3L3BA

Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
216
structure length
210
Chain Sequence
LNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFAPNKNQKQVVDHKKKESVGEVRNILVESARIARGSVYDIEQIRVEEFDMLVIPGGYGVAKNFSNLFDEDNDYILPEFKNAVREFYNAKKPIGAVCISPAVVVALLKDIAKVKVTIGELIDKMGGVHVDCPTIKSVKDDVNRIFSCSAYMRNDSLYNVYLGIQDMISSMVNYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Es1 family protein
publication title Crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from Ehrlichia Chaffeensis at 1.90A resolution
rcsb
source organism Ehrlichia chaffeensis
molecule tags Biosynthetic protein
total genus 71
structure length 210
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l3bA00
1OI4A 1T36B 4GE3A 3VU3A 4B2YA 3BHNA 1IPHA 4ENSA 1GPMA 1T3TA 4UCFA 4Y1GA 3NOVA 4HCJA 3PQ4A 5JZMA 4P5PA 3P9QA 5IP5A 3SF8B 1JVNA 1N57A 1P80A 4MNTA 3P9PA 3PQ8A 4E5VA 3B38A 4L8FA 3ER6A 1VCOA 2RK3A 3CNEA 3KKLA 4N12A 2VXOA 4UNIA 3TTYA 4D1YA 1OY1A 1JDBC 1QVZA 2VPIA 3EFEA 4S0ZA 1CE8B 4ENPA 1SY7A 1UCFA 4JQSA 4N0MA 1QVWA 4RKYA 3TQIA 3UOWA 4AUMA 4ZDIA 1R9GA 3EZGA 3L4EA 4B31A 3EJ6A 3SOZA 4L78A 3PQ3A 2R1TB 3CZAA 3NVAA 4P36A 4QYXA 2R1VA 3ZR4B 1KEEB 3PQ5A 1GGFA 2H2WA 3MGKA 1OX4B 2GK3A 1VCNA 1L9XA 1KWKA 5SY4A 2ZUSA 1S1MA 2AB0A 1G2IA 1M6VB 1OX5A 1Q7RA 1BXRB 1P81A 3N7TA 3TTUA 5DFAA 3EN0A 4BTEA 3TTVA 1GG9A 3R74A 1PDWA 4P2GA 4QYTA 4GE0A 4ZDJA 1FY2A 4OJYA 3D54D 4UOQA 3NOQA 3UMMA 1C3OB 2AD5A 3CY6A 1J42A 3OT1A 1I7SB 4GUDA 1I7QB 2FEXA 3L7NA 1C30B 4Y0NA 2W7TA 1IZYA 3PQ2A 2ZUVA 4I2NA 4Y1FA 3B3AA 1WL8A 5BV2P 1PE0A 1KA9H 2VRNA 4RKWA 1A9XB 1Q2UA 3P9SA 4ENRA 1T0BA 3BWEA 4ENTA 1CS0B 1QVVA 3L3BA 1GGJA 4Y1RB 4BIMA 2NV2B 1PDVA 1U9CA 3SF8A 4I46A 4OGFA 3WFZA 3NOOA 4UOZA 4Y1EA 2YWCA 4OQ4A 2ZUTA 5E9AA 3FSEA 4LRUA 3M3PA 3NONA 1GGHA 1P7ZA 1O1YA 4WXYB 3UJNA 1I1QB 3R76A 1P7YA 1FYEA 3NORA 4ZGGA 1CF9A 2A9VA 4UZSA 4ENUA 4XLLA 4ENVA 3TTTA 1VHQA 2RK4A 2VDJA 4L8YA 5SY9A 1KXJA 2ZUWA 3P9RA 3UGJA 2ZUUA 2RK6A 2YWDA 2R1TA 4ZDKA 2R1VB 3TTWA 2NV0A 3PQ7A 3TTSA 4ENWA 3B36A 5LIRA 3FIJA 4P34A 4L7QA 3ZJ5A 1GGEA 5K4AA 4OGGA 4AUNA 4I4NA 2XF2A 3MIIA 1OX6A 4L8WB 4MGHA 3UK7A 4LGYA 3TTXA 4B5KA 1SOAA 2YWBA 1K9VF 4R7GA 1KWGA 3F5DA 1GGKA 4ADSG 4AUEA 2GHRA 4AULA 4WINA 4AJ9A 1VCMA 2IUFA 4OIFA 3L18A 1QF7A 3CYFA 4L95C 2OR3A 1OX4A 4MTCA 1IZZA 1QDLB 1PV2A 2D7JA 2VKTA 4PXYA 3F71A 2LXNA 3R75A 4K2HA 4P35A 4B7AA 4E08A 3ZJ4A 4OFWA 3EWNA 4B40A 2R1UA 1P5FA 2WJZB 5SY6A 3RHTA 1GPWB 2V4UA 4ENQA 1ONSA 3GRAA 2YWJA 3PQ6A 4BFLA 3OT1B 4Y1RA 1QWSA 2ISSD 5SYAA 5JZOA 3CZ9A 2ABWA
chains in the Genus database with same CATH superfamily
4PG5A 5ALPA 2IHKA 10MHA 1NW8A 3E2PA 2UVPA 3RFVA 3PKZA 4PIPA 1L5GB 1W0KD 2I6UA 4OFXA 1UBJS 2XUZA 1H8EA 2C2YA 3ZWYA 1SVOA 4I7EA 5AUPB 1U0RA 4FYHA 5FP0A 5I9LA 3FHTA 3BWDD 1XRMA 4UARA 4DIMA 3BGIA 1QH0A 4DC1A 3CVXA 1AQJA 3NQ41 3EAGA 1RYFA 2ZJ6A 3LY9A 4IS2A 4OMUA 3FCCA 3MJHA 3C8MA 1C7IA 1Z5ZA 3L0YA 4L2IA 2JLVA 1IXRC 1W1IA 2PK3A 3G17A 1KR2A 3D4NA 3MLBA 4GYKA 1BE8A 5KSPA 3F9IA 3FKSD 4RY8A 1ZJJA 2Q2WA 2QSUA 3TDKA 4M8NE 2P9EA 2WKWA 4PLHA 4AF6A 3MFQA 4W82A 1THMA 1R12A 3MGBA 3QM1A 1PFWA 1TXGA 5F4BA 3EJ6A 3WDLA 4V1CA 1GSAA 5CB4F 2IPNA 3HBJA 1EJ0A 2R1TB 3RUHA 1KI9A 4ESHA 4GQBA 4AZTA 4BZPA 3Q5GA 4TRJA 3NT2A 1PKEA 5C1DA 1W49A 2AOTB 3REFA 2IYTA 4ONEA 2AFIB 3KUDA 1WW8A 2GNAA 3N3BC 3FMFA 3QXHA 4M9RA 2B0CA 1G21A 1ZYUA 1L1EA 2ETXA 1FS4A 3SBOA 3DMDA 3HSKA 4BNJA 3CRQA 1ND5A 221PA 4EB0A 2BKVA 3DVLA 3GEDA 3KAPA 4FYIA 2D62A 1Y9EA 1I4LD 1YAHA 3B7PA 3FHJA 1NRWA 3CGGA 1RQXA 2ERCA 5ESWA 3FR8A 5HCNA 3LHDA 2OXRA 3QI2A 1DDOA 1H8HA 1T4CB 1Y8QB 3E7PA 4CN8A 1OB5A 1LK7A 2FW1A 4MS3A 4HR7A 4JR0A 1RQGA 5B64A 3D7MA 1TAGA 1T0IA 2R60A 2Y1LA 3WRXC 2CL0X 4A6PA 1Y8ZA 3LSTA 5IC5A 4D26A 1RXVA 4WBNF 1LX7A 2KHZA 3HFJA 3ZI0A 3GLIE 3V1TC 4UHJA 2OESA 3HZOA 5DT9A 2AYZA 2JD1A 2LKDA 4ZD6A 4OM7A 5TY0A 2XWBF 2QRHA 2OG1A 3OEHD 2RDMA 4Q24A 1X2EA 1XJQA 3JWIA 4G89A 4PLGA 3SJBA 2CDBA 4N47A 4CM9D 5JATA 1IZ9A 5L6MB 4MUBA 1AVTA 3VTZA 4HADA 3PPVA 4QUBA 3ET5A 5KPJA 3WLAA 1NOJA 3HA5A 4V3CA 2DPMA 4M8LA 4P5DA 4YUVA 1N0HA 1RI4A 2I3AA 2YHBA 4RJ2A 1SVMA 2HA0A 3NG1A 5J4VA 3S28A 3X3HA 1AO3A 1NVUQ 1ZJZA 4I5FA 3X1MA 2AFIA 4I6JA 1E96A 4DMMA 3PHIA 4PYIA 3C70A 4P3NA 2BDUA 2CK3A 2O1WA 2O0HA 2QJWA 2WKQA 4KRGA 2AKAB 3NALA 4HQKA 4PX5A 2B2CA 4L95C 4TL8A 3OFVA 1DMRA 4MO2A 5CH8A 1J1ZA 4YGXB 5J5AA 1KRXA 2D5LA 1F8GA 2NQ2C 3DTYA 2YCBA 2AR9A 1FX0A 3SGLA 4GDMA 3MSCA 3DDNA 1CFJA 4N8EA 2W2MA 1FVHA 5KPDA 4MLCA 4GM4A 1KC1A 3RHFA 3UUWA 1KEKA 1YZVA 2ET6A 4CKYA 1U11A 1IQUA 1F8FA 4KKXB 4J3FA 5KWIA 1XF1A 2C0QA 5CLJA 2R2GA 4XVRA 3VOBA 1NX6A 3TPCA 5KNCD 3G2MA 1LBTA 3ILXA 2VJAA 3AUSA 4EJ0A 2AZDA 3Q7RA 2G1PA 3NDJA 2PL1A 1ORIA 2PANA 3FVQA 4MRAA 1R5NA 1UT8A 2H2IA 4PLVA 1FP7A 4R8RA 1KK0A 5EKUA 3UH0A 2FUCA 1WQ4A 4RFSB 1K0FA 1UEIA 1DQPA 3H9BA 2XGJA 3PTAA 4KOAA 1DTWA 1YQXA 3KLBA 1Q3KA 3SC4A 3WQBA 2O0LA 3K1TA 4YAEA 4DV4B 3WO1A 2EZ4A 1V8PA 2VPYA 3W7AA 2XCOA 4EGAA 4HEA1 1KAHA 1IN7A 1CETA 2WRZA 2ZYRA 1H2BA 3A4LA 4ZDWA 1HE4A 4ZYVA 1TYDE 1HDRA 2YIJA 3TQIA 4QVKA 4UTVA 4MI1A 3HWWA 2P5YA 5K2MA 5C5CA 4M87A 2FWIA 1XEFA 2HRQA 2JFBA 3I2JA 1KQ3A 4J4TA 4ZA2A 3GUUA 3N0XA 1D04A 4HEQA 5EHGA 4IL5A 2E9SA 1SXJD 2P77A 2NPIA 4LHEA 3RH0A 4UHHA 3H9JA 3BMNB 4NE2A 1DUVG 4N54A 3HXOA 4DADA 2RH4A 4BMZA 3JPWA 2PH3A 3ZWCA 3JQGB 4U7GA 3L6DA 8ATCA 1Q0LA 5JAUA 4YRTA 2Q5JA 1PFVA 4E1BA 5JS8A 1C0KA 4CG2A 5CNJA 3SHFA 4RK6A 2QN1A 2FCAA 4ODIA 5JPCA 2XVXA 2BSAA 1CPYA 2X8JA 5IJAA 1HOTA 2ZGVA 1M1XB 1Z45A 3K1ZA 1NSTA 3PZRA 4QBGB 3A9UA 4R7ZA 5IJ0A 2AVNA 2FEXA 4IZHA 1DC7A 1U81A 4BO7A 4OBEA 5KVSA 4XFKA 4DPLA 3IKJA 4J0IA 3WY9A 4JROA 1P29A 1W5EA 3CR7A 3SZLA 4BNZA 5L4LA 2JFHA 1IZ0A 1YFZA 3DZCA 3TMYA 1UR5A 3FPFA 4IHAA 2C2WA 4LC0A 5BYJA 1C0LA 1RCFA 3N59A 1WUKS 2XAUA 4OJMX 1K7YA 3NRBA 3T9AA 1DBSA 2R8YA 4PCVA 2O20A 3AP2A 1WBJB 3KJNA 3UHAA 2P8SA 3GOHA 3I8XA 3KXLA 3S7ZA 1R0RE 1QNLA 5EMJA 5FR1A 3VH4A 4E09A 3OP1A 2GEFA 3TZQA 4ARSA 2DLDA 2JLQA 3OX3A 3FSJX 1H9BA 1LK0A 3JQBA 4F60A 4TN5A 1P3Y1 3AHEA 1WXWA 2O48X 2ZBRA 3ASZA 2NTVA 3G5UA 5BV0A 4EFLA 3DKVA 1UBEA 4ZICA 2CJPA 2IEAA 2OL4A 1A9QA 1TI7A 4HEHA 4KI7A 4YONB 2XB8A 1PWZA 1PEYA 2ZWVA 1E18A 1RWOA 2JAXA 1IEVA 4ZI7F 2QDKA 4BQOA 4J2HA 1G7SA 1TVEA 1XQ6A 2ONZA 4O8CA 5CM8B 5IVDA 4QUEA 2V1UA 3FGNA 4URWR 1CEEA 4DB2A 1GNQA 2FN4A 2Q1WA 1I3CA 3UUEA 1S2MA 2JI4A 1VG8A 3VC2A 3ZDCA 2RBGA 5A5DA 3T9FA 4IVNA 1I7PA 3RGGA 3IAM1 4UCXA 4GWKA 2RAFA 4QJ5A 4MULA 1I01A 3O9VA 3OT1B 1AD2A 4YRIA 2CHQA 3CZ9A 4Z3KA 4JQCA 1P62B 2AEMA 1T5TA 1E61A 5JXGA 1UBHS 4W7HA 4FFRA 4YN3A 1D03A 1ZONA 1Y1PA 3CTMA 3U13A 2BGUA 3H7IA 3KXKA 4FS3A 3ZPXA 1V9LA 1OIWA 1U7TA 2X0IA 1JB1A 4QRIA 4TTSA 5EHNA 3TK1A 2ZDHA 2AKYA 4MRRA 3OCCA 4LZJA 3WLLA 2V7GA 4RSGA 4MNTA 1T25A 5F21A 4FLMA 1JA9A 2IYQA 1AF7A 3ICCA 3LQKA 3B70A 1RYDA 3KFXA 4OHMA 1OT3A 1HDEA 1P4JA 3NXKA 1UFVA 1YZ3A 4G0QA 3VKUA 1W36B 1QV7A 2IZZA 1LSSA 3H2KA 2BI7A 3I76A 3R8XA 2JFXA 3P9NA 4R4JA 2JARA 4V38A 2H1OA 1KRHA 2CXNA 3U7FB 4P5EA 3RG2A 2YWHA 3A10A 1GRVA 4WXRA 3HMKA 1U90A 3PC8A 3FCYA 1E9DA 1IOWA 5FLKA 4CL2A 4BJ1A 2WUWE 3W2TA 2VA8A 3H8VA 2AR7A 3GPIA 4QUJA 1AT1A 4TMFA 3JCZA 1SUIA 3DB2A 1SU6A 3ELUA 3DBLA 3TOSA 3H1TA 2F1RA 3WK5A 1SHKA 1ZUHA 3DS8A 2QZZA 1QKKA 1B0ZA 4D25A 1OBCA 1N2IA 3MT8A 3W3AH 3ZHOA 4F46A 1P4GA 4TRNA 3IL2A 2X8WA 4Q39A 4UAUA 2H00A 3FCSB 1H1TA 3K0FB 5C1OA 3VYUB 3C7AA 5LR6A 4I1PA 2HHJA 1WMAA 1E2QA 1G8YA 2OEPA 2WF9A 3ETHA 3GAFA 3OECA 4HWKA 3EIOA 4Y1FA 1Z07A 4DLTA 1JJAA 1HNNA 1PE0A 3CEJA 2PKEA 2Q2QA 4KHZA 5JHHB 4FEYA 1DQRA 2BH2A 3DBIA 3EYWA 3QWAA 4HAOA 2H2DA 1JKFA 3R23A 2RJ3A 3GZJA 1IRIA 1RJ9A 1G42A 1UZMA 4YR7A 3RC2A 1T36A 1YRBA 3H1BA 4RNDB 4BNKA 1A9YA 1KGSA 2W22A 4BQQA 3PEWA 2B5WA 2P4HX 3PE4A 4D8WA 5TMBA 4DJEC 1XMQB 1NFRA 1I1QB 2QVZX 1IBSA 2F3PA 3A26A 4Y2QA 3SDSA 1F4LA 2PMBA 1X9GA 1KO4A 1ISMA 1EFCA 4Z99A 2JA1A 4P4SB 2X0EA 1QZXA 2HLNA 3ZGNA 1NQ5A 4Q4HA 1NQOA 4QUIA 2HN9A 2A1TS 2J6HA 3TTSA 2HL6A 1Z7GA 3IV7A 1C2YA 1EFRA 1W5BA 4FT4A 4M1OA 5K3EA 4CQMD 2H9AA 1OX6A 1N2CE 4MGHA 3CCBA 4EO7A 2IHYA 5A7HA 4BEJA 5TF4A 3SCZA 4EP1A 3A4IA 3E1KA 3R5KA 3ICEA 5HRUA 3CYFA 1GG2A 4N0PA 2FP3A 1QF9A 3BD7A 3L0ZA 1UC5B 3GGCA 3PHGA 3RKUA 3VR6D 4AQDA 1PVOA 4CM4B 3D7SA 1F0PA 3D6MA 4MVJI 5D84A 4OHZA 4PPFA 1NXSA 4L1KA 3IAS1 4GXQA 3A4YA 5EGSA 3W5SA 4DGQA 4HVLA 2JC3A 2GN4A 1M6NA 2PBRA 3DL0A 5JCXA 5KTNA 1XNQB 1O9GA 3ZWMA 1NF2A 2WG0A 3IBCA 1Z18A 5LN1A 2X77A 1GXSA 5F23A 4UU8A 2O0MA 3QE9Y 2I4TA 2O0JA 1WVIA 2NG1A 1EVKA 1GARA 2D0IA 2QD3A 1NATA 4GOMD 4TMTA 3GLIA 4RGQA 2QTVB 4NMMA 1QWSA 4WOKA 4LV6A 3TH5A 3GOQA 2E4UA 3HWRA 1LQTA 2HQRA 4IDQA 4BLOA 3GEGA 1WHTA 4O59O 1T4DA 4WCDA 3OUUA 2R6HA 2QVYX 1EK2A 3S0JA 4DLUA 4O3FA 3IXMA 3SU8A 5DN9A 4OO3A 4ZT2A 3WFIA 3N0RA 3K9FC 3MMNA 1MRZA 1MDBA 4E12A 4IDFA 3HUUA 4EZBA 4K1LA 1U8UA 3O31A 5K09A 4O4JA 2D74A 1WM1A 2PPLA 5GONB 1NTRA 1ONPA 4DIOA 5E3JA 4X60A 5KIAA 3KE8A 1XEXA 3ASYA 4CCSA 3DGFC 4AJEA 1J2YA 2Q6IA 5ENDA 5KHLB 4IXDA 4C43A 4CDNA 3USZA 5CDGA 3OMWA 3H0KA 4PYMA 2I66A 4PPGA 1QBKC 4BU1A 2C57A 1IOVA 4U2DA 4YAJA 2G7MC 2ZBEA 3EWSA 3VR6H 5D1NA 4C29A 1DWPA 4TM7A 5AKGA 4DAEA 1VE9A 2HBYA 4F1JA 3IVMA 1UOPA 5CDSA 5CM2Z 4R69A 1HZZC 2YWRA 5HWSA 1DIHA 1JHMA 1GG9A 1Q1GA 4RDHA 3A28A 3K71B 5ALVA 2I8CA 2RGUA 3AV3A 4I6GA 1L5YA 4I2VA 4BBZA 1PTKA 2IXTA 4C3OB 4CQLB 2F67A 1Y4SA 2ID8A 4F6CA 2OZLA 3VC1A 3GFFA 1SCDA 3PBKA 4YMUA 2P5UA 4L6AA 1DTSA 4EI8A 3I09A 4YAIA 1MTOA 2GBFA 5CX1B 3E0QA 5E6RB 2R8RA 1U0FA 2KI5A 2VDRB 3NEPX 4M54A 3U9TA 2GEJA 2H4WA 3BKXA 1GN9A 4YLGA 4C87A 4BMNA 1VIAA 2EXXA 1NXTA 2VK4A 3F3KA 1DAMA 1L5SA 1UXGA 3QWFA 4JNKA 2OO5C 5LZ5A 1N5LA 1HDXA 1Y33E 3RUAA 1SVSA 4OXIA 3QY0A 1XEXB 3I4LA 4QU9A 4Q1VA 1U3FA 2WT4A 4KQWA 4V03A 4RH1A 1WSDA 5DIFA 2OCYC 1JSXA 5EMMA 3WSVA 4IZ6A 4K26A 4PBTA 3ZV6A 1I5EA 2QLJA 1JFVA 2ADFA 1N2EA 5LNK1 3DDWA 4HWTA 5TGTA 3FJ1A 3PG5A 4PC6A 4C7VA 4FHCA 3DM9B 1XD2A 1XVVA 4L50A 2REBA 3U48A 4YUWA 5K6AC 2QIOA 2Z08A 3GVPA 4K9MA 3TSAA 4IF6A 3IEUA 1KRWA 2GN1A 3WO0A 1SRRA 4OIFA 2VH2A 4ZODA 5KYXB 1YB4A 4A91A 1G66A 1TKRA 3CU5A 1OF1A 1TUIA 3CA8A 4MGIR 3R9XA 3NIDB 5KS2A 1QHEA 3E9YA 3ORHA 5FOSA 3BTSA 1YBMA 1XZLA 3BFKA 3CPEA 4PYOA 5ALJA 3E9RA 5AKYA 5KKCA 4J7AA 1S7CA 3KZKA 5CG2A 2BEWB 3DOOA 3W5VA 4B3TB 2VEDA 1CZNA 3TB4A 4R6WA 2Q5HA 3O8RA 4HGNA 3L49A 3UCFA 4G01B 5FUXA 2YWJA 4F2PA 4WZAA 3VKWA 4HNAB 1FMJA 2AOWA 4R9RA 1FA9A 1GNRA 2C9MA 2RC6A 3NJRA 1RRKA 1JPJA 4Q9DA 5DGXA 1PAUA 3C5CA 4IJUA 1T8SA 1THGA 2R6FA 1R16A 1Z7BA 2EKBA 1QGYA 2GSDA 3SFTA 1KFJB 1KIFA 4L5BA 4WVLA 2Y9PB 4MW2A 3W06A 1EGHA 1HYBA 3FPGA 1N57A 1PQYA 1QFYA 5KTSA 3SOPA 4O4LB 3H5WA 3TAXA 1Z6XA 3LRTA 4QG3A 1AZTA 5C9ZA 4IXWA 4PZ9A 3K70D 3C8DA 3FUUA 4R3NA 3SX2A 3THXB 1ZVVA 2BKAA 3U81A 3UAZA 1CD5A 4N6NA 2VOEA 5D5PA 5TT0A 2R5WA 2CEKA 1JXOA 2VDQB 4KCGA 3OFSA 1ZMBA 3R09A 1FPMA 2DUWA 1N0IA 4BO6A 4BJHB 4OREX 3ONFA 3E82A 2TSYB 3SQXA 4I81A 4IFBA 3B5JA 4OHUA 4C0HA 2HUPA 2QDXA 5FADA 3GLGA 1S3SA 4NU8X 1O96A 1PT6A 2P67A 4K0KB 5AKIA 2ZJBA 4TQAA 2X7HA 4YLEA 1KO5A 3VO8A 5GMOA 4DLZA 3P0EA 4MCHA 5GJCA 3NT4A 3GGPA 2G08A 1JYFA 4GNKA 4HO1X 1PK7A 2VDNB 1YRLA 2A4MA 2AYXA 2DPLA 5ALWA 2DJ5A 4IV0A 3IYLW 2B8WA 1EJ2A 5B2ZA 5JO0A 2YOHA 3C45A 5AKKA 4RTRA 3ZV7A 5JNVA 1QJCA 3TNDA 4PNEA 4JYMA 1H2FA 4PHTA 4BGEA 3KO8A 1SKUA 3MWEB 2HZBA 1JILA 4EJ6A 4EKEA 5BVHA 2CNBA 2KQUA 3BDAA 2GF0A 1G8KA 1UBSB 3FHLA 1Z7EA 2ZRQA 4UM8B 3QFFA 4ZREA 1XTSA 5CNKA 1KEWA 2PLFA 5JYEA 1YB1A 3C7TA 2NZVG 4C22A 5FJJA 2ZVPX 4IKPA 2Z58A 4U7WA 5GM2A 3K15A 4I4TB 4DIDA 4RD0A 4DQUA 3A9RA 5DBIA 1AURA 4TWRA 1A2KC 4J4HA 2QT9A 3D02A 4QDUA 1K7FB 4Q9KA 3GROA 1JEYA 3JQAA 2IEBA 4JJKA 1P7ZA 1PJQA 3DC7A 4IDCA 4YRMA 1ESCA 4GMKA 1X1QA 4IIJA 3ZZ1A 5COAA 1XLWA 5FTNA 1YCGA 1ZK2A 1ZWKA 3O4HA 3ODGA 4MB2A 1IXYA 2ZUWA 3H5VA 3OICA 2IUUA 3UGJA 5EP2A 2EW8A 4JQOA 4K1XA 5LUBA 3T7DA 5EYPB 1E1MA 2C3UA 2ZI4A 4YRCA 3I6IA 1T5SA 2KE5A 4QRHA 1HKHA 4U7FA 3LCRA 1DKLA 1P5HA 2EYUA 4H08A 1MRSA 2VL7A 1MVLA 1F20A 1ZJWA 1P1BA 1I10A 3LC0A 3PKJA 4XLTA 1U2PA 4WCVA 2NYRA 4YY3B 1V7ZA 4J0JA 3SC2A 1JE0A 4EG0A 1OX4A 3QENA 3GA5A 4I1YA 4MV6A 4WK4B 4ER6A 2H31A 1JIUA 1R9JA 3KJGA 3ZN2A 2R0QC 2CLDX 2D4AA 2PSJA 4DBZA 5BVHB 2IP1A 2BHRA 3AP1A 1LQUA 3DDUA 3LQ2A 1FYXA 1WF6A 3EXIA 4CTOA 2VTBB 2UUOA 1SOWA 2OYSA 4B75A 2CYAA 2J46A 4B7CA 5BRNA 1TNDA 2XT0A 4PFQA 4ZCSA 2FPPA 2PA3A 4LHXA 4BNHA 1TU3A 2WZCA 3P45A 1L8XA 2F62A 3IRVA 2HO4A 2OXFA 4HNUA 2O8CA 5U4XA 3UMJA 1SIWA 4C7BA 3T1TA 3MSXA 2VQ3A 4WLFA 3JQAB 2AG8A 1JEYB 1PFKA 2Q5IA 3JQCA 1B6RA 1XZ8A 1T3SA 3UHFA 1OTXA 2X4IA 4B3DA 5J43A 2JHFA 3CN7A 2E37A 1Z6ZA 4Z9FA 1SC4A 1DWOA 3FMVA 3LP8A 5ICCA 2UUCB 3ONDA 4OQLA 1JMVA 1KI7A 1XCPA 4QPNA 3BWVA 1PJLA 1NF8A 5ELMA 2V4ZA 4M60A 2H57A 2FETA 3ESQA 3NV7A 1VDMA 4MUKA 4K3UA 1RRGA 1UOQA 5FBLB 4FEGA 4O4IF 1OBOA 2YJTD 4GSYA 4NJOA 2IUEA 1PT5A 2KMLA 1IEQA 1Z2AA 3RYFA 4MWOA 1KBZA 5ITWA 1AKRA 1PFUA 1T5DX 1VL2A 2L17A 2WMOB 4KXUA 4M0EA 2ZRGA 3O94A 4NP6A 4C4ZA 1I3LA 4RHXA 1DS6A 1JPUA 1V26A 3T61A 3IPCA 3UPTA 3ZUPA 3U4QB 2WWGA 2G06A 1F6BA 3H04A 4NF2A 3I9OA 4OP1A 1KWKA 4CHTA 4XEUA 1YHYA 2BEKA 1Q7CA 3WRYA 4GI5A 2PT6A 5BSKA 4DANA 4I8XA 2A0UA 2XWJI 5L4SA 3GRYA 1P0CA 5TPWB 4BNFA 1R3UA 2EP7A 3RTDA 2Q3LA 3KPVA 3S2UA 3W34A 1Z4LA 1ZH8A 4N7MA 3RFXA 4YRSA 5IT5A 1A0OA 2ZS8A 3HKEA 5B3KA 4OGLA 1DZIA 1E69A 3WL6A 3EQ2A 4FOLA 2C97A 1TF5A 2C61A 2EW1A 3I28A 4BX8A 5KTRA 4M1SA 4X8OA 4HFJA 2B94A 5ALLA 4YHBA 1K0UA 3V4FA 1KC3A 4DQLA 1XZEA 3NJ8A 2ZUTA 4JLUA 3FFWA 1RYZA 2WNHA 4UU7A 4L5YA 5CFMA 2DY0A 3E7XA 4BRUA 1T91A 5JQGB 5A4JA 3TLMA 5AUNB 2QX9A 2BPOA 4P22A 1DBWA 4XLLA 1ILEA 1NLFA 3RBVA 4B9EA 3GWZA 3RYFB 2JF0A 2PGJA 1ZKMA 3ND7A 5AJUA 3OTGA 4N0EA 4YRZA 4Y3UA 2JDIA 1DX9A 1KYTA 1JAIA 1X7WA 4A0SA 2XZPA 4MCAA 1N2CB 2VXBA 3AY3A 1T1GA 1IATA 2VQ6A 2REOA 3DWEX 3U4QA 1XKTA 3G0IA 3EMVA 2COEA 3RVOA 1JB9A 4HRYA 3TTXA 5IHXA 1RM3A 2NXJA 1V1MB 4ZVUA 2WAYA 4F92B 1NIPA 3LPCA 3N39C 4CCWA 1VCMA 5I8WA 3FH0A 3ESXA 1L2TA 1VSQA 3RS2A 3MLEA 5FAKA 3PPYA 3GI1A 2XOEA 2P65A 3LPNA 1ZD1A 1J25A 4O4LF 3SIPA 3AEUA 3AR2A 5JNLA 3B78A 4Q12A 2CSXA 2KPOA 2REXB 2BSXA 5ALZA 2ILVA 3SYLA 1C7EA 4B40A 1HEYA 3KFVA 5AKHA 3HV0A 2Q62A 2Q7DA 5DLQC 4QUGA 1MAHA 3AI7A 1KEUA 1PJCA 3LWDA 4V39A 4DDHA 3NTRA 3JALA 1V1RB 1R6VA 2EZ9A 2SKCA 4KX3A 4PLPA 4KO1S 1R7RA 1UWVA 4ZQBA 3CXUA 2L18A 1T9GS 1Z38A 5IZCC 2RHWA 3ABIA 2ZUEA 1CNFA 3AYZB 3PDCA 2NU6A 4AZ0A 4HZIA 1LDYA 4QUAA 2YRWA 4TOIA 1Q7GA 3ZBPA 3FLAA 3N2KA 3U4IA 2XXAB 5JQGA 1EPUA 2O50A 5FI3A 4E0BA 1SWWA 2YZ2A 1PV4A 4LJ9A 4GYWA 1MC5A 3WWCA 1U7PA 3ER6A 3W5IA 1ECCA 1Y3HA 3N2EA 4LC9A 3ZIAD 5CB6A 4R05A 1LC0A 1GAJA 1HM5A 1RMTA 2VPIA 3NH9A 4JEUA 4PZLA 3AT1A 3T1NA 5F3WB 4XW2A 3E23A 1NONA 4CR7A 1QVWA 2AG6A 4N65A 3F49S 3O1JC 3RC9A 5E38A 4GLFA 4F2GA 1ZI9A 1UK9A 2GN6A 1GZDA 1QG0A 3FWKA 3RU9A 4BNXA 5I4KA 2OV4A 3BK2A 4YRQA 2Q3MA 3QVXA 1GN8A 3KKPA 1UDRA 3LQQA 4IGEA 3F47A 4RY9A 5DTIA 1Y3AA 5C7LO 2YHSA 2ZIZA 3QZUA 1G8MA 4YJ3B 4DREA 3PX2A 4GLBA 2GJSA 3W8DA 1U8XX 4RVOA 5KX5B 3B7WA 2IHBA 3GL9A 2AXNA 5CA0F 4FINA 1KGDA 3VGPA 5BWCA 3GX1A 2HQOA 1ZJ5A 4Q9JA 4EQ6A 1S4MA 3MB8A 2AMYA 1O8BA 3E9ZA 5AI5A 2GF2A 4QTYA 2UU9B 5IKEA 2GF9A 2XUKA 2ZJ3A 1E1KA 1NUUA 1PQ4A 3D1VA 3IELA 3O3CA 4PICA 3UJPA 4E31A 2XZOA 5LZ4A 4O3MA 3X1YA 1OWLA 2IEDA 2XYHA 1HMYA 3VAAA 2GERA 5A2GA 3FXAA 1W4BA 2VWPA 4K86A 4X92A 3VMFA 4CLEA 3UMCA 1QX3A 3I04M 2WT8A 2NV2B 4JODA 2Z4RA 1BJKA 2QD4A 2PUBA 1VP9A 4UMDA 5AHOA 2IL1A 4CFZA 2YWCA 1LDGA 1TKBA 1B2RA 2GAIA 3I6MA 5KTMA 1XL0A 5JBQA 3KXIA 2QR2A 1HT3A 3F90A 4AJJA 4INPA 1FS6A 4O02B 4XM2A 5JALA 2XVAA 2BGWA 2WNSA 3OZCA 3G13A 2D3WA 1C8BA 1KBOA 3HLTA 4FIDA 3V6LA 2ZE8A 4AO6A 1GPNA 3BL8A 2QRVA 4CT0A 5B36A 3NYIA 3U7QB 1IPEA 2E5WA 4G1BA 4KSYA 4Q66C 3SM9A 2VUSA 4B3HA 4E5KA 1NBAA 1M83A 3NC1C 3ZNNA 1FDWA 2RIPA 1I0IA 1LC3A 2X5XA 3FYHA 3B3QA 2GS9A 3TSWA 4Z7NB 4TT8A 1E32A 1JI3A 2D5IA 3B20A 4TMVA 5IBPA 4QZVA 3EUFA 1JZSA 3DEKA 3LY5A 5FI0B 3TGPA 1RLTA 4L08A 4KRYA 2ZRCA 5TXGA 3T1VA 1P0FA 1OLSA 1RKQA 2GH1A 5JXWA 2HT1A 3I37X 4AG6A 1OFIA 2Q1TA 5B2FA 5G3YA 2ZUCA 1Q15A 3G5LA 2FZKA 3O0TA 2V7EA 4JLAA 2FJ0A 2ZSKA 4M7WA 3GFVA 5KYUB 2NXCA 5K0LA 4NYJR 2O8FB 1WPQA 4CV0A 4WEQA 1KKUA 3KTDA 5A5GA 1WZUA 3GJRA 4A8PA 4B47A 5JEDA 4OKIA 4ENQA 3EG9B 1KJWA 3HEAA 4LHVA 4JZKA 5EWLB 3FM9A 1ZESA 4BNDB 4E4RA 4FFBA 4M98A 1DUSA 2PG3A 1MC1A 2VT2A 5G1OA 3C1UA 1CXZA 3TXXA 3AIKA 2ZIGA 4YO7A 1E89A 3U16A 1CUUA 5CCEA 2P9JA 3VH3A 5FNZA 5KJ6A 3NNSA 5E6UB 4Y7DA 3WI7A 4EEZA 3VR6A 4KFCA 5CA0A 1DZ3A 2XYRA 3LVQE 4QDTA 4ZRNA 3U7QA 5F5NA 1UK7A 5HM6A 3WX0A 2OAP1 3KKLA 1Y4ZA 2C4MA 3P4UA 1NLZA 3ZQ4A 3IT0A 3FMGA 1HO3A 1B41A 1ZISA 4L0MA 4Y6QA 5CTAA 3EMBA 1L4YA 4M36A 3TECE 1LFAA 4UQOA 2V7VA 3LT1A 4KQ9A 1PWEA 2WAOA 2Q9CA 3N87A 1HLFA 4LWOA 3EIXA 1E4VA 3VNSA 3EBLA 4RL6A 1KFEB 1PSZA 2IT1A 4WPGA 2PXAA 5BSWA 1PGNA 1LV8A 4NYIQ 4RIEA 2BC9A 3G0BA 3TIVA 1ADYA 3ZDEA 4KHPB 1XAIA 1OLSB 1PW5A 2QN2A 2VCEA 3LNTA 4KQ2A 4R81A 4XUGB 3RS4A 2NZWA 4B2IA 2OCXA 3FFTA 2GWHA 4KN6A 1NRJB 1W581 1M6VB 4LK2A 5JH7A 4NFYA 4GZMA 1CUJA 1MC8A 1ZVQA 4ID9A 2MSCB 3DZ8A 3UMFA 1EVJA 2EC5A 3IUMA 5GTDA 3V9PA 3EG9A 4PYRA 1KJ8A 2J5KA 3UIEA 3U44A 3SYRA 3DHEA 1QYDA 4YMHA 1KJQA 4INAA 3IP6A 5C4MA 2HYIC 1LCIA 1TW3A 2AJ8A 4YRRA 2JVKA 5DTMA 3MJDA 2JCSA 3IA2A 1XELA 3S5JA 3D6HA 3L7BA 1NC1A 3IMCA 3B2NA 4I9HA 1VL8A 4RD1A 4B84A 3OLYA 4P81A 1S3IA 1P17A 5BSUA 1MVNA 1J09A 5E6UA 4B6SA 3JWJA 2GK4A 4UJ3A 2ZAOA 1NZJA 5GY7A 3T5TA 1KMCA 1NASA 3G5TA 2JAQA 3EIEA 3OM8A 4GPZA 1K27A 4WXMA 4XPIA 4F4HA 5J58A 2BGTA 4LNUA 4PLWA 3ICOA 4QUDA 3TWOA 5EZ5A 5KTTA 2ETVA 1DC8A 4OI4A 4BLQA 1NA5A 3D2AA 4WY5A 4BX2A 1Y5NA 4IH1A 1I2DA 2XPCA 4CV3A 2P6PA 3E4DA 4RV5A 1G7RA 2I6SA 1XHFA 2IVZA 4D9KA 2IS6A 4Z7OB 4AP5A 3ESBA 1NJ6A 5JJCA 4FD2A 2SNIE 2JGJA 5DGTA 2Q3BA 3PD0A 3E18A 3HYTA 4J94A 5F51A 1MLDA 2VZEA 4X90A 1PX2A 3MCAA 3L7OA 1ZJ6A 2ZTUA 1G2QA 2YYAA 4IW3B 3L1HA 3BCHA 3L04A 3WWDA 3DXYA 4J7XA 3OF2A 1T6ZA 1ORVA 2GLUA 1UT5A 3KJXA 3W9BA 3FYTA 2ORWA 3GZNB 4CKWB 2JPDA 1U5AA 5IKPA 3BD6A 3LLUA 4YJGB 4RHFA 4W5JA 3W5AA 1G20A 3S8EA 1REQA 3STXA 4AY5A 3GRKA 2FSFA 1LS1A 1EM8A 2C5BA 2X7XA 2ECQA 1OZAA 1V2GA 3B51X 3HPRA 5M34A 3U6KA 4E33A 3KQSA 2RHHA 3IQXA 1MAUA 4MO9A 5A9RA 1KKMA 1M2WA 3I92A 4CU2A 3IERA 1A9PA 4OLJA 4JEIA 3CLRD 2FQ1A 2W6PA 3LC1O 4YPFA 2P2NA 3UFXB 3URMA 2A7QA 3FKJA 3P9QA 1ARZA 3G8AA 2CJFA 5BN3A 3KYCA 3RODA 3PEYA 1OLUA 4HGOA 3AOGA 5CEJA 3SXUA 1SG0A 3NBQA 4H4EA 3FCAA 5FNVF 3BXZA 4M9ZA 4DUYB 4EK9A 5EESA 1SCJA 5KNCA 4ND1A 1D1QA 1X92A 5DN6A 2HA6A 4ITVA 3S4YA 3KTAB 3WMFA 1N5MA 1IJKA 1B16A 3LI2A 3DMTA 3AUKA 3FAZA 3QVKA 1QIMA 4XXHA 3ROFA 4AJ2A 1ZW1A 4ZCRA 1Z3IX 4MGKR 5H83A 4R0VA 4G2TA 3G9ZA 4ZYXA 1ZCBA 1KK2A 3EDRA 3LTEA 3UOAB 3LV8A 4ISCA 5DWDA 4K28A 1L6IA 5D5QA 2XUJA 1KIAA 2BGLA 2FZLA 2QROA 3VI4B 4ASUD 5A6VA 1IVNA 5AW3A 1L4MA 2CUTA 1DP4A 3MS4A 3VR5H 1J2EA 3O3NB 5KJFA 2IY8A 4OCZA 4UQLA 4EX7A 1AUXA 2EP8A 3EFHA 3K16A 1AHIA 3PPXA 1U7UA 3CG0A 3ZGXA 4BVKA 1UXHA 5AI6A 1ISSA 3I2GA 1QKIA 2A0FA 2PTGA 2XNDA 3GGDA 3NBMA 1XHLA 1KQGA 3K92A 2PVSA 3NANA 3S1SA 3HCNA 3MJCA 1UOOA 3WKEA 1KA9H 1RYNA 2G8NA 5JD5A 2J1LA 4Q1FA 4KPEC 1YJBA 2X8AA 5JNUA 4BXOA 1DTEA 3Q0TA 4ZMSA 2VUUA 4ZCQA 3CUKA 2PNJA 5JXHA 2A5DA 5JE8A 3DEFA 3OEHA 1DX4A 4TV9F 3P97A 2BF4A 3AC0A 4R1MA 3FFXA 2R6CA 4G5HA 3L4KA 2WUGA 2FWPA 2J5QA 2GBLA 5E4FA 4IIBA 3EXEA 4WXPA 3BULA 4INZA 2RBEA 1A96A 2H18A 2RH9B 3BIFA 4XFDA 3ZZNA 4ENUA 2C84A 4LXQA 2B4QA 1YK0A 1G3MA 4LJ4A 4E5NA 1XFAA 1FRQA 1Q0SA 5D6OA 1BN7A 4MUIA 5DT2A 2RI1A 4KYVA 4XWAA 3QJGA 5IABA 1D2RA 1DAIA 1GKUB 2JIOA 3G79A 1LNQA 4BKQA 1GOTA 2Z1NA 3E53A 4W63A 4NL4H 4C14A 1JQDA 3VTFA 1W25A 5ADVA 1E2JA 4Q3KA 1Q1NA 1XA0A 2QKYA 3DZKA 3JQPA 1Z08A 1N6OA 3HABA 2KM1A 3GYGA 3GDWA 4IEIA 4BFWA 2YY6A 2I2FA 4FS8A 3JD4A 3FUTA 3L77A 1K68A 1J20A 1XJWA 5K3CA 2PLNA 3LJKA 2IV7A 3TI9A 4DJJA 2W98A 2XDAA 5KWVA 2BGGA 4OYYA 2JFFA 4FQ5A 3EVDA 4PYNA 1HURA 1QHNA 5TQ2A 2PBZA 2BN4A 1AOXA 2QBYA 5EIEA 3A27A 4BXOB 4GEGA 3SVZA 4NZPA 3LP5A 3GA0A 2J5BA 2RHLA 2EQAA 3A31A 1IE3A 3QTLA 4B0PA 5K6TA 1DG3A 4B2YA 4YMVA 4OKNA 4XM0A 3VU3A 3LP6A 3GO4A 3SZMA 1T3TA 2P7IA 4ZVQA 1HDGO 2DF8A 1VE1A 4JD5A 1O95D 4CTNA 2YS7A 1RE0A 4YCBA 4OB7A 3VU8A 1W93A 3QEMA 5J2TB 1H1LA 2QP4A 4MRMB 3BB3A 2IU3A 4TRMA 1PO7A 3IKVA 1FQJA 1FTGA 2G1JA 4GGMX 3WLFA 2IZ0A 3GELA 4EI7A 3KBBA 1TUGA 3IB3A 1ZA2A 5CGQB 1G6Q1 1ZU5A 3W9YA 3PX3A 2M98A 3DCIA 3QWIA 4BFVA 5EAIA 4X1YB 4C7OA 2CDAA 4F1WA 3OQNA 1JH8A 3EGDA 5KHAA 2I4OA 3DEAA 3PWZA 1MABA 2XGSA 4GC9A 4LMRA 3MGKA 5LPNA 5P8WA 3NATA 5ELLA 2CK3D 4OU4A 3TSYA 1BA3A 1QAOA 4QWMA 5CU7A 2WFZA 1A98A 2GZMA 4FSDA 2GM4A 3JZMA 1ZIPA 1K2WA 2GD1O 4KWEA 4RQTA 3I01A 3O47A 3ODPA 3DV9A 3SJCA 2NUPB 3WBBA 1VPVA 2BP7B 3WB2A 2AVDA 2X8LA 5HF6A 3HXKA 1G60A 4QFMA 3I4FA 4AWBA 1CZOA 1UH5A 3S27A 1JF8A 3SSMA 5JI2E 3F7MA 1X13A 3A6EA 1IM8A 2OC9A 3IOYA 4U39A 5JCPA 3VYVA 3Q40A 2OGWA 2D0DA 4KLCA 4RLHA 4L4XA 3H99A 2FPRA 4P93A 2P2YA 2YN2A 1GFWA 4DZRA 1XB2A 5IM5A 1JJFA 2JIDA 2QI9C 3K0CA 4ROSA 4U6SA 4HQLA 1OPRA 1YCFA 3K5IA 3T9BA 1A5BB 1NQAO 4G23A 5TR9A 3RHZA 4BB0A 4EENA 1WBDA 2FY8A 3OFJA 4QGFA 3GK3A 1OMOA 2G25A 5IN5A 1PD1A 2CC2A 2DTDA 2A8YA 3AETB 4A0HA 2C4WA 3WIEA 1P1JA 1VMKA 2QMHA 5A9TA 2EDAA 4W6QA 2VP0A 1TPZA 4POAA 3SE7A 3WICA 5AVYA 1B00A 2ZBDA 3OM9A 2XCQA 1NW6A 2PWPA 4M6WA 1RCTE 2EYQA 3O8OB 4MROA 4HWRA 5TPZD 4DE5A 5LFAA 3LC2O 1WQ3A 1PJSA 2QTRA 3I8OA 5D85A 1GUYA 5HKKD 1GDHA 3LF2A 4JC8A 5AR1A 1MJFA 1V16B 4LE0A 4PIVA 1LRKA 3ZHVA 2HREA 3C6XA 1GFIA 1U1FA 3KR1A 2ECOA 1NBWB 1RADA 1TC2A 1X7YA 3FOAA 3ZHRA 1GLNA 1ZVKA 4DSUA 1MA0A 2C8JA 1H3FA 4BNVA 2NO6A 2PT7A 2BP7A 3CZQA 1ZR4A 1JG4A 3EA5A 2FMFA 5IAGA 2XQJA 1J6UA 2I6XA 1Z0KA 1U2SA 3GYBA 3KOMA 3PI6A 3HCWA 3TIIA 3OC6A 2CVOA 1M1UA 1Y7LA 4FFNA 3RRBA 2CNWA 3PDJA 5JTUA 2WLTA 4GMGA 4JVSB 1PFYA 2XZDA 4LVNA 4BLPA 4ER0A 1XRQA 4POOA 5K1ZA 5B6JA 2R68A 3HI6A 3VDQA 5EQFA 3PL5A 2XHZA 4D3SA 2ABWA 4TXHA 1OI4A 2KBFA 2RGCA 1C7QA 3COWA 3FLMA 1U3UA 3FWYA 3L01A 2DHCA 5DXAA 1K4YA 4FUTA 1COWA 1D9XA 4M9QA 4PZYA 1QV6A 5JADA 3I1JA 4ZOQI 5DI9A 5ADHA 1AGPA 4EMTA 4DNFA 3IHKA 2YMQA 1X9IA 2QGNA 1D0SA 2FGJA 1K08A 3OF3A 1HLGA 1HSZA 2YL2A 4CDMA 4MAFA 1LKZA 3WKBA 3O8OA 3KCNA 3I1IA 1FB5A 3HTXA 2E89A 1JIJA 3O2JA 5FQNA 1NVVQ 1KOLA 4DPMA 3I64A 1O77A 1OYWA 2I1VB 4GUAA 4UTXA 3H8WA 1WR8A 4LEIA 3X43A 2WIAA 5FJIA 1CRWG 5T8KA 2EIHA 1XZGA 2VYVD 2BE9A 1XTQA 4MQFA 1M7GA 4DMRA 2VJLA 4TSFD 1JIIA 2QS9A 4BN5A 4TKUB 5H82A 1GSIA 5KVQA 2FMTA 2QRPA 2V4MA 1Z73A 3ES9A 4H0NA 1K7CA 1O87A 5HBGA 4MRVA 1PR2A 3DT6A 2R7MA 3H2JA 2F3RA 2JJMA 1FFEA 1TJ3A 2KX7A 3RSGA 2Z9BA 2B3DA 3IPYA 4TXMA 5AW4A 4JR2A 1YFKA 1E6CA 5CPFA 2YDYA 5D87A 5G1NA 1ZUIA 4LZLA 1YDMA 3CY6A 3K0EA 3ORSA 2EWVA 2JFOA 2X0DA 1Y0BA 3HP7A 1KDYA 3TOCA 3I73A 3QK7A 4ZJZA 2P9ZA 3CVYA 4QPDA 1AC5A 3CUYA 1XEAA 4TYNA 1USUA 4G0ZA 1Z4JA 4HGYA 1K7SN 1SKYE 3ND6A 4P83A 3V1KA 4BLRA 4A26A 3FSGA 4JVOA 3O3OB 1YQGA 1MOSA 2NACA 3Q98A 5LBTA 2IV2X 1V5EA 4CQNA 1EA5A 1YS4A 1ODKA 2SECE 4OMCA 2VWQA 3DE3X 5KQPA 4P32A 1FTQA 3FSEA 1KARA 4KLNA 2PFKA 4DR7B 1U8FO 1H5NA 2CNKA 3O4JA 1IN8A 4OUDB 3W5UA 1XNHA 2GZRA 1ZOOA 3OO1A 1WSBA 3QKRA 4XIFA 4F93B 3B6KA 4LISA 5BO5A 4WESB 1FU7A 3NFRA 1WVMA 1FRVA 1M2GA 3TBKA 3TQFA 2AW3A 4JXZA 4PZDA 3DV2A 3P52A 5I4BA 2GUGA 4HH1A 1M8GA 3NHBA 3KVYA 4MYSA 2G72A 2EBFX 1TPYA 2VWHA 3BFXA 4DG9A 1K97A 3C1OA 2WU8A 1J8MF 3L6EA 3PL1A 4RV4A 3TEFA 1YDFA 2H16A 3TO5A 3ZWNA 5BNTA 1FJXA 2PWZA 2PHZA 4M1QA 4Q47A 5KTYA 1B42A 1JXQA 3G2JA 4DWWA 4CG0A 3B8HA 2CHVA 2YX1A 3QOFA 5BSHA 1SQSA 5ELXA 1F7VA 2EDCA 1JX6A 1SUFA 4G1CA 1TZJA 2ZPAA 5DULA 1GNSA 1PNOA 3KBOA 4PR0A 3EXG1 2O8DA 2ODWA 2YCLA 4RVFA 2NW6A 4DMCA 1EUCA 1O97D 5AKJA 1A8QA 3CE6A 3IJEB 4UHCA 5DGCA 3UT5B 4YALA 2F55A 1DEAA 2C3YA 2J0EA 3TR5A 2GDJA 2A0XA 1GL3A 1YZQA 3LT4A 3ZXUB 4NK5A 1MENA 5IBCA 1C9JA 3E3AA 1VZ3A 1QCDA 2QD1A 4FFWA 2XIJA 3EA4A 2IXFA 5EE0A 4EPWA 4XYMA 5FPSA 2P27A 2ZWIA 3WDSA 1M3SA 4XASA 4YV1A 1Z4KA 5K99A 1C41A 5L7YA 5BMVA 1PG2A 4E7PA 1Z34A 3WIUA 3EXFB 1N2ZA 4GE3A 2EBWA 2DFVA 1H8ED 2WIDA 1WZ2A 1UBTS 1VYTA 4XUCA 2VJPA 4EEXA 1R0LA 1ATIA 1MDFA 3NHWA 4FOPA 4J1TC 4OUDA 3UPUA 1L8OA 3VISA 3OTQA 4MYUA 1XCJA 5JNWA 1I51A 3G49A 3TLKA 5CLGA 4FFSA 1KKLA 2QRMA 1KH1A 1MFZA 4EHBA 4D79A 3KPUA 4X24A 5EMLA 3RTGA 4JJFA 1Q95A 3V2IA 2BD0A 5DNVA 3LLSA 1BS1A 4UUQA 4F7DA 2AC7A 1R8JA 3I9NA 4DM7A 2TRSB 2ZBFA 4OQYA 3RE1A 3RBZA 4KE6A 4PO8A 1FNDA 1O6FA 2LV8A 1ESEA 4JYCA 1BX0A 3KZ1E 2CYBA 1ZOPA 4AJPA 3VV3A 5HRCA 5GOZA 5TJHA 3I5XA 4RXUA 1PZEA 4A9AA 2BTOA 3K9LA 1U04A 2UVDA 3LD9A 5H16A 2P78A 1ZBDA 2AIRA 1BFKA 2PXHA 3K32A 1KQPA 3FFAA 3TRIA 4A0GA 2RCNA 3F5MA 4KXNA 2W83A 2XX3A 2MSLA 2EX4A 3MBOA 5FO0A 3O0DA 1YO6A 2GEUA 4Q19A 1LPAB 1CF2O 1EFKA 4DM3A 1Q44A 1HV8A 3M7IA 4KK3A 5KOHB 3MRSA 2IUTA 1OGYA 1Y4DE 2VYCA 3H5LA 5FAXA 1J42A 7YASA 4N8DA 5ILGA 2HI0A 4CDRA 1I7QB 4B6RA 2XMZA 4XPZA 3E48A 3GXOA 1CULC 3IEKA 4JIMA 3VR0A 4GL2A 3WNQA 2JZCA 5AJWA 3NHSA 4L5JA 3GEMA 3W8FA 5CT9A 3FYUA 2IHJA 4YK7A 6ABPA 1OASA 3L8DA 3OLZA 4GVLA 3CW8X 3BK1A 1NL3A 1TVMA 3NWBA 3W2HA 3BM5A 3QU4A 2Q4TA 3U7RA 3M89A 1W6UA 2XDQB 3HFGA 1XJ5A 1VL6A 5JJBA 1O08A 2B4RO 4KW7A 4YAGA 3ZJUA 1YBVA 2ZYHA 2NU7B 1UM8A 4DQVA 1KAMA 1RR6A 3PFHA 1FRZA 2F9FA 3KQYA 3LK7A 4IXTA 2B1GA 1YZGA 2VT7A 4DBLC 1NP3A 2H8GA 2ZATA 3L79A 3F4KA 1GGEA 1WBBA 1YQ9A 1MGPA 1KS2A 4NU0A 4V1CB 2CLOB 4BX9A 1QQAA 5AJVB 2DUUA 4WL0A 1QCCA 2MJLA 3LXXA 4ND2A 821PA 1T6BY 5IW8A 4MKFA 2LBPA 4ZI3A 3VR4D 1FBTA 2GRAA 4BRWA 3RU2A 3X2SA 1ZNZA 4OB6A 2JFUA 1T4BA 2O5EA 1KORA 3DQZA 4MGZR 1E7MA 3DL2A 5EHXA 1VPDA 4MQBA 1G3QA 2FLKA 1BVYF 1VHTA 1QLHA 1INLA 1V7CA 1QYWA 4KWCA 4LC1A 2Q8NA 4EWLA 1A9OA 1FL9A 4RFLA 1UAGA 1P73A 3K3PA 1DJOA 3F4LA 3KKMA 4RLQA 3E3MA 4FZ5A 1NSYA 4EBBA 2NSDA 2JZOA 4IJWA 1J0AA 3KZVA 3C6BA 3WLNA 5I47A 4RH0A 3ANSA 3CVVA 4LKOA 2JIBA 3IP5A 4ZVVA 4B6FA 3DEYX 2KJQA 3DEJA 1G64A 3O1IC 4UHKA 1Y5LA 5CEEA 1LGYA 2JFPA 1RLJA 4Y1GA 3ZYCA 3H84A 4S05A 4DR4B 2RHBA 4FMDB 3UYLA 1MG5A 4KMSA 5KNLA 4KFTA 3ENVA 4EOGA 1H05A 2X2OA 4R3WA 3NO4A 2G36A 3DE6X 4TRRA 1XMXA 4IYJA 2JAOA 1OVMA 3RRXA 3SR0A 2DULA 4J16A 1Z82A 4KQEA 1NVDA 5B7PA 1R0SA 4JC5A 4YJ2B 3H9GA 4JAVC 1MEEA 3IQGX 4TZKA 1P1RA 2C96A 2H48A 4JI8B 1B43A 1ULUA 1E3QA 1D0VA 4KQIA 3ETDA 1CFZA 4JUAA 1APBA 3ZWWA 1N9KA 2KS6A 2CT8A 2PS1A 3IT2A 3PQ5A 1ZR2A 2PGIA 1C3JA 1GPJA 2ZI7A 3IHWA 1B4DA 3AY6A 4X7MA 5J59A 4DA7A 4O1MA 1PJRA 4KLAA 1SH7A 1UK6A 4HDSB 1CR0A 1WZIA 3JWHA 4YJ2F 3A6LA 4MITA 2A35A 3R9IA 4ZJYA 3QEAZ 1YFLA 1JDJA 2NZ2A 1M5UA 3ZIUA 3H3XA 1LVUA 4RTKA 4DR1B 4IICA 3K9HA 3LUHA 4D6YA 1W6RA 4ARIA 5AVWA 4UPDA 1BEUB 1WUTA 2I4MA 4ATNA 1WDMA 1DV1A 3D31A 1AGXA 3Q5DA 5C4IA 3CIOA 1KY4A 4XARA 1E58A 4N6OA 4NCAA 1MW8X 1LUAA 5FWXA 1E0DA 4HWPA 1JFFA 1U3TA 1HORA 2G3YA 3DC2A 3AR4A 1L5HA 3DAGA 5C8VA 2A9KA 4OUKX 5EZQA 2GPJA 5DK4A 4ETIA 2Z2ZA 4BIMA 1GG5A 3FPKA 5FI1B 1ZCAA 5CBKA 3WFZA 1RU3A 3L8HA 5JAQA 4GO1A 3IEPA 4V0ME 3T94A 5BWMA 2R7NA 3EHDA 1ZK3A 2I9KA 2XUIA 1EE9A 3Q3VA 2IYNA 2NNWB 2OO7A 3ISJA 3VNAA 2XQIA 3O4IA 2YRFA 4KQ1A 1DTWB 2O6HA 4E2ZA 6NULA 1GQQA 4UDNA 1F9AA 4AF7A 3RABA 1FXWA 3JVIA 5IULC 1POWA 2HFKA 2RGXA 3KJHA 3NYQA 3WMGA 2OLJA 5G41A 4NOJA 2ZIFA 3SBEA 4B33A 3AHIA 2GRUA 3T15A 4Z2YA 1XQYA 5CNMA 2PZMA 2MYNA 3BRQA 1F9EA 3KS9A 5CJJA 3E3OA 1BVHA 4PAGA 2DPXA 3PWSA 2OOSA 2CWDA 1KJZA 1L0BA 4G1UC 3GG2A 4ND4A 5GOTA 2I4RA 1UJMA 3OZUA 1ENYA 3HY6A 2FXIA 3CLTD 5DMXA 2EG9A 2WYVA 3W2IA 2CV2A 4UBOA 2V5AA 2CMKA 4INJA 3OU2A 1Q0QA 1YH3A 3GFRA 5EQTA 5AW9A 4IEEA 1NIJA 3GP8A 1YAJA 4AF8A 4HN9A 4EYEA 4ND3A 4D3ZA 3BA6A 3HEMA 5FWXB 4JK3A 4D0NA 2O57A 1AA6A 4K6GA 5ABPA 2IYSA 1N3IA 3PNLA 4N49A 3Q3CA 3ETGA 2R11A 5JQWA 3VKGA 5JVDA 2BCEA 2CBXA 1DE0A 4B3BA 5AYVA 2JJ8A 1GZHB 2GCNA 2NUAA 3D59A 1G55A 3FGZA 3PNQA 2VJKA 3Q41A 4D8UA 3DVRX 1M5RA 3AJEA 1CJMA 2NGRA 1KY3A 2J3EA 1HKUA 2B83A 2DPHA 3PQCA 4NAVA 5JFGA 3AWIA 3DZIA 1Z06A 2QZJA 4GECA 5AM4A 3V8QA 4EEKA 4A0FA 2B2NA 2P9HA 3AR5A 3H75A 3HVHA 4JHLA 4I1SA 4LVUA 5T4BA 4F38A 1LB1B 4DIKA 1Z3CA 1IHYA 2FPIA 1OLXB 4ZZ0A 5KVAA 2XD4A 3JSAA 2UDPA 3PC4A 2XUDA 2DT5A 1YDGA 2XMRA 3R5FA 4CMAA 4ROTA 3I23A 4JJGA 1RWNA 4ENPA 1E3DA 4U8HA 2C5FA 1I24A 3K0KA 1QOPB 1WKCA 5G0VA 4PZ0A 1U7XA 1KJIA 2H7VA 1E2FA 1WTAA 5DWQA 1LRLA 4QU5A 1S2OA 5DLYA 4OXXA 5CEFA 3T3NA 4UREA 1NM5A 3WRXA 2IW1A 3GC6A 1PR6A 4U7DA 3EIHA 3HDHA 4NOMA 2JD2A 2VH5R 1UC4B 2WWHA 1ENOA 3AB7A 4ZV4A 1KTIA 2NO7A 3G0CA 2E87A 3KC2A 1J4AA 1MQSA 3I9JA 1S96A 5GP1A 3CWCA 2IIPA 1XNGA 2AXPA 3C1AA 3NC4A 1M8KA 3TM4A 4IIDA 2OHGA 2X6RA 1X1BA 4WHMA 5ENZA 3LO5A 2ERYA 2XT9A 4ZTBA 3LLCA 4L3OA 2Y1OA 4IFEA 1JBEA 1HTTA 1UXKA 2UVQA 4L5CA 2NUAB 2WUEA 1NURA 1TF2A 2L42A 1PTJC 2JAUA 2PKQP 4ILEA 5SV2A 4YMIA 1FXWF 5FPHA 4RPCA 3FBGA 4FE4A 5A3VA 1M1YE 3Q2OA 2YQ5A 1G4HA 3M5CA 1GGNA 1M34E 2QTGA 1UQUA 3K70C 2YC2C 2AHRA 4F12A 4ZJPA 1K5DA 1M34B 1PEDA 1SA0B 2ZJ7A 2HF8A 2HV8A 3V1MA 5F7JA 2OA0A 3E9DA 4HMQA 4WASA 3VU0A 2K2WA 3V9AA 4Q3BA 1BYIA 2FPOA 3M6XA 4JX8A 1IK4A 3UAYA 3KUUA 1P7YA 3WHPA 1I2MA 2PX6A 1D4AA 2BHLA 1NPDA 2I55A 2GASA 2V9CA 2Q4DA 3IT3A 4G4GA 4NBNA 5AOCA 5L3SB 5IWAB 1AU9A 1WMFA 4HB4A 2X4LA 1TYAE 3F4BA 4LW8A 5ALIA 3X1XA 2UYQA 2W6IA 3BFPA 3ABSB 3ZVNA 1L4FA 2QG4A 2AFRA 1C0PA 4ENWA 2OV1A 1KEPA 1LDBA 2OUIA 1GTG1 4UNPA 1ADCA 1U3DA 2PRZA 4O4JF 1GG8A 1T34A 1PLKA 5E1MA 2L2QA 3C43A 4V2UA 3V8NA 4EL5A 4FONA 2PX8A 1U4OA 1Y63A 5B5SA 2VXCA 4QXRA 4EGFA 3D4LA 1FOEB 3SSOA 5JRZA 1G3IA 1CUZA 1RJFA 2QX6A 4UASA 3QYAA 3RF7A 4EABA 3PB3A 1RYBA 4IUDS 1JHYA 4V24A 4RSHA 4FLEA 4BFXA 1R4AA 4E08A 1R74A 5T3YA 1GITA 2O9JA 3HG7A 4R1LA 3H11B 5E4TA 3TQHA 4CLHA 4GR9A 3M4NA 1XA3A 5JUWA 1WX1A 1P9RA 2I9PA 4YYZA 1VE5A 3LDUA 1FSZA 2P6RA 2ALJA 4Q18A 1KDOA 2CCKA 2CFCA 3DMNA 3AR3A 3DTVD 3R9KA 1S1CA 1CX9B 1WPGA 2ZR9A 4HK4A 5C18A 2ZZMA 2H06A 2P9FA 4LMBA 3U9SA 3L0DA 2IP2A 1KO8A 5CLFA 1SB9A 1JBKA 1GUDA 1OQAA 4EKGA 2ZJ8A 3D6VA 4TYMA 2BM9A 1JW9B 4P9NA 1SG6A 1IY1A 4KPUB 5M3BA 5EJ4A 3SMQA 3WA7A 3ABZA 5FTJA 4E2YA 4MUAA 3DTNA 3HYCA 1SO8A 3U3OA 4AW9A 2IXEA 1GKLA 4Q7MB 1MO2A 1ZNWA 5IHPA 3HZHA 5L40A 4MTLA 5CD9A 1SU4A 4KVZA 1Z8FA 1JTVA 2FPGA 5ALQA 2XYGA 4GRDA 3C74A 4B3FX 1D0IA 2AZTA 3FCUB 4K6HA 2VP2A 3DYIA 2PX2A 3KSBC 3JQ8A 4MW6A 3SNHA 1R5JA 3ESDA 3OX4A 4CM4A 3JZDA 4OXQA 3KK0A 1YDEA 2CMGA 1KBQA 4JVLA 4RV9A 3TI7A 3HVKA 4KXMA 3MHTA 2QE6A 3KTFA 3L7NA 2W7TA 4IJMA 4YI3A 4F9GA 4YAKA 1YMQA 3PNKA 1B23P 3GN1A 5GZ6A 3W4KA 4E5YA 2FRXA 2QLLA 3DL7A 1E63A 1VQ1A 2GM3A 2HPHA 3RK0A 5A62A 5AW7A 2QVCA 3L7JA 1XEWY 1JTFA 4D45A 2LUOA 1LPOA 4CMHA 2X2PA 1QG4A 2ROQA 5CM9C 2XQGA 1SHTX 5A0FA 1WHTB 1ZH0A 5LVAA 3RS8A 1DADA 2BM0A 3P0JA 4B80A 5AVKA 4ZKDA 3FOFC 1EESA 2YZNA 3OCZA 1W5AA 3HCEA 3A6DA 5IBQA 4MIEA 2QUZA 5A3SA 2R6JA 2CD9A 3FGOA 4ZT4A 3WG9A 3MT7A 5D1HA 2IH4A 4G1EB 4J29A 5BMOA 3OFND 4TYPA 4HB3A 4S3MA 3BH6A 3NW9A 5JECA 5TSDA 3WGUA 1TD1A 3OJEA 1J70A 4MUMA 3R24A 3EF3A 4MINA 1EBBA 1T2UA 2VPQA 4KO3S 1GTL1 2WHQA 3MJSA 5BORA 1LNZA 1EXDA 4B6EA 1K9VF 3LUKA 3Q5EA 1BHSA 4YDSA 3R5SA 4KR9A 3KT8A 4FFPA 3TRKA 3U31A 3NDIA 4AULA 1IAQA 2I6QA 2NTNA 4BEWA 3B9BA 3D4BA 4UE2A 4F4JA 3CM0A 5REQB 2G83A 4ABYA 4IKEA 3UN1A 1U0EA 5GONF 4MICA 2DKOA 4N5MA 3TYXA 1KVSA 2HBQA 1JU4A 2FDRA 2W8BB 5FB3A 1GT6A 3F71A 1YJ8A 3FZEA 5FL7D 4EHNA 8ADHA 3F78A 4LRYA 1R8QA 2QYHA 1VA4A 1E8MA 2ZR8A 3ECAA 4I8IA 4PQFA 3SFZA 3TFOA 1DPGA 4TLDA 1KQFA 3ZCXA 4OHBA 3P2YA 5JSQA 2RJNA 3RO7A 2DFDA 1JIKA 4H6WA 4JN6B 3VO2A 3HKCA 4C0AC 5M2QA 1GKIA 2W2KB 3NUZA 1AIPA 2V7QA 2HK7A 3LA6A 1V25A 3ZOZA 4KKVA 3LKVA 3T8YA 1LLDA 5JNSA 5CX1A 5E6RA 3RUFA 3D0QA 4ZEVA 1LH0A 3BTOA 2I6FA 1Z5VA 1H0SA 2VATA 2W43A 2YYSA 3M6WA 4P5PA 1LW7A 4TXNA 2P41A 2IS1A 4BIIA 3AL0C 2QVXX 2JI6A 3HLYA 5DNCA 2IFTA 2JKZA 1X3LA 3G1WA 2BCGY 3L7KA 2VDOB 4UNIA 3U9LA 1EYZA 4F3YA 2JRCA 4KSBA 2N46A 5E1DA 5E2BA 4F3RA 5C32A 3IKTA 1I94B 1R0BA 2RONA 1RYMA 1BSVA 1EWVA 1NBEA 3CF0A 1AKQA 2IQ5A 3P19A 3P0HA 4FJ1A 4QGAA 3Q8XB 1U6JA 4FYKA 4IDDA 4R2JA 5E7MA 2DMRA 1IDN1 5J2UF 1DCMA 1WY5A 5FDFA 1XRSB 1YL5A 2CVQA 5KQGA 1U3VA 3EE6A 3LUPA 3VZDA 5MN6A 4CQMB 5CTJA 3L92A 4FP9A 3D9QX 4ZALA 1EDZA 2UZAA 4W9MC 5CHEA 5HQ3B 1GSOA 5I48A 3CVUA 3LW8A 5HHTA 2OAGA 3CPSA 1EDBA 2NT3A 2ZVDA 3W78A 5FUMA 1U2DC 3VAYA 4OI0A 4QM6A 1QAQA 1PLJA 2AI3A 3TTVA 3K9NA 3AL3A 4LKRA 5GINE 5ED4A 1HC7A 3EW9A 3G2OA 4LGVA 5EIBD 5JAIA 5AHWA 4AYXA 1XPOA 1CIVA 2FR0A 1WOMA 2ZETA 4UUNA 1G20E 1AG9A 3Q1KA 1G1AA 3GW8A 1QS0A 4R5HA 4PN3A 4L57A 1VHJA 2EGGA 2W2KA 1JS1X 3JS5A 4JLPA 5A4FS 2IBTA 3MTIA 4DWOA 4IXMA 2NTEA 3C5HA 4HJRA 1U2EA 3UQYS 4D2IA 3GZTB 5ESXA 3RUCA 2JGFA 3PHJA 5K03A 1OH7A 3GCXA 4HNAA 1WEKA 3JQDA 3VXKA 2JL1A 2WIFA 1JNYA 2GUWA 4ZIRB 1HPLA 4CKEB 4OVKA 4ZZ1A 4DY4A 1WSAA 3U1TA 1HY3A 5BOSA 4EG4A 3PYMA 1FVXA 2IYOA 4R2LA 3DP9A 3RROA 3Q9SA 1AZLA 2WHRA 4O4LA 5LMZA 1YNOA 3BFJA 2VDJA 3FE2A 3JV7A 4RTNA 4DABA 4LDZA 5TVGA 1RXWA 4ZO9A 1YJ5A 4Q1DA 1SGWA 5JU6A 5EHQA 1ULHA 3T41A 1XZCA 3C5WP 1KY2A 2CW5A 1RI5A 2Q28A 3QE4A 1TJ5A 3THXA 1E0AA 4GI7A 1UWCA 5TVKA 1PGQA 3GJ0A 5C52B 2WTBA 5IH7A 4B3CA 2VF7A 2I1LA 1XDUA 2ZYWX 5K2OA 3DUFB 2XV1A 1LSUA 2R00C 2ZRBA 1O96B 1QGDA 4TYYA 1CK4A 3W04A 3HA7A 4HB2A 1RLIA 3LGAA 1UXJA 4KREA 3HACA 4XIIA 3UHJA 1M1YA 4RMNA 1RWWA 4ZJUA 3I05A 1JGTA 3AIOA 5FBZA 2CFRA 3BREA 3GUVA 1Y5IA 2IIQA 4YXWD 1CUVA 1WKBA 1Z6PA 1OVGA 2G0TA 3NUQA 4MUJA 1EUZA 4LF8B 1JN0A 4KUHA 5K0NA 1W2GA 3OX2A 4BFLA 2XQVA 3NI2A 3H5NA 3ZCUA 1RZVA 5FUQA 5HIKA 5KJ1A 3T38A 4DWJA 4RVSA 4LYFA 5LBUA 2RG7A 2P4QA 4DSNA 3D8NA 5AVVA 4ZHSA 1Y8QA 3EG5A 4OHVA 4Y6PA 1FSFA 2OORA 5D7BA 5CFPA 3DDCA 5KZMB 4DV3B 2QLNA 1T10A 1UQRA 1YMVA 5DO9A 2J4CA 1RPTA 2A88A 4MP6A 4BBJA 5BOSB 4JBGA 1QIKA 1DL5A 1BXKA 1U9IA 4HQFA 1E5TA 2QUIA 3PXCX 4C0XA 3H5AA 5DHUA 3AHGA 3KB2A 4PYQA 4RA6B 4MPPA 5JARA 5K3AA 1VJCA 3EFEA 2JLYA 4S0ZA 1S02A 1GGMA 4KE9A 4MZXA 3ZKWB 4IIJB 5EUMA 2EJUA 4NSNA 1SBCA 3MJFA 2PYZA 4UMEA 2VDWA 5AIBA 5B6IA 3DUFA 4JP8A 4Q21A 3HQ4O 4EGSA 3C5EA 2H2WA 2ZSBA 3SR4A 4PRLA 4V2IA 3O2NA 1I33A 2VSOA 1ECJA 1X42A 5DU2A 1V6CA 4P7FA 2AEEA 4L27A 5G0SA 3AVTA 4MWEA 2RGBA 2X15A 4B9AA 2VLBA 3CC8A 3PUYA 3CG4A 1GU0A 4MPJA 4WGFA 3RS7A 1ZQ1A 1E9RA 3BKWA 1M0WA 5BRJA 2QF7A 3H1AA 2RFLA 5AM1A 3A2MA 3QXJA 1Z6TA 4MH0R 1LVHA 1OC2A 2ISQA 3AF0A 2EFEB 1JWBB 3JD0A 3NTUA 4OI2A 1ESDA 3OE7D 2OO3A 3QSGA 4GKBA 1UF9A 2ORIA 3P9SA 4YJKA 1VRWA 16PKA 3A06A 3M4YA 2OVBA 3T34A 3I4CA 2W58A 3HDYA 4EYKA 3Q8WA 5KTKA 1K92A 1R8YA 4BO9A 1JJVA 1YJXA 1GTMA 1QTRA 3MWDB 4M8KA 2HXGA 3CKKA 5DM1A 1VHWA 1L5FA 5JSYA 2HSZA 1DKRA 2I4NA 3UG7A 4FBGA 3ZDQA 5DBEX 2XA1A 4AG3A 2CZGA 2ST1A 4RFSA 2ORYA 4C4XA 2PS3A 1ZD3A 3RVPA 3SG0A 2D8AA 4P3KA 4RHYA 2C20A 2VJQA 4BQFA 3F6RA 4Z4IA 2ZB3A 4MWBA 4GRIA 2J41A 3U1VA 3C3BA 4HDCA 3DV0B 2Z04A 3JATB 4B6QA 3BHMA 3H18A 3N0VA 3H1PA 4N0QA 1GQRA 4WBSA 1GPH1 2ZYVX 2FZVA 4K81B 5ER6A 5FEMA 5FBKA 4ZXFA 2O52A 4YAUA 1QP4A 4GR4A 5CFQA 1RXUA 2IZOA 1XK7A 2BUAA 1GV0A 4NH0A 5EE1A 1YKFA 3EFBA 1Y7PA 2YV2A 4QDZA 1DIBA 2HU8A 4IX1A 5CDFA 3BB1A 4M99A 3HM9A 2BR4A 2E1RA 3RRJA 2PQ2A 3JQGA 5FTLA 3PHCA 3ZHYA 4WZBA 1D1PA 2N9UA 3COSA 3RU7A 2IS4A 3C1TA 2VA9A 3UAGA 2E21A 4BNMA 3PLAE 4KAAA 2HIMA 4LMPA 3PR1A 1QLJA 3F7NA 4IR7A 1U65A 1L7MA 1QANA 2NPOA 4I4CA 3BWYA 1GY8A 5ILOA 3QG5A 4JI0B 4KACA 2PD4A 4KO4S 1WXDA 5A4DA 4D3XA 1V96A 1S2GA 2CZCA 2BFOA 2XJ4A 1U7HA 4EY5A 1E94E 2Q4EA 2CJWB 3L6OO 4QU0A 2CVPA 3AUTA 3E7DA 4D3DA 2O3RA 3VSCA 2ZS9A 3H6GA 1RTTA 2GN8A 1N7JA 3BDIA 3FRJA 1L5KA 1QJ4A 2RHJA 1O6CA 4AJ1A 1JDPA 2WZQA 2HH9A 4Y98A 3NEYA 2RB4A 3RYCA 2AE1A 1PYDA 1L4EA 5LDHA 4PZCA 4QL3A 1P2FA 3CNEA 4I5EA 4PG7A 3H2HA 5CT5A 2J3DA 2YN4A 4F2DA 3I3SR 4IDPA 2A9QA 1IXKA 2R8BA 3JZAA 2BGKA 3GLSA 2F64A 2WNIA 5IF3A 3M1YA 4M1YA 2OFWA 3CUEF 4RJTA 1WIWA 1MJ5A 4N3AA 4AS3A 1CCWA 2I2XB 3KAKA 1Q22A 1F6DA 3LIIA 2WM8A 1BE1A 4X6UA 5BYKA 3K2IA 1W4ZA 2H85A 2HLPA 2PYIA 2WMYA 4K8RB 5CB8A 3CURA 5HSGA 4ARZA 2HHHB 4CV1A 3V4PB 5CVEA 4L6IA 3VV2A 5KNDH 3O1HB 1Z4MA 2X2FA 2D5AA 3N7TA 4EGCB 4X64B 2F8LA 3PC6A 1V48A 1SK9A 2J9FB 3DCJA 3VTAA 2FPMA 4CG3A 3EPRA 4TVBA 5F7ZA 1Z0AA 2JLCA 4WACA 1JFSA 2YVQA 4I4TF 4Y8VA 1NXOA 4ZQGA 3U4HA 3G2PA 5CDHA 3IBFA 1B0UA 1WB9A 1EHCA 4IRMA 1G18A 3AZQA 4K9PA 4LRTB 4MV8A 2XRZA 1ZH4A 1QHGA 2CJWA 2HA5A 2XODA 2ZBUA 3DNFA 3UBMA 4LJSA 4A0QA 2R2AA 3UJ8A 3BGOS 5A2QA 2FK8A 1ES9A 1R8SA 1JA0A 4WKOA 5BUZA 1VBMA 3TZKA 1NF9A 3EDQA 4H35A 4X8HA 5A05A 3BE6A 3RSQA 9ABPA 4K5QA 2QPTA 4Z3DA 3V5NA 3MGCA 3MQFA 3QIAA 1E0SA 2ZI3A 2Q3FA 4H1UA 3TFQA 3IMKA 5MFZA 4YRJA 3EVTA 3M2TA 4PHGA 2VWGA 5C5EA 2A9VA 2I2CA 4UZSA 5HFAA 1T3HA 2IH2A 3L07A 1ND6A 3JRXA 5A04A 1X8XA 3TJRA 2AH5A 2VUTA 3A05A 1V3QE 3JWPA 3T52A 1PQUA 1B6GA 4LUCA 3VHXA 4M88A 3EMDA 4R41A 3G9QA 3LPMA 1ZA1A 4B5LA 1ADFA 2P1RA 3IPRA 1XTTA 4TQUS 2NO0A 3IH5A 2G4VA 2O2EA 1QHXA 1XMVA 1Y3BE 2ZPTX 4RVDA 1C7ZA 1OWNA 2Q5QA 2OPBA 3COZA 4JLNA 2OBXA 5HGJA 4YDQA 3S2GA 1S8NA 4LBZA 3OLCX 3PA6A 2OO5A 4YJ3A 1JU3A 5AW5A 3M70A 1RZ3A 1VMIA 4PXYA 1O95A 3R41A 2DFTA 2VP9A 1SVNA 4RZSA 4G07A 4U2CA 4K7JA 4REMA 2H4YA 5EVJA 4PSCA 5BSRA 4U00A 1OXMA 3KKKA 3V4LA 4Q3CA 4XWGA 1NMEA 3D43A 1BW9A 5BQOA 1UJ2A 3AVQA 1L5NA 3R3WA 5EXXA 3K0FA 2HDWA 5A0VA 5JZOA 1JXAA 1GFSA 1GNLA 2P0AA 5EIAA 2YR0A 4GOND 5FNVB 3Q8MA 1IB6A 2XNDD 3CBQA 2PZJA 3IAEA 3BICA 5E9WA 1Y7TA 4EY3A 4IIGA 5A02A 4LF7B 1D6NA 3FTEA 4N3GA 3W1WA 2ZRKA 5CMLA 4RE5A 3KSUA 4RS3A 1UMBB 4HYYA 2WF6A 4YCSA 3OMXA 2RMKA 2IA5A 3MINA 4XGNA 2HJRA 1E1RA 2EHJA 1B3RA 1D8AA 2VJDA 3IP9A 4BHTA 1KVUA 4QT4A 2H1IA 1T3LA 3DSRA 3CTPA 3LXMA 2ZM5A 4J7UA 4US0R 4N0MA 1NJFA 3AF3A 3UG6A 5LP1A 3OHPA 2ACEA 2PKCA 4UBJA 5TQJA 1BROA 1YK1A 1FDUA 3B89A 4Y6LA 3H4TA 1QFZA 4BQSA 3W5DA 2NVUA 1VA5A 2WUVA 3JYLA 4H3HB 1T4GA 1WCWA 1YQUA 1Z29A 3L9WA 4KODA 5JBNA 1V6SA 2BRUC 2P9TA 1LLUA 2QEQA 3FIUA 2PY6A 3Q11A 3QV2A 1NQUA 4IGAA 4MB6A 1XQWA 4TTTS 2P0YA 3MT9A 4WZZA 1RAAA 4ETWA 3C0KA 1IUNA 2J48A 1OXXK 3LGSA 1P3JA 4URFA 4LJKA 1KEVA 1U2RA 2W00A 3DHNA 3E7FA 1XP5A 2PZEA 4O2AF 1RBZA 2W6JD 1DNPA 1KYIA 3OZGA 2ACWA 3UWSA 3UMMA 3OJOA 4BFZA 4W7IA 3W6ZA 4UHDA 4IIUA 1E9SA 1US8B 5GADl 3FVRA 1RZRA 1D6SA 2O8FA 3E5MA 5ESDA 1QMGA 1UKBA 2MSKA 2K6GA 3OHSX 4AMBA 2BYTA 1XN4A 2ATIA 2HNAA 4UTNA 1GZ4A 4LG1A 4K6MA 4PY2A 3S2ZA 3BH0A 1Y80A 2AV6A 4B7UA 4KE7A 1ZX1A 1IC6A 2QTVA 2YBEA 4OGFA 1J5PA 2A9FA 4ED9A 2HPZA 4JH0A 3LX6A 5E2AA 1KYXA 2WHXA 1HNZB 2XNJA 3AQ4A 3CLUD 3QYFA 4LGMA 3PT9A 5JEEA 1JQBA 4NCBA 2XKJE 3EOBI 3KZMA 4IXNA 4KWIA 3U09A 1EUDA 1GZ6A 1L4BA 3HRHA 3H1GA 1CF9A 1F6WA 1M8FA 2JK1A 5I7SA 4L22A 1AXEA 1XQVA 3GEHA 3N05A 4FLFA 2FRVA 2E4AA 2VHQA 4R2IA 3M6VA 4I9GA 4TXLA 1R64A 4OYHA 3IRUA 4OHFA 2EIXA 4RXTA 5LIRA 4QJBA 1M1ZA 4L7QA 4WI1A 1Y1RA 3L9XA 3QSYA 1V4BA 4Q16A 2HMAA 3FYDA 2GX6A 2YWBA 1RQPA 2ID4A 1N9GA 3Q87B 2I2DA 3EGIA 4HN2A 1E1YA 2OC4A 4O2BA 4PHFA 4GX2A 4JSYA 5LXTA 3AG6A 3KT0A 5LQJA 1QF7A 1FW6A 2V7UA 1O94D 2HWKA 2WWXA 3OQOA 1QDEA 4RVCA 5AHRA 4JWKA 5HBRA 3VSAA 5K0ZA 4MQEB 2PXXA 3SPXA 5TX7A 7MHTA 3ORRA 3H5IA 3PR2B 4ALKA 2CF6A 2XVZA 1SKQA 4U0JA 3L6RA 5ULLA 3WIOA 2R6DA 3CE9A 2DWOA 2QE7A 1L3BA 1QAMA 1NG9A 4RK0A 1EXMA 4X41A 4WADA 4JUFA 3HA3A 2DFPA 3PE3A 4Z8YA 3UANA 4MV1A 4FW8A 4EYSA 1W9HA 1VRCA 2E6KA 3MFYA 1H8HD 3MXTA 4YP5A 3U4CA 4PYJA 3QUBA 1W4LA 1LPPA 4B17A 3N86A 1V5IA 3H86A 3KFLA 3USCS 4A16A 4G5RA 4OD0A 2VDLB 1D2EA 1U9JA 2EFCB 3H2BA 4L0DA 5FBHA 1D2MA 3V42A 4DCMA 3Q9LA 5FD8A 2PKQO 3PRJA 3FUWA 4YRPA 4C0LA 2ZZNA 4IO0A 1XNJA 3EUWA 2C8LA 4AQYB 4UVHA 3CX6A 4MI3A 3TOZA 5J47A 3MUFA 2PQ6A 2VPPA 2EJVA 4LNUB 1HFKA 1VL0A 2OQIA 3PEUA 1NPYA 3RYTC 4I55B 5TJ9A 4HQNA 2GPSA 4W8HA 1ODLA 2VXYA 1AKNA 5EIHA 3A6PC 2IY9A 2ZUDA 3CUTA 2IYRA 2D1SA 4MUGA 4YRBA 1UDCA 1ZNQO 1SAYA 3RGWS 3WRYC 1SFRA 1UJNA 2ZYGA 2NO5A 3B60A 4RXMA 4ZVMA 5LXTB 4DKXA 2IHTA 2FRDA 3EAQA 3WS7A 4DZTA 1R9MA 1KH2A 1GAEO 1L5RA 3QG1A 1ADBA 1PS9A 2O1XA 4IJVA 3TZLA 3KXPA 4MQEA 2HA7A 1S3GA 2C7GA 4D97A 1I6WA 5CVTA 2Q5EA 4N40A 5LJLA 2R66A 4QOSA 2ACKA 3WOVA 1WDLA 5KYXA 4REQB 3ZTYA 1K6IA 1V3UA 5A03A 1MIHA 2XYVA 3BWBA 2XRYA 1RM5A 2Z56A 1N34B 3HV2A 4UOQA 2GLXA 3EVCA 2MSEB 2Z2XA 2COUA 1AS0A 3DOHA 3O4GA 4YJGA 1CYEA 4FZVA 3DQPA 2BEUB 2V54A 3D8UA 3LUDA 2H51A 1ZIOA 3TL3A 4G0NA 1QHSA 3ZEAA 2XCUA 2J3JA 3T12A 5AESA 2A9PA 2H4HA 2B7BA 2FFAA 4X6XA 3ENNA 3GRFA 1VI2A 2I2BA 3JQRA 2E1PA 1O4WA 1QRTA 2WICA 1W94A 4QXOA 1BTOA 1P1CA 1SUSA 1CJBA 1DAOA 4KPGA 2FG5A 4HYTA 3R76A 5C8YF 1W1UA 2D7CA 1YUBA 1NW7A 5E0OA 1PEAA 2XE6A 3WB0A 4R98A 5LLDA 1QGED 3EGCA 5U1PA 4IJQA 2RBKA 3BD8A 4ZCLA 1K8QA 3ER8A 1RCUA 2O8BB 3DWIA 1DKOA 1Z2PX 4ZOLA 3NAZA 3FSRA 1MIOA 3MYYA 2IUYA 5HZHA 2H52A 4LQLA 4NFLA 5DHTA 5K45A 4QXQA 1RJEA 1LZKA 1BJRE 3DG9A 2ZIXA 4WBNA 1SOAA 4W8OA 1L3CA 1UKEA 2Q2OA 3KTAA 4LYYA 1BKSB 3ABOB 4HDKA 1PJ2A 2GHRA 3C6QA 3JYHA 1ZC4A 4FHDA 4KN9S 1Q1EA 4J7CA 4B85A 5K3OA 3GJXC 4REQA 1BFUA 5KVVA 1C1DA 2RKWA 3ADKA 3HYNA 5E7QA 3I9FA 4F9TA 5IC4A 1VSVA 2AQKA 3CMCO 3NIFB 4PGAA 1UFKA 2IBSA 3H8JA 4MV4A 5GWXA 1NWCA 1DQZA 1R3DA 1XA4A 2JHPA 4URUR 3SS8A 3T6KA 4W7SA 1DXHA 4C2UA 2MSDB 3AKDA 4PWYA 1GO2A 4KSCA 1WP4A 3D2BA 4XX0B 3ZI4A 4Y0VA 4EJSB 1M6WA 4N8SA 1JT9A 3I9V1 4RPJA 4PGMA 3PFFA 3QPAA 4GS5A 3MWEA 4PANA 4ZU6X 5GZ1A 4CYMA 5CD1A 2UUAB 3O6VA 2ZRNA 1V7QA 3DD1A 4N48A 4L3WA 4KLRA 1ZY2A 3RC7A 2JRLA 5AJZA 1OCEA 1Z5GA 2NVOA 4DCUA 2PZGA 2G9RA 5ITZA 5AWFC 3WLTA 4GC5A 1DAPA 1EG7A 2TMKA 2PNFA 3LKDA 3MM4A 4O6VA 4UBKA 3O38A 4BRSA 3G2QA 2PUDA 4XGIA 1TMOA 3QW4B 4YB8A 2PZ8A 4DZZA 1BWRA 2X0NA 3QXSA 4U5XA 3TW0A 2SCUA 2HCRA 3GJTA 5GV8A 1MIOB 2VHEA 4ZCTA 1U3GA 1Z4PX 3LUGA 1PK8A 1ZFNA 2R7LA 1Q83A 2BWJA 2EERA 3D7NA 1SWVA 3OT4A 1WZEA 2HCJB 2R8EA 1M2HA 1MC4A 1Y1QA 2W6ID 3ECCA 2YVKA 4YS6A 5DNDA 5FA6A 1JHPA 3BWXA 5DJ5A 3T3PB 3WXBA