2CF5A 2QVYX 3LQKA 4MJ3A 4OGKA 4QXOA 2OXFA 2PZMA 5HIJA 2GF9A 1ESMA 1W6RA 2R6FA 4IMPA 3C7AA 3D2CA 3H0KA 2B92A 3DVLA 3OFKA 4E1AA 2FOXA 4MPJA 3T1TA 3OURA 2E0IA 2EWWA 3OQHA 1BQ4A 4X1KB 4I1SA 1QIKA 4G3XA 1GN8A 1W96A 2ECFA 5CDFE 3QMPA 1LPBB 1KE2A 1JLHA 3Q15C 5DWQA 4QM6A 3ANLA 2NP6A 2P30A 3LFHA 3JALB 4CKBB 4RHFA 1A95A 1Z34A 3Q7TA 3IJEB 3GIDA 1WSAA 4P2GA 5CVJA 1NHWA 4RSHA 4NBKA 1MT3A 1K7SN 5CIWA 4TXHA 4LOIA 2BEVB 4NJEA 1CY1A 3AR6A 3MWEB 3C1AA 2FETA 5K1ZA 1EKXA 1XP8A 3M5CA 4G5XA 3K4HA 4HUQA 3JQ9A 3I8OA 3OLXA 1G8FA 2F59A 2HHCA 2P0EA 2WYVA 1EK2A 2ZTSA 4V3CA 4A82A 1B23P 1E2GA 2HL6A 2C31A 5GONB 1F14A 1UBTS 4UNQA 4M53A 1U3TA 3SLGA 3IURA 1RMTA 3QVXA 4IJVA 3L41A 3N7TA 1AURA 5J9FA 3SHTA 5BN5A 1CP2A 3CN9A 3BORA 1N5IA 3Q3JB 1I10A 3BIWA 4FLFA 3TF5A 5CAEA 4DPKA 3IPLA 3ZHCA 4NMMA 2X2FA 1KE1A 1M8JA 4RNCA 2X15A 1G63A 5IJ0B 4CG1A 4U8HA 2FRXA 5CNKA 3G0BA 2X5NA 1YV9A 1LFAA 2C96A 4RU1A 3F6RA 1E7WA 4KIGA 5ILGA 3SU8A 1SIWA 3Q8KA 1TA0A 4R1UA 4OHVA 1C30A 4C9BA 4ZHQF 1YB7A 5BWMA 3DJYA 3KDAA 2O7VA 1W4CA 2JHPA 3NWJA 5JYDA 1H8EA 1V8DA 2EXXA 2ZFUA 1JKFA 4YJ2B 4IDEA 3U5TA 1YASA 2OHFA 1DDGA 2BZSA 3TL3A 1QWOA 3N74A 3KSDO 3ZZ0A 4RCVA 2UZ4A 2Q5HA 5BW4A 3ZIAD 3UA4A 1C9MA 3SJAA 2VYNA 3OQPA 3U1VA 4EI8A 1DOZA 5JAUA 1IXKA 3ICPA 3P32A 2XUIA 2EQAA 3JX9A 2QEQA 1XKLA 1TOAA 1FMLA 1KO8A 2ACWA 4GSLA 3L1UA 1N25A 3I5XA 3DZBA 3H5OA 4MQLA 3L3BA 1VGQA 1DELA 3LUCA 1I3CA 3QBTA 4EG3A 2EP7A 5KQRA 3AQIA 2ZJ8A 1QGAA 3QVTA 4CKCB 3DR5A 5A4IS 3HLTA 2GN6A 3FY4A 2YHIA 1T3LA 3RBAA 4ZTBA 4IR7A 4FYIA 1W85A 4QFDA 3KZ1E 1W5EA 4HLUA 5B1YA 3AERB 3K92A 2VJKA 2JRLA 5EL0A 1FXUA 3MGAA 4YUVA 1I2ZA 2WWYA 1TEZA 1R15A 1Z68A 2J3EA 3DZJA 2YMQA 2Z5LA 3G0CA 3RGWS 5CPBA 1BXGB 2VUIB 1IXZA 1N6LA 2NO4A 1OIWA 2PL1A 1XYYA 4FVTA 4BAZA 3AIIA 1WM1A 2WVGA 1DKOA 2VNJA 1GU0A 3SYRA 1NLFA 3H9GA 1JPNA 3IBYA 2QD1A 4JENA 4RIIA 4Y98A 1ZZEA 1AKQA 2F1HA 2R3SA 3WNCA 3PFNA 5A9SA 1X3SA 4IIFA 4NBWA 1I7NA 1X39A 2DYKA 2ZT5A 1G42A 4JNKA 5C31A 1GTRA 3DLHA 1BXRA 1JU9A 2HMSA 2X42A 3LQRA 3JPYA 1IPFA 1ONBA 4M6WA 5KNBH 1N9KA 2WKWA 4KEAA 4Z6KA 1NTRA 1YK1A 5AJHA 3EGOA 4AT1A 2IJGX 2N3ZA 2PQ0A 1QLHA 3B70A 1DZ3A 4B82A 3A70A 4DYVA 4EG7A 3CEHA 1KP9A 2OBBA 3KXKA 4MUIA 3WIVA 1I1OA 3T3HA 4LHWA 1PD1A 5SYAA 5TNXA 1NVBA 1HDCA 3OQIA 3GNQA 2PFSA 3JSXA 1TF2A 2FFBA 2O2EA 3QOXA 1TVCA 5A7HA 5I4BA 1J2JA 3IEMA 1C5KA 1XXHE 2QE7A 3WKCA 1QQAA 2P9FA 1KS9A 1E89A 1MA0A 2ZKIA 3C6YA 3DBRA 4H7JA 1V9LA 1BCRB 3M6WA 3G5LA 4LX8A 4XUDA 2RK6A 3TW6A 4C7OB 1M2NA 1XMJA 2EBUA 5HW0A 4CLHA 1G1MA 4QUJA 4WLOA 4B1FA 4UULA 2RGDA 4ON9A 4MIYA 1KVQA 1LDEA 3H3JA 3D4LA 1E4YA 1E18A 3DPIA 2VG8A 4UMVA 4OLBA 3M4JA 1E20A 3L7NA 4F9EA 1TM1E 1O97C 2W6JD 5FD8A 3DVQX 2MT9A 4DJDC 4FCTA 3PQFA 1JZSA 1XQ1A 3E53A 4MX8A 5IVDA 4BCBA 4EDFA 3PEYA 2DLNA 1CIJA 1CZOA 2GRAA 4P2BA 4AF7A 1XD2B 2AOTA 4WLVA 2JGMA 1GG5A 4C2UA 1IY2A 1OASA 4XUGB 4ANFA 1JILA 3EGIA 1GTSA 3VGJA 3OQBA 4AF6A 4WUTA 2QE7D 2W22A 4NATA 2R7NA 2J3KA 1EX7A 4ND8A 4X20A 4ZRDA 4Z1MA 3VDNB 4GOXA 7ABPA 4DQ0A 1A76A 1HE2A 5EPEA 2DPLA 4EB3A 1N9GA 3K0EA 2H4WA 4MGIR 1GDHA 4QGGA 1R37A 1RHJA 2LXNA 2ZRGA 4RLHA 4Y0NA 4DPLA 2CBXA 1XMQB 4FZJA 2ANBA 3TL2A 2X9QA 4AX8A 1A5TA 3H1BA 5I8ZA 4WNCA 4JLUA 5EWMB 3AVTA 2YH2A 3MTQA 4HADA 1S3GA 4P58A 3EDYA 2ENWA 2V6IA 3L40A 3PFKA 2VJAA 5HE9A 2WIJA 4LXYA 2CY0A 1AU9A 2ZBUA 3ZY4A 2VTBB 4HQ6A 1E1CB 1AQUA 4BUCA 1QIDA 3DWFA 4PANA 5GGYA 4O33A 1AD2A 1XQ6A 2D1QA 4MVWA 3DFMA 4KMSA 4F3TA 2ORIA 5LU9A 3KZXA 3B3GA 2C20A 1M6WA 1N3LA 2EHDA 2YW2A 4DANA 5B5SA 1F20A 4GGMX 3FTNA 4NCKA 4YCCA 1E64A 2QN6A 3NHYA 2H5JA 4BAUA 3PVSA 3ONWA 1X86B 3LOPA 4MI1A 3R7LA 2W6OA 4F2HA 3CCBA 3D0KA 4PYKA 1KK1A 4XTRA 1ORDA 4H4DA 3K71B 4ZO4A 1L7NA 4X97A 4IRXA 4BATA 1M2KA 3OZVA 4Q24A 2HDHA 2BT4A 2YHIB 2CHUA 2C57A 2O0HA 2QT0A 2IXGA 4Q4DA 1J42A 2Q1XA 1R0KA 1W75A 1GP2A 2JAOA 3FLMA 1HYHA 1TCUA 4EB6A 3RHFA 3BGSA 2BMEA 3SIXA 3HY6A 1ODSA 4KFUA 2QR5A 3GH3A 1DCMA 4KN6A 4X3PA 2IS4A 2W2OA 4N7RA 4Y2RA 1DBRA 1N6NA 5E2AA 5KI6A 4BN5A 5AKJA 4OY3A 2SICE 3P2JA 4ZARA 5AW9A 2CMGA 5TGTA 2A0WA 1NJFA 1NNUA 2E1PA 3PA8A 4R9UC 4AC9A 2FPPA 4R71A 3MLAA 1OV4A 1F2TB 4HPJB 4PLTA 5JBQA 4X63A 2VHTA 3FUWA 3OKAA 4G2TA 2IVZA 2OXEA 1J2RA 3TZLA 5CJ2A 2FKNA 5E4YA 1YJ5A 3CF4G 2WDZA 3HM2A 3Q88A 4LG1A 4I99A 1BXRB 4LJAA 2QG9A 2Z6AA 1X2EA 4LUCA 2EFHB 4LZJA 1GL7A 4WNAA 4B4DA 3FGZA 3THXB 1SRRA 1LWOA 4M89A 4MWDA 4QUEA 3R3ZA 4KGDA 2BFFA 3EGDB 2NXEA 1M33A 1HY3A 4JJIA 4TQ9A 4DQKA 4E5PA 1WWKA 3A4LA 3CN7A 3T5DA 4CM4B 3CMCO 5IMBA 4HWRA 1P18A 1JHAA 1SBCA 4L22A 4W63A 4EH1A 2GCGA 4EPRA 3WLQA 1P73A 1XQ9A 3LF1A 1BHJA 1EG7A 2X1MA 3HYSA 4IINA 4R1PA 4YJDA 4BNWA 5CEFA 5JQWA 1XLUA 2C7RA 2XB2A 5DULA 2C83A 3WLAA 1QH9A 2FJ0A 2DLDA 3PDIA 4MVJE 4NS4A 3UHJA 5J4VA 4Q4HA 1H3EA 1DJMA 3USES 4I9HA 5K0ZA 1NONA 1OV6A 3FH0A 3NM5A 4MGKR 1NFFA 1ZIXA 1CJUC 4X41A 1HE8B 4X8LA 3JASB 3RKRA 1K7EB 1P44A 2ANCA 3TJZA 4AJIA 1V3TA 4EGCB 4HLDA 2GVDC 5CCDA 1F9EA 1GT6A 3OJCA 1J0AA 1HMYA 4BMYA 2RGUA 3IE0A 1LI4A 4XFJA 2O8FA 4L6AA 1DOHA 2CDRA 4PSKA 5A7FA 1N5OX 3AB7A 4FQ7A 1MQSA 2Q5IA 4ZVOA 5JBIA 2UXDB 4ZEWA 3RS5A 5JJCA 4NECA 2B5OA 1JDVA 4OJMX 5AKLA 4B7CA 4E46A 3DTVA 3UC9A 3ZLBA 1LTHR 2R84A 4AY5A 1N2BA 5F5LA 1YB2A 3HXOA 3B1KA 5BN3B 1N77A 4GKKB 4WCFA 5GV8A 3ZLTA 1MB0A 2Z1NA 4DYDA 1PCXA 1TMOA 1H05A 1R4AA 3E1KA 4GMFA 2BMWA 2DX7A 2G7MC 4EUHA 1FNCA 1TLLA 4P0QB 3UUFA 3A4YA 5IF3A 1H4QA 4ZK6A 5E0OA 5DXAA 1NP7A 3BJEA 3VTFA 2R00A 4XYMA 1TTTA 2PS3A 4NMLA 1BMTA 4CJXA 2VHZA 2HTEA 1MB4A 2E5LB 2RKBA 1YA8A 5CCBA 1GRVA 2VXOA 2PBFA 3SMQA 3LQ4A 2JVKA 1LLCA 1U0FA 1Y1RA 3O75A 4QOGA 1B1CA 3OMWA 5HKKD 5C9ZA 3ZWYA 4CMKA 3MTJA 4P86A 4E2YA 3EW9A 2G76A 3OIUA 3LPNA 4NDNE 4NSNA 3UJ9A 3FZEA 3LPLA 3K0HA 1ZCAA 4AKSA 5JXGA 4BKUA 2FVXA 5C8XA 1A9YA 3CPJB 5DYYA 4KR9A 1G5HA 5EWLB 4DV5B 3H7AA 3HB9A 3UJAA 1Z5OA 1X7YA 4CLRB 5C80A 4QXAA 1FFSA 2QW0X 4BMSA 2R47A 3AJ9A 3JQBA 3DE2X 3OY2A 3M9WA 3R7SA 1RRKA 4TLEA 5EG5A 4CCSA 4M0LA 2ROQA 4YV1A 4GPD1 3VUEA 2O1SA 4FDVA 4BFUA 5IH7A 3AI7A 2XF2A 2HMAA 4QL3A 4X85A 3QW2A 4Y2HA 4XI9A 3WC4A 3KPWA 4K6CA 4B81A 5K8CA 1QYIA 5B57C 1JEYB 5E1OA 2UVQA 4MNTA 4L16A 4LRTB 4MLDA 4MP6A 1C80A 2OV2A 4XH9B 5FI3A 1B15A 2XMGA 3JY6A 3OHSX 2GZ1A 2FEKA 2VSYA 3QBEA 4GVPA 4E32A 2PXCA 3CM0A 3O8OA 2IZ1A 3CZ4A 3QG5A 2FKAA 3ET5A 4G09A 4X7BA 3H3FA 1IHDA 1YE3A 2ZUWA 3NW9A 3WHKA 1SCUA 2P9TA 3ISJA 3HWRA 3S99A 4OO3A 5GP1A 1QM5A 3KXPA 2IH4A 4D97A 2REQB 2PRZA 4YS6A 2CW5A 2H4FA 5CEJA 1GAEO 5FKJA 4B8ZA 3F96A 5A2GA 3PDUA 1F0KA 4TRRA 4UM9D 2A0UA 2QX4A 4ZGBA 5A3JA 1E3MA 2UZ1B 1G1AA 1O58A 1W46A 5AH0A 3O3NB 1L5KA 3FNIA 2I8LA 3MGGA 1RABA 1PKEA 1QRRA 3MAAC 1BAPA 1JG6A 5JHGB 2YZ2A 2WAOA 3BMQA 3ZPXA 3GLFA 3CVUA 2XUQA 1Z8DA 2FQWA 3CONA 4F3RA 5B2FA 2IX3A 1E9FA 1X7XB 2JIRA 5HJ2A 1IB6A 3P20A 4ZAFA 5CA1F 1JG3A 1EHYA 2AJDA 1EYZA 2IHUA 4P8RA 1SWVA 3OEED 2ZUDA 4R5MA 5I45A 4R1TA 1TM7E 2QRKA 1PHPA 1CY7A 2JGEA 1KEEB 3I9LA 4UASA 4XCVA 4ALIA 4E5YA 3AUYA 3O2SB 2G0AA 4M1KA 2XQFA 4O2AF 5DSZA 2CVFA 3NBFA 5G1PA 5J2UA 3THWB 1OFTA 3NBYC 1IN1A 1GLVA 4RTPA 3A6HA 1Q3TA 3FCCA 3GLKA 3DDNA 3NHRA 4LV6A 4GU5A 4G56A 4UUQA 5EHGA 2PWZA 1VI2A 2B7BA 2QN9A 5AXDA 2IYYA 3RVBA 7GPBA 1N6HA 3OPYA 1SKYB 4GYYA 3U19A 4UTNA 4AJNA 3LDFA 3HACA 1M0SA 1JT9A 2JCGA 1FNDA 4IUYA 5CP8A 2EVWX 1SVWA 1NBEA 4UAUA 1VBFA 1TRKA 3MS7A 3I8XA 4BZXA 2AEFA 3N2KB 4K9RA 4JUFA 4RLFA 5EPUA 1HSZA 3IRUA 4NFLA 4Z3KA 3NWOA 3GLHE 4QLAA 1IM2A 3ZCQA 2YRWA 3CGGA 6ABPA 3HK2A 2A35A 4C0SA 1NYRA 4RK0A 5HBGA 1E5DA 2AGVA 1JHPA 4LWZA 4FQ8A 1L6RA 1IPHA 1ESNA 1BSVA 1C3VA 3G0GA 3N2LA 4PG4A 1YKFA 2XPCA 4HLUC 4L27A 1DUVG 4JOSA 4GM0A 3AEKA 4LYEA 5TPWB 2ZQZA 1LPMA 3SSMA 5KYYA 5EIHA 3T7AA 4KQJA 1W88B 4IDOA 3HO6A 1RR6A 5KO2A 1RU3A 3CB2A 2EZ8A 3M33A 4RYLA 3I1FA 4N47A 4U7DA 1CUDA 2FA9A 2HWYA 4H1WA 4MYRA 2QAIA 3BJIC 2Y99A 2ZDHA 4TN1A 3VR4A 1MAUA 2ZUUA 3L77A 1W52X 1I2BA 3PFFA 2QRVB 5DHQA 3REGA 3NNDA 3FNBA 5DHUA 3WL8A 3N7UA 5FH9A 3KJGA 4YJ3F 1RZVA 1XZLA 2GJ9A 4NMWA 2YZKA 4J75A 1HORA 4BVKA 4EATA 5KJ6A 1OIXA 3BIXA 2O7SA 1KI9A 4OQYA 5BSUA 3JRWA 1PSDA 1A9XA 3GAFA 4AS2A 3DP9A 3KS9A 2HZ7A 1XRJA 5M3BA 3T5BA 1Q0SA 3ZUGA 1V11B 5FPTA 2I6QA 3TZHA 4HBZA 2CYBA 2VBCA 4QOJA 4Y3UA 4D0GA 4EOGA 3WRYC 4X62B 3PFIA 1JFRA 1U5BA 1W73A 1XQVA 2O7RA 4OA8A 2FPGA 4X00A 3T0IA 3IKLA 3TAXA 3U61B 3NC1C 3G13A 1RZRD 2BSQA 3F3KA 4ROTA 1JTFA 4JI3B 1HK7A 1POWA 1YL7A 1X13A 1KNQA 3TR5A 1YIDA 5FPPA 3DEZA 5EUCA 3IAFA 4QQKA 4OH1A 1UIMA 2F67A 1FX1A 4EHDA 4DA9A 4ZT3A 2I6GA 5E6SB 3RJ5A 4BVHA 3D7MA 2DULA 4ZK2A 2VTDA 5HBRA 2ZJ1A 4Q3LA 3DQZA 3CU5A 2O2HA 3X1XA 1MJ5A 3HJAA 1P60A 3I23A 3CLTC 4PZPA 4Y67A 2ODWA 4AKHA 1TLTA 5H83A 3IQIX 1MT0A 2E18A 2P6MA 3CX7A 4IJQA 5EKUA 4L8FA 1L5GB 1WNFA 3IEPA 5CB6A 4ZJYA 3N76A 3ZHVA 5M2QA 3GLFE 3SYLA 3BWVA 3LP5A 4K87A 2YNMA 2FWJA 1J07A 1JEAA 1S01A 3MJTA 2NZUG 4M99A 2IYTA 2WKQA 3AUUA 4OV6B 4L4RA 3TQIA 4I0WB 4AMBA 3T5TA 1NJ2A 2EW2A 4MW6A 3KOZA 2XGOA 5JPIA 2WOOA 4DLWA 1M6VB 1RYMA 1P4JA 2VZEA 2XCLA 2ZIAA 3CVXA 3B3AA 4FCCA 3ZW8A 4L0MA 4A2WA 1CJMA 4B75A 3OOEA 3HA3A 4JKIA 4KGVA 4ARCA 4EQ6B 3I4CA 2Z2XA 2F6RA 2PRJA 1AF7A 3GN1A 4OMUA 3FOAA 4V0MA 1XEWX 4B2YA 4Q1VA 4XPIA 1NXOA 4PLZA 4D45A 3FCXA 2AMYA 4ALJA 4NBUA 5HJEA 2IQ5A 2NT3A 3VV3A 2D5IA 1GGFA 4RMHA 4OJQA 5EE9A 1E6MA 1OMOA 1Q12A 2YYYA 1Z6AA 3EEIA 2IYFA 1OTYA 1SCDA 4OQPA 4OREX 1Q57A 2XNSA 4G0YA 4G4SO 1P2BA 1VLJA 1O4WA 1XG5A 2PKWA 3DNFA 4NPCA 4B7XA 1VLMA 2B0JA 3IAXA 3IJRA 2R97A 4I4CA 3DMFA 3OC6A 4GQIA 2VT3A 2PVCA 1TF5A 2C3PA 1A77A 1FSZA 4QQRA 1Y5MA 1P4RA 1QIIA 4Y2YA 4X95A 1C4OA 5K4AA 3STVA 5L4LA 4Z1OA 1JT2A 1UJ5A 4WBNF 3QIVA 3VOBA 3ZE2B 3AEXA 2IOFA 1P91A 4TS3A 4NONA 4M1WA 3OPYI 1SQ5A 2E55A 5ES4B 4IDBA 5AM5A 1C1YA 4XX0A 5IKXA 3JU3A 3HO1A 2B30A 3HZRA 4CDNA 1FFEA 1P75A 2IIPA 2C2HA 2X41A 4D9CA 4S2UA 5EKSA 5CFPA 2WWVD 2R0QC 1P5FA 2C4HA 3C48A 4MVJI 2JLVA 5K8UA 3S6JA 1PFKA 3W5UA 5EIXA 3GCGA 3N7AA 1JR2A 3PJDA 1FNSA 1ZL2A 3IB3A 2NU9B 3S2IA 2B8JA 2OQRA 4QGHA 3TW4A 3V4FA 3K9GA 4FK8A 4H7HA 1Z0FA 1E3WA 4Z86A 4JI4B 1USVA 2WM2A 1EK5A 4KQ2A 2MMGA 4CKZA 4MB6A 2XT0A 2WJIA 2OO5A 1KEZA 3PC3A 1D2CA 1FYEA 1U4NA 4DT1B 1RLIA 1T35A 5HG0A 2R87A 3MCVA 1L7AA 3CWQA 1P2TA 2RJNA 4RQUA 1K66A 3OAAD 1IATA 3KQQA 1JTVA 1KBZA 4JB2A 2NSYA 2WZDA 3M2TA 1KHTA 4UNPA 4MDHA 1S4QA 3E61A 3G0HA 4JLWA 1RHKA 4HK4A 2HH9A 3QXCA 4F1KA 4D80A 3LI2A 5BVHA 4HO1X 2AN5A 2HUPA 1P61B 3N8GA 2CXXA 4S1OA 3KTOA 1E5TA 5D2CA 3NRJA 5JSYA 1FTNA 1SVUA 4C76A 3D3WB 1EUDB 1T3TA 3I45A 5C1BA 1AMOA 4R2JA 1YHYA 1U2RA 3N3BC 5CW2A 1ZMTA 5AVKA 4ARVA 3OFJA 3MMPA 2G9UA 1XB2A 2VWHA 3D0OA 3UYKA 2JC3A 2O5VA 3FLAA 3GZ4A 3L18A 4N18A 3P0EA 5EYPA 3TW8A 1JLLB 4H7PA 5HX7A 2NU6B 1ZAKA 3LK6A 4YH1A 1VPTA 2D3TA 3UC5A 1K5HA 2VJNA 3LCVB 5BQ3A 2CEAA 2AJBA 3K8QA 3SMVA 1EBBA 3VR6A 3BERA 4OI1A 5LZ8A 3FTQA 5I7WA 3NIDB 3BX1A 4BLVA 1YR2A 1V8OA 4FE7A 2EJUA 3GBPA 4CEJB 4XQGA 4L74A 1OB5A 5L9AA 5DNYB 2VP0A 5IJAA 4F2DA 2OBMA 2G4VA 4K2AA 3RAJA 3LE8A 4DLPA 3VHRA 3TS1A 2OD9A 1TJPB 2OM2A 4G2NA 3SZLA 3DJFA 4DXAA 3PUYA 1OLSB 4GZ5A 4DVGA 1SEPA 1GSAA 2V54A 1QO0A 2XD4A 3GJQA 4DDVA 1N0WA 1EUYA 4A23A 2OHIA 1DS6A 1NIJA 1K7YA 1XL1A 2JAQA 2JJ1A 2JLSA 2SECE 2WR8A 1REQB 3ASYA 1W59A 3KL2A 5K99A 1P7CA 3RRJA 3UMGA 4QUKA 2ASEA 1MOQA 2L0XA 5TPZD 2HV9A 4BRUA 1DXQA 2EGHA 2HM7A 2C00A 3L6BA 2PA0A 1U8UA 4ZVKA 3NP9A 1Z4NA 2HV8A 1DBIA 2XKAA 3AETB 1O77A 4KFRA 3A26A 3ZHQA 4O0LA 1U3DA 4ITVA 1E2MA 4IOJA 2QZSA 3ODGA 1Y34E 4EGAA 4HVAA 3VDMA 1VJ0A 3SDSA 4YECA 5AWFC 1QR2A 3P4UA 4NDZA 2GZ2A 1J20A 2BONA 4RVOA 1S9HA 1S2OA 1N2GA 2PEZA 4DV6B 1UZMA 1GADO 3DXFA 1HR0B 2WY2D 5DCYA 1U0HC 4H2DA 2Q0SA 4MRPA 3WI7A 5REQA 3U1TA 2IHNA 4QU9A 1UBGA 2V7QA 3GGDA 3WKBA 2OGUA 4BQEA 5C7OO 3O4IA 2C2BA 4FFBB 4D4GA 4BV8A 5BSTA 2GAOA 4ARSA 2I54A 1HNWB 2ZTUA 4UDYX 4UPVA 5T57A 3L02A 4W6QA 2PX2A 2GNPA 2J8ZA 3ENQA 3G89A 3KKOA 4GZ3A 4TLDA 4Q7MB 4GPEA 5CLGA 4J1TC 1VECA 3AU9A 2Y05A 4RMIA 1JAHA 5GONA 1P7WA 1M1YB 2I66A 4G4IA 4QYSA 4JR0A 5KPJA 3H86A 4QHTA 1DO8A 1EVLA 4UCXA 5JS1A 1XFAA 1XT6A 3GFVA 2QTVB 3P2MA 2COUA 3D3JA 3M6UA 1FUEA 4J16C 3M4XA 3WDMA 2CHVA 2GRJA 3CXRA 4WOBA 4M8KA 1U5AA 1D2RA 2WABA 3AYXB 3E8MA 5IM5A 1ISFA 4A15A 4D41A 3VDQA 1OGIA 4AG3A 1DE0A 3D7NA 4YA6A 3T9CA 4YT2A 3ZWDA 1PG2A 2GETA 1BEEA 4F2WA 1G3IA 2O0MA 2V6GA 1ZH0A 3O6VA 3IAEA 3K15A 1I0ZA 4WT7A 5K3OA 4LTNA 4NL4H 3U0VA 2FPUA 2F1OA 5AI4A 3Q2IA 3IE2A 3VPDA 3WIUA 1BJKA 2ZT7A 1L4EA 1MIOB 2GKGA 5DBGA 3W8FA 3BWEA 5G41A 2AK3A 5KUTA 1HEIA 3O8CA 3I53A 3OI7A 4OK5A 5BR8B 4NBNA 3KXLA 3AKZA 5LNK6 3H6HA 2JLAA 4EYQA 3L4EA 3M82A 4XWGA 5LQJA 1GCOA 2YFKA 2QPLA 3FSEA 2OEPA 2QPOA 4TXMA 3RRXA 3UJNA 5BSWA 1LRLA 1RLOA 2FOIA 2OAEA 4JLVA 1L7QA 4F4UA 3H9QA 5ED4A 1FZQA 4XIGS 5IYZF 2HRZA 1N57A 1P0FA 1IN8A 2F1JA 2XNKA 4JZKA 4WBNB 1E9DA 1FP4A 5EP4A 5C34B 3C14C 3NAQA 1PTKA 3GARA 4MV6A 5IAEA 3GGPA 1Z0KA 1VRCA 2C94A 3ZHZA 1LPNA 4LZZA 5LWQA 2HA5A 4TYQA 1OLUA 4DCGA 1PJTA 4IIXA 4D2IA 4YXWD 2Q8QA 3A3NA 1Y4SA 2IV3A 3RNOA 1N2CE 4UFPA 1XJ5A 2FVYA 4B48A 4R83A 4B44A 2X2EA 4HQ0A 4PZLA 2V55B 4UM5A 1KVSA 4OHWA 2MTBA 1ESZA 1SHZA 1YB1A 2YINC 2R8EA 3AHFA 3BJRA 4K81B 4LVUA 3OAAA 4R8MA 1N7IA 1ORIA 1G20B 1OU0A 4QG3A 4UBOA 3K6JA 4JLKA 4DSAA 3T3IA 3EOZA 4CDMA 2I4OA 4GEKA 3HXQA 1JDZA 1H2WA 1NKVA 3R1IA 3SR3A 2FZVA 1GPLA 3H9EO 2RCYA 3LH5A 1QQ7A 3L7AA 5EIFA 4AAYA 3W1VA 3AESA 2KLBA 1SK8A 3E03A 3HKBB 3TD9A 1Y0BA 4W8GA 1UC5B 2AJTA 3N6XA 4WXMA 1YAHA 2FPKA 2V7WA 1JR3D 3CR3C 4GGOA 2VP4A 1L5VA 3WYEA 2O8EA 3MTDA 4XQ9A 2IEDA 4RTJA 4YHBA 5AUPB 5CPFA 3ONDA 1I6MA 5F33A 5HQ3B 1PWHA 2GYWA 4IIJB 1YJCA 1Q7RA 2Q50A 3UK1A 1AM4D 1X7XA 3UJ7A 4D4HA 1NW5A 1PD0A 3OT5A 4I8DA 2DKFA 2A5FA 2WIAA 3C3DA 3VU9B 3VYWA 2PO7A 1DXYA 4R2IA 2IK8A 4F6CA 5EQFA 1NBIA 3IBFA 3KQHA 1UQRA 3GLTA 4BP9A 3C2QA 1MW8X 3KZMA 4BZWA 2GFHA 5LMCA 1P9NA 1R5OA 4DV7B 3HY3A 2B4AA 3A1SA 1GZVA 5D7BA 1XNQB 2XUZA 3IQEA 2FW1A 1O6CA 4PIVA 1V5GA 4MDFA 3TFOA 1OTXA 1B26A 1O08A 2JAHA 2P9HA 1NXWA 4D42A 5CU7A 1AS0A 4ONEA 2CMDA 1SVMA 4KR3A 2O52A 3KKMA 3KT6A 2XGMA 2YL2A 3N07A 3R9KA 4BTVA 2JFWA 1F3OA 1RWMA 1YS6A 2C2MA 3AFNA 2VJBA 4IWNA 1O6ZA 2QPAA 3BMCA 4KE7A 1HBJA 2BDUA 4X45A 2H7YA 3SJBA 4BGVA 3A6LA 3ZR4B 3EFBA 4CMIB 1W0KA 4MA0A 4G24A 3K1ZA 1JNYA 1ML3A 3FPGA 3EVAA 2G9VA 3BG5A 1K5PA 1MAHA 2CLIB 3WMRA 4LJ4A 1BN7A 1L5HB 1V3QE 4XLTA 1WSWA 3AL2A 3AEKB 1DINA 1I3OA 5HS4A 4HEA1 1Y3AA 4ZRMA 1J9EA 1WXXA 1SM4A 1RWVA 4A0RA 5IAJA 4MKGA 3KVOA 2EYQA 2IKSA 1ORTA 1DIRA 2OMKA 4UE2A 4IX1A 4OPMA 1XZQA 2PS0A 5J1TB 3S44A 1M6EX 2D0OB 3A7EA 2DBQA 1GFZA 3HJHA 4FMPA 1AMUA 3SE0A 4O0MA 3TPZA 3TEMA 3S0JA 2CK3D 2QRVA 3PT5A 1C50A 3NNSA 3NORA 1JXMA 5ERGB 2X3YA 4ZV4A 1PYGA 1Z0DA 3TJMA 4MUMA 3QX9A 3PI7A 1E9RA 1LSUA 4HTFB 1EVKA 3LYAA 3SSNA 3EXIB 3VR4H 1WHTA 2DH6A 5SV2A 3TFWA 5JDIA 1ZISA 5TB5A 3TLZA 3CV3A 1Z45A 2PRIA 3SBOA 3C5HA 1ZJ6A 1MO2A 1MO4A 1VZ2A 4E5KA 2ID4A 1M0WA 1M34B 1TE2A 1W2GA 2RHCA 2PL9A 3GLGE 1DFGA 1TZ2A 1ZCFA 4ZOCA 1WOMA 1W4ZA 2WQ6A 3F6CA 4MUJA 3ZJUA 2EERA 2HJ9A 4QDKA 4ZKEA 3VPAA 3MMXA 1XMSA 1XLWA 1IM8A 1C2YA 2MHCA 1YQXA 5F2NA 2RGRA 3M6IA 1HG1A 2FZCA 1IAVA 1NBME 2WB4A 4JKOA 5K5EA 1XE3A 4ZAWA 1QF9A 4JEMA 4NYMR 1VG0B 1PWYE 1UIRA 2ZW9A 4GE0A 3V8EA 5BOSB 5BV0A 5KC9A 3RVKA 2PUHA 1VYUA 2JBAB 1WKBA 4PZ0A 5ALFA 1BMFA 2JGAA 5H9WA 3UH1A 4K9SA 1YZGA 3OOWA 2WIBA 1DFHA 4PX3A 4BEBA 1DZIA 1NAIA 1QVAA 1ZWKA 4U7JA 3RS4A 4N65A 1ZVMA 4RHTA 4DCUA 1FMJA 4OXQA 2DY1A 3EPPA 3RBVA 1U9CA 3UCFA 3L05A 1A2QA 4Q7KA 1TKAA 1KEWA 1KI3A 5IASA 1CPYA 4HQFA 2H65A 3FFBA 4IEEA 3JQGA 3CVWA 3GUHA 2PIDA 4G5RA 4NNPA 4P5DA 1HTWA 3I52A 1PVVA 3SBEA 3V80A 2VDOB 4BLRA 2XDQB 4EIWA 1TDJA 3FTPA 5E6RA 3I61A 5EQJB 3CBGA 3KE8A 1WB6A 1YBHA 2G1PA 4B3SB 4FQ5A 3PHHA 2EEPA 1BMQA 4W8OA 1WY5A 1LRKA 3AINA 2JEZA 3D7KA 2J5XA 4XGIA 1ARZA 4RPIA 4NBLA 1U81A 221PA 1LBTA 2HF7A 2RAPA 4OHCA 4PAQA 1YVPA 4PW0A 4F11A 4PRYA 3O8QB 3R5XA 2RHBA 1X19A 1DT3A 2HC9A 1A88A 2IUFA 3OOJA 2V0CA 5B4UA 4KHPB 2RCNA 3QU9A 4ZI7B 1YUNA 1KJYA 4ACBA 1EX9A 2ZVDA 3M3PA 4QYMA 2ZSUA 5JYEA 1YS2X 2ZPTX 4Q3AA 2WPDA 1Q19A 2AX3A 4XJSA 1WUYA 3G88A 3FCAA 1WG8A 3P7MA 4WKPA 1U2PA 2QTLA 4TZKA 4FEGA 1PZEA 3WO0A 2BKEA 4DARA 2WIDA 3C3BA 3R24A 3OVMA 4Y6PA 1YL6A 3TEFA 1YWGO 5CLHA 5HK9A 1RI1A 1G2OA 2WYHA 4OP1A 2UYHA 1J8DA 1ZRNA 3IVRA 3FYUA 3D1VA 4F0JA 1GAQA 4AW9A 4Q12A 5JJBA 1UKCA 4KK3A 3JZIA 1SFRA 3MM4A 1KFCB 4QAQA 2PRSA 2A78A 2C5BA 3FD8A 4HT3B 1XP5A 2NADA 4PPGA 5FBKA 3NHLA 3NVKI 5I3ZA 3PXBA 4M8IA 2OB1A 2PSDA 4MR8A 4DNXA 3KU4A 2IWHA 5CX4A 3OZ7A 1WBJB 4TQGA 2VJCA 4BBAA 5KQMA 4F71A 4BX3A 2TMKA 2V7VA 3FYSA 4F12A 3DFIA 2FSGA 3FNQA 4P3OA 4C2TA 3DNMA 2BFDB 4A6DA 4K46A 4WECA 4MW9A 3TXXA 2YDYA 4A2QA 4E4RA 3WOVA 1JP7A 4DOMA 2O50A 2HBYA 4QBTA 3OQ1A 1V7CA 2EEZA 4J3JA 3WGHA 2P7HA 3P9IA 1QHXA 5IH3A 3WWOA 1G3MA 2N75A 2P2CA 4KE8A 4QJIA 3AM3A 4NJMA 5EIOA 2FDCA 1PV2A 5I7RA 1JA0A 3PPIA 1R6AA 2BCJQ 2J6CA 5TT1A 3RYCA 4RK4A 2PV0A 1KERA 4A91A 4QFBA 1G9SA 1Q0LA 4MMYB 3ITNA 5L7TA 3B1WA 3MINA 3MWGA 5UKDA 1SOAA 3VH2A 2DUWA 2Y1XA 3OPMA 4XTCS 4YJ3A 2CFTA 4WESB 2CL0X 1RYYA 4ETMA 1OC2A 2CNWD 3LCUA 1JDBC 1W8IA 2ZI6A 4IH4A 2MR5A 1ZJ4A 1UBSB 3FWZA 4OMCA 2LDXA 5FF9A 3VKWA 3T5AA 2MOKA 4FFSA 4OUDB 1N1MA 2OYSA 3TIVA 4CM7A 3KTFA 5A6SA 2C04A 4B6OA 4MWBA 3NU1A 3STHA 4YP9A 3V46A 2BV3A 3O8OB 1U2DC 1F7UA 5H16A 3WX0A 5BUZA 4X91A 2F9FA 3UXMA 3MC1A 1CRLA 2YWFA 4D82A 3DTVB 3UXYA 2EV9A 4MPPA 5D84A 4KQWA 5CM8B 3TRHA 1QGDA 3DZDA 1DXOA 2G5CA 3MELA 4RD2A 4ARZA 5E4FA 2GN0A 1KQPA 4RJIA 4ZVUA 5EJFA 2XRFA 2NAPA 3BB3A 3EF1A 2HY7A 2G0NA 4U7GA 2AC7A 1NYQA 2JJMA 1CR6A 1FDOA 3ON5A 1FLNA 1M1NB 2AKAB 1U8TA 1ZH2A 1QFJA 1D6NA 3AKYA 2BW0A 3C8DA 3IMFA 4MS1A 1E9BA 1XA0A 1Z7BA 3DAGA 5FO1A 1RKXA 3T7RA 4YRRA 1Z5GA 2JATA 4P53A 2Q4EA 5H4HA 3BM5A 1FUYB 1Y6QA 4D99A 1ODLA 1YQEA 3TQTA 4HY3A 4XB6B 4KDRA 5BO5A 3CQ9A 1IK6A 4HZUA 4WK0B 1ZH4A 1UOOA 4DLBA 3V8BA 5AQEA 3TUZC 1P62B 2F2TA 4HLQB 1P2GA 5DGXA 2EATA 5HRAA 4RZSA 1I32A 4BQFA 4RDCA 1I2AA 2HJGA 2JF0A 4P22A 5ALTA 3VBCA 1V5IA 3D7LA 4DCNA 5M34A 1N0VC 2DLCX 1ZGHA 4N3AA 4TLBA 1UEXC 2V9ZA 4FGKA 3U09A 3RUCA 3AEQA 5HEKA 2ECKA 3VZDA 4LEIA 2UXBB 3TQFA 4REOA 2CVHA 3E81A 2I2AA 3RG2A 2I9PA 5AI9A 1GV1A 4K8RB 1PFGA 2EYUA 3WZMA 4EPYA 1OILA 2FLWA 2XMQA 3TBHA 4ALMA 1QHEA 3LY7A 3KUXA 4YPVA 2XGSA 1UP7A 4RE6A 2B9EA 1YS4A 2W0MA 4QARA 1KC3A 3ZEAA 1GR1A 3ZWKA 1IVNA 2OCDA 1OOEA 4BLPA 5CEEA 1Z0UA 3TRDA 5L6LB 1OXTA 3OLCX 2V6FA 1M8GA 2GCOA 1Y6JA 4PSDA 5CH5A 3AGPA 2UV8A 3VKFA 4G26A 1L8OA 1DL5A 1O94A 1QH8B 1YGYA 5EUMA 5KHLB 3A1NA 4BQQA 3C41J 3RYCB 5AVJA 2FGKA 3LQ1A 4DRXA 4M1TA 3C74A 3G2IA 2OV4A 2B21A 2J07A 2AL7A 3P9QA 2CXTA 5AKEA 4GX2A 5DN9A 3I42A 4MR7B 2HIAA 3GT7A 4QUBA 4UJ3A 3OQNA 1VKOA 3HO8A 3O0DA 2AZDA 4U9HS 3WGGA 1I7DA 2P6OA 3PD1A 3OTHA 3LC1O 2EG9A 1RKUA 1ECPA 5KEIA 4LIPD 3H4VA 5IXSA 1JSXA 3QUAA 2QLMA 4JITA 2KMLA 4XPZA 5KYVA 3OZCA 3G9TA 3JVVA 3ITKA 1ZOPA 4H16A 1YFZA 3PWKA 5G02A 1RD4A 3KJHA 3ETGA 3AGQA 4P7JA 4WJKB 1HLDA 4UNNA 4NCNA 4NG5A 3AR4A 5JXJA 5K2OA 1VQ1A 2OBYA 4J07A 1FP6A 3QJ5A 5TE9A 4F72A 4UNRA 4FMBB 5EESA 3G49A 3HDQA 2VDKB 4B84A 3COJA 3VDXA 2Q41A 3L84A 4EW6A 2YRFA 1YBFA 2C2WA 5CLQA 1XROA 4DA4A 1DX4A 4BFTA 4KQFA 4CCYA 5AD1A 3E4CA 3UPTA 4JJAA 1HDOA 1ZMRA 1PFQA 4B73A 1BA2A 1NF3A 3I09A 4G5FA 4LPSA 2H7XA 3A3KA 5EJ9A 3M34A 4F5Z