3EWNA

Crystal structure of a thij/pfpi family protein from pseudomonas syringae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
242
Chain Sequence
SLHPHAMPDMGPDMNKVPWMGDEQIAMLVYPGMTVMDLVGPHCMFGSLMGAKIYIVAKSLDPVTSDAGLAIVPTATFGTCPRDLTVLFAPGGTDGTLAAASDAETLAFMADRGARAKYITSVCSGSLILGAAGLLKGYKATSHWSCRDALAGFGAIPTEARVVRDRNRITGAGVTAGLDFGLSMVAELRDQTYAECAQLMSEYDPDPPFNAGSMKTAPAHVRTAMIELVAEFTKKADALAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/PfpI family protein
publication title Crystal structure of a THiJ/PfpI family protein from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 72
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ewnA00
4P2GA 3L4EA 1OX4A 1Q2UA 5SY9A 1Q7RA 3L7NA 3PQ6A 4P5PA 1GGFA 1QDLB 1CE8B 1L9XA 1P5FA 1S1MA 2LXNA 4QYXA 2V4UA 3TQIA 1QF7A 4WINA 4Y1EA 4ENVA 3B38A 2AD5A 4ADSG 3F5DA 3PQ4A 4OGGA 3SF8A 5E9AA 3FIJA 3MGKA 1IZZA 2R1TA 2FEXA 3NOQA 1QVVA 1UCFA 3ZJ5A 4MNTA 4P35A 1CF9A 3B3AA 2VPIA 1A9XB 3R76A 4ENQA 1IZYA 4ENUA 2GHRA 1QWSA 4D1YA 3M3PA 3EWNA 2ZUTA 2W7TA 1PDVA 3FSEA 1KA9H 3BWEA 3EFEA 4I2NA 1P7ZA 3TTXA 4AJ9A 4B7AA 5LIRA 4R7GA 3UMMA 4L78A 3RHTA 3P9SA 3NORA 4N0MA 1VCOA 4OFWA 4ZDKA 2RK4A 1KWKA 1R9GA 1I7QB 1P80A 4MGHA 3TTVA 2R1TB 3P9QA 4I4NA 1SY7A 3PQ7A 4UZSA 3D54D 4MTCA 3SF8B 4ENRA 4ZGGA 4L8FA 1GGHA 4BIMA 3PQ8A 4GUDA 1P81A 1CS0B 4BFLA 4P36A 1SOAA 3KKLA 1GGJA 4E5VA 2XF2A 5IP5A 2VXOA 5SYAA 3TTUA 4AUNA 1I7SB 1OX4B 1OY1A 1GGEA 4BTEA 2YWCA 3NOVA 3VU3A 4UOZA 4ENSA 3UGJA 1O1YA 2R1VB 1I1QB 2YWBA 2ZUUA 3CZ9A 1ONSA 1PV2A 4Y1GA 3OT1B 1G2IA 1GPMA 3B36A 3EZGA 3GRAA 4L8YA 4WXYB 1KXJA 3NOOA 5BV2P 1J42A 1GG9A 4OJYA 2R1VA 1M6VB 3L3BA 2IUFA 4L95C 4ZDJA 1GGKA 3NVAA 3ZR4B 5JZMA 2A9VA 2R1UA 4XLLA 4OGFA 4RKWA 4OIFA 4AUEA 4UCFA 4ENTA 3CY6A 4L8WB 4K2HA 1P7YA 2ZUSA 3N7TA 1K9VF 4GE3A 4S0ZA 3MIIA 1QVWA 1U9CA 3CNEA 4UOQA 1T3TA 2GK3A 1WL8A 1JDBC 1KEEB 2OR3A 4ZDIA 1GPWB 3F71A 2H2WA 3PQ5A 4LRUA 3TTTA 4Y1RB 4PXYA 2ISSD 1KWGA 3P9RA 1C30B 1OX5A 1JVNA 3ZJ4A 4B5KA 2NV2B 2ABWA 3CZAA 3SOZA 2NV0A 4HCJA 4B31A 3WFZA 4Y1RA 3P9PA 2ZUVA 4QYTA 2VRNA 4N12A 4JQSA 5SY4A 4I46A 1QVZA 1PDWA 1PE0A 1N57A 4ENPA 4B40A 2AB0A 3PQ3A 4E08A 4OQ4A 4ENWA 3PQ2A 1OI4A 1C3OB 1OX6A 1VCMA 3UJNA 2ZUWA 3NONA 1FYEA 4RKYA 4B2YA 3CYFA 5DFAA 3TTSA 2RK3A 3L18A 2D7JA 4P34A 5SY6A 4Y1FA 2VDJA 3TTYA 4GE0A 4L7QA 4LGYA 2YWDA 3R74A 5K4AA 1BXRB 1FY2A 3UOWA 3EN0A 1VCNA 1T36B 5JZOA 3UK7A 3OT1A 1T0BA 2VKTA 3ER6A 3R75A 4AUMA 4UNIA 1VHQA 2RK6A 2WJZB 4Y0NA 1IPHA 2YWJA 3BHNA 3EJ6A 3TTWA 4AULA
chains in the Genus database with same CATH superfamily
1QNLA 4R1NA 1A8IA 3H3XA 5C81A 2IEBA 1I6KA 4YQEA 4II2A 3C7DB 7ABPA 5L3RA 1XCGB 1UBNA 2FY8A 2BGLA 3QLTA 4OOFA 5JWOA 3THWA 1CE8B 1T4CB 3AY3A 2IE0A 4Y6RA 1ACLA 2ZROA 3UFXB 1I5EA 2JI4A 1KH3A 4R9VA 3IT2A 2BZ0A 4Q9JA 3SNKA 5CDFA 3OTWA 1E3SA 1SHLA 1Z12A 2ZSBA 5BMVA 4LZZA 4M21A 2IKQA 1DKUA 2JLAA 2QU7A 4HH1A 4JD5A 3RTDA 3VKFA 1XZBA 4I7EA 2Q41A 1L7RA 3BBLA 4MCAA 3QU7A 2PZAA 3VZQA 2XUPA 4D3SA 3HE3A 4PXSA 3KU4A 5C80A 3R7BA 3K73O 1I51A 2ZXEA 4QD3A 5THQA 2Y99A 1E4OA 4DUZB 1FRVA 3KOUA 4AYXA 5JSKA 5AM4A 2FWNA 2XIQA 1L5HB 1NT2A 3GCGA 4NEQA 2W98A 3UV7A 1J5XA 4V1CA 3AKZA 5IW8A 1NBME 4BO0A 3B82A 5IF9A 5GADl 1B1AA 1E2DA 2SHKA 3NYIA 3GROA 4W5NA 3GARA 3AR6A 4PS0A 3TM5A 1E1RA 5J2UA 3A36A 3CWCA 3H75A 4G24A 5FPSA 2EEPA 2OOSA 1NXWA 3SFTA 4XQGA 1M1ZA 4DG8A 5AVSA 3Q9UA 2AYXA 1R6AA 2PX0A 3NHYA 1ADFA 1FP6A 2BEVA 2EL9A 4QFCA 3UJ3X 4A8JB 1HNXB 1EFLA 3C1OA 5AESA 2AEJA 1RWWA 1PZFA 2M1ZA 4V2UA 1NR1A 3MPUA 4INAA 2IDKA 1KEWA 4Y2GA 1E2JA 3WIUA 4MUJA 2A58A 2CCGA 4Y6QA 4DPLA 4HYYA 1FS6A 2LDBA 4AS3A 3LBIA 1XVLA 4L4UA 4RTQA 1EWVA 5I9LA 3HO1A 1P17A 2AKEA 4YFVA 2J3JA 3LGXA 5A4JA 1T2AA 1X13A 1GZUA 1QFZA 2ZE8A 2DQSA 4K8RB 1GN9A 1KE1A 1UEXC 3VNBA 4F72A 3NBAA 1XTBA 4KXFB 5LDHA 4HV4A 2AOTB 5CBPA 2QENA 5BUSA 2VTDA 3VSDA 2HI0A 2RC6A 3MMPA 4Q7LA 4BZPA 4WN9B 3F4KA 4I50F 5EIEA 5K0BA 3MM4A 4BO8A 2I6GA 4OI2A 2D13A 5GIPE 3QMWA 2WD7B 3HNRA 4TN5A 1MPXA 2ASEA 4IHAA 3AUUA 2X23A 5EWMB 3DC2A 2H31A 3RT7A 4AO6A 3HFJA 4F9TA 1XTZA 3W9YA 1JR3D 5FLXA 3PQ3A 4L74A 4XPZA 4BO2A 1CT9A 1WM1A 1Y9DA 3ESCA 3H1EA 4H7HA 4V0LA 5AHWA 4AJNA 5C51B 2O8BA 5DBEX 1TCBA 1Q12A 1UWCA 4J7AA 1ETUA 2Q9AA 4BLUA 5K2MA 4QJIA 4W5TA 1IJKA 2X5XA 4LMPA 2DSNA 2QSZA 1XRLA 1ZD2P 3I1JA 3OQPA 3JATB 3I30X 1VJ5A 3UOGA 1TTQB 5AYVA 4BPRA 1ZH6A 4WFJA 3PLAE 5FNVA 3RROA 2H5LA 1IDN1 4HQRA 1YUBA 3F4BA 4F4DA 5A4MS 4DBZA 5E1OA 2V7GA 3H97A 3TLMA 2O0HA 2I55A 3TINA 1N9GA 3M6IA 3HZHA 5IARA 2NZYA 1FK8A 3ZHCA 4AJIA 5KYNA 2YY6A 3GLUA 3ONWA 3UHJA 4P5PA 1RYDA 1ID1A 5JNUA 5EL0A 1V2HE 4G1BA 4K5QA 3OO1A 3PP8A 1NZDA 4ADSG 1ISJA 1A77A 3JR3A 3LTEA 4DV1B 3LHFA 4GX0A 1TYEB 1IZZA 1KMQA 2OHIA 4LISA 5D7BA 4MV9A 3SR3A 1KFCB 2IXBA 2ZDQA 3MGCA 4IOLA 1Z5PA 2QMHA 4G1FA 2G8LA 1KSGA 4LGCA 1C9NA 1WPQA 2GHRA 1RQLA 2X0RA 3A6GA 5F64A 5ULLA 1L4NA 1KYXA 2X14A 1GYQA 4BMVA 4QTTB 4FSHA 4I2NA 1BTOA 1N8NA 3EC7A 3GJXC 1DBWA 1LNQA 1XK6A 3JQ8B 4KODA 3WI7A 3L4JA 3IT3A 1VE7A 2C0QA 2ZVPX 5K99A 4BEJA 4C7VA 3Q40A 3CG4A 3HP4A 4K9NA 4CLEA 3KAQA 1DCMA 4PLHA 5IANA 3KTAA 1IMOA 2JFQA 4QO7A 3D5TA 5FEMA 1K1EA 1SC4A 4TN1A 2P6RA 1MXHA 4G4SO 4ZKDA 2B4AA 3ZI0A 1ICIA 1V16B 2R00C 2CL7X 3PKJA 1Q7GA 4Z6KA 2PKXA 4ZVUA 5CAEA 1O8CA 5JD4A 2V5AA 1SU8A 3M3HA 1HORA 2RI6A 2ZIFA 5F9MA 1FVHA 4P86A 5FADA 1P31A 3M70A 4TXHA 2BFMA 1K6IA 1HO3A 2QAGB 1YACA 2NU6B 3SJCA 1I4TD 1ZH8A 3REQA 4EG3A 1NAIA 4NOKA 2WTNA 3BHJA 1H05A 3A6KA 4H17A 3TMAA 3TQHA 4BTVA 4E21A 2UXCB 2EJVA 3GJRA 3VX3A 1YA8A 1YC5A 2ID4A 2IYUA 2YDYA 3BE5A 4WESA 4Q9IA 3DVAB 3B2QA 3NHWA 3VHQA 1YCHA 2XMCA 3C97A 5LYJF 1WUJS 1Z7EA 3DW1X 1PGQA 3EVDA 4Q34A 3WG9A 2XRMA 2R5NA 1A98A 1JSRA 4BQIA 4ECAA 7GPBA 3K5PA 3U7IA 2MSEB 1YFKA 1P7VA 3QXHA 4K9MA 4YCNA 3NALA 5HF9A 4N65A 5LQDA 1ISFA 4IIYA 3SEZA 2BR3A 1T3TA 3ZCSA 3N8HA 1JQAA 1WL8A 4O4LF 4Z9XA 1TYDE 5JNLA 5K09A 4IOJA 3OKFA 2NU9A 5G2OA 4HEJA 1ULTA 2B4QA 3LJKA 3Q4GA 3TBHA 1GG2A 2PU5A 2EX0A 3FZQA 3MMSA 4P2BA 4HAOA 3I2JA 2JBAA 1DKQA 5EPUA 1UT8A 4UW9A 4M8NE 4QTYA 1QQ7A 1CU1A 5BSVA 4OP3A 3BXFA 3TCKA 1L7NA 4MUAA 4ZMBA 5C32A 2XQGA 5BSHA 3A2LA 1T4GA 1MO4A 2CUTA 1FNMA 3P52A 4NAUA 3EB9A 4AMUA 4DM4A 1W49A 1J7JA 3FOCA 3WXMA 1AQIA 3C41J 2HR1A 4TKMA 3RARA 1WXFA 4L4YA 4NJMA 4OXNA 3RC1A 1LDYA 4YCDA 3ZQKA 2A35A 3HEBA 4MV3A 1E0JA 3IE0A 3ZV6A 2EF1A 2HKIA 1S8AA 2Q7XA 4R9NA 3OEED 5KYUB 3BF7A 2YOHA 5BYJA 4HWKA 1XTPA 4ZCTA 2JGRA 2P27A 4URZR 3OZAA 3UJAA 4EUEA 5JQGF 1JPJA 2FU5C 1TAGA 5DSTA 2C31A 2QORA 2RARA 3TRJA 3ZVMA 5CX1B 5F52A 3RJ5A 3ZDEA 4WVLA 4EG0A 4UHKA 5HTOA 2JC3A 2J33A 4UDNA 1K3FA 4ZC8A 1NX9A 3L92A 2YJ6A 3DUFA 1Z0KA 3GJ0A 1JEEA 2J0VA 4J6EA 1MMFB 4RFSA 4E33A 1CUJA 4WEOA 4WKNA 2FWIA 2B3DA 1TO6A 4PRZA 4BNTA 1NNSA 1YDFA 2YHIB 1CNEA 1QV9A 4EBFA 4EL5A 2XTNA 4B3RB 4WFIA 1XDBA 3NTLA 1W4CA 1ZUIA 1ESNA 2PT7A 5C8YB 1B0ZA 2FJUA 2QP9X 4P35A 3DC7A 2WJHA 3RIGA 2ZIGA 1A0OA 4URXR 4ENQA 1N2CA 4IDAA 3E05A 3SN6A 3L9WA 2W6NA 1L5QA 1Y6JA 2GH1A 4QDUA 3WAJA 1UDAA 2G17A 2OKCA 4LHYA 3PGMA 2YZMA 5DZSA 1KO7A 4DXAA 5BOSA 3UBMA 1CW2B 1R5NA 2PSEA 2WJIA 1D2RA 2C42A 4N7MA 1N3LA 1ISIA 4QDJA 1U90A 3FUCA 4TVKA 2D0IA 4E6EA 3I4LA 2ILTA 1KJ9A 3FFAA 4TXJA 1XRJA 1A9TA 1E6LA 1J8QA 4DN6A 4EJSC 2XA9A 3ZGZA 3O38A 1U0HC 3AF6A 1ST3A 4FZ3A 2VF8A 2GK6A 3RYFA 2FQ1A 4F2PA 3JQPA 2F3PA 4ZI3A 1AIPA 1W76A 1ZIPA 1G8JA 2R47A 3KQSA 5EZSA 2VYVA 3BQNB 5FBHA 3DQPA 3T8YA 5FL7D 1MVOA 2YWXA 3CCCA 1ZRSA 1GUYA 2VSQA 1QHNA 3GR6A 3ROEA 3UBTA 5JS1A 2R7NA 1OYVA 3L0SA 1WXGA 1Z4PX 1C80A 4H6WA 3T61A 1YS7A 3PPIA 1RXCA 3MPOA 2WNIA 3TD2A 4JEUA 1JLLB 4H2DA 2WWIA 5JH7A 3T7SA 2X15A 1QNFA 1KPIA 1V3QE 1I7NA 1T15A 1UOOA 3BCHA 5L3ZA 4POOA 1E2IA 1JVSA 5EIXA 1NA5A 3D8NA 3DL0A 5HF6A 2NUTA 1S3IA 2BELA 3RG8A 2OBXA 1NVEA 3FCXA 4JOSA 3JQBC 2CMHA 1DIBA 5HUQA 2CJYA 3E22A 4GP7A 1JEAA 1Q21A 1EMDA 1V16A 1VECA 3AOEC 1A69A 3D6AA 3FMOB 1UODA 5CAEB 1IBSA 3G0IA 3RASA 2Q27A 5GINE 2FQWA 5EZ5A 4AAYA 3GJTA 1XNJA 3L1IA 3FH0A 3GEEA 4ZFNA 2B9VA 1GAXA 3D0QA 3R0ZA 1WA5A 2FUG1 4KPYA 1ZUHA 5FUVA 3N6XA 4G3XA 3UHPA 1Z4MA 1J90A 1U6IA 3WKEA 4C1NA 3N8NA 5KQPA 1FSFA 4J6FA 2Q50A 2NUPA 4JASB 5ALOA 3NMUF 3T4XA 2CVZA 2QX7A 3UWSA 4BMCA 1ZN9A 3IA2A 4QGBA 1RKUA 3IIEA 4NK5A 4Y2XA 2FPXA 4QOEA 4G26A 4D9MA 1KMCA 2HJVA 4EZBA 1XCBA 4KOEC 5CFZA 5B37A 4DILA 3B6KA 2QM8A 2ZSJA 1QAQA 4GS5A 4MJ7A 5L4NA 2SBTA 1R64A 4H1TA 4B83A 3CX3A 1EFRD 2DFPA 3R3ZA 3B6ZA 5T5QA 1GTG1 5YASA 2KBFA 2JF0A 2P4SA 2V7UA 3AF1A 4RESA 3GNTA 4WOPA 3EIEA 3KEOA 4F8JA 4J0FA 4MQFA 3X2SA 3VZRA 3TN7A 2JHCA 4XPIA 2WG0A 1Z2OX 4TL9A 2AWNA 3QLUC 2PLRA 2JW5A 2GPAA 4JBIA 3IXQA 2IZ6A 2CXNA 3G2NA 4B3TB 3GJSA 1U1GA 4JYCA 3SYRA 4Y2PA 3TIGA 1G5RA 2P75A 4BLPA 2FA9A 3DO5A 2DECA 1RYBA 1E6WA 3OFND 2X77A 3SHTA 1O0BA 2A0WA 3QBJA 3UYLA 1IG0A 2QPOA 2G7ZA 3C3AA 4AZ0A 3Q1LA 3Q3VA 4M8LA 3UMFA 3U3KA 1ONNA 1ST2A 5G3ZA 2AI1A 2HU8A 3JQGB 2GDJA 4PINA 2DU8A 4O2BF 2FPIB 2VDNB 2XECA 3K1ZA 3WWYA 2EZ9A 1QHGA 1T8WA 4DS3A 4LDQA 2HM7A 2PGNA 3SKVA 2AKAB 1KEVA 1TYCA 3QI2A 4D6XA 4YDQA 3BK2A 4PLWA 1DCFA 2OKGA 1K6EA 2OHGA 3QVLA 4L4XA 3QVSA 2GTIA 4C7OB 1NQWA 3H9QA 4LCJA 4CM1A 1Y37A 2OLKA 2XTAA 3ICVA 3QKRB 3IUQA 1C8LA 2WI8A 3LU1A 4ZAYA 3VAYA 1W88A 3GPLA 3R1IA 2CCKA 2YX1A 4A4DA 1OLSA 3LDFA 3QNWA 5E4JA 3VZBA 1RRKA 3TO5A 3RU7A 4AMYA 1IN6A 1JIQA 1KIFA 1I33A 2AFRA 2EJCA 5JMOA 2Q5EA 3D4BA 3S2GA 2CHEA 3KSAC 3GVXA 1EM8A 5DHQA 2B8NA 1I6MA 3QV2A 3OUZA 1IY9A 4LJAA 4CMCA 5KDLA 3IVRA 2VYVD 5FUWA 4KIWA 3QPBA 2I9PA 4K03A 1XF9A 3OOJA 1G98A 1RI4A 2IEYA 2NZWA 3H4TA 5ER9A 4QNRA 1P61B 1U2GC 4O0LA 3M6AA 2ZBGA 2J3HA 2B7CA 4DIOA 1MJHA 3IAUA 5I4IA 2AUTA 4DDTA 1HTBA 1RXSA 3HJUA 1MO2A 3EFHA 3EEFA 4P3KA 3ZDYB 3P9XA 2UVQA 4V38A 3S7TA 3QYJA 3VPAA 1RI5A 4D02A 2ZSAA 1Q0HA 4F6RA 4HUQA 1N25A 3W1WA 2CHUA 1AD2A 2B82A 3AI7A 2VO1A 3TE7A 5FBVB 2P6PA 1OKKA 1SQ6A 1YJXA 2V1XA 4X54A 4O1IA 3REFA 1RU3A 5BWOA 3VTZA 3O9MA 5AKGA 4LZLA 4XLTA 3ZZTA 4IJKA 4FHGA 4N4AA 4P93A 1GZHB 4CMIA 4LV6A 2A0YA 2QQ0A 1XEXA 5J5AA 1ZJ6A 1ZS9A 1YS9A 1NZFA 1U0BB 8OHMA 3ZXXA 3H0KA 2G0AA 1P3DA 5CEJA 1BDJA 3EGWA 3IELA 1PJSA 4GR4A 4OU4A 2JDIA 1VQ1A 5LDDC 2WYOA 3J81k 3TQFA 2XE4A 3G2IA 1BRTA 1DG9A 4JAVC 4K46A 1QJCA 3IHWA 4YP0A 5B1SA 1U0JA 3K05A 4H7FA 4C6RA 2IS6A 1EK5A 2XADA 4I4TB 1ULSA 2HY7A 1TZBA 3IUMA 2ZIWB 3NHAA 4N54A 3GZ4A 1YTLA 2QUHA 2M6SA 4I19A 5K05A 5K9ZA 2JIPA 4XWYA 5JSUA 1JI0A 2B99A 1XQ6A 5C7OO 1QRUA 3C6QA 1EBBA 1A82A 3M34A 5FP0A 1Y5RA 3MWKA 4XCXA 1DC6A 1KJ8A 4IKOA 3ER6A 4AXXA 4EUFA 1D4FA 4Q3EA 3RVQA 4ZJPA 4Z4GA 1H6BA 4EGJA 1H22A 1FU8A 1LU9A 2C94A 3N9IA 1LFAA 4ZYZA 4BMYA 3DFIA 3TK1A 2IUTA 2XTJA 3OQOA 5CLQA 3QENA 4PHHA 2BMFA 2DPLA 2IC5A 2FMIA 1I80A 3OP4A 4WSOA 2CZCA 1JT2A 4B2LA 1J99A 1P4HA 1JG4A 2NZXA 1UOPA 3ZJUA 2NTYC 3PITA 5EIBD 3RT1A 4ZPXA 2RCNA 1M1NA 3BXZA 3FRIA 3Q8LA 3AHFA 2KS6A 1WQ3A 3MUEA 5H70A 3FR8A 4Z54A 4FX5A 3VKGA 2OCGA 1V48A 1NQVA 5DLYA 3T9CA 1VXOA 4N18A 3FYTA 2H07A 1GNSA 3GPIA 4WDQA 4CDNA 4O33A 4Q6WA 4CU2A 2X9VA 3GYBA 4LXXA 1WAMA 4R68A 5KAMA 3KFVA 4IEFB 3A3NA 2R0QC 1RJGA 1RWBA 3VR6H 1D5CA 2O4CA 3EGDA 1YB4A 1JR4A 1DTSA 2W22A 4QEDA 4UXIA 1H0SA 1I9GA 3EMBA 5JFGA 5JUWA 1QFMA 1VBNA 2Q4RA 1X7DA 3OH8A 2Z8YM 4NQZA 1V37A 4RDCA 2XQFA 4NBTA 2RHHA 5AHXA 2E1RA 3WGMA 3MGGA 3VO9A 4D92A 2CLMB 3D6MA 3QLEA 3PJRA 2D59A 4DAEA 2I91A 5GJBA 3TM4A 2WKSA 4Q00A 3T7KA 3N6VA 1SXGA 3FPBA 4YMUA 3EZ7A 3PQ8A 1I6WA 5JYCA 1Z34A 2B3TA 2P2CA 1M2GA 1QIMA 3LF1A 3SS9X 2Y0PA 1DTEA 1PFUA 2WKRA 4C3OB 2AEEA 2Y77A 3VHLB 3O1JC 1ZQ1A 2XKKA 3PIRA 1IZ0A 1Z35A 4OA5A 2PIAA 1MC5A 2CHFA 1XAHA 3LQ2A 4QNMA 3SNHA 5BVHA 1G8GA 2JFGA 3TJZA 3TW6A 1O95D 1Z2DA 2A5DA 4JQOA 3VOBA 3LPAA 3ZU6A 2W6JD 4M8SA 1RYMA 1D0VA 4LYFA 1TYBE 1VRWA 3IAM6 3D3EA 2J0UB 4YUXA 4N5IX 3GPBA 2UUOA 1BCRB 2ERXA 4QLOA 4YECA 2F1IA 2EVWX 5D86A 3WP1B 4F3TA 4MWOA 4A0QA 5JCPA 2QMUA 2X76A 4N6NA 4IYRA 1M8PA 4I4CA 2DBZA 3BB1A 4TMXA 4WL0A 1V6SA 3G49A 3PFGA 2Z57A 4EF6A 3FVWA 3VZDA 1P7CA 2BGRA 1DBPA 2GBPA 1EUZA 3IXLA 1LUAA 1TMKA 4RGBA 3GOHA 1JP7A 5FPHA 1HDGO 3U3MA 4CEIA 1CIPA 1MH1A 2PZJA 3EC1A 4TPKA 1ECLA 3WIOA 4F56A 3GFPA 4NESA 3ZV4A 3OE7D 4JC5A 1PDWA 2PY6A 4OYHA 3EIFA 5KWVA 4PIPA 3KD3A 4OQYA 4CTMA 3KVOA 1NN5A 1PGPA 3E9QA 3OAAD 3RRBA 3TRHA 5C34B 1BJRE 1JTVA 1TJ3A 3DBIA 4LE2A 3P2IA 3WIEA 4UTRA 2HA6A 3EPHA 4EY5A 5NLLA 5I8PA 4OREX 2ACKA 2V7QA 2QJRA 3QLVA 5KOIA 3L7IA 1SIUA 2O7NA 5HKKD 5ICFA 2OV1A 4ZGWA 2ZGVA 4DMMA 1RP7A 4A6EA 1PL8A 2D6FA 1V7CA 5L7YA 4MGEA 1ZYUA 1ZICA 4B74A 1TEZA 4TS9A 4PQEA 1TVEA 4ND7A 2X3UA 3L4EA 3U09A 4JEIA 5K3OA 3PQ6A 1W75A 1DOAA 3LPMA 3OIFA 4RLHA 1NVFA 3RQSA 2XEDA 4W8HA 5TV2A 1NF9A 5TT1A 2WQ7A 1AZLA 2ECFA 2OMEA 1U2DA 1UM9B 2EDAA 1VI6A 4L0DA 4UFPA 3V8BA 1X7WB 5KCMA 4Z7JA 3G8DA 2JRLA 1AK2A 3TB4A 1L6RA 1E0SA 2GDZA 4R83A 1DI0A 3R3YA 3MBOA 5FUYA 5GV8A 4ESEA 4TX1A 4IHJA 2JL1A 4YRZA 3G8YA 1IAVA 5K6TA 1OBOA 2QKYA 1D3AA 2O2CA 1A97A 4OAQA 1J0AA 3NWEA 3W8FA 4EVIA 1V26A 3A1WA 3BWYA 4KDFA 2QYSA 5CTJA 1CNMA 1NGSA 4L78A 2WUWE 1EGMB 2C2YA 2NVBA 1CTQA 4EGFA 3UMJA 4AX4A 4G5FA 2EKBA 3OU6A 4TTVA 1SKQA 3L0DA 3WB9A 3KB8A 5KSOA 2IX3A 5C53B 4ZGGA 3UA4A 1DFGA 4C4RA 1TUEA 1XDUA 4A16A 1P81A 5EE1A 5T4FA 3LC0A 3EBPA 5EXPA 4IVRA 4DDKA 1XZCA 2IPMA 3U0VA 1CBUA 2JGJA 4DLBA 3OZCA 5EOVA 3IAAA 4BLTA 4KGDA 4BFTA 1GV0A 2EP7A 2VJBA 3RG2A 3LC7O 5F1KA 2I34A 3EF0A 5C1PA 1XPOA 4DR1B 2Y68A 2YRWA 4TTJA 3TUZC 1NVBA 3ELBA 4KR0A 2G4LA 5D00A 3OI7A 4OHYA 2WPNA 2XPCA 2P9CA 5DBOA 3C8UA 1CR0A 2C59A 1JQDA 3P97A 2Q0SA 3BSFA 1S2LA 4HNTA 5KREA 4CTNA 4S2EA 4OYYA 1ZNYA 1GFWA 2ZWVA 3Q5EA 4I4TA 1WABA 1YB6A 5T4HA 1C1DA 2RHGB 2VQ6A 5KYXB 4C2UA 3EEQA 3PUZA 2JJ1A 5K0SA 3EH1A 4ZRNA 1C3LA 4N82A 2ZB3A 2G5TA 3OIGA 1TCCA 2DR3A 1J1ZA 4ZA2A 3F1LA 1I4OA 4LE0A 5EE5B 4P33A 3GG9A 5IUKC 4P54A 1IL0A 1H1DA 2I6FA 4W9NA 3GZNA 1XEXB 1RVDA 3L6UA 1V7QA 4FEYA 1XD8A 1XSEA 4XX1A 5T6BA 2B83A 3NHKA 2QT9A 3LHKA 3KJIA 3UZUA 4IS3A 3T9BA 3RKRA 3OFNA 3K16A 3QBEA 1UP7A 1NBHA 3G02A 1T43A 4JWKA 4OJQA 1ZUNB 1E7QA 1Q16A 3MT0A 5JWHA 2BSQA 3QXSA 4J76A 3KUUA 4LYJA 4FK8A 3BA6A 5HILA 5DNCA 1XIVA 2GCOB 5KSZA 5K4AA 4CFZA 1RYYA 3HVUA 3AEQB 4NL4H 4X8OA 3RLIA 3ROPA 3VYVA 2VH5R 4DV5B 5I9TA 5ES4B 4Q1BA 3GFSA 4RA6B 3OQ1A 1WDLA 3V4RA 2XHZA 3WQRA 2QBYA 2JJ2D 3VUFA 4CI0B 5BWLA 1Y9JA 1PJ2A 4N5NA 3DE0X 3MQFA 2IPNA 1MAWA 1FS5A 3WQQA 4RPHA 1YJQA 3WLHA 1QO7A 1EM8B 5LUAA 1F2UA 5KNBA 2NVWA 2R751 2Y1DA 1J25A 3QBVA 1Q83A 2ZCVA 4I5FA 2WSIA 4F4HA 1XP8A 1H6CA 2H1OA 3AM4A 2WFLA 1OLSB 2OC4A 3E7FA 4UMEA 3V8QA 2XLBA 4O2AA 1KJIA 4ZO6A 3ZD6A 5KVAA 3DS8A 3WK6A 2C1ZA 4EZIA 1C1HA 2VNHA 5BNIA 1RZRA 3O3NB 1W0CA 1WW2A 3ROQA 3N1UA 2FETA 1OSNA 2I3AA 3ILVA 2ZU6A 4JFRA 2VDLB 5CB4B 1AHPA 2IUSA 3LD9A 1R8QA 2QTNA 2VNAA 3TEJA 1C4WA 4ZT5A 2R11A 1PL7A 4R2IA 4N47A 2FR0A 2H06A 2BTQB 2CNWD 4X20A 3FSGD 4FQ7A 4PZAA 4LFBB 5GQSA 4X0EA 2WZQA 3P9QA 5FYDA 2DUMA 3AEKA 4CHGA 2I2CA 5AJVB 4RJKA 1LPAB 1T3SA 3JYPA 3NHLA 4MSUA 3I39X 3ZIAD 5IDQA 4QUDA 5JJ5A 3RTGA 3HYNA 4NYJR 1SXPA 1OB2A 1D2AA 2GEUA 5HIAA 3BGSA 3I2GA 5ECGC 2GAIA 1PWZA 1SEVA 3PE4A 4R71A 4DJTA 4BASA 2UDPA 4K9OA 4LYHA 1TPYA 3OCJA 4IVNA 2PHZA 4B3CA 2FAXA 4BQEA 4S3MA 1DUVG 3HBAA 1MZVA 2DR0A 3DLPX 3EOBI 2JVJA 4X6UA 4MR7B 2C9YA 3Q87B 2VHEA 3OX3A 1QAOA 2PQ0A 5HQJA 4EGSA 2A1IA 1JHMA 3B1WA 1TYZA 1G64A 4KRFA 2A30A 4D9GA 3E9CA 3U9LA 5JYDA 1AKQA 3KJHA 3Q3HA 2WZDA 4LF7B 3HN6A 4C7BA 3T5DA 1MQ8B 3ENVA 4HZGA 3LI2A 2QL6A 1FPQA 1QORA 4D46A 1DOHA 1PRYA 2BIFA 2C29D 4JJ8A 2NAPA 4UNQA 3X1XA 2WUEA 5LMZA 4RKEA 1U9IC 4A6XA 4MTLA 4BMOB 5FH9A 3AB8A 1F60A 2EV9A 3AF3A 1EIWA 3CLRD 3SQXA 3GMIA 1KHTA 1V8PA 4HWSA 4AX8A 1RR6A 4DIFA 4D0GA 1U02A 5LPNA 2MYUA 5EMLA 3IVMA 4J0CA 4ENWA 2B20A 1ZD4A 3QNUA 1E6EA 1LXCA 2QVYX 4BVHA 2Z6UA 3KZVA 1GPLA 3FOWA 5ARCA 5ALVA 4B73A 4YGYA 3KB1A 5BWBA 1XTJA 2C7VA 2P79A 3CEJA 4EFMA 3FHCB 2I1LA 5M34A 2OAEA 5JMTA 4QXMA 1I2MA 1RRFA 1G55A 2ATVA 5FAXA 3CRQA 5TPWA 1TPZA 1JLLA 2P2DA 2QRQA 2XE7A 3LZ6A 5LYJA 3UK7A 2FG6C 3KS9A 3EIOA 4R1QA 1QPZA 4EB8A 3UWDA 1LDEA 4CG3A 1VHQA 3PFFA 3DLIA 2VJAA 2F90A 4Q4JB 4RHXA 1T3ZA 3H5NA 4ZVLA 2OV6A 1ZU5A 3BGVA 2JJ1D 3HCRA 3RWOA 1DAHA 1M2HA 2DWUA 3CLTC 2DJIA 2GAFA 1O96B 2P67A 3NAGA 1MNAA 1X74A 3A70A 4I1IA 4JOQA 5AOAA 2PMEA 2G77B 3VSCA 4B87A 5JPCA 1RLIA 2ZETA 2YV4A 3DDZX 4NX2A 3F6SA 4RIGA 3CVWA 3B9BA 4XLZA 1AHHA 3NS7A 4GKVA 2CGEA 1EZ4A 2GZMA 4IAOA 5I9NA 3E3LA 2GZAA 3GCDA 4FJ1A 2VJMB 2VHVA 2XUGA 3PLRA 3TSAA 5DT2A 2ZTUA 2FZCA 2O0MA 2PNFA 4MW9A 4PGMA 3WXBA 4NPAA 4J43A 2R7AA 1MLDA 3STHA 5U1PA 3GUYA 4KIGA 4TXNA 2WD9A 4GIBA 2OQRA 4MR9A 3DMTC 5IJ0A 3AW8A 1J24A 1NVXQ 4G65A 3DTVD 2P5TB 4N5LA 1KMHA 3VJMA 5A4DA 1FYVA 3ZD7A 1JNXX 1MB2A 2GI4A 1JQEA 2DM6A 4YC7A 2HNBA 3HI4A 4KPGA 3EDOA 3U7JA 1U8ZA 1EFCA 4YUVA 1OZHA 4JC8A 3N2ZB 2YVAA 2RKOA 4U02A 4MB6A 5HBRA 2RH5A 5KAPA 4A2WA 1L2TA 1KARA 3PUKA 3I23A 2WW8A 3U1VA 3Q0EA 4FMBB 4R05A 4CG2A 4RCYA 1I1QB 2QTTA 1XFAA 3CQ9A 5HE8A 4QGSA 2K7FA 1RZUA 4K40A 4RADA 3CX6A 1GDDA 5D3MA 3S29A 1NBWB 5KNCD 4DMRA 4OBXA 3FRHA 4A0SA 1O4VA 2ZJOA 4Y2UA 4PW0A 1G3IA 1GPJA 3K3PA 5EIHA 1BJKA 2JIOA 4IWXA 1A76A 2A9VA 3IO3A 1GCOA 3E84A 4FBMA 5JNVA 1DRUA 1YJ5A 3L01A 1IMJA 4OB6A 4PZCA 3KSMA 2E21A 3JWGA 4TWBA 3GRKA 3K09A 3TIVA 1INLA 1NURA 1USGA 2LP4Y 1WF3A 2YTZA 4PVCA 2QOEA 3UFBA 3TRKA 4JCCA 2BSXA 4JYZA 1XXHE 4Y6LA 3HKBA 1H66A 4D9CA 3RT9A 4ZQFA 5KYTA 1M2FA 3P9KA 4PLVA 1T13A 1XU9A 1J9EA 1GL6A 4G23A 3N0RA 5CBKA 2QL9A 4NMMA 1YGYA 3QF4B 3D43A 3M5DA 4WLOA 3T3IA 4GSYA 1EVQA 2PQ6A 4PYKA 2I3BA 2NU9B 1UJ5A 1KY2A 4JB2A 1EHCA 4GPBA 1EU1A 4YXFA 2JGKA 1XTKA 2DUJA 3B1FA 3BH7A 3ML1A 5EHQA 1NXVA 2D4HA 1E1MA 3RS4A 5HRUA 4MDEA 3IBGA 1C3OB 4WKPA 3C6ZA 1KI6B 2ZUCA 2PSJA 1Y3AA 3DF7A 5IDVA 4BFVA 5G4LA 4RVHA 3ROZA 1A7AA 5FWDA 5KNDH 4L7QA 5FJIA 3AV3A 1R5BA 3HB5X 3NTUA 2IXDA 4LJLA 2O2DA 2J3KA 5JQWA 3VPFA 2F8SA 1OLOA 2Q9BA 1GRRA 3B3QA 5THXA 1E7YA 4NFLA 2GFHA 4UULA 4D44A 5EIAA 1Y8QB 2KW5A 1T0BA 4J2HA 2ZUFA 1NT4A 4I3FA 3IERA 1SEPA 3BS4A 4UNIA 4ND3A 2WV7A 4ZQGA 4BVKA 1ZU4A 4F04A 3DOIA 4R1MA 4H35A 3I0MA 4PZYA 2NZ2A 3BWXA 3EVAA 3QELA 2G9VA 1YKSA 3OE4A 4MVJI 4RANA 5IM4F 4HPJB 4HVTA 3VYSB 4M36A 4O4IB 4NENB 1Z28A 4MZXA 1PJAA 1NI3A 5HIMA 2C8KA 1DX9A 4R9RA 4GOXA 421PA 4B3IA 3F7NA 2OORC 4DCNA 3AWDA 2QV7A 2BONA 2YJGA 5FNZA 3U3XA 4AJJA 5A9RA 1PJ8A 1JL3A 1S6YA 1QYRA 1UMBB 4TKUB 3ZGLA 3UMYA 4H59A 1FDUA 3TAUA 1DWOA 3JQ8A 4Z0NA 4MMXB 1RWQA 2HA4A 2CDRA 2ZRNA 2BY4A 2C2MA 5CM9C 3U6BA 4ALNA 1KSFX 4YUZA 2DAPA 2IF2A 1OYOA 2QG4A 1VPEA 2ZTSA 3DOOA 3H5AA 3K8QA 2F3UA 3PL1A 1DRVA 1QCZA 3VKVA 4DABA 2AGVA 4JLWA 3WLKX 5EYPB 5G4KA 4BS9A 1DAPA 2XA1A 3DHYA 4MYHA 1UFRA 3U17A 3RHZA 1LLCA 1RJWA 1W29A 1ZCFA 1VG8A 1UMDB 2HZBA 2QP3A 4HZUA 3VH2A 3QFTA 3RSLA 2QTLA 3KDPA 3K6RA 5I7OA 3CZCA 4Z2AA 5CVCA 3VR4A 1DOZA 2IGTA 1NXPA 3KCQA 4PR3A 1HEUA 2RHMA 3HCPA 2P11A 5T4EA 1DJLA 2NVUA 2ZJ7A 3AF2A 3K0CA 5HXAA 1M6VA 5IZCC 4PPFA 1X8XA 1S3GA 3U7RA 1HKUA 2DY0A 3N2YA 4ZYLA 2OLJA 2A9FA 1MJNA 1TD9A 2GX6A 2XVAA 2ODTX 4L5JA 2HJRA 3FUUA 3MQ4A 1QKIA 2WM3A 1OAKA 2VPPA 4DBLE 3HGQA 2RHCA 2F3QA 3HCOA 2P2NA 1FTNA 1KY5A 2VWHA 3RANA 4KQEA 4QODA 1J2JA 4LTNA 1AUXA 1QFJA 3QVMA 3PLNA 7YASA 3RUIA 1O0SA 1GU7A 2REXB 3K8ZA 1H2RS 2AFHA 2F43A 3LNCA 5HCUA 2X42A 4NJOA 4ES6A 4A2CA 2FCAA 3ZG6A 3GL9A 1GCAA 1SCAA 3MIIA 5GJCA 5TR9A 4BC0A 1U3UA 2WWFA 3U4CA 1SD5A 1KRHA 2CHGA 2H1FA 4DCVA 1R15A 4ZDIA 4KE8A 4TLBA 3WYEA 2VJYA 3EOAI 1GR0A 2FK7A 3GDHA 3I01A 3NT2A 2PK3A 1H0KA 1FVXA 2OECA 3DZHA 4JY7A 1NUAA 5JEEA 3FGPA 4LG1A 4TV8F 5EJ2A 2EQBA 1P72A 5JG7A 1X94A 5AVUA 4DV0B 2A78A 2HD4A 4TQ9A 2DUUA 4OMFG 1E2HA 2I9KA 2YHAA 4E14A 2FPUA 1T5BA 2HMYB 2QZZA 1N5OX 2RDMA 4JR1A 3RWBA 3ZU3A 2PUAA 1KI4A 4HLNA 1ULAA 5TQJA 4ZT7A 1RQ2A 3AU8A 4TWJA 1QJ4A 1JHQA 2XV1A 1E0KA 2YYAA 5FL7A 1E5VA 2HSZA 3BXOA 1WPGA 3TTYA 4D9FA 4W5HA 4W6QA 3JD0A 3E35A 2JEZA 2A94A 4E2YA 1FFEA 1SH7A 2GKOA 1PJRA 1I3KA 4IV8A 1G9SA 2J9YB 4KG7A 1X9GA 3LX4A 1BD4A 2Q9UA 2CLIB 3IJPA 4U9HS 4Y6SA 4HEA1 2G8NA 1SCUB 3OAAA 1ZMTA 3X1WA 4BATA 1MQSA 3GZJA 4JLOA 1EXVA 4Y6GB 1OQAA 2C4TA 2ECOA 3NLLA 3L7NA 2IU4A 2IHJA 5TIIA 5IDXA 2J31A 3KJXA 1T9KA 2G1UA 1W85B 3H9CA 3ABQB 3M4JA 4PGFA 2VJPA 3E1SA 3I6IA 2I67A 3T5MA 3V7YA 3S44A 4EHIA 3A9TA 3R3JA 3D9QX 3RKSA 4JQYA 4LVUA 1ABBA 1SUIA 5F5LA 2HLDA 1DCKA 3BH0A 2Z9BA 3M5CA 3PYMA 5I5EA 3DEYX 2HX1A 2W2OA 1KYVA 4UJ3A 5D5QA 4ALMA 3JVEA 1L7VC 4OSPA 3ZBPA 1IQPA 3IMFA 2C03A 5F9HA 5LB4A 2VN8A 2ORIA 5LLSA 4TT8A 1PZEA 4CF5A 2J0QA 1V4BA 4F2WA 4R7GA 1QANA 1XMJA 4H0CA 2YDXA 4BBJA 1PFKA 2E4YA 3ZW7A 4ZYTA 4ZTBA 5FPTA 5KPJA 4LXUA 1C7JA 3R7DA 4C3UA 1XPRA 1JZSA 4HGZA 1MC4A 2A9KA 2OHXA 3ZBUA 2GA8A 3NBFA 1ZI8A 1NFRA 2JD2A 3VU9A 1FDTA 1IVYA 1CE8A 1P2SA 1SOAA 1T4CA 2AMLA 1XPUA 5BMOA 1UAGA 4AJPA 1XNRB 5E7JA 5IP5A 4KNVA 5TF4A 4A1OA 2CSXA 3VR1A 1ODCA 1DKLA 1NTRA 4DT1B 4HHEA 2XKJE 3K0EA 6LDHA 5KHOC 5HKBA 1LH0A 1WD7A 3BZBA 1J0BA 3L6CA 4KJZA 4ND5A 4ZVSA 1FQKA 1SUBA 1MCZA 3PC4A 4EELA 1B41A 1D1TA 4XOIA 5HF5A 3RVKA 4F0JA 3GEIA 3S1SA 1PQYA 1XMIA 4R69A 4JI4B 4GQAA 1GCUA 1UWLA 3DBRA 3HV0A 1QIIA 4UBLA 4WEQA 2AQKA 4KMOA 3DEAA 3EXAA 4OM7A 3LY5A 4MYRA 1RAGA 1WW3A 2FPOA 4JX8A 1PNQA 4UBNA 1W7AA 1T0IA 4A0RA 2PD3A 2X1VA 5MDHA 5DI3A 1YDHA 2XT0A 1Q6ZA 4LZWA 1JW9B 1CUEA 3GT3A 2DQ4A 1MX3A 5DYIA 1I3OA 2WIJA 3N0WA 2NG1A 3ZZ1A 1NUUA 4F4IA 1RRGA 4QXRA 2A84A 2YCLA 5IJZA 2GOYA 2VRCD 3OWHA 3VNVA 3UUEA 5TEVA 1P9WA 2Z5LA 3UWMA 1CRQA 5A2QA 4CUKA 4B4UA 5AJTA 2RIPA 4BDSA 1NQXA 3L8MA 3LDHA 2NO7A 4FUTA 2LVBA 5I48A 1CCWA 1XT6A 3P4YA 4YALA 2C95A 4TL6A 3E9YA 3GELA 4GM4A 1I7PA 4IGAA 1KYYA 2BH9A 3NONA 2EKPA 4HNGA 3KWLA 4OXKA 2PUGA 3ENQA 1EVKA 3MYRA 2PL1A 2J67A 2D7JA 3CLSD 4K6CA 4DDWA 2G40A 4QVIA 3SFVA 4IJMA 4EKEA 5ALTA 1S2MA 1JA0A 3BMOA 1NTOA 3GCXA 5FF9A 2WIFA 1C9MA 1PTKA 1TD1A 3RB8A 5K01A 3RC8A 5F35A 4B84A 1OR8A 2INGX 5IH3A 4DR3B 4OQDA 4DMGA 1KO8A 3G5TA 5AP9A 4M9SA 1HDXA 3OE1A 1QHSA 4PZLA 2G6BA 1IEWA 3T0GA 5ED4A 2DQKA 2OMKA 3KSZO 5KOHB 4ZVMA 3K8OE 4Q3BA 2NMVA 3BMOB 3GUHA 3HYRA 4BGEA 3VSBA 4G56A 3IP1A 1NJ8A 2XMDA 3SBEA 5BN4B 1KQPA 1JT9A 3CCBA 4Y2QA 4DKXA 2VHTA 1VKHA 3QYAA 1AMUA 2F8MA 6CHYA 5F1PA 1C29B 2VPIA 3WE7A 4X64B 5JRDS 1JXQA 3GH3A 4Z4QA 1RRCA 2I2AA 2GVDC 3E3AA 3ZQ6A 3N7UA 3NDPA 1XA0A 2WSMA 3H99A 4MGIR 1X7HA 3U7GA 3ZD8A 4EKDA 5EHXA 4XVQA 2ZI9A 4WXEA 1T0UA 1TAQA 3CJRA 2EBUA 1QG0A 4RD3A 3U4DA 4FYYA 5MN5A 1DX4A 2RK4A 4TMWA 2WWHA 3RJZA 2ONYA 1KEEA 2OZLA 4MYDA 1VLHA 1GTRA 3ZWYA 4DLWA 3IPCA 3VR6A 3NO4A 3SIWA 1AHNA 1GTMA 5FPKA 1E3WB 1OJLA 4XEHA 4OJKA 2DERA 3RAPR 3M9XA 4DM7A 2AN4A 2D7DA 5JXGA 1QF9A 4YRLA 5ESRA 1TUIA 4FMPA 1SKYE 3OFJA 1EBFA 3VNRA 5LIPA 1UK9A 1KP9A 821PA 2ID8A 3IV6A 3U13A 5IVKA 1N2EA 4MVJH 3ZCTA 2WU4A 1Y4SA 2WIKA 3ZTWA 2O57A 4MQMA 4RTNA 2Z30A 4NE2A 5EJGA 1BW9A 2ZVQX 1BFKA 3O73A 4UREA 5KNCH 4JNKA 2EBFX 4N3AA 1YNSA 1HR0B 2C82A 1VL5A 3PZBA 4GPIB 1BS1A 2AR9A 5JPIA 2C2ZA 1TADA 4GKJB 1MJ5A 4KAJA 2AK2A 2H4YA 5EP2A 4DV2B 1KR5A 2AR7A 1TVCA 2GD6A 4FJ0A 4DWWA 4UQPA 3IDAA 1GKIA 4R9SA 1QBGA 1UIMA 3R41A 3RF7A 3BD7A 1UFOA 3FTPA 1NLUA 2FE4A 4EJSA 1GA6A 2ZI5A 3RSQA 1E2FA 1GPBA 2I87A 4KQKA 4DC0A 3C2QA 4XM1A 3JWIA 4K81B 2X7XA 4BKUA 3OQHA 1LRKA 1XU4A 3HJTA 4Q1EA 4CIAA 3EIUA 4JSYA 5TQ2A 1QVRA 8ATCA 1IB0A 5L8VA 2J6CA 2OFOA 2FZWA 1PWYE 3RC3A 3TIFA 3KLPX 4WOCA 2JHPA 3F6EX 1RP1A 4BWGA 3QOWA 5C8VA 4HWRA 4IZHA 5JSQA 2FPWA 1J8DA 4ED9A 1H3FA 4BKQA 1RD4A 3MXOA 1ZINA 4HLDA 2JAHA 2ZRAA 3OCXA 1RPTA 1KL7A 4J03A 4MMYB 3R74A 3KKEA 3ED1A 2ANBA 2NVOA 2XMPA 4YLEA 1TLTA 5DNVA 3RVBA 6YASA 2C7OA 5CCDA 2XZOA 3WL6A 4RE6A 3NEYA 1T25A 2FSVC 4D0RA 5JFOA 1PK8A 4LQDA 1XMPA 5H59A 5AW2A 1NKTA 3F47A 4G1EB 1IWBB 1OF1A 1WB6A 2GZRA 4EF4A 2GEJA 3I28A 4OEHA 4GI1A 2E3JA 1NHWA 5CNJA 3ITNA 3JYNA 3FCSB 2HRRA 3BGIA 2ODPA 3ONVA 4F3RA 3W78A 1VKNA 2CT8A 1GTSA 4WDRA 1FX1A 3KIPA 1LBHA 2Z58A 3P2KA 4EQ6B 5CJ2A 3AINA 1T4DA 1PLLA 3CLKA 1QRDA 4RNCA 5BVGB 4DMHA 3A1FA 2PE5A 3A7EA 3FVTA 3C8ZA 5AI6A 1UL1X 2IFTA 5H9WA 3V34A 1OFUX 3JQ9A 1VC2A 2O1WA 4JHXA 1E61A 1FSPA 3UXEA 3QX9A 3AUTA 4IFTA 4LSGA 3KKQA 2VG8A 5J2TF 3H2GA 1NNUA 3KLMX 1B8PA 5B7GA 1OWLA 3UYKA 1GP2A 1K68A 2X9GA 1U8AA 1T9BA 3ANXA 4MVCA 3ANTA 3WBFA 1Y1SA 2EP5A 2KBEA 1JEYA 3CVOA 1JAYA 3IBCA 2RI0A 2X8AA 4GWKA 1THGA 1X1QA 1X2BA 2DFLA 3LPCA 4MPTA 4M60A 2NQTA 1GQYA 4FCVA 1JAZA 3PRKE 4F6CA 1DBIA 1WCWA 3AILA 3GGSA 1W36C 1R9JA 1XCJA 2FWPA 2DH5A 2KM1A 2TMGA 3FM9A 4JYPA 1W35A 2TMYA 5I9SA 3VVLA 1JAXA 3BDVA 2YWCA 1UXHA 3COPA 3BT7A 1QGDA 1T5DX 3RVMA 1QGZA 4BX9A 3KPVA 5A0FA 1CRPA 4UUBA 2OZVA 4AY2A 1A9QA 2EW1A 2Q6VA 4NMWA 4QWWA 1YOBA 4RF2A 1O0CA 3AVTA 3I5YA 1YZVA 1FXWA 2VWQA 4FINA 1GPH1 2M6LA 4A0FA 4B80A 3ABSB 3AT1A 3AUJB 3LVRE 2QL5A 4HBZA 3SHOA 5JBQA 2QIOA 3U1BA 3AVOA 2DPMA 3ORYA 2II6A 4OG2A 4JLSA 4QM7A 1TJPB 2A7QA 1EA7A 4EP1A 1ISRA 4G2NA 1IBKB 4O2RA 5LA6A 1BX0A 4CRWB 1BQ3A 1T8TA 4UHDA 4BFWA 3V46A 2WM2A 1KZ9A 3QWHA 5DMXA 1PNVA 5ERGB 3G17A 5A3QA 1FFDA 5KTYA 3R9WA 3W6ZA 3KZMA 5A7FA 2VHZA 5LMUB 2HIHA 1WLYA 1XL0A 3BM5A 4Q05A 5DYYA 3F78A 2JFZA 2IV3A 621PA 4F6LA 1IXKA 2V8BA 3F6PA 4US1R 1ZVKA 5HVNA 4MA0A 4NBKA 5B1DA 1MUUA 2WM8A 4KZPA 2C7PA 5I7UA 1T1EA 4RY0A 5IABA 1E2PA 1H8ED 4CQMA 4L7VA 1PHPA 3TRIA 4NWIA 3CVXA 5G1PA 1V8FA 1NNLA 3QH4A 2AZDA 4CM6A 4EAQA 3AEUB 2AF4C 1BD3A 4DNPA 1M5RA 2ZU0C 3V9AA 2HQBA 3OMXA 1YS6A 3KHKA 3E22B 2O0KA 3PT5A 1UBTS 1UBCA 1U11A 1GU1A 1BE6A 1JFFA 2FPIA 3BZUA 3AVYA 2RK3A 5C0OE 2VAWA 1IHOA 2P6NA 1QZTA 1PSWA 1TT5A 4URFA 4NENA 5AKLA 1G6HA 4KQ9A 5K45A 1G3RA 2O4UX 2H2HA 4OQMA 4FZRA 3RUEA 4A1FA 2G04A 3PC6A 3TEMA 2JGLA 5EWJA 3HVRA 4ZU1X 2IU0A 4E7OA 4EENA 2B94A 4A27A 3KSRA 5ICGA 3PNBA 1M34E 1SXJC 3ICWA 2YZ7A 1EWTA 3QUSA 1CR2A 1PV1A 4ZZ2A 2I3GA 3NJ8A 4DG5A 3P9IA 4RTJA 3E9EA 2VXYA 1K0UA 2DUNA 2IZ1A 5DX8A 1Q0PA 2AFIA 1TTHA 1FXSA 4GNRA 1ILEA 2R6GA 1DEOA 2JLCA 2QRGA 1GNLA 3P5SA 2GR9A 1ZD9A 4YQZA 3UKDA 3A04A 4D41A 4RTSA 5EPEA 3E3MA 4FC7A 1G8HA 2H8KA 4HXFB 4YAGA 1JHRA 1FOEB 3MWLA 2FMFA 3A1UA 3H2YA 1C3OA 4BFSA 2ZE5A 4M88A 3U81A 4C4OA 2B8WA 1GZDA 2EZUA 2PJDA 2Y4NA 5ALPA 2P41A 2P9GA 5JVDA 1A96A 1YAJA 1Y5IA 4FE4A 4I4LA 4U2EA 4A0HA 1RYZA 4DSTA 3H7IA 1YQDA 3K7EA 3F1KA 5LIRA 1AQJA 1UKVY 3C4QA 2G0NA 3FPAA 1NQTA 1Q3HA 2FN9A 4ZHSA 1GKYA 5CFQA 4Y9TA 2GM4A 1FC0A 2P3QA 1TU0A 1W19A 5JAOA 3AKYA 4PG7A 5FCDA 2HMSA 5HUJA 3W3AA 1OTXA 1O95A 1VYVA 2V54A 4MO2A 4BIMA 4QYMA 2B78A 1GADO 3N2IA 3JSXA 4E5KA 4AKEA 2ZBDA 4OV6B 2Q2NA 5TF0A 1WW8A 5LP1A 2UYYA 4BYMA 2A9OA 3CE9A 3IR7A 3PEFA 4M98A 4DXHA 3E9NA 2IS1A 2HGSA 1QRSA 1AQLA 1L7OA 1QO9A 2GNPA 3EWAA 3OM9A 1WB5A 5TE9A 4ZREA 2DETA 3HCDA 2NACA 3CB4A 3QX7A 3EXIB 4YAOA 1H2EA 1E2GA 3UT5B 4NZMA 3QXGA 3CKLA 4X9XA 3WBBA 1RTKA 4NKRA 1E5XA 1SG9A 1SK8A 4GR9A 3SE0A 1M72A 1XNGA 4HB3A 4L9RA 4M0KA 1WCIA 1AK9A 2DT8A 3VNQA 1FXWF 2F1OA 3JVDA 2ZBPA 4MV1A 2ZJ8A 4JI3B 4PTYA 5AKIA 1WRBA 5JPDA 1L5SA 2GT1A 1JU9A 3U3JA 1G38A 4JENA 1UQRA 5CLIA 3AH8A 3K5IA 3Q5GA 3RRFA 3OHPA 1HI9A 2OZEA 3L7KA 4WWHA 4K2HA 3HXOA 4V0OA 4LYYA 1ANKA 1CUIA 1RHRA 1RHQA 2AJTA 1JR6A 5JSYA 3WYCA 2QSYA 4F5DA 4P0PB 1AQYA 1SXJE 1EEHA 2JKVA 4U2KA 3MTDA 4ZO7A 8LDHA 5FXMA 5DTQA 1T9DA 4I1PA 1YONA 4PPNA 1NPYA 1O08A 3OLCX 4BHTA 2N3ZA 3F6BX 1SBHA 4M8IA 1Q1GA 2YFHA 4KMRA 4AM8A 2VTEA 4ER5A 2OB1A 3P4UA 2E5WA 1IQRA 1MOZA 1T91A 1E79D 1R3DA 3W06A 3E82A 4MS1A 2RGYA 2WYUA 4WBNA 1OVMA 1XKTA 2B36A 2E4VA 3KVRA 4REQA 3UT6A 1E0AA 2AZ4A 1FYEA 1BGXT 4AN0A 2MR6A 1WX1A 4H7IA 4RZ3A 5JAUA 3M6MD 5CA0A 2O8DB 3OJ0A 2R25B 2EJWA 1M54A 1SXJB 1X7ZA 3DBRB 1VCHA 3DE5X 2PZMA 3N70A 4RQUA 4WLUA 2H7XA 5FWYA 5HS4A 3HBLA 1WXHA 2ZBQA 4C5AA 2YVUA 3DUFB 4RFSB 4XJTA 4E5NA 5AVYA 2PG3A 2XNKA 3ZWDA 1IVSA 1RBZA 4UTZA 2Q0XA 2CF5A 1O6FA 1KS2A 2X0DA 2XR1A 1KDTA 4JELA 2IYYA 1ADGA 2P9HA 3PNSA 3TIIA 4EMBA 4DT1A 2BMAA 2QP4A 2X0KA 1W46A 5LYJB 3JQQA 2ZB8A 3FCYA 3NTOA 1PQWA 4G85A 1OXXK 1PJLA 1VSBA 4IDQA 5CVVA 1XQVA 4B6SA 3CEPB 3T7IA 3TQIA 2P9ZA 4RK7A 5M04A 1SG0A 3GD5A 3IVXA 5EVJA 3OO0A 4PAMA 1M66A 4DE5A 2YVKA 2FMKA 3JARB 3ADPA 4GRDA 3PCXA 1OFGA 1QS0B 5ALUA 4ZCPA 3GP8A 2VTBA 1BQ4A 1VP3A 3GAAA 5HRAA 1U2SA 1X0VA 3UJ7A 3LPNA 4KX3A 3ZZ0A 1T3HA 5HW0A 1T9AA 4JQZA 1IJEA 3GNLA 1N5LA 5C5EA 3FOZA 4LAFA 3WGKA 2R8EA 1VGVA 3OCCA 1C0PA 3KEGA 3O1IC 4PSAA 1V5IA 3NNSA 4UTVA 3NORA 4GOKA 2H5IA 4JT4A 1JLHA 4M1QA 1L7XA 3QLJA 4B09A 4CM4A 3KPYA 5J3JA 1RBQA 4DIBA 2Y0CA 2JLYA 1EP9A 3VR5D 2O3QA 3D8HA 3RSZA 5KKCA 1L5VA 4GX1A 3LXUX 1BMDA 1U4SA 2CD7A 3H5WA 1Y8RA 2JFWA 3FDZB 1PIWA 5HJ5A 3GW8A 1XDGA 3FB1A 4JVNA 2BGMA 1LZLA 1P91A 2FPMA 3GLHB 4HNQA 3MBIA 1ONBA 4FGUA 4AU1A 3RIMA 1VKZA 2RJ3A 2H1SA 4U00A 4D9EA 1X39A 2RGWA 3DTVB 4UUMA 3LWDA 4KGVA 1DJOA 4R8LA 5GP1A 4ABTA 3K1JA 3TNJA 3FIUA 2R7MA 3OMWA 4KSYA 5TJ9A 2QJFA 4O2BA 1CYEA 2L17A 4Q4LA 1G1AA 3BMNB 3LBNA 3ZKWB 3KRTA 1KEUA 5AT1A 4HTAA 4G8DA 4N49A 4Q4HA 4BQSA 3JQRA 2V58A 4K87A 4MI3A 2VP4A 1NRJB 7AT1A 1UWVA 2GXQA 1LDNA 3E5NA 4IQFA 4YONB 1GM5A 4RTMA 1K92A 4G8BA 2WSYB 3H83A 9GPBA 4YRDA 2VWPA 3GLHE 4PCLA 1ZKDA 3BIXA 4FMDF 3SPXA 1OGYA 1N4AA 1K63A 2P91A 3K2IA 1WKCA 1C2TA 4R2MA 5AOCA 4LXQA 1VYUA 4ECEA 4X20B 4DY4A 1AZWA 3C3KA 3G2KA 3KKNA 3PDHA 1QRTA 2X22A 5CB6A 1ARZA 2EIHA 1N0VC 3ZY3A 3WMWA 1QP7A 1F4PA 2WJJA 2XOKA 5MGNA 2B35A 1CDOA 2DE0X 1JPUA 2PGDA 2QRPA 1PE0A 1WHTB 2NU7B 2K6GA 3LBFA 3NNNA 4CI9A 1G8AA 2FW7A 1Z7GA 3CZ5A 1LS1A 1OX6A 4D5GA 4H3KB 4UBKA 2C78A 1REQA 5JAMA 3SLKA 3WJ7A 4AZ3A 4W7HA 2V1UA 2C8JA 1GPAA 1NBOA 3BSWA 1Z2EA 3A4LA 1ZIYA 2OC9A 2AQHA 5DBIA 5A3SA 2L0XA 3JTEA 2WICA 2H0AA 3DE6X 1U3TA 4JLBA 1GR1A 4RGVA 1KP3A 2ZBUA 3MC1A 3ZYCA 2JLVA 1KS9A 3WR5A 4D25A 1CF2O 4FXOA 2G9UA 1JKIA 1XXLA 4DNXA 1W581 1TOAA 1MTZA 3QXXA 2OXFA 4MKHA 5JOQA 3D2CA 4MUBA 4NRDA 3OX4A 2P9BA 3G1TA 5KC9A 4MS4A 1QU3A 4IFIA 1CY1A 3E8XA 3PGLA 3PVZA 1C41A 1CQWA 2W43A 4ROSA 1OXKB 5EN4A 5KWIA 1L4EA 2R1TA 1DRJA 1L5HA 4BQQA 5LD2C 5B1IA 1HFJA 3SS7X 1E98A 1Z07A 1U7OA 4HFMA 3CH4B 2O7QA 1GYPA 5AQEA 2CVFA 3G82C 2R6FA 1AG9A 3PXBA 3RAEC 4MW2A 1Z6GA 2QV0A 1G5TA 2X2OA 2YS7A 3WDKA 2QLFA 4N1AA 5AOVA 1T8PA 1B1CA 2FZ4A 1MX9A 1XDZA 4R0NA 3TAHA 1IVNA 1CIJA 4GOLD 4UNNA 1GG8A 2OAQ1 3L84A 4N0MA 2VBIA 1VHTA 2JVKA 1KDPA 3E03A 1TU4A 1LD3A 4KGZA 3V5NA 3QVJA 3HWSA 4TKZA 4MTCA 3DPSA 4C0XA 4WN9A 2WIDA 3HA3A 1AO0A 3EPJA 2ECPA 3T1VA 9ABPA 1JEQA 1TO2E 1Y6RA 3BD6A 2QD4A 3DB2A 4DY6A 1VMIA 1A4UA 3BGWA 1NYQA 3LXMA 4RSRA 4W9NC 4WLVA 4ZI7A 1E1QA 1EWKA 1YHZA 1Z0DA 3NTQA 3QELB 3DNMA 4MAAA 3AP3A 3QHQA 3R0JA 2E49A 1JBQA 3ZH2A 5DIFA 1Y6ZA 2WK1A 1JFSA 4TYYA 5DLQC 3MWEB 2CUNA 4IUDS 5TQ0B 1R0ZA 4DCOA 1WBDA 4BJHB 4TKVB 1CETA 5B2ZA 1A9OA 4L5AA 1BMTA 3R5KA 1RQGA 3DR5A 3TRDA 3L5OA 3PEVA 1AN9A 2IUYA 1A72A 4G86A 5B4UA 5C3MA 4X62B 4I55F 1Z4NA 2O8FB 1DINA 2O7SA 1SC1A 2MT9A 1J2TA 1T3LA 1HK7A 4KMMA 4KVGA 2Y1FA 4W1SA 1OGIA 3L0BA 1J2RA 3HCFA 1OAOA 1GZVA 1RLUA 4NCBA 4GEGA 2I71A 1TGYA 2VDQB 2P35A 5C9ZA 1CIVA 2CNLA 4BY9E 3HFGA 3GP3A 3HS3A 3ZUPA 1QWOA 2BGNA 1YRLA 2IYVA 2JIQA 2XTMA 3WP0A 2VFAA 4RZSA 3R7LA 1CXZA 3DP9A 2HA3A 4KO3S 1F9AA 1TVKA 4JL8A 4OLAA 3I9NA 4UNSA 2A0UA 3TXXA 1AJEA 2NU8A 5C52B 1GRNA 2QRKA 2HK7A 2RONA 4AG3A 1CY0A 3K2BA 1EVIA 2CV1A 3D6UA 2ZPTX 1Z5ZA 2J0EA 1HE4A 2WHEA 2EBHX 5HFJA 1VDMA 3F8WA 3K31A 1VCIA 3PF9A 3G2JA 3FJOA 1KH1A 4LWQA 5BMVB 4GYWA 3FTCA 2AG0A 1PQ4A 1Q11A 1MC1A 3EFBA 3WWPA 4BOYA 2GD2A 4UTNA 4UMVA 4HT3B 4IRMA 4U9IS 3CLHA 1JQLB 1IOVA 4B17A 3DWEX 3WHKA 1DV2A 4OHMA 2A2ZA 4ND4A 1XDSA 4UAJA 2IS4A 4PZDA 4DYVA 2XZLA 1TKCA 3OPMA 1G8FA 1I5OA 1JEJA 4IG4A 4GOND 4UU7A 4KLAA 4IXMA 1O5OA 2P7IA 4DGSA 3M2PA 4Y6OA 4QPNA 5KYVA 4K1LA 3KTFA 4B3HA 4EYSA 1F2VA 2PWYA 3PFKA 2AX3A 2YW9A 4Y2VA 1DAOA 4A82A 1UFVA 4LF9B 1QYDA 5CBPB 4AECA 1V1RB 1YIOA 1D0IA 3RVLA 3PDJA 2KJQA 2BFOA 4LW8A 5DVZA 4BB0A 4LHWA 1VI5A 1P2DA 5DTEA 3UB4A 2B25A 3ZWWA 1KMHB 4CVNA 3HKCB 1DBSA 2WJWA 3EF3A 3GT4A 2GLTA 3KL4A 3E7DA 3TVYA 1UQUA 3B5EA 1U3CA 1PDVA 3G0DA 2Q4TA 2I5PO 1LKZA 4H16A 3ZCRA 1HF3A 2C7QA 5FR2A 4O63O 3KYDA 2ZRKA 2VJMA 2AR0A 4GHWA 1OZAA 1F8YA 3ER9A 5JI2E 2O3UA 2ZAGA 3R3VA 1KIMA 3I34X 3GMDA 5LZ4A 1HOTA 2H9AA 1L1EA 2EBWA 2X5KO 4J8PA 4O25A 5DTJA 1W2GA 5AVKA 2PSHA 2ZG6A 2NZ8A 3N2GA 4D96A 2P90A 1ZUWA 1TFUA 2BF4A 3IDQA 1R2QA 3CF0A 3QJGA 4AUNA 3HBFA 4W5QA 3GPDG 3RC2A 4UM5A 5FAKA 3EA5A 4JU8A 1BH2A 1T35A 2CMKA 1GFZA 3TZEA 4HZIA 3CLVA 3IILA 3NUZA 2PO7A 1DEAA 3HUFA 1R0RE 4O02B 1M34A 1SRQA 4H7KA 2C83A 2IL1A 2VBGA 4FFMA 2PU7A 2VK8A 3WGOA 5FOVA 3T99A 4W5OA 2XYVA 5FWAA 5KX5F 3JALA 4C04A 4QWMA 1P2VA 3E48A 3FNEA 3PQEA 1LLQA 2FPLA 4NLLA 3KZOA 3S68A 3R3UA 1ZK1A 5LOVF 1O8BA 3ZY5A 4FDAA 2Q0QA 3TZHA 5AJXA 3AVUA 4BIIA 3PHCA 5CFLA 3EGCA 2CJWB 1SCNE 3FGZA 2Z83A 3I3OA 1OA0A 4J4TA 2UVPB 4F9EA 1FDSA 5AI5A 2FZVA 1VSTA 3TTTA 1QZXA 3KG2A 3RVSA 1U98A 4UZFA 5IZ4A 1VLMA 5DTRA 3UOAB 4UM9B 4F92B 3LLUA 2Q5QA 2IODA 5EJ9A 4C6HA 1AN0A 3HXPA 5BQOA 3TSOA 2ZBVA 1JAIA 4O2LA 5HHTA 3LQ1A 1RFGE 1M7HA 2CFSA 1Z39A 2MINA 3NYWA 1HMYA 3BFPA 4FT2A 4ZXPA 1JYEA 4L85A 1BS2A 2G0TA 4BNHA 2ZJZA 1M8FA 1ORTA 3KQWA 4CXMA 3NBKA 1Y89A 3KQYA 2HA2A 3VR6D 5KTPA 3VPHA 4YCMA 2O14A 3DZKA 4PAQA 4YA6A 1WULS 2PLWA 1NMYA 1V1RA 3DAOA 1U3WA 4YAFA 4PLFA 2H08A 4AXBA 3QX3A 3L7MA 1EB9A 3OZRA 1YQWA 1T6YA 3QVOA 2NXEA 4S1TA 3WHLA 3IP8A 3IR6A 4JI5B 2AVNA 3G2MA 1FU7A 3A4VA 2XW6A 2ZWMA 3GJ7A 1ZZEA 3ZE6A 3A4IA 3H4MA 1Z06A 2BRUA 4B3XA 1P75A 5J58A 5LP6B 3IQXA 2R66A 3W8DA 2FPPA 1XVUA 5DASA 3LM8A 4HN2A 3HH8A 1GRVA 2ZZMA 4X95A 2Q5OA 1RMQA 2P9TA 2JPDA 3N75A 1YBVA 3O4FA 4BBZA 1XCLA 4LXYA 5JDIC 3WC4A 4WW0A 1IUNA 3IX7A 4EY3A 5LCXA 4EPRA 4DUGD 5JR3A 4DR7B 1MAVA 3F5DA 2X9NA 2WWGA 3IS3A 2YVQA 2XBLA 3U7EB 4JXKA 3N7AA 5F33A 1RBYA 2ODNA 2P5YA 3IPAA 4MS3A 5IT4A 5DHAA 4XE5A 1Z2AA 4ZRDA 7MHTA 1EA5A 4KR2A 4C0AC 1G8KA 3OOSA 2FMXA 4AW9A 1Y8AA 2FH5B 3L4BC 4MUNA 4XKJA 5D85A 4URVR 3GCZA 4AL4A 3OQ6A 5JZSA 1VPTA 4FFPA 4FGSA 4KO8A 1N3IA 1KDRA 1RKQA 2A0FA 2E5FA 2F3SA 5JC8A 5K0FA 3WBKA 5DDIP 4NV1A 3R6LA 3NTXA 4I8DA 5ALXA 1DELA 5LBTA 2BMEA 4L16A 5C1DA 3WLFA 3SEFA 4UZSA 2WSSD 4NDZA 5DGTA 2P62A 3WMFA 3TZ6A 1P6QA 1X7XA 2WKPA 3BGOS 3GX1A 4YI3A 1DPGA 1HC7A 3AKDA 1O6GA 4FYPA 3ZOZA 1APBA 4QUKA 5FTJA 4L8LA 3VR4D 3ZK8A 4JUDX 5EKXA 2NTNA 1CUXA 2CVOA 2IHVA 3LDGA 4C4YA 1F1JA 3WRYC 4H9GA 3GO4A 4WGGA 3OOWA 3WJ2A 4HH4A 1XDWA 1EQ2A 1TQ6A 3O7WA 1LQUA 1IBRA 5KYWA 3GLFB 2B4TO 2CE7A 3S70A 3G8AA 1JJ7A 2XD9A 4L9SA 1SM4A 4AO8A 3EUWA 3KPUA 1MDBA 3TI9A 3E61A 4OTZA 4M0UA 5B3KA 3A9WA 1QRRA 4O29A 5ABPA 2P30A 4L51A 3H2BA 1S2OA 2E48A 3AIIA 3IRUA 3MRSA 4FFVA 4PF1A 4DBVO 1NFQA 5KTRA 1KJZA 2UZ3A 3BRWD 4WKBA 4B3GA 2D54A 1S02A 2J9RA 3HHEA 4FYIA 1OH8A 2F8LA 1Z82A 2IHZA 4QASA 3HEMA 4JGIA 4QHTA 4XYGA 3UWPA 3EQ6A 5J4LA 3WNVA 4NZOA 1PAUA 1SUCA 3BGDA 5FOUA 2H29A 4CUZA 1KYTA 3FAKA 5EWLA 3SOPA 4PYNA 3P0IA 5IH7A 1NSYA 4CGZA 2CKMA 3HCCA 2NV0A 2DLCX 4EPWA 2C84A 4WECA 1M67A 3UXMA 1ADBA 4RM2A 5L4LA 2HA5A 2R00A 4CMEC 4O08A 4X1IA 4BXOB 2NP7A 1CP3A 1L4BA 1DADA 2BBOA 3BRQA 4GM0A 4NV3A 5BNZA 5IKPA 1LPNA 2XOEA 3RSSA 1DIOB 4B6PA 3NV9A 4R0VA 1YRQA 1SULA 4IO1A 2WTUA 3K5HA 3HACA 3UY4A 3V1YA 2BH2A 4LYDA 4FFBA 4MI6A 4EFLA 2XB4A 1UT6A 3D3KA 3QOYA 4MW0A 2X13A 1VP9A 1X1AA 3JX9A 2K2WA 3FHTA 1XNHA 4QEKA 1E77A 4TYPA 1VJDA 1ISHA 1RBMA 1C9KA 1EUDB 1H42A 2CBGA 1IPHA 1IWPB 2OV3A 4WBSA 5E9QA 5J23A 1NP6A 1ZUD1 2N46A 5JJKA 2XOXA 4B82A 5TS2A 4WXPA 5L51A 3RH0A 4LF5B 3N87A 3U2QA 1S7GA 2VF2A 4XPIB 1UFQA 3I64A 3DG9A 3CS3A 1MIOB 4AZ3B 4WK0B 3B9PA 3ZGOA 3DVSX 3S2SA 5DM70 3ZLJA 4GM1A 2YNMA 1HLPA 5TNXA 4RKRA 3R8XA 3WYFA 1Z74A 2QF7A 5E0KB 3INGA 3IQWA 3RGGA 3IEUA 1ZLYA 3SYMA 3TR6A 4QC2A 4YCLA 1OT3A 3FCAA 4NZ9A 3CRVA 2GPYA 4KYIB 3L1VA 4Y2HA 1ACJA 3OU7A 1JHUA 2R68A 4HXEB 1G4AE 3KT0A 1GPUA 1ZX1A 4PC3A 2RE8A 3MNFA 3ZTTA 3NWJA 3VYWA 1FLDA 3NTVA 2G1PA 4EF5A 2QR5A 4AY5A 4ZOQI 2RFLA 5H1YA 1ZGCA 1D6NA 1L5FA 2LCIA 4HNSA 3FPSA 4BMNA 1ZVVA 4LF4B 1W4ZA 5IYZF 1LZKA 1BHO1 2KHZA 2Q4BA 3C85A 4POAA 1Z47A 4H18A 1DQSA 4FM9A 1HL7A 4RAOA 2IEDA 1BMFD 2FX2A 3N0XA 1UPUA 1ZNQO 4RA9A 4OCZA 4GMFA 1G8PA 3FKSA 3MCZA 1JRLA 3EXFB 4UC0A 4YRPA 3UGJA 5LQKA 5FJJA 1WF6A 4O2BB 4LUCA 4BFXA 4QYSA 4DRZA 2P6MA 3DBVO 3ZDAA 3A4YA 5CJPA 1G18A 1EHYA 1K4YA 3B36A 4MVXA 3DTVA 3B5JA 4KFTA 3VR5H 4IIHA 2HT6A 3MHPA 2ZXFA 1JE1A 2PR2A 4ZQIA 2F4VB 4HI0E 1B73A 1UBJS 1C3VA 4HFRA 4BV9A 2FPGA 2Q6TA 4CKWB 5CRIA 3IKJA 4QSHA 3EGVA 3FUXA 4EW2A 3IEPA 4YQFA 1CJMA 4M7PA 3VTFA 4TYNA 3PJDA 4JHLA 1Y5LA 3HWRA 2QJOA 4RYLA 1G59A 4RD1A 4AURA 1G19A 3DDCA 2TSYB 1QH9A 4P5DA 3MQ2A 3SQLA 2VDWB 3CUYA 4MA5A 3OQNA 1PZGA 1E3TA 1TGVA 1F14A 1GAJA 1TJ4A 2NT3A 2QAIA 3IOMA 2IZOA 5HR5A 1DG1G 1YZTA 1DDIA 3PYLA 1LDBA 2WNSA 1M76A 1P5HA 1S8NA 3A6JA 2VA8A 3AL0C 2V7WA 2OL4A 2YVLA 5K8IA 2R6ZA 5ALGA 2WHRA 5KCZA 4WK6A 1YI1A 4K6KA 4EJMA 1PFWA 2HQ1A 3L02A 4K9SA 5HTKA 4IEEA 1TU3A 2CUKA 2GHQA 3F97A 4R84A 4BBAA 5C18A 1SBZA 2C9BA 1ZO8A 2RHRA 3JARA 4IY1A 4LDJA 2FEOA 4DA6A 4Y3UA 2E6UX 2VK1A 2HA7A 3GEDA 4MQ6A 1RWVA 4P4NA 4XYBA 3TBKA 5KU1A 2W2KA 4AMBA 2HU2A 4Z9BA 3UJ9A 2WD8A 3ZHOA 4BO5A 4E12A 1UPAA 5KJ1A 3UTCA 3FYSA 4LRSB 5D3KA 3GQBB 3UAVA 1F38A 1YL5A 2ZSKA 1QH8B 4AP6A 3TLEA 3UUGA 5BYAA 5LNK6 3T7AA 2O8NA 3ET4A 3ZI4A 1ZN7A 1P8JA 1N5KA 1SZPA 2G83A 3GEGA 4AS1A 2C5BA 3ZV7A 4QQ8A 5BVHB 4IHKA 3WLIA 1FLAA 1N6HA 5IT0A 2B21A 5HF8A 3C3JA 3FLAA 3NM5A 4BVLA 1COWA 1TK2A 4J1TA 1OXUA 2ZVDA 3LLMA 4UQLA 2WVAA 3N8KA 4TL8A 1ZNWA 4BMPB 4MCJA 2J48A 2C8VA 3N2GB 1O7JA 2R4QA 2V3CC 4ZYUA 3B38A 3LG2A 3ZS8A 5HIKA 5HMMA 2CYCA 4Z9FA 4ZZ0A 3GY0A 3ZV3A 5BW6B 1UPCA 2EX4A 1MEJA 2EKDA 2R6JA 2GN8A 2JFOA 5KOJA 3T6KA 3Q15C 2QLTA 3AQIA 1TCVA 3AI1A 1DAIA 2JKZA 4E5YA 1J06A 3BRSA 3DJYA 2GJSA 1IB6A 2H1HA 4JZYA 3D7LA 3D1VA 1HQCA 1L5RA 2E5LB 3S8YA 1G6Q1 1VCOA 1VL8A 5JZ9A 4L0MA 1L7DA 3R24A 4DSNA 1QGYA 1JH9A 1TLLA 5FOXA 1EE2A 3QVGA 2QZPA 1MAAA 2ZZNA 4FSXA 5BN3B 2ADOA 2GO1A 3WA7A 1GKUB 2W0MA 5EIBC 4UMDA 5J4HA 4QUAA 1FFGA 5DYGA 1HT3A 2M9MA 2AZMA 2BUCA 4N3NA 1Z5VA 3G9XA 1H6DA 3KXLA 4FOTA 1J07A 4P4GA 1TF2A 3M1LA 4QOHA 1QZ3A 3D0KA 2BGGA 2QMYA 1V8BA 4XWKA 1PTJA 2C2GA 4CLRA 3OETA 1K86A 1R7RA 2Q3HA 2WUGA 3L46A 3EZGA 3OT1B 2I66A 3MB5A 4HDKA 3S99A 3WQHA 4DHWA 2B8TA 4CMGA 1PGOA 2O5CA 3CW8X 3CT6A 4DMFA 3EMVA 1RJ9B 1R6TA 2X0FA 4CLXA 4F3CA 3P0EA 1NBIA 1BVRA 1OUMA 4TTTS 1KI2A 3ADCA 2VDPB 2WLTA 4ZYYA 3DJFA 2CBXA 1DKMA 1JFVA 4XUCA 4UTXA 1VMAA 3WLRA 3FWYA 3KYCA 4LRQA 3KE9A 2WEKA 1TAHA 2LE0A 2OTCA 3D6VA 3DE7X 4QG3A 2GKGA 4FN4A 4A92A 2XVMA 2ZTMA 4DRYA 1D0SA 1PUIA 1Z0IA 2PGLA 1U7HA 3ZK9A 7ADHA 5JECA 2H8GA 1SZCA 4PXYA 3H5TA 5EKDA 2HMWA 4ZVNA 3SC2B 2BFPA 1KR2A 5K3SA 1UBHS 3CZAA 3GG2A 4EX6A 4CCYA 5IXYA 5HJEA 3L82B 4ZEVA 4IJWA 2J9XB 4I50B 4LI3X 4GP9A 1SUPA 2JJYA 2FW6A 2ENWA 2PANA 2OG2A 2XMBA 1SVSA 2DLNA 1S2DA 2IXGA 2REOA 2JI6A 2BEWB 3EEBA 2I4IA 3FPJA 1JPNA 3ONDA 3SJZA 5I47A 4PPQA 3FY4A 3I04M 4JBGA 2GM5A 5J59A 3SHQA 3VZCA 2H59A 1GEGA 4F6RB 5EFZA 3RSHA 2DLDA 1K06A 3CSSA 4LJ7A 4JKYA 2EIXA 5HK9A 4AKGA 4GXNA 1CK4A 4RD0A 5G41A 3X1YA 2IIPA 3WL7A 1I01A 3DLAA 4UEJA 5EA2A 4C0JA 2M1XA 1XZJA 1GUBA 5AKXA 3IDSA 2FJ0A 4BNNA 1OROA 5HA5A 4FS8A 1S4QA 4G1MB 1AUPA 1PX2A 1Y3CE 3MLEA 3FBWA 3NGMA 4JH0A 3WV5A 4N8DA 4L5YA 1Q6YA 1E5LA 1WJGA 4RY2A 1CRZA 4CM7A 1ZCBA 1PO7A 2NX2A 2XNCA 3HSSA 4IWYA 4KHZA 5LNK1 3TF5A 3KEFA 4AWBA 1AF7A 3NHMA 2QR2A 1G66A 4I1OA 4XSGA 4GGPA 5T3UA 3P0JA 4JI1B 3NH9A 1LSSA 4NNJA 3U61B 4IFEA 1YE5A 4Q1DA 3GLQA 3STTA 1IBMB 1U4NA 5EC8A 1ECBA 2WWYA 2GJ8A 3DLHA 5HKAA 2CDNA 3G7SA 4U5QA 4YAKA 1N8TA 2Y66A 5I7AA 3KJFA 1GSOA 2EJTA 3TPZA 1OPRA 3BHIA 1VRVA 4ZQHA 2HNKA 2ZJ5A 5HZHA 3EYWA 3ICCA 4DLAA 1T0PA 3C70A 3HDVA 3A9VA 1U2DC 2Q99A 2JBHA 5BNFA 4GI5A 2VH2A 4A3SA 2EW8A 4DMUB 1WXXA 5JO0A 4C7OA 5B7QA 4QXOA 2J4CA 4MUXA 2XCTB 4QDXA 3QMPA 4DQLA 1E2MA 1H3EA 1XCMA 2Y1LA 2JCSA 5C7IO 1YZNA 2WT4A 2RIRA 4TZ0A 2O2JA 5KQLA 1TB4A 1TM4E 1XTTA 4MGKR 5DX1A 2ZB2A 3C0KA 4GLJA 4JFAA 1PN3A 2IHKA 3U3RA 4QGHA 2QB5A 3GGDA 4RV9A 4YRQA 2PZLA 3SF8B 4QHSA 4GQBA 4ROTA 3CMMA 4YAEA 1KQOA 4LHXA 3F9IA 1SBQA 3I9FA 3JASA 4EIWA 1X42A 5JD3A 4B6OA 4NF2A 3KKLA 4JJ6A 2B34A 2C9ZA 5ALFA 1EUYA 4AJOA 1ABEA 3KAPA 4HD8A 3PKZA 1H9CA 4QGAA 3VPSA 1C7IA 3JWPA 5JXWA 3HXMA 3OCVA 3A1TA 4RZ2A 4BE9A 1ML4A 4PWZA 4PZEA 3IV9A 3V1TC 5ECDA 1ZM2A 4YT5A 3V3KA 4LXIA 1XD9A 1YQGA 2K87A 3GDOA 1LF0A 5AJYA 4YMGA 2FP4B 1N7IA 2IE8A 4S1OA 3ZY4A 2RGNA 2HIGA 1QIKA 2J08A 1SKMA 4ZDJA 2ZW9A 2TECE 1KZ1A 1VSQA 2HFJA 2W2NA 2ESRA 3B8HA 2XWSA 2XXJA 2YYSA 1IN8A 2XT9A 3RR2A 2JARA 1HOXA 4N01A 5TRTA 3USCS 4D56A 1QR6A 3KSDO 1Y4ZA 4AKHA 3BWMA 1JLSA 4U7TB 2QDXA 1CG6A 3K1AA 4J1NA 4QREA 2QMEA 4EUHA 3FMIA 3FDXA 4V0NA 4CCYB 2AC7A 2ISSD 3BN3A 3CIOA 4GWLA 2FYTA 3FXAA 2CZQA 3LY9A 2VYQA 4ICIA 3KOMA 4O2AF 4I0WB 3D4OA 1IUKA 4RV5A 5KYUA 2WWVD 3V4SA 1QP4A 3N28A 4KSCA 4Y7CA 3ZHYA 3WWCA 3IKLA 3PUHA 1Z62A 4YRCA 3SLGA 2XB6A 2JDID 1DWPA 4IIBA 4OXQA 3O4HA 1VCMA 4BJ3A 2X7HA 4Z86A 1OIXA 3HY3A 5BVGA 4F71A 3VAAA 1EX9A 2ZB7A 3PWZA 3A4NA 2V0GA 3MCUA 3PKIA 4G36A 4W8GA 4G5YA 3U7HB 1PK9A 1FPMA 2V7BA 3OOHA 4TYMA 2QAJA 3ISJA 4MUMA 5JH7B 2NUBA 3WL3A 4MA4A 2V6GA 4HDKB 3OT1A 3LX6A 5ITZA 4WERA 5LKAA 3MGAA 2NYRA 4UEQA 1OWNA 3C6BA 3DM5A 5TC4A 3ZDDA 4TSKA 4PQYA 1E2QA 1Z38A 3CR3C 1FBNA 1ATIA 4CCWA 1WMSA 5KMGB 4GL2A 2FFQA 5EJIA 1PJ3A 1PT7A 2ATCA 1M2VB 1PLJA 5TVKA 4BNGA 5DISB 3IUBA 3DE2X 4DC9A 2YV2A 2R7KA 4QBKA 3AONB 1NDQA 2L82A 2RHTA 2VHXA 4HB4A 5E6UA 5B58T 4CKEB 4YRIA 4CV1A 4NCAA 1YRBA 1Y6GA 3Q3IA 1JAHA 4UD2A 3T4PA 4EYEA 1IULA 2VC2B 5A3VA 2BUAA 5AIBA 1E0DA 4WNAB 2RH9B 2I8LA 3IP9A 4IDCA 2C4HA 4WOBA 4DDHA 3O31A 1KY3A 2L2QA 1CZHA 1KI7A 4IKPA 5D8DA 5CIWA 2JIDA 1YV9A 3SCZA 1OWOA 2UYHA 2I65A 4ND2A 5ER6A 2I1WA 4MVJE 4DDMA 1THTA 3P9SA 1UBRS 4J7UA 4N7RA 3GK3A 4MWBA 4HRVA 3U4MA 1ZG3A 2V0NA 3TI7A 4F3KA 5C8YA 3K9GA 4BN4A 3R3SA 2VSYA 1JKXA 3ZHVA 2VZ9A