2VDWB

Guanosine n7 methyl-transferase sub-complex (d1-d12) of the vaccinia virus mrna capping enzyme
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
283
Chain Sequence
MDEIVKNIREGTHVLLPFYETLPELNLSLGKSPLPSLEYGANYFLQISRVNDLNRMPTDMLKLFTHDIMLPESDLDKVYEILKINSVKYYGRSTKADAVVADLSARNKLFKRERDAIKSTENNLYISDYKMLTFDVFRPLFDFVNEKYCIIKLPTLFGRGVIDTMRIYCSLFKNVRLLKCVSDSWLKDSAIMVASDVCKKNLDLFMSHVKSVTKSSSWKDVNSVQFSILNNPVDTEFINKFLEFSNRVYEALYYVHSLLYSSMTSDSKSIENKHQRRLVKLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VACCINIA VIRUS CAPPING ENZYME D1 SUBUNIT
publication title Structural Insights Into the Mechanism and Evolution of the Vaccinia Virus Mrna CAP N7 Methyl- Transferase.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
total genus 96
structure length 283
sequence length 287
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2007-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03341 Pox_mRNA-cap Poxvirus mRNA capping enzyme, small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11680 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vdwB02
4CKBB 2VDWB 4CKCB 4CKEB
chains in the Genus database with same CATH superfamily
1GPYA 2C03A 3CNOA 3PFGA 3LYHA 2AMLA 3KLPX 2G0NA 4GGMX 4R9RA 1SHTX 2C5GA 3QTLA 2DM6A 1SU4A 1A96A 1R37A 5IMSA 4W8OA 4BNNA 2W58A 1LQTA 5DHFA 3LAWA 1KOLA 4XWWA 1SCNE 3GFOA 4GPIB 2HR1A 1VBFA 1X1DA 3QEAZ 5A0VA 4PQFA 1NG1A 2BEWA 1V11A 2X13A 3A9UA 1ZHOA 1UJ5A 2IPXA 3I09A 4MYHA 1GKYA 2WHEA 3CG4A 5I3CA 1I7PA 3I5XA 5LWQA 4QNMA 4NBLA 4WD3A 3A3NA 3L8CA 4ARSA 1UM9A 5LDHA 1W1WA 4ZQHA 4CN8A 1IB0A 3SLKA 4ZEXA 4DQVA 2FEXA 1UBRS 3WYEA 4IDQA 2YCLA 1E9EA 3C24A 3DEHA 3RYFA 4C0KA 2FPUA 4MPDA 4ZOBA 1ZN7A 5G02A 5C8XA 2W2OA 2Y99A 2B5OA 4UE2A 1TYDE 2V0GA 5DT9A 3KS9A 5G3ZA 3ZHBA 2D1QA 3OO1A 2CJWA 3K6SA 1F20A 5K0BA 1OB5A 3INTA 4GLFA 1JPVA 5BWMA 4DB2A 3N0TA 3G0IA 4LSWA 1SCKA 1SQSA 2O06A 5I51A 5F35A 2J9RA 2P79A 4HFRA 2UU9B 3M49A 5IKEA 4IRXA 3G13A 4KQKA 2ZAIA 4KXYA 4AXBA 3EZ2A 4JL5A 2XVYA 5EGNA 4PCUA 3VR3D 1B2RA 2VJOA 3FYDA 1WXWA 3T1QA 3C2QA 3SMVA 3PNQA 2ZSAA 2J9FA 4KNWA 5BNTA 1Q3KA 1M8GA 1Y1QA 3O4HA 3M3HA 4FD3A 2Z56A 2HSWA 3F7MA 5AT1A 4JL8A 4BO1A 5I6DA 3EIFA 4E5SA 3K71B 2P9TA 1FLDA 1PTJC 2OK8A 3L7CA 3HU3A 2PV7A 4YACA 3TLBA 2VPIA 1T4GA 2YHSA 2XE6A 4QUAA 2G5PA 5IDVA 5JNUA 2IQIA 2RCYA 3IAM1 1EVZA 2CLLB 4D9CA 3C1AA 4MA0A 2W0MA 1FY2A 3JARA 2JFUA 1L4EA 3B1YA 1IEWA 4M0UA 2A9JA 4D42A 2JJ1A 3R0ZA 4U2FA 5GVRA 1AT1A 5GGYA 1GAWA 3V34A 3VH2A 1U3VA 3F5MA 1KO7A 1AF7A 1O94A 4G5OA 2GM5A 5ICFA 1ODKA 1QHGA 3OBIA 1BD4A 4M2LA 3TB4A 4CF6A 2AXEA 4NNJA 1L4LA 3OLVA 1XQ9A 2HLDA 3RUHA 4BS9A 5BXQC 5AKGA 3KQVA 2FN4A 4IDCA 3QPVA 4LBVA 3HR4A 2HSDA 2F9LA 3G2QA 4OYHA 3A6JA 3GMDA 4V2UA 4XJSA 3V2UA 1LNQA 4HGRA 3RNOA 1NNEA 3KDAA 4K8OA 2F59A 2R8XA 3TTVA 4K8RB 2G76A 4M21A 4OXKA 4ATNA 1DL5A 3L4KA 2WYVA 5BSKA 1F2VA 2GASA 1QLHA 5DI3A 1BSVA 3AERA 2PLRA 2Q7XA 4QXPA 3RTDA 1T6XA 1Q11A 1UKYA 5AJUA 5EINA 4BUCA 5CDUA 1J24A 2VNKA 5AOCA 3FZYA 3WO0A 2JZCA 5JYEA 5IJZA 3GF4A 4E94A 1FX0A 3FSEA 1LPNA 3QVJA 4N41A 1VL8A 4DCGA 5LKRA 3JX9A 1P7WA 1GL9B 1X1CA 4DXAA 1JDBC 2GT1A 1OHHA 2YMPA 1XP8A 4R1UA 2G17A 3RUPA 4MDEA 2IUFA 2EL7A 2MSLA 4FGKA 1OMOA 1NQAO 3WWZA 1IJBA 1BN6A 1ESMA 5IRCD 4CM8B 2X40A 2ZPAA 2IYQA 4MB6A 1GPJA 1KEWA 2Y4OA 4MRVA 1ZH8A 2YXEA 1UC9A 2ST1A 3LDAA 4BZXA 4F5EA 1N2XA 8OHMA 1TUGA 4NEQA 4PX2A 1WUHS 3AF3A 3LUJA 1RKUA 1FQKA 5IZ4A 4BYGA 4BGEA 3V9AA 1R64A 5IJ0B 2IL1A 3PIRA 2JGDA 1AQIA 4MLPA 1WXEA 3EMVA 2JEOA 5BSHA 4BGUA 1KI9A 1NPDA 2D4AA 3WV4A 5BVHA 3RF7A 3QE9Y 3E48A 1WKBA 2F00A 2LUOA 6AT1A 4XX0A 4DBLC 3BRWA 1T9ZA 3KCQA 2VS1A 4YMSA 1UFRA 3PEFA 4Q3AA 2YJ5A 3K0AA 4Q7QA 4I81A 2UVPA 1I0IA 3OQHA 3H2HA 2FE1A 4RAQA 1B0UA 2WJJA 1K98A 3KV1A 4H27A 3U7JA 3UQYS 3UXYA 1XJ0A 5KOJB 2ZUFA 2PRIA 3T5AA 4A1OA 4TLEA 3ZY2A 3UAGA 3VA7A 3MJ4A 4JN6B 5JHHB 5HNKA 4OL9A 4TYWA 4P6VF 2EERA 1VCOA 3PHIA 1CC1S 4GGPA 4JI0B 3BOSA 5BV1A 1HV8A 2ZPTX 2UDPA 1F06A 2RBGA 2A4MA 2PZJA 3LRXA 1IN8A 4YUVA 4OU4A 3SPXA 2BJWA 2DHQA 5BRJA 4I9HA 1NX6A 3KWLA 2IHJA 1XN4A 2OK7A 2GLXA 4MCAA 3LLMA 2ZTLA 4A26A 1NW7A 1YQQA 4IWNA 2AC2A 1GA4A 3JR3A 4POAA 5THKA 5KKCA 3MOSA 4RPHA 1VPWA 4O2BA 4JY7A 4NH4A 3CVJA 3P20A 1TJYA 4PG8A 4K28A 4HS9A 3R5KA 2ZJYA 4YDSA 2ZRCA 4YP0A 1E9DA 3RC3A 4OIFA 1VHDA 2OPBA 4B6RA 4CLEA 1QU3A 1KAEA 1TQ4A 2ZATA 2IGTA 3FMVA 2WT8A 3ZG6A 2E7ZA 1FS4A 1RMQA 3MJHA 4RGYA 2CFTA 5KVCA 1QO9A 5GJWC 5AJYA 4MV0A 4KIJA 2Q5HA 1KI3A 1XI2A 4QFBA 3U7IA 5CBKA 4V3CA 2QT9A 4E5KA 1Y9DA 2QJRA 1TO6A 1MA3A 5DX8A 3UWSA 4EG5A 1FJGB 2CL0X 3GJ5A 3IDQA 5H0IA 4PFJA 5IJAA 3R6LA 1R0CA 4AJPA 2NUAB 3FOBA 5BN5A 1QRUA 4MP8A 4HZGA 4OHZA 3B3QA 4IS3A 2NXCA 3K0KA 3OOWA 2NU8B 1QOZA 2OQIA 4MA5A 3TTUA 5YASA 3WGKA 3I4FA 3IQFA 4OHBA 1QQTA 2R8OA 2C9YA 3MBOA 1Z17A 2I22A 3LLCA 3OTHA 4YT5A 3TTSA 3ZZMA 3ADBA 3AZPA 4IQ8A 2VDKB 4C43A 4L50A 3DTNA 4ZEMA 1T2AA 1VRCA 5GMOA 2XEDA 1QSGA 3KHSA 4KWTA 2HLHA 3LUCA 1NBMA 1X1RA 2IY7A 4KQ6A 1NNSA 2N0SA 4RF4A 3ADOA 1SQGA 2DECA 3L7IA 3UVEA 1ZGCA 3QY9A 4F04A 3HFJA 1Z56C 3P2YA 3GB9A 1NI4B 1V1JA 2NO1A 1VGRA 3IOBA 2Z8XA 2HPHA 3OE7D 3NRBA 2EP7A 4KN9S 3TBHA 3PWKA 4R5MA 3ELBA 2E89A 1UT5A 4KG7A 2CHFA 2VAMA 3AI3A 3KM0A 4U5XA 1WQ3A 3D7NA 2X6QA 3C8DA 2JCGA 1F14A 3PKZA 3T0GA 2QVYX 1KP2A 1XR3A 2PX3A 4NH0A 4AZ3B 4N01A 2I55A 2XB4A 1KK1A 2OO5C 3DM9B 4X8MA 2ZRIA 3AEUB 5KAMA 3WC4A 4MROA 1PNVA 5BSRA 1TK3A 4R1TA 4PX9A 2P11A 8AT1A 4F8YA 5CJJA 3OVMA 1SHZA 2H1SA 3KSRA 5A1TA 4CTOA 4ZQFA 3U4QA 3GGDA 1EU1A 3KHUA 1XZMA 5EJFA 1M0TA 1RI2A 4BUJA 3HB0A 4E2XA 2LRHA 1HWYA 1NI4A 4LJAA 3RAJA 3JPWA 4O02B 2C00A 2GO1A 1GLGA 4LA4A 5IARA 7REQA 2OL4A 5BNZA 1LSOA 4LJ7A 2OFFA 4RPLA 1Y1SA 2YOHA 3C5CA 4P4TA 4GIBA 1JHVA 1J8MF 1KJNA 3PIDA 1FMLA 4HGYA 4TLLB 2CEKA 4MRMA 5C1PA 3H75A 3TRHA 2D1SA 4HQ6A 1Z0DA 4RH0A 3M6IA 2IIBA 1VLLA 2OOKA 1U98A 2HT6A 3D0RA 2AN9A 3FNEA 4MRPA 4ZTZB 1WPGA 2AK3A 5D6NA 3SJ7A 1P1HA 3EC1A 4HUQA 5K99A 2H9AA 1CWUA 2B6HA 2FX3A 5BMVA 4KV7A 4RKFA 4F9FA 4RGVA 3RIHA 4H31A 1O0BA 1KP9A 4OY3A 4DC1A 3QNWA 1UR5A 1PUJA 3MRXA 2CXNA 2CXUA 3B7GA 1P3JA 3RUFA 5A3JA 5ICSA 4IJKA 4XDZA 3EDMA 2CFIA 5AKEA 3UGQA 1U80A 2Q41A 3IEIA 3B85A 2I99A 1D7AA 2Y77A 3HN7A 3B6JA 2XBMA 4RY9A 5JZBA 2BRUC 3N86A 4MUAA 5EHIA 4NF2A 2J85A 4YRJA 3TJZA 3O73A 1UBUS 3EZYA 4FMCF 4YAJA 1GXSB 1LV8A 3CV3A 2WABA 3ESZA 2OORA 1GQFA 2FFAA 5KIAA 1QMPA 4OX9Y 1FVOA 2AJBA 3D2AA 4Q39A 2W4QA 4X7MA 3QI7A 1CY4A 5K0EA 1Z62A 1QYVA 3ERCA 4TWJA 1ML4A 4JEUA 1ORDA 4GZMA 1Z6PA 5DLDA 3KLBA 5MGBA 4BWFB 2XUDA 4L8WB 3ISTA 4MSUA 1ADYA 1R0LA 2JGEA 1KPIA 4FE7A 4QG3A 3D3WB 3IIEA 3TIIA 3K16A 2H5JA 1GZSA 3AVPA 2H29A 4K6CA 4Q4JB 4OMFG 5JASA 3E9ZA 1AGNA 1EI9A 1PV2A 3C74A 1E59A 3DOHA 3GHHA 4UQPA 3DMTC 3IRUA 4NIMA 4DL9A 1GPLA 3TX2A 4CI9A 3NQ41 3E3LA 5K8IA 3SC3A 1HF3A 5DT2A 3D6JA 4F5ZA 1C29B 3JQ8A 1WF6A 2IDZA 1T1EA 4WKNA 3ZS8A 2A5LA 3EVEA 4RULA 4RK0A 2VDWA 4NHOA 4EELA 1PZEA 4FLMA 1FOEB 1MO2A 1WMFA 4FOTA 2GPSA 3V7UA 2V54A 3GLGB 3LX5A 4KK4A 3Q3JB 1WNTA 3GJXC 2HK9A 4WCFB 2AZXA 3U48A 2X3FA 5T67A 3DVRX 1IC6A 1B3BA 2XTAA 5DMXA 2EX0A 3O93A 4BVLA 3QG1A 3TW8B 4I66A 1OFTA 1KSJA 2J08A 4XX1A 4MZDA 1U0JA 1GADO 2G36A 3NVAA 4PFKA 1EEHA 4F86A 5A4KA 3IEMA 4OHFA 4KHPB 3GFQA 4TWAA 4M1MA 4MUFA 4G4GA 4XWOA 2PUJA 5KQPA 3HJCA 4OP1A 1U2TA 3R7NA 3OU7A 1YDMA 4OJQA 3R75A 2JCVA 3FYUA 1KQPA 2G3YA 2VJKA 1EX9A 4FUTA 5BW4A 2UYHA 4LIPD 3RTGA 1LVGA 3N0VA 3WB0A 1L5ZA 5BWBA 5C7IO 2WLTA 3LFUA 4KGDA 3ZPXA 1B1AA 2VL7A 2FRDC 5IEBA 4AKGA 4MR8A 1PQWA 4BQNA 1GILA 2I9PA 5L3RA 3ROEA 5TR9A 4U4AA 4UVGA 5ADWA 2O48X 4L5AA 4NC9A 1H2AS 4MB0A 1N1GA 2IHTA 4QPPA 3Q8MA 2JFZA 1K7EB 4GSYA 5LYYA 1DQSA 2X9LA 2L82A 1O97C 1AO0A 3UMGA 4AF8A 4PHTA 4EJSC 3NORA 3WBFA 1BJKA 4KX3A 2PSEA 5FV4A 1V4BA 3JQPA 5I9BA 4EB0A 4O5OA 1CUDA 2CXTA 3OC6A 2HHHB 5KO2A 4NWIA 5AVYA 2ABWA 1NXPA 2J0EA 3E9EA 1P3Y1 3K4HA 1TVCA 3UUEA 2AD1A 1DKLA 1OFVA 1NOKA 2AYXA 1PEKE 2B92A 4M7OA 4OB7A 1NP6A 5F78A 1ZIDA 3CLSC 4ZV9A 3OLXA 4AY3A 1RFLA 2ECQA 2H3EA 2MSWA 1A82A 3B6IA 4UU0A 5J47A 1JQ5A 5FOWA 3M9LA 5CDFA 4N0DA 4AMVA 3GYBA 3E23A 4BZZA 3ROFA 1GYQA 3PVCA 3VH4A 4CL3A 4MRAA 1EFCA 3TUJC 1I9GA 5AHXA 1ZUHA 3TAHA 2EZ8A 5H9VA 3C5WP 3FPGA 1RE1A 5FUQA 4IIVA 3L7KA 3HP1A 5HIJA 5LJLA 3DFUA 1FQJA 3GJ7A 3U1TA 5CCDA 3LDHA 4YRRA 4DIUA 3J7TA 5GONF 2YIJA 4UM5A 3ANLA 5EKXA 4EG6A 1EWYA 1BG6A 1VXOA 1T9HA 1BZYA 5KHAA 4HUQB 3ET4A 4FGWA 4EL5A 4FKZA 4ZC1A 2PIAA 3WR5A 4IL5A 1ZGHA 4LZNA 5TLSA 1ISHA 4L4SA 1AE1A 1TM3E 3EFOB 3TW0A 1ACLA 3FYUC 2PJUA 4X90A 3KTFA 1GNPA 2JBWA 2DY0A 2Y1CA 4R16A 4WADA 5F1KA 3W6UA 3WGHA 1M1NB 4YUXA 1BXRA 3O1LA 4QJBA 3O7WA 3GT3A 3H9UA 3TS1A 1EP1B 3AG5A 4R1SA 1DHTA 2B8WA 2CXQA 2Z30A 4WLFA 4E70A 3D4BA 2OKCA 3MJVA 4ENUA 5JJKA 4MR9A 4LOJA 2A9OA 2IYOA 3KTAA 3QUAA 4M53A 1KO8A 3OPVA 4H1UA 5REQA 4HUJA 1FVXA 4MGIR 3VJKA 4BNUA 3BGWA 3EY4A 4D8TA 1JNYA 4GMHA 1V35A 3H8VA 4PO1A 2WV7A 5EWMA 3WHKA 3GFBA 1JFFA 3RDPA 1XPOA 3P0IA 4E14A 2CYBA 3MPOA 1CUIA 4CM7A 1KEVA 2PL1A 3LCVB 2QMZA 3IELA 3UGKA 1PWZA 2Z09A 1DTSA 3C4JA 3IB3A 3AEUA 3VC7A 2ICAA 4RDCA 4ZJPA 2M9MA 3O7MA 1DI0A 3E3OA 4D97A 1KK2A 2WYIA 3PR1A 1Q0LA 1KQGA 1FLNA 4WT7A 5FA6A 4LYJA 3VZRA 1G6OA 1FUIA 1SD5A 3ZXUB 1SKAA 2BOVA 5H3HA 3OFND 4LW8A 5D3ZA 5CA1F 4ISCA 3U0VA 4C01A 3BTUA 2NO6A 2Q1UA 3H9BA 4ZVNA 1YVEI 3WP1B 4W5QA 2CFRA 4EF4A 1H2EA 1BU8A 4MJ3A 4R68A 3BGDA 3E5RA 3KJHA 5AI6A 3SXUB 1ZGJA 2P5SA 3GO4A 4MV6A 3ZVRA 4J94A 3MMXA 4R1PA 3BJRA 3REGA 2XH8A 1LBTA 1M33A 4R8LA 1RCUA 1MENA 2YJTD 1FSGA 1J70A 2NIPA 4F8EA 2QMEA 1E1QD 1WKVA 3DBVO 4X3CA 5LMUB 3LQKA 2E55A 1VFPA 3EULA 1P0MA 5IVDA 2HCJB 3CH5A 3UK6A 4AN0A 1SKYE 1PF7E 4D3YA 5I4KA 3ETGA 4DTCA 5LQNA 4IQFA 3NT5A 4J1NA 1J2YA 1Z13A 2I6GA 3CE6A 3HL0A 1Y3BE 1NP3A 3QF7A 4FR2A 4JBXA 3SZ3A 4PYJA 1ZK4A 2ZSJA 1LV7A 3BM5A 4OGGA 5GONA 2C4VA 1C1DB 1NRIA 4N6OA 4YWJA 5FOQA 1WG8A 2YWXA 4D98A 2C3OA 1LQ2A 3WYCA 3UB3A 5JALA 2EP5A 3ILVA 5DM60 1DOHA 4IEIA 5C4GB 1Z2NX 1EWKA 2HX1A 4FEGA 3C4VA 3HDVA 1WD5A 4QO7A 1RQNA 5IT0A 2FWIA 4J4HA 1OX4A 1RLMA 2CUZA 3E5NA 3FPEA 1AURA 1IYZA 5IANA 2UYYA 4BFCA 1NRJB 3QKRB 4CR7A 3VR0A 4MQFB 3OZWA 2I87A 4JIGA 4HKTA 4MR8B 3TEMA 4DMLA 3HKDA 4V0SA 2ZXEA 4D41A 1Q0HA 2HQOA 2L69A 2QRGA 1V6AA 3EIXA 3ONNA 2AKAB 2VCYA 3WLJA 3MWFA 4OFXA 2RK4A 1F2UA 3TH5A 3I42A 3Q1KA 4EIWA 2FWRA 5KYWA 2XT6A 3RFFA 4LXXA 1L7EA 1XAIA 2F3UA 4DQUA 4Z1MD 4Y98A 2QRMA 4NBRA 1X7YA 1GTMA 3QTTA 2G9UA 1UWVA 2UKDA 4OHWA 3PYXA 3T1HB 1JSRA 1MV8A 1YIAA 3STVA 3TSAA 1W49A 2YHAA 1NI5A 1UC8A 1E2HA 2IP2A 1O57A 3L0SA 4M7RA 4YV2A 2QNBA 5JYCA 4GMFA 4TLDA 3O8QB 2BFMA 2IBMA 1TEZA 2X4DA 4FONA 5FI3A 1KC3A 3ORQA 1M9NA 1TM2A 3IQGX 4AL4A 5K8TA 2D59A 1XNHA 4JJEA 3LA6A 5G2OA 1UH5A 5C4IA 5CDYA 1ZCFA 6NULA 4FYVA 4PZAA 2NYUA 4FZ3A 4QTTB 5FKJA 4B3JA 1YZHA 2ZRBA 2CEAA 3SOZA 1XCBA 3K9GA 3ZI7A 2OV2A 4DWWA 5FBRB 1NUSA 5F7JA 1YNOA 3ZDAA 4KACA 3VUEA 1L8OA 2CBZA 4QXAA 3E58A 2JIQA 1N2GA 1SC9A 2ZB4A 2ZSHA 4KXVA 4U00A 3EXG1 2I4MA 3PG5A 4EA9A 3MWEB 1LW6E 1L7NA 1YZQA 1U3FA 1UF9A 2J31A 5CVUA 2AA3A 2OAP1 1IG3A 1U3TA 2GLUA 2A3NA 2DPXA 2F3SA 1SBYA 5A3SA 4Z4IA 1PCXA 4RGQA 3ZIAD 1C0LA 4RSRA 2M6LA 2PGDA 2CBXA 4P5PA 3TN7A 4DNPA 1O95A 1NVAA 3EOZA 5A0TA 3AB3A 2C61A 4NPCA 1BH2A 3GG2A 2P9CA 3NJ8A 1AS2A 1JJFA 1SCBA 2FSUA 3ZBUA 1Y6GA 4KU4A 5B12A 2C77A 1XZKA 3HWWA 3IV6A 3KQQA 4WPGA 5AOVA 2BSXA 1KETA 3PGA1 3N3BC 4XYLA 1M74A 5B4UA 2ZJ2A 3NO4A 4CKXA 4FCCA 3SGLA 2ZTMA 4HB4A 3K73O 1PDWA 2J9FB 1OFUX 1ARZA 2A3RA 2FZ4A 3AW8A 1BU5A 1F8YA 1U0TA 1BWPA 2A9RA 2J48A 3O5AA 2V74B 3SSNA 1DELA 1U7WA 2P5TB 3OPQA 4E1BA 5LOVF 4H15A 4BU0A 3QTBA 3H97A 4DV5B 4AAYA 3IOEA 1YR6A 2B4TO 3VR6H 3SD7A 1JYEA 4YMVA 1CQWA 1XTPA 4C1NA 2FJPA 3FVWA 1V5FA 1F6DA 1YSCA 1YWGO 1AU9A 2W6QA 2JG3A 3QM1A 2WUVA 3DMNA 3ND5A 4HLUA 4AG6A 4M9RA 5CT4A 4EYEA 4WXMA 1RD4A 4MGYR 3PQFA 2VHJA 4BNTA 4TQ9A 4QOFA 3HB9A 3WJ1A 1JIIA 3DQQA 3GWGA 1ULAA 3MB8A 3PL5A 3PE4A 2NV6A 1ESEA 2QRJA 2VDLB 2BGGA 3D6TB 2IHZA 3BD8A 1IQUA 1GPMA 1NN1A 3H0EA 4O2BB 4H18A 4K9SA 1NMZA 1X7XA 4UDNA 4DKXA 4IZOA 4HAZA 4GEGA 3WHLA 4KNYA 2R6DA 2OV4A 4E4TA 1CZOA 2LNDA 5BOVA 4MUMA 5JROA 4DJJA 1O6CA 2Z95A 4CL2A 1HNWB 3AP2A 1PFGA 2W8BA 3BQMB 4L0MA 3QLUA 1MD9A 4I6GA 3ZZ0A 4BLPA 2Q50A 1V4VA 4W5HA 3VO1A 4OYLA 3JQQA 1RCTE 4FIDA 2GN1A 1XZGA 4JJZA 4OHPA 3HUFA 1XJ5A 1ZH2A 3LPDA 5D8DA 5BMVF 5JQGB 3UENA 5LJIA 3QOXA 1BMFD 1U0FA 1D9ZA 3ZY4A 4XVRA 2EX1A 2H2GA 3DT6A 1WZ2A 4HLNA 1F0YA 1TGVA 3CRW1 4OXNA 2E4YA 2X2FA 4BOYA 3A9CA 3L6EA 2W2KB 5GADl 3PC3A 3PPXA 3LT0A 4JBNA 2HQRA 4ZALA 3K0AB 5H68A 3RLFA 4YRKA 5J4LA 1AB5A 2DZDA 3MUEA 5CFZA 1FBTA 5E9AA 2WWYA 5KTRA 1Q1NA 1SXGA 2ADFA 3IXMA 2OGWA 1EGQA 1ZMRA 3GGJA 1B6GA 3OEED 4YECA 1DEAA 3QELB 4BJHB 3C3BA 5JDCA 2ZIEA 3NM6B 1RZRD 4JLSA 1PWEA 2O7SA 1GJRA 1N5JA 1TQ2A 2WF9A 4PIMA 3PITA 3R7BA 1U7HA 5KREA 2FW0A 3TOVA 4EABA 1OT3A 5COAA 1L2TA 1OIWA 5K0JA 2EX4A 3K32A 1N6OA 3CPJB 1FMCA 3VPCA 5HIKA 2JIBA 3ID6C 3PJDA 3CQ9A 4FLFA 2BFFB 2BR3A 4ES6A 1X8KA 4QO8A 4HWRA 3A6GA 3MT9A 3QFHA 1N3YA 3DMDA 4Y1RA 2NPIA 3ZZNA 1E3QA 1MRZA 5JLAA 3Q8WA 1KDTA 4CEHA 5AVSA 1TRKA 3QVMA 1HETA 3KVYA 1DUIA 1SD2A 1TNDA 4O4HF 2HLNA 5LYJA 2H9IA 3RV4A 1TB4A 3ZJVA 5CVCA 2Q5JA 4IHJA 4J49A 5FR1A 4HH0A 4EPVA 5DJ5A 1A2QA 4F2PA 3DBLB 2X0DA 5ALGA 5CT5A 4X20B 5EE1A 1W25A 3F5QA 5AHWA 3GBSA 3EUEA 1WZNA 2ZUTA 5JJLA 5EGSA 1FUKA 1HTBA 2GPYA 1SC6A 2JW5A 1GZ6A 2UZ3A 1DBPA 4P83A 4U2CA 5ECDA 3SBDA 3WKAA 4B44A 3J81k 4JC8A 4GI7A 4UE3S 3EGXA 4KLCA 2DVMA 3SC4A 4EA8A 1HEUA 2PH1A 3FGPA 2EDAA 3C3PA 4TKVB 3VR2A 1G8AA 3AUKA 4WUVA 5IAGA 2RIRA 1EFTA 3U4QB 3GMIA 3TZBA 4JJFA 4B8YA 3MJSA 1N34B 3WRYA 3WZLA 3GMTA 3JYHA 3WGJA 3W6ZA 1DOAA 3A4TA 2BFCA 4GS5A 3CCCA 4ALLA 4DCTA 4EI7A 4N76A 3C41J 4EFKA 1ZICA 4UHDA 5A02A 3H1EA 4RMNA 5TRTA 2AN3A 2COEA 3AUFA 3B3AA 3HSKA 1QYRA 1N5IA 1EG2A 3HABA 2H2DA 2HV8A 3LX6A 3WKCA 4AECA 3L04A 4Z7QB 3BILA 5H4GA 2XNCA 4PAQA 1AZWA 1W30A 1XOIA 1O87A 2ZS8A 3EGCA 3QLTA 3LTNC 1Y7LA 3CW8X 1N9ZA 5KKAA 2FN8A 2DCUA 4OFZA 2AWOA 4C7MA 1JR6A 4G0QA 4C7BA 5TPZA 2O8CB 1Z38A 4TS9A 1QVRA 1RU3A 5DCYA 3RYCB 5TE9A 2RFLA 4IIFA 2Y1LA 1T25A 1MVOA 5LP6B 1GRCA 1U2RA 2J3EA 4AXXA 4ZYZA 1KJWA 4IHKA 4KFTA 4IGKA 3EFHA 1GUFA 4E7PA 4BUZA 5E4JA 1C1XA 3ENNA 4JHXA 3UJPA 5U1PA 4CEJB 1BEUB 1QG2A 1T8UA 2RH9B 1KNXA 3VU9B 1Z82A 4LX0A 1L9XA 4KVGA 5AHKA 4C0QC 2VYQA 5ANRB 2PS1A 3HXQA 4CKZA 3IAAA 4W5NA 5CP8A 4HAUA 5AFSA 3A1SA 4L4XA 1NUHA 3Q3HA 2VEDA 5M34A 2PLAA 3S68A 2IHYA 4NZ9A 4JI3B 4WJLA 2HLPA 2G9VA 4LRQA 1W0CA 3DZGA 3WTBA 1Y6QA 1N7GA 5EAIA 1DX6A 1QAMA 3CR3C 3BCRA 3AB8A 4CMEC 2MR6A 3COYA 1FDTA 3H16A 4MV7A 4KBFA 3Q72A 2O14A 4Z7NB 1QFZA 3GUZA 3HPRA 3JQBA 3NXSA 3W7VA 3VKHA 3QLVA 5F9FA 4UUMA 2ZFUA 3MUFA 5M29A 1NYLA 3OSZA 4P3OA 2FZLA 1A9ZA 4MINA 5CXUA 4NZYA 2O3RA 1GTG1 2O2YA 1SU6A 2B1RA 2RK6A 1WF3A 2PZBA 3P9QA 1RM4A 1MC4A 2VATA 1V95A 2VZ9A 1HURA 4FXPA 3NHFA 3IKMB 3KIPA 3F46A 2X8JA 3TOSA 3DF9A 2Q6KA 4TTJA 5F23A 3ENKA 1V43A 2YIVX 1U90A 1J8YF 2XV1A 3I73A 4JZYA 3MMZA 4CODB 5HIIA 4C6TB 3EZ7A 1EZ1A 1KDPA 3CEJA 4NMXB 3GOQA 4BHTA 3PD0A 3S1AA 1O6BA 2VUSA 2Z83A 1CRPA 3GDOA 4YC7A 2JJYA 3V4ZA 5IYZA 4FX2A 4LF8B 2YDYA 1JR2A 5K3CA 3V3KA 5CB4F 5KNBH 4E15A 3EFEA 3IJPA 5G4LA 1FK8A 3P2OA 2RGEA 4A8TA 1EUYA 2B9VA 2EDCA 3BXFA 3C7AA 1TJPB 3DO8A 3D1VA 3L0CA 4L72A 4L5BA 3T54A 1DC3A 3LJKA 1I4WA 4JX9A 2ZRMA 4QQNA 3ZWYA 2DETA 3M6LA 1ZI8A 1M5UA 5C1BA 1NJ1A 2ERYA 4J0GA 2O1WA 1P1FA 5EMKA 2PEYA 2B4QA 4RF5A 4X1OA 3UXEA 1T9GS 1WCIA 4TYQA 2B20A 1W46A 5TQJA 3U44B 3P97A 1U0NA 2WHPA 3UPDA 1JR4A 5BXYA 1RI4A 4YUAA 1TO1E 3S2SA 4CE6A 2Q5OA 3EXIB 5JZSA 1P72A 5EJ5A 3GNTA 4B6GA 3OIFA 4MJXA 2BUAA 3RIXA 2XUJA 4HRAA 1X15A 1JIKA 5BSMA 1GY8A 2GJ4A 1A1VA 2O5EA 4NBSA 5D51S 5FWXA 2FPIB 2DWOA 1BW9B 1M2EA 1V11B 2BC9A 2H52A 4QC2A 1ECFA 5JAHA 2L42A 3KTAB 4ARVA 2F8SA 1E3SA 1Z5GA 3H2JA 4Y6SA 1RVV1 1C9NA 1GKLA 3P7MA 2ZZMA 1TIKA 4DILA 1S9HA 3PZBA 2PUWA 3LG2A 4Q0MA 3LBYA 5EKSA 4NMWA 1R9JA 2OBNA 1NONA 1YR7A 4GD3Q 1DDGA 1RXUA 2ZEJA 4R9VA 1ZD2P 5K0LA 4D9EA 1M1XB 2O8VA 1ZH4A 3OAAD 5A9SA 1Z0SA 2HSJA 5IUKC 2RONA 1EINA 2W7TA 1U2DC 4UXJA 4HC4A 1U11A 2HK8A 2PFSA 4LV6A 4PLWA 3DTYA 2ZAMA 3Q7SA 3SR4A 2JGIA 2VLBA 4Q21A 1YQDA 3WIEA 3VBCA 5HX7A 1W19A 3CEMA 1T9AA 4M86A 3IAHA 3V1TC 5AVUA 5B3JC 2VK2A 1F17A 1OYOA 5CK4A 3FI0A 3ITEA 2YZGA 1P17A 3C39A 2XT9A 1R10A 1U3GA 1LW7A 2PXHA 3ENZA 4US1R 1QP7A 3E5HA 2D1TA 4QRHA 1JE1A 5G0WA 4BX0A 3I1IA 3TCXB 5CW2A 4GZ3A 4BN5A 5A4MS 3D8UA 1P2VA 3EVGA 1A5SB 3W3AH 1TD1A 4X6YA 4I99A 3K70B 3F67A 3SMQA 3W7BA 1UBLS 4Q5IA 4OV6B 1U8FO 4UU1A 4QOHA 3WLHA 1UWLA 5ALKA 3AONB 1N32B 5GJCA 3FSGD 3SYMA 4TKLA 4F2GA 1IY8A 2AEMA 1SB9A 2GEUA 2OV3A 3KVVA 3WP0A 4CCYB 1TI7A 1W1UA 1VKHA 4JB8A 2OENG 4MV8A 3AWIA 3X2SA 4CKBA 3DWGA 1G8GA 3TBFA 4W5OA 4IH1A 1JEYA 1CY6A 3WQRA 2QR5A 3EAGA 3I12A 5EOVA 1RXIA 3PHJA 5CLIA 1GRNA 1IHOA 2X2EA 3RS2A 1ZAYA 3M7IA 3H1FA 4TTAA 1N3BA 1KZYC 1YNSA 1AB6A 4IDFA 2VA8A 4BFVA 3B1VA 2NTNA 1H65A 1W87A 3AQ4A 4MLCA 1AS0A 1ND6A 3PXAA 4MUKA 1W73A 4MX8A 5EJMA 4A03A 4QVIA 1M7HA 4ZT6A 2EWVA 4QASA 1JG3A 4FJ2A 5ALDA 5KOYA 5BRAA 4A73A 3KZXA 3CLUD 4WRRA 3JQRA 1L3IA 4F91B 3SEQA 2JZOA 4L9SA 1UWCA 3SIXA 5JBIA 1H6DA 4WZBA 3V7YA 2OLJA 3E3AA 2FKNA 1U9CA 1K7XB 3I9OA 3K9LA 4MVJI 4F84A 2QUKA 1T3HA 3TK1A 4RTOA 1YQGA 1O77A 4BJ5A 4R51A 2F17A 1GPUA 4ZJYA 3QRWA 2EJBA 2Y1GA 3HUTA 4FBMA 4R6XA 4E5MA 1M6HA 2JJ2A 1K8RA 3G1TA 1AS3A 1BXZA 4D3XA 4F2WA 4HDQB 3DV9A 1WHTB 4I46A 1BS9A 1XYVA 4CKCA 2R8YA 3R09A 1EP9A 5KNDD 1MORA 1NJ5A 2EARA 3KR1A 4M1YA 1ESCA 2ZRFA 4QOIA 4YDRA 2N42A 3G5UA 2P62A 1MB9A 4KPGA 5BYKA 3TMYA 5A3RA 1YU9A 2CXHA 1U5AA 3G2PA 2CL6X 2XVZA 5LC1A 3DHNA 1C4KA 1O08A 3D3EA 3HCPA 1C3VA 2XRZA 3A6HA 3FETA 1ZVJA 3QXCA 4XUEA 3GPLA 3T61A 1SELA 3G2LA 3ZU6A 4Y1RB 1BYUA 4KI7A 4A8HA 2Y66A 3ZCXA 4EA6A 1NTOA 4HFJA 2YY6A 2PXXA 4C78A 5DTMA 2PKEA 1Z4IA 1Z74A 1WSBA 1P6QA 1L5GB 1RRGA 2IEBA 1BIFA 3FPKA 1X80A 1H5QA 5DWQA 1KMHA 3D8BA 2FKAA 1A8UA 3HA7A 1N9KA 3QQPA 4GMKA 4HCJA 3AR5A 5DBOA 2A0YA 3RI3A 3HA2A 5TMBA 1Y63A 2DYKA 2C5FA 4RV5A 2JJ2D 4X44A 3VKFA 2GEDA 2CUKA 2BGRA 2FN7A 1M8FA 4P4SB 3SS9X 4KODA 3SQDA 1JEOA 2DUNA 3KSUA 1T0BA 4TVBA 1G3UA 3KBOA 5AVKA 5LQMA 2NQ8A 3WJAA 4EI2A 2DWUA 3DQPA 2WUWE 4LHZA 5TQ2B 2NU6A 1EFPA 2QRNA 3Q7IA 3R4CA 1OF1A 1B14A 3GG9A 3FCSB 4MLDA 4B7UA 5JV5A 3KB1A 1W9MA 4O4JF 4D25A 4KR0A 2Z3VA 3DL2A 4A6EA 4L4UA 5EHGA 1J56A 1X7HA 3QXGA 3ADDA 4A5SA 4Z9FA 2YJGA 2RI1A 2VHQA 1LK7A 2WTAA 3DJFA 5ALUA 1A5ZA 3V4FA 5IBCA 1JLKA 1VMEA 1NVBA 3V1MA 2PZLA 4CDGA 5JWRA 2CNLA 3OE4A 2YQZA 1DPGA 4LYFA 1Q84A 1BH6A 1KRHA 3EGOA 4LOAA 4R5HA 5DYYA 2C3MA 1WIWA 3HMKA 3RSFA 1U0GA 1HDZA 1IM2A 1XROA 4L0QA 1VE3A 3F6BX 4RABA 2WZQA 1EVKA 3WLSA 1DFHA 5ALEA 4D3SA 1YK0A 1JA9A 3ZWXA 3BB3A 3HCOA 3ISJA 5ITWA 2FHPA 1ORRA 3DYVA 1W8IA 4QJ5A 3QVXA 3GAAA 4H3SA 5LIPA 2JGDB 1GFWA 2FJ0A 5K8UA 3FPLA 1HDEA 2C5AA 1Q7RA 1UFOA 1PBTA 5HW0A 5JNTA 4INOA 1WXFA 4RM3A 3NKVA 2G06A 5LZ4A 4Y2PA 1YCHA 2JD0A 4AS1A 1J5EB 1GLNA 1BMTA 1W76A 2O2SA 3AHFA 3OFNA 4NCXA 3W05A 2XIQA 4URZR 4C22A 4LYGA 3FWKA 4G4SP 3RC2A 2B8TA 2MMCA 4LBWA 1FDRA 3CLKA 1FU4A 4ZCIA 3IAXA 4C04A 1JG1A 2CSUA 3JWJA 3GPBA 5FQNA 1TTHA 4HVAA 2QX7A 3QVGB 2GNAA 1CUXA 2ZJFA 3KHKA 3HE3A 1JKXA 1ZU4A 1LI5A 1N6HA 3I5YA 1BQEA 5FQOA 5AM4A 3P96A 4R2MA 2EWWA 2JAQA 4OHKA 3L7BA 2A57A 2PU7A 3S8YA 1CZKA 3B70A 4IMJB 4RDXA 3Q88A 3CKKA 3U19A 1Z68A 2HEGA 1I3MA 2JJ8A 1L7MA 2Q1WA 3N8HA 3FRHA 1BNCA 4U9HS 1Q1EA 5KWSA 2YVUA 2PFGA 3KYDB 2NZJA 3KT0A 4DGSA 2XW6A 2EZ9A 3DAFA 1ADCA 4MCHA 5JS6A 3D4PA 3KQUA 4LI3X 2Z9DA 4CJXA 3G17A 3ED1A 4JOBA 4R84A 3VSEA 3ZHTA 4WLUA 2FQ1A 2C4MA 1S8AA 1ZWLA 2OGSA 2Q07A 1K1EA 1R2QA 1U81A 2DSTA 3B2QA 3KQYA 4Q3EA 3W5UA 5CDHA 1L5VA 4ISBA 2YQ4A 2H3HA 3GJQA 3OZVA 4H6XA 3RIGA 4CV2A 2Q0XA 1R4NA 2FPMA 2WC1A 4R9UC 4TUYA 5FORA 2D7DA 1FFSA 3T1VA 1XXHB 2YN4A 1KZ6A 2DKNA 3RSOA 1G38A 2P4HX 5DTRA 2WQ6A 4J3FA 3K8QA 2R8RA 5BY2A 1R5OA 2QA5A 4E03A 3GP3A 3CM0A 2O3QA 1UMBA 4Q9NA 4M99A 3QW2A 1UM9B 2AXNA 4D1YA 4A92A 5B6IA 1J39A 1D2NA 3M33A 6GPBA 5AVQA 1RJEA 2LCIA 3R3JA 4FFWA 4KO3S 1K2VN 2O8FA 5HFAA 5HVNA 3WIDA 1YU6A 2J5QA 5HOQA 3AL0C 1VRVA 1J25A 1CVRA 2FI1A 3ANTA 1JQ3A 4DR5B 4B5LA 1TQHA 2BMAA 3PUZA 4XZ3A 3W8DA 4YO7A 2IS4A 1NVWQ 3Q3VA 4MI6A 4R2KA 1Z7EA 4E32A 3NAMA 1EFDN 5AHOA 3D02A 4O25A 3MWLA 3E9CA 4K9KA 3ZXXA 5KSZA 3PHBE 3QOFA 4I4TF 2C98A 4JAVC 1QTQA 1Z28A 2ID8A 3EG9B 3OJEA 5TT0A 4PINA 1AO3A 1NM5A 2XY4A 5FFMA 1JHYA 1PK8A 3OZIA 2NXWA 3WGQA 4OCZA 2VWHA 3V4OA 2L19A 6PFKA 5DH9A 1XEWY 4H9GA 1JVSA 5BW6B 3H83A 4JKIA 4XQGA 3BBLA 3V8QA 1Z26A 2PR2A 3P9RA 5E7JA 5BWCA 4YHBA 1N5RA 4YRDA 4QPDA 3DLPX 1GXSA 1Y8QB 3IX7A 4JS0A 1P18A 2ZWMA 5EIBD 4J1SA 5FHRA 4IVPA 2AJTA 2Q2VA 1OFHA 2R5WA 4XGRA 4UMDA 1H0RA 2G9ZA 5HZKA 1EP2B 1DKPA 4LJLA 2WWIA 3KZMA 4J0HA 1PUXA 4WOKA 4E46A 4L5CA 1E9VA 3MNFA 4P34A 1VBKA 2V1XA 3KZNA 4A6DA 4ER5A 1YOBA 1T13A 3LM8A 5CNKA 1KOGA 1W29A 2D0DA 1MUUA 2LD4A 3GNSA 2JD2A 1VM6A 3EXHA 3MAGA 5I8PA 4JEIA 2WAXA 4O59O 4U7JA 3G2JA 1IN7A 5K8VA 4MUNA 4W1SA 1QYDA 3EGVA 5IK2A 4D9GA 4DRXB 2BDTA 2OYSA 1O4WA 1SBCA 4H0FA 2PS3A 3VYTB 5IM4F 1HQKA 1IIBA 2PTGA 3IHKA 1EUZA 4TWBA 3AIIA 1CDOA 2OMKA 2OUIA 2XVMA 3SJZA 5FPKA 4BP3A 3CTMA 3NTLA 4C30A 1QK4A 1L4HA 3OIUA 1E8DA 2RC6A 4GBED 1QCCA 4AJKA 1CFJA 4IV5A 1U1EA 1Z0KA 2VNHA 4OM8A 4M9XA 4PANA 3W1EA 3JRXA 5A5GA 1J7JA 1QLWA 2EOAA 1PJ2A 1HOTA 2ZP1A 1O8CA 2AZDA 2C83A 2PSSA 4PGHA 5L3QA 1XTRA 3VHRA 2NNLD 1E2NA 1KQNA 4QTZA 3FDZA 2XCLA 1DEKA 1DCKA 1TU4A 4PBSA 4REQB 5J5CA 5TDHA 2XD9A 1QHSA 4DV7B 3DMPA 4B80A 2C8VA 1X9HA 2AFHA 2DBVO 2YYSA 1W34A 4X8LA 3T7SA 4DV6B 3RHSA 2XODA 1OASA 2I7VA 2Z98A 3I32A 3R0IA 3UHPA 4DMRA 3ZD6A 2AJLI 2TRSB 3CN9A 4QM7A 2XJ4A 1NBME 3G0BA 1BX1A 2HH9A 3AVQA 4FWIB 2QM3A 5ITZB 2PPLA 3U16A 3KT8A 4MI3A 4ZHQB 4F71A 2NACA 5JEDA 1ZUWA 3PHHA 3N0WA 4M1QA 1K63A 3EODA 5T6MA 1R6TA 3VJRA 1Q1ZA 1WP4A 2QD5A 4HB3A 1VECA 3CS3A 1KFCB 3FCUB 2B2NA 2AG1A 4N1AA 2JLWA 1P2FA 2BEWB 2BMWA 2DLNA 1OE0A 5TQVA 3ZE7A 1O3YA 3AUYA 3AEQB 3CLTC 2MYNA 5IKXA 4UTXA 2OSVA 4CNBA 3G6WA 2JANA 5AJTA 4ZN6A 1GU0A 4B7ZA 4LRUA 3LHSA 4RIHA 4KR7A 2IHVA 4MJLA 2D7CA 4KAFA 2D2IA 4QYIB 2ZREA 1ZFNA 3GIDA 1SVWA 4UDXX 1W5SA 1J23A 1D6JA 3V9PA 2OECA 1Z6YA 1PGPA 1WUIS 1II8A 3JATA 2QK4A 4PRLA 2HJGA 4ALMA 1TT5A 1ZEJA 5CB4A 4MQUA 3L1UA 2IZ6A 4PYKA 2UAGA 3UGTA 3K35A 1RRCA 1R0XA 2CLIB 3EJWA 1ZISA 3N2LA 3VTZA 4JJAA 2I1QA 1OXTA 1YRBA 1T34A 1NFQA 4J2HA 4HDRA 3JQ7B 1TADA 2JFFA 5L4NA 3JW8A 2D1RA 4CCAA 3EN0A 3QKUA 1HT0A 4DMKA 3RYHB 1ZKMA 4U2GA 1CJSA 4L57A 5MFPA 5C1IA 3M1IA 2IYEA 3H4IA 1RM5A 1YT5A 2IH2A 4PTLA 5KNLA 1AQUA 5IW8A 2CHQA 2QQGA 4G1VA 2L17A 4QU9A 4S1VA 3UV3A 4I1UA 2EW2A 3Q10A 5TJHA 3BTVA 5DHRA 1OBOA 2EU8A 4C4ZA 3V2GA 3SZGA 5JUWA 1U1CA 4F4UA 3EWIA 4B74A 3GPIA 2QM0A 2E0IA 2MTBA 3INGA 5DM70 1G291 1C7FA 4JEHA 1PW7A 3NHKA 1FA9A 1XLUA 1YRHA 4G85A 4FFDA 2QPAA 2XA9A 4LVNA 4MYTA 2PM8A 3JASA 4MWZA 2VJLA 3VR3A 4F56A 3CWCA 1R8JA 4YV7A 5BV2P 3OJFA 3EVZA 3QWBA 2OCIA 5DRTA 4YCNA 1Z39A 1FYEA 4ABTA 2UVQA 5JHGB 3VZSA 3V97A 5HZGA 2ZKLA 4BMPB 3J80A 4L75A 5F2EA 2WWRA 4JVMA 1A9XA 1KIMA 1G42A 4UW9A 3OEHD 2F8MA 2WFLB 3O4IA 4MS1A 5E7QA 5K01A 4RVUA 2IFTA 4J7AA 2WMNB 1NWHA 3U9LA 2P78A 4KE7A 1U4OA 3OM0A 3VYWA 4A5OA 1A7AA 1OU4A 1X9GA 2EQBA 5KPJA 2FW6A 4EGCB 4PBRA 2FMHA 1EVYA 2XSZD 4XB6B 2F9MA 3H13A 2HHJA 3E18A 2YIMA 4IOMA 2WUGA 4MMYB 3OCCA 4OPMA 4XH9B 2HMTA 3E0XA 1P74A 1MNQA 2R11A 3AFGA 3JQBC 1ZVKA 3Q5GA 4LNUA 3G88A 4N12A 4QXMA 4V1CB 4BRUA 3LV8A 3GLGA 3KV3O 4JDPA 3NEAA 2PX2A 5SY4A 4O3MA 4HEHA 1C41A 1NQXA 1WL8A 3JATB 3Q6NA 4MUBA 1JR3A 2QNIA 3DOCA 4W9MC 1KFBB 4FNMA 2LPMA 1M34A 5C80A 4HXGA 3USES 1JX6A 4KYIB 2YV1A 1MB2A 2V6JA 3CUEF 3QX9A 1P1JA 1T91A 2V7WA 3CKLA 3QJYA 3IMKA 3FOEC 5CG2A 4OB6A 1Y9AA 4BMDA 2QAGC 1E1YA 3O0DA 3CG0A 5KX5A 1DWQA 4MS4A 2EGHA 1R16A 3E03A 4O2RA 4FYJA 4L07A 3D6HA 2GFQA 4FFPA 3T4XA 1VHWA 3N53A 2BISA 2IYZA 4L51A 4B76A 3KQLA 1XWFA 3NBYC 3I0MA 2Q3CA 3UATA 3LP6A 4DNXA 1VJRA 1ZJWA 2C7BA 2VP6A 3UUWA 3KG2A 4FOOA 4I9FA 1NF9A 3A9TA 3TL6A 1ZCAA 2OFPA 1CUSA 2QX9A 2Z9BA 3MAJA 5E2IA 1LPOA 1NGSA 3BFKA 1MXFA 1UP4A 4CKCB 4MK4A 2RD2A 2A9KA 3PQCA 5GP1A 4RLSA 5DFAA 1TZBA 5EYPA 1KQFA 2FF7A 3BS4A 3CH7A 3A1FA 3NAQA 5KDDA 4G3XA 5LP6A 2E4XA 4X1YB 3NYQA 3CTPA 2IP1A 4H7HA 3HKDB 2XADA 4MPTA 1DQRA 3EF0A 2IV2X 1TPZA 2VF2A 1DBVO 1H2XA 5CG1A 2HMYB 2JH9A 3A1NA 3F6EX 3ZK9A 1XQXA 2Q5LA 1Y8AA 3OWHA 4Q24A 2FZ5A 1YD7A 2AR0A 3ECAA 3RB8A 4CMIA 1W2GA 3HBFA 4MHOA 4NJMB 1WMDA 3KZKA 3IC5A 5DV9A 2HFJA 1JIUA 1NJ8A 5CXQA 1XMIA 2OZPA 4CKBB 3H17A 1TMYA 2WPDA 4QBHA 3W4JA 3D6NB 5DTIA 2P0AA 3WIVA 1LF5A 1MPTA 4R2WA 2ZIGA 3PPWA 4S1OA 3TDNA 1TA4A 3PENA 4JOSA 1E1RA 3HV0A 4LHVA 1TD9A 1YRYE 3L6CA 4QBTA 4X97A 1ECGA 4WKBA 4YR7A 1Q0PA 2BE7A 2HFKA 2JGLA 3BXPA 4NICA 4WEOA 3T5CA 5T4HA 2ATVA 4TMYA 2YNMD 1CV2A 1VIYA 1CE8B 1ZL0A 4ZDWA 3FHOA 4LDJA 4B32A 2IE0A 5ICCA 2JI9A 4PZPA 4O4LA 3GGOA 4YRAA 3ZHOA 4B3FX 3KQTA 3O8DA 5JATA 2XUKA 3ONEA 5IPFA 5FYDA 1EBUA 2H48A 2AE2A 4PLFA 4RF2A 4C0WA 3U3DA 4DEXA 3HKEA 1GGJA 3FVQA 4HQNA 3RTEA 1URPA 4G4IA 5CM9C 3O82A 3QPBA 1T8TA 3S5UA 4G0OA 4B87A 3HO8A 2ADOA 1XMVA 2V8BA 1GNVA 1ZH0A 2RH5A 2VPZA 2NT3A 5DXJA 3R4VA 2WOJA 4D0RA 4Q9DA 5C8VA 2GJKA 3WK4A 2ZWAA 5TX7A 1DTEA 1S7CA 3GEMA 1MPXA 2AN5A 1GIAA 3VAYA 3CONA 1UBHS 2RHJA 2ZM5A 3NEPX 3GDHA 2YXNA 3WL8A 4WNIA 5ITZA 1SG6A 2OV1A 4YP5A 1QIEA 2LR0A 1L4NA 1RP7A 2YZ2A 4J9VA 4YJ2A 2R65A 1WDTA 4Y0VA 1S0UA 3RSGA 4EGAA 4R0MA 1FVHA 4B3SB 3W5JA 4UC0A 4R8VA 1E3WB 4I8XA 1JB1A 3BMCA 3BXOA 3HVJA 1TU0A 5ARDA 4LNHA 3WIOA 2BI4A 2Q4DA 1JG4A 1S5PA 1YI8A 4ZAYA 4R1LA 3WAGA 3R5SA 4DMCA 2IJGX 3L79A 2QRLA 3IP1A 1XA4A 1NJ6A 2PMBA 3PDWA 5HF5A 1R9GA 1WEKA 3ZDDA 3L4BC 1XDWA 4IV0A 3AI2A 4OMDA 4HX2A 2WAYA 4Y6QA 3WLOA 3JVDA 2WF6A 3EF1A 1DBQA 1JKMA 1JXAA 4JJIA 3RC8A 5KTPA 4I19A 4I55A 1P8JA 2ZIZA 2ODWA 5B58T 3DMTA 4D02A 2C9ZA 3DXZA 2YMMA 3A11A 1G5IA 4ZPXA 1G16A 5LOVA 2OTCA 2IOFA 2MYPA 1ZJ4A 4FQ8A 4DCSA 1EAYA 5JANA 3ZVNA 4EENA 4BMOB 4RD1A 3LOPA 3H5WA 4HN9A 2YJ3A 4FNOA 4H7DA 4N82A 3VKUA 6ABPA 2O8CA 1RZUA 1QZZA 2E3JA 2XA1A 4OBEA 5K0ZA 1W88A 4IIJF 3KETA 3KYJB 4PO9A 3U6KA 1CJTC 4Z6KA 1FP2A 1GTZA 5E38A 4H7IA 4W5WA 5JC8A 1Q0TA 2Z2KA 2RKWA 3N6RA 3OQJA 3TLAA 1ZK3A 2AEEA 3GJTA 2GZSA 3MAAC 4K81B 4F6RA 2K5UA 2ZE7A 2Q3EA 2B0CA 3GY0A 1O95D 5GJVC 3THSA 5JD6A 1VPTA 2J7PA 2Y9MB 1IK6A 2EKBA 1PJZA 4CM1A 3S0JA 2BKUA 4DA6A 4BFXA 3TUZC 4GOJA 4DLLA 2F1RA 1TLFA 1X8LA 4AWAA 3H4TA 3I64A 4CF4A 5AW2A 2XXAA 1RIFA 2I7CA 4MKZA 1N2ZA 5EQTA 4B71A 2H8KA 5LP1A 2ZKIA 4Q93A 4BNXA 4BMXA 4POOA 2HJSA 3W5BA 1QQBA 4HXFB 2CVQA 4JHLA 4N5DA 4KN6A 3I6IA 3BMNA 3AR7A 2ECFA 3IXLA 3ACCA 2BGJA 3UCFA 2VWPA 3KLOA 3DDWA 3VJLA 1P6UA 3U26A 3PWSA 5JWOA 3L6DA 2ODNA 1Q6YA 3I53A 3D7KA 2ZRHA 3ZQJA 3GCGA 3THYA 4PPFA 4XIJA 5A0FA 2XB8A 1KI2A 1FRQA 4PAWA 4CIAA 4CTMA 3C48A 3GAMA 4MW2A 2FDRA 2K87A 5JNRA 1D2HA 1QB8A 3OY7A 5CFMA 1Y5MA 4GAEA 1FZQA 1Q0ZA 4X62B 4KQXA 4ZZ1A 1V6SA 4JP1A 2QM7A 3BAZA 4GOKA 1BVHA 1EDOA 1FFXB 3GBPA 4A8JB 4EEXA 3QXJA 5FBVB 2XR1A 1FUEA 2WDPA 3ETNA 4HN4B 4YV1A 2NO4A 1F3OA 1V26A 1LWNA 1V8DA 2PVCA 2RMKA 3BHJA 5KJ1A 4CKWB 1IEQA 3JD0A 5LA6F 5JH7A 1A77A 3PT9A 4RESA 2PKQP 3H84A 3NBXX 3B8HA 3G7NA 4XD2A 2V65A 3BXZA 3LUDA 3HLKA 2HSGA 4B0OA 3Q5DA 3PBKA 4RHXA 3C6MA 3MIZA 2BFWA 4A82A 2WW8A 4B2LA 4N3AA 1CYEA 4GR5A 1CPYA 1TM4E 1EZ4A 1FLAA 2IHUA 4CL0A 1QS0A 2BEJA 3HMQA 4JXKA 3WLTA 5HJEA 5EESA 4UM8B 5FLEX 2QR3A 1XVLA 3DV2A 4WZBB 3UTDA 2YZ7A 4DYHA 4HNTA 2A5FA 2LXNA 2W6JA 4F6LA 2AYZA 3N2KB 4ZTUB 4MJ7A 3KYDA 3NHUA 2VH1A 5J2UA 1OIVA 4LOKA 4TSFA 1TUBB 4IP0A 5AXBA 2E4AA 1IHDA 3ETHA 1OUMA 3L8HA 3MS2A 4QT0A 5DNYB 3QVKA 1VG8A 1R0SA 1FUUA 3E9YA 1FFAA 3R0QA 4MPJA 4F3TA 3G9UA 1GTSA 3FBGA 4LHWA 4ZHSA 1XTVA 1AZLA 1QCZA 2PV0A 2IEIA 4JOCA 4KIUA 4LQCA 3MBKA 4M8SA 3QLUC 4BE4A 5KNBD 1KAOA 3U80A 1GSAA 1ONNA 2QQFA 1H5UA 3DF7A 3FWNA 5KAPA 3VR6A 1I1HA 4TV9B 1VG1A 5L45A 1KEZA 1FLVA 3A1DA 3ONWA 2CLEB 4DT1B 4EEKA 1Y8ZA 1ULUA 3QBTA 1F12A 4GXQA 2HL6A 5EP4A 2P5UA 1YB2A 4BY9E 1LC3A 1EXMA 1SEPA 4IMPA 5CHEA 3AVVA 4Z8YA 3VV2A 2F90A 3FCOA 4B4UA 4YJ3B 3OX1A 4NQZA 1SUAA 1TKCA 3SIPA 2CDNA 2WF7A 1HEYA 1Z4KA 1AK1A 1D07A 4NLLA 3W8RA 1VPDA 3N5KA 5HUJA 4G2NA 3UOWA 3ZU5A 3U3XA 3GUVA 2O1SA 3PFKA 5FUVA 1R6XA 2X9NA 3U4AA 3WKBA 1XGKA 4P3KA 1XRLA 2H4FA 3N5CA 2NXNA 4O4IF 1IL0A 2PQ6A 5ALQA 2FWMX 1RLIA 1BDJA 2OBXA 4Q3DA 4UD6A 5JISA 3WNZA 3L0BA 4JB2A 3OM8A 3V6MA 3Q12A 4MMXB 3TJRA 4TKMA 1Y6ZA 4L2IB 1WZUA 2GPAA 1F8UA 4EZIA 2VXOA 1TTTA 1EM8B 5C8ZA 3FTQA 3QYFA 1Y3DE 1KI7A 1XYYA 2QIPA 1RMYA 1FDSA 1IRXA 1NQOA 2PLFA 1HDYA 2H07A 2FZVA 1E2DA 3I9MA 1SBTA 4MARA 1OI2A 3UANA 1CD5A 4LMPA 3K0FB 3QHAA 3RS5A 1SCDA 2JGRA 3UIEA 4L22A 1G4HA 2VTKA 1I0LA 3TLZA 4D82A 4IGAA 1YZGA 5FNZA 3TVYA 5HKAA 3OOEA 2J3HA 2R6GA 4WX2B 2O3JA 4FZ5A 3GLSA 3OHMA 2OCGA 1A4XA 2LCFA 2PBZA 4MKIA 2R1TB 4FT4A 1YZUA 4RQTA 4UAGA 3ZDQA 1I9CA 1BO6A 4KFUA 1IXSB 4LCJA 4X9XA 1KY4A 5KTMA 1H3NA 1TYCA 1YJ5A 2VHXA 3CMCO 3I9V1 5DGTA 3AGQA 2IXAA 1IMOA 5B36A 1DFIA 1MT3A 2XCQA 3DE4X 4M0EA 3KSBC 5B30A 4Y18A 1BGWA 1P73A 1N25A 1ZGAA 4JUCA 1MF7A 3OFVA 1FTYA 4DVJA 3M4YA 4WESA 3DDCA 3ILYA 1O5IA 4N40A 1DIHA 2JFGA 3PZRA 4FWTA 4LMAA 1ETHA 1PK7A 3A4VA 4S1WA 3TYXA 3RLIA 3GFTA 3WFIA 3B8EA 1PGJA 2HO5A 4LBZA 4RKYA 2BBWA 3ZH2A 2SKEA 1Q0SA 4RFVA 5DBHX 3O8RA 3IEKA 1S1MA 4IRUB 3Q11A 4TMWA 4RIIA 2FDXA 4KQ9A 4AI6A 2GDZA 3SX2A 4Z54A 2B4RO 1SHLA 1T8SA 3PF9A 4WACA 5JO9A 1RQPA 2X1LA 4Z4EA 4KQHA 5DU2A 3IILA 1RYNA 1IZYA 4F4IA 2Q3MA 4JI6B 3UA4A 2Q4EA 1TAGA 5DHTA 1QXSA 4GOLD 2FEOA 2OLEA 3MZ0A 4KUGA 1KDVA 2XNDD 4Y2JA 3HO1A 3CNNA 4NU0A 1VL6A 3ELYA 1CERA 3HDGA 3H6HA 4Z2AA 1PZNA 2O0HA 4LDAA 3GELA 4WLEA 3TTTA 4EB3A 2HQSA 3IKVA 1UJBA 1TGYA 3KJZA 4QIHA 2OHXA 3EAFA 4JYCA 4PIVA 5LUBA 1Y33E 1UBNA 4QUJA 5IWAB 4V38A 1S3FA 3LPMA 4I1YA 1JXQA 4X1IB 5DYGA 3W78A 1A50B 1QHIA 3E1KA 3B9PA 2WOOA 4F4HA 2Q45A 3NALA 3QX3A 4AMGA 3SYNA 2ODEA 1PJCA 3GRRA 5CVEA 4YMLA 2CDCA 2VRWA 5KJCA 3JASB 2IIVA 2FFQA 1WB6A 4ARAA 3HJBA 2YVLA 4H0CA 3GUCA 4ZVSA 4H16A 3DE0X 4BO4A 1TW2A 4CTKA 3RT9A 4G0PA 4KRGA 5AHRA 3AIKA 1LPAB 2ALJA 2IC5A 2VK1A 3OE7A 4P98A 4X95A 4KAAA 3RJTA 3RYFB 4CXMA 4G1CA 3P0RA 1UFKA 1SXPA 1GLVA 2H31A 4HL6A 3GDGA 5GOZA 3B1JA 3AT1A 3VDMA 3WYBA 5BR4A 1CR1A 1HLDA 1NMYA 4H0NA 5BURA 1HDIA 1B4DA 3DEIA 4OSOA 2XCRB 2OCDA 3KYCA 1W36B 3O2NA 1U6IA 1L8XA 3PDJA 1KMHB 2F4NA 3BQ9A 1GNSA 1QHHB 5KTKA 1MX9A 3NHAA 4IDPA 1ND5A 1KBQA 1DTWA 4GVLA 5IVIA 4KH0A 2CJPA 1LBSA 3CRMA 4NMHA 5D5QA 2Q3JA 4Z7JA 5LKAA 1SCUB 3IJ5A 5FLYA 4HLDA 1TYBE 1CB7A 1P7VA 4ZU3A 2WSMA 4BAZA 2ZUWA 4HQLA 4H4DA 3NS7A 1C80A 5LBIA 1ZG3A 4ZT3A 2AXPA 5GPBA 2QAGA 1CQIB 1S2IA 3TQIA 1AY0A 1J9ZA 5ENVA 1Q7CA 2IPNA 1XNRB 3AJDA 3PX3A 3T94A 2V6FA 2BDEA 2CLHB 4R2HA 5DIZA 3ILHA 1XHEA 3GW8A 3L7DA 2VJBA 3COSA 3NHYA 1L4MA 1I14A 4ZI7B 2RGUA 2VDVE 3WFZA 1T2UA 4QDUA 4UKDA 3ZBPA 3GRKA 2E4WA 1YB6A 3U9TA 1ZJ6A 1NW5A 2MJLA 2Q3LA 3IVMA 3EVTA 1QH1B 1IE3A 4QLAA 1OZAA 4IYRA 4L4ZA 3T12A 4C9BA 5A6VA 1JHOA 4PG7A 3RREA 3ZCQA 4L28A 2AG0A 5BN4B 4BVHA 2JZNA 2W70A 3ICQB 2DUWA 3HYRA 3M70A 4LN1A 5KSYA 2BHNA 2HO4A 4CTNA 1I7DA 1CNMA 1E9BA 3SR0A 3UY4A 4HNVA 4ZCQA 4NXMB 3P26A 4BLOA 4ZXFA 4Z3DA 4Y1FA 4J2OA 1RADA 3QPCA 3TIXB 1OH5A 5DGHA 1DIGA 3IHLA 4JC4A 3EDCA 1DADA 1UINA 2BM9A 2GZ3A 3BZWA 4B34A 3NHSA 4AC9A 5L7YA 3MQ4A 1LBIA 1Y5IA 2GJAA 2QG9A 1B73A 3FNFA 3V00A 3OJWA 1FTQA 2BBTA 5G41A 3RSZA 4MS1B 5K9ZA 3MWGA 2A9VA 1TK2A 3U4CA 3P9ZA 5IEJA 2WFMA 2PMFA 1HA3A 1M6WA 1NOJA 1HT1E 3EASA 3QUSA 4JD5A 1TMGE 4DLSA 1ZSVA 2AD5A 2XIJA 3PYLA 4FS3A 4LOLA 1BFUA 4MRSA 1KE1A 1X1AA 3U7QB 1SVNA 3HO6A 1GN8A 4LUCA 4BX3A 1OA1A 3FHTA 3KFVA 2BTQA 3LT2A 5F4BA 1UEXC 2W6NA 4XARA 5LWHA 2EBWA 2QZZA 4NU6A 1IZZA 1SUFA 1N0VC 3PDIB 5B53A 5JD5A 2PUFA 3LCCA 3FZQA 4EDHA 1AMOA 2ZLBA 2HHAA 3ZV4A 1A98A 1CUHA 3DKKA 2FSFA 4ZQIA 1TEHA 3BD7A 5JW6A 1REQB 4RACA 2P2ZA 1YJBA 2Z58A 1NBEA 1CUBA 2VTEA 3THOA 1THTA 2X4IA 3DTVA 4BFSA 1OGJA 5H7XA 1LX6A 2Z1NA 2R66A 4BO7A 4BDTA 1JV2B 1T4CA 1L4FA 1TJ3A 1TAQA 4Y30A 1IY2A 2DWCA 1RQ7A 1IUKA 4DDKA 3UAVA 1I7SB 4GI5A 2PZEA 3RIMA 2FZWA 2PCJA 1M2GA 4BEWA 1R27A 1ZM9A 1I30A 1JJ7A 5DI9A 3QELA 2Y3IA 2RGNC 1YRWA 3AEKA 2OLKA 3R8XA 2FN9A 3DV0B 1RABA 4HQOA 4WXEA 4XIYA 4REMA 3NI2A 1EFVA 3UJAA 3WTCA 1ES9A 2C95A 2ECKA 2HF7A 2UXBB 3IBCA 1ODTC 1C9KA 2I8LA 3IR5A 4Q3BA 1NMQA 3SKXA 4ZI7A 1L5OA 2JFYA 1CYDA 3LZCA 1GAXA 4PLVA 4HDSB 2HNKA 2V59A 3MB5A 2CLFB 2FR1A 3LYUA 2FB9A 1C3JA 3P9KA 5AM5A 4EPXA 3DNMA 5E2AA 3HN6A 3RYTC 1VMAA 2FR8C 2XQFA 4QU5A 3BWCA 1UQUA 4E1VA 3IPLA 1NT4A 5FUXA 3GRYA 4DDUA 3D81A 2ZQ5A 1JAZA 3GFSA 3IBGA 4MQBA 3L1VA 1G8PA 1D1TA 2ZUUA 3NCTA 3WLLA 5J5AA 5FD8A 2Q21A 2XCTB 1QIHA 1PD1A 1UPTA 2R86A 1IN6A 1YE3A 4M9CA 4F6RB 1RWOA 1B74A 3PIIA 2R96A 5EA2A 3HCWA 1ZGZA 4YV0A 2C9BA 4QLOA 1C30B 2CK3A 2OXRA 1XZLA 1EB9A 5CVDA 5FAKA 5M04A 3TQTA 4LDZA 1O94D 1C7RA 1OTXA 5DNDA 1SQ5A 2OGTA 3C7DB 3G85A 3M8KA 1A8IA 3EPRA 2YZKA 1ZXBA 3DE5X 3R1IA 2Q8NA 4JENA 1S2LA 1Z4QA 5CH8A 1KSHA 2IF0A 4M7PA 3TRFA 4BMSA 3U5ZB 1TKAA 3OT1B 4ALJA 4CU2A 2CHEA 1II9A 2RARA 3OQBA 3WBBA 1Y9EA 2JIZA 1YR9A 3KJEA 1VL1A 4RQUA 4TV8A 4NNPA 1CULC 3RD5A 1UKZA 3AM3A 2YXPX 1XD9A 3C8ZA 3JQ7A 2HLDD 3PF8A 5DGIA 4ZVKA 4C3UA 2H1OA 3I6MA 1QGUB 3W3AD 4A9AA 1E1KA 1B00A 2H11A 2W2QA 3B2EA 3G0HA 1XMJA 2A5JA 2AJDA 4G9GA 3K15A 4DGQA 1T43A 4PYLA 1ABBA 3FOFC 2D2FA 1S8NA 1YAHA 4PRKA 3UWKA 1GCOA 1TUEA 3BHNA 2GBPA 1CQIA 4TS3A 3T5MA 3O8OB 4MWOA 2PFKA 2J1LA 3ENVA 3UK1A 2LKDA 3E2MA 2EVWX 2I1VB 1XLVA 3TSCA 1PQ4A 4X3OA 1X87A 1KI4A 2XVXA 3G9TA 4JP8A 3PS9A 2EXXA 1IQPA 3RSSA 2GJSA 1WU8A 3UJBA 3E7PA 3AI7A 3UJDA 3MUNA 1ATZA 4HNHA 3AHHA 4CU5A 5H3CA 3TGPA 2GBLC 2WSSA 1Z16A 1E2MA 2R7AA 1LS1A 4EG3A 4I9NA 1T2NA 1KP3A 4RTPA 4KW7A 4D80A 2YUIA 3WWOA 1E89A 2OORC 4M8IA 2GB4A 3VZBA 4BCDA 3H5OA 4A91A 4CKEA 3BMOA 1E2FA 3M1AA 4OHMA 3SVZA 1VCIA 3DPIA 4C7XA 1G21A 2JAUA 1GZDA 1SBIA 5KWEA 2ZSUA 1G5PA 3W34A 1KAQA 3U3JA 4A6PA 1HG1A 4LY0A 1H1DA 1EK5A 1LBEA 4XM1A 4FYMA 1JBEA 1G55A 3AF5A 2GPTA 1NSFA 4JYBA 1B6SA 1L7AA 3P9IA 4EEZA 1U28C 2FRVA 2GPBA 4NYJQ 2QXUA 5LM3A 2OHJA 1GKUB 4CMIB 5B6JA 1A5TA 4HRYA 4EG8A 2B2CA 3QVOA 1E6CA 2J4FA 4G2TA 4D8YA 3RABA 4EFDA 4KX5A 2ZCUA 4CM3A 3ROZA 1H1TA 3G2IA 4J29A 2V1UA 2ZYUX 3HEMA 2PKYX 3AM5A 5DHUA 1F7VA 1Z0JA 1HE5A 2X4LA 2P41A 4IZHA 4LY6A 3RUEA 4UNQA 4BAGA 2HYIC 4TTQA 1S2DA 3ONFA 1V9SA 1P0PA 2OB1A 4KIFA 4Z4FA 3HVHA 1YI0A 2C7QA 3NXKA 1QHNA 4BX2A 4RZIA 4P36A 4PONA 3MQ2A 1YQWA 4ZZIA 3U6BA 2D0IA 2XWQA 3OLYA 3QKIA 3I5UA 3ZYCA 4G0YA 1H3FA 3HI6A 1GR0A 1SHKA 1JKFA 4ZMRA 1AHHA 4RJJA 4RZHA 1IATA 3GRCA 3SFVA 5F2OA 3T41A 3TMKA 3S2FA 1JFLA 5IDWA 3UFBA 4DV0B 1WD7A 3CINA 2O54A 4ENQA 2O1EA 1TCAA 3JAKB 2B8JA 4YJ2B 3MW8A 4DREA 2V58A 2WHRA 3NTXA 5IUJC 3OF5A 2O8FB 4HAWA 3M81A 3CE9A 4CNQA 1OBHA 3EQ8A 3L1HA 3ZXSA 2DQYA 1QVWA 2TECE 3WHIA 3W5AA 3MSCA 1KA9H 3WOVA 5MDHA 2FMXA 4H77A 5JAMA 1XVUA 2EW1A 4EO7A 1N0UA 2AF4C 2GARA 1FDVA 4KLZA 4ZVUA 4RZ2A 4AP9A 4ENTA 1ZC4A 4DUGA 2Z04A 3JARB 4KOEC 3EYAA 2QD1A 4E6EA 4RZSA 1DFGA 1ZPDA 2PS0A 3FTDA 3LVRE 2G8LA 4A2CA 5ICGA 2DUMA 1DT3A 2KX7A 3IQHX 3T52A 4B6FA 1PW5A 2Y1OA 4IDOA 2O0JA 2QORA 3F5FA 3M89A 5KYVA 5HM8A 2VYCA 1JS1X 2ZS7A 3JQFC 3C0KA 1A9YA 1JXMA 1WB4A 3KAJA 3LT4A 2ISSD 4FWBA 2PSDA 2V4UA 3SSOA 2FPGB 4DCVA 1NJGA 3PJGA 1JMVA 1FS5A 1LSUA 1LQUA 4WFQA 2FOIA 3H9EO 2G5CA 3BJMA 4IDAA 5E6RB 4ZOLB 2C0QA 2QUJA 1S01A 4X7BA 4DA7A 2VF5X 2FSVA 3UWPA 1PDVA 1U2DA 1NX9A 2CBGA 1OJLA 2B1IA 2OB2A 2SKDA 3C3DA 2CXRA 2PMKA 4FNAA 2Y1KA 4GE3A 4HD8A 4PGMA 4JBYA 2ZJ6A 3GFPA 5B1EA 1EM8A 1YUBA 1JDJA 1XZDA 3KAPA 4QATA 4YAIA 3BKXA 4BKQA 5ED4A 2HTFA 3VR4A 3DE2X 4KQMA 3WA7A 1TCUA 3LD9A 3NTVA 4LV8B 2BGUA 2IZ0A 3X1YA 2C59A 4ERXA 2OO5A 1DC8A 1USVA 5DNVA 2O59A 3BYZA 3R9XB 5HS6A 3RJ9A 2QRQA 4OQ4A 1N2BA 4KPEC 2YYYA 3LMKA 1SURA 1VGQA 2PGNA 4X92A 1EVLA 4WV3A 5LR6A 2W2MA 1RYMA 1W9HA 3OMLA 3IAUA 3AUSA 4N5LA 3DE3X 1H9AA 1DAKA 4YUYA 5A7HA 1MH9A 2REQA 3PWTA 5SZKB 3DL7A 3NRCA 3KKQA 4GWKA 2OA0A 2IUYA 2QZSA 3GA0A 4TYPA 3WYDA 5FWNA 1OAOA 5AW1A 2JLZA 1WY7A 4PO3X 1SIOA 2EW8A 2R8BA 1DNPA 3GPDG 4Z8XA 2CZCA 2HY7A 3S2YA 2H2FA 1RI1A 4IUCS 1USUA 3ZE9A 1YJAA 1NY5A 2AOTA 5KQGA 1DXQA 1NBWB 1UADA 2AFHB 3FW1A 3OKCA 3ROKA 5LBTA 1UEIA 2W5UA 2JH3A 3LGSA 1WEHA 3NYWA 1QM5A 1U9YA 4YMWA 2I54A 2QNRA 2JD1A 1BS2A 3LXMA 1O7JA 1VKOA 2GN9A 4KH1A 1NRWA 1E2QA 1X38A 3FMPB 2C5BA 2CFSA 4XASA 2J0QA 2G4LA 1WA5A 4L2IA 1I2BA 2Z6QA 2CNBA 2IEAA 1PDOA 4BLSA 3VI3B 4D0NA 6ADHA 2ESRA 4NARA 3FTFA 4BEVA 3MTBA 1V5GA 4UCFA 5BVGB 4LXUA 1NN5A 1A27A 3OFJA 4JFAA 4BV9A 1MOZA 1K4YA 4KE9A 2JIRA 2EZ4A 3AESA 5C0OE 3N6VA 1DXHA 5B64A 3S40A 5F1PA 5FTNA 3ZOKA 2VP2A 3H4VA 3JTMA 4LC1A 2B34A 1PLJA 5JSYA 5AESA 3GEPA 2WYHA 1QRDA 1A8PA 4AFNA 5KYXB 4C14A 2I2FA 3D64A 3DDNA 1Z6TA 3RFUA 4B4WA 3MILA 3QIVA 2XTNA 3IFSA 4OKSA 4PZUA 5ECGC 4RHTA 1S3GA 5B4VA 1E7QA 1FNNA 4FM9A 3KXIA 1AKMA 1KIAA 1PHPA 2P67A 1UJ4A 4DIOA 5JZVA 1VSBA 3GLFB 1FXSA 4TXHA 5FH9A 3O3NB 1V25A 3K6JA 1OIXA 3IQDB 1IBCA 1G2OA 3V1YA 4Z3KA 4G5SA 1E98A 5E9QA 1YRLA 2V3WA 3H2SA 4DY4A 3CVWA 1Z4NA 3G2KA 1R18A 2CNNA 2XNSA 2Z1DA 3DXFA 3JSAA 5KYGA 1QRSA 3TR6A 5JDIA 1L0BA 3WBJA 4WIAA 3ADKA 3BK1A 3IT2A 2XB6A 2ZI5A 4KE6A 2Y8EA 4LE1A 1V5WA 4B35A 3VRHA 5C53B 5FOUA 1RRVA 3USZA 3SLRA 4EFMA 2QI9C 5KQSA 4H1HA 1BRMA 5EP2A 1ADFA 1FYWA 5HF8A 5EJ9A 2GTHA 4J7XA 3PEWA 4MQFA 1GPNA 3PGXA 3TR5A 4B3RB 3AMVA 1Y3HA 2Q29A 1JIQA 4EGSA 1L1FA 3AEYA 2AT1A 3ZUGA 3FOWA 2HZ7A 2WE7A 2ATXA 2Z5FA 4PQRA 1V96A 2ECOA 1P7YA 3GXOA 4ONEA 3R3SA 1ZD3A 3PFNA 4PEVA 5C8YB 1JH8A 5KKNB 2HWKA 1NBMD 3IQXA 1E0DA 4MR9B 3S1LA 3DUFB 1OX4B 1PSDA 3OJCA 1YR1A 3PT5A 4GF5A 5AJWA 5H59A 3ZW8A 5JH7B 4KGXA 3H5IA 3KALA 1ST2A 3GLQA 5CX1A 5K3OA 5K03A 2CWDA 1ZP6A 4DJDC 5A5VA 1JG2A 2VWGA 1ZC3A 2PA0A 2R47A 3AGPA 4I4NA 1M2KA 4Q1DA 3BX1A 3GEGA 3R40A 2IV3A 4Q4HA 2RHBA 4AK9A 1W59A 2ACWA 1GV1A 2BHRA 2N75A 4GOXA 5BYJA 4OLHA 1XF1A 5BYBA 1TZ2A 2GK3A 4U7WA 2QAIA 1ETUA 3FYHA 1KVUA 4J76A 2G5GX 4N65A 1DEHA 3R0VA 3H11B 3NT2A 3KT6A 2HPAA 3IV9A 4J3JA 5TQ2A 1ZRSA 3ZGOA 8ATCA 1XZAA 1C3EA 5F5NA 2P30A 3NBMA 4FC7A 2OD2A 1RQGA 3IBTA 1NYRA 1QDUA 2Z0MA 3EHEA 4K9MA 4EHHA 5BPHA 2E5LB 1ODIA 3BXGA 4P4SA 3QVLA 4TGLA 5KOJA 4NP6A 1SXJA 1P1KA 2QD3A 3BE8A 4UZFA 3DW3X 5JPDA 1GM5A 4ENSA 3L77A 4L5JA 1DTWB 4FR5A 3RSQA 3UWOA 4LXGA 4LECA 4KSCA 4YREA 5B3KA 3ZHXA 4CDNA 1V1MA 1TA0A 1L5KA 3ZEIA 1IJFA 1C4OA 2GRUA 1D7OA 4KE8A 3I9LA 4FCWA 3GJ6A 3VHLB 2JEZA 1BE8A 2G71A 3QPWA 3C5VA 1BCRA 2DULA 2WINI 1VQ1A 2BFBA 3FA2A 2AUMA 4Y2YA 3A0UA 1EGHA 1BVYF 3B6ZA 3LXRA 1Y4DE 1L5LA 4R0VA 1EA5A 2CHVA 1IVNA 1XAGA 3VDXA 4FOLA 1JU4A 1P1IA 1YUMA 1U8ZA 3IDOA 5EUMA 5B3JA 1GVHA 2C99A 4PNPA 2G1JA 1QH8A 4D5EA 1BDMA 3EWAA 4CF3A 4WHMA 3AFMA 4Q3OA 3BMOB 1W0JA 4DPLA 1IEXA 2OXEA 2SECE 4NYIQ 1G2QA 2CYCA 2IDMA 4A2PA 4BQFA 1XZNA 5JY6A 1SC4A 5F33A 2DR2A 3T0IA 2ZIWB 5H16A 4Q18A 3Q0EA 4YA6A 1SPXA 2YFHA 4TXJA 4RBNA 1T5TA 2B4KA 4FFNA 4ZGGA 4HQRA 1QIDA 1XKLA 1W5TA 2GLTA 3RHFA 2PD6A 4ZO9A 4URXR 3NUGA 5HBGA 2EF1A 2EBHX 2WD8A 3C45A 4FMPA 4DLUA 3T35A 3TZ6A 3MYRA 3L8MA 4TT3A 3BHIA 3P4YA 1TF2A 3HJUA 4PXSA 4BCCA 3VGPA 1U8YA 2HA7A 3G8YA 3OCJA 3W9YA 3QMMA 2HJHA 1NSYA 1AKEA 3ZQKA 3NTUA 4MV5A 2QUZA 3DEYX 3K30A 4BZPA 4S24A 4PG6A 1R5JA 2FCAA 2C07A 4C29A 3LECA 2EV9A 2VCHA 3IT1A 4E5UA 4WOCA 3N59A 4EKNB 2PKCA 4PTZA 5A4AA 1NVVR 3F3KA 3V7WA 3TFWA 2IW1A 3ZLUA 1T2EA 1V7CA 4UMVA 1VIVA 4J16C 1Y8RB 3OF2A 3C14C 4UULA 3D3JA 3RKRA 3DH0A 5IDXA 2Z2IA 1FXUA 4ZICA 3IAM6 4BO3A 2HWXA 1CXZA 4FCTA 4BO0A 2PRZA 2IYYA 2CKMA 2A0FA 2DC1A 2GCNA 3LHIA 3RG2A 2UUCB 1DIBA 1Z08A 3EIUA 2R8EA 1E92A 3IIJA 4UVEA 1J0DA 2GAJA 2JAWA 8ABPA 1DGQA 1K88A 5I3ZA 2RAPA 3AZOA 4ARUA 1RQ2A 1G20A 1YJCA 2JARA 2VPWA 3CRZA 3R7FA 5JPIA 4ZI7F 1GZ3A 3KUXA 3RK0A 3QEJA 4ZARA 4BMVA 4E30A 1TCVA 1USGA 1YBAA 3ETEA 4NFSA 1DRWA 3TD6A 1W4RA 2GM9A 3AUTA 4ZCLA 3ZWBA 4RETA 1M8KA 1CQZA 1B8UA 2CWWA 4IS2A 3DQZA 5LXTA 1LY1A 2DBZA 3CW2A 1W48A 1NXWA 1NBHA 1I36A 2D00A 3CN7A 4TX1A 3CSDA 1FMTA 2LBPA 1JPNA 3UW3A 4ZU1X 3H19A 1ONPA 2UUOA 3JZFA 1IJEA 1RWWA 3N70A 2QLLA 2NUTA 4PLZA 2W2XA 2VDQB 2W6IA 1GTVA 3JQGA 1O5OA 3K2EA 2YMLA 3DVAA 3PXEA 3K0FA 1HFWA 4JJGA 2P8SA 2H54A 4HEQA 3WL5A 3ZE2B 5DNCA 2EKDA 5KYYB 1AXRA 1MT0A 2BMEA 4JL6A 1AH2A 5HTOA 4GVPA 1G9TA 1BE1A 3MCTA 5GOTA 1B93A 1LNSA 1H8ED 2NV2B 1KMMA 1IAVA 1VPEA 4G0XA 1KJZA 5TXGA 5CFOA 2IH5A 2ZIVB 4NU8X 3PNBA 4D0LB 4YY3B 2CHGA 5AW7A 3U3KA 2BM1A 3ZOZA 1TECE 4PHFA 3C1OA 1EKXA 3JWGA 3NM4A 4S35A 1Q92A 5AP9A 3A1UA 4HPWA 4EUHA 3EXHC 1JJBA 4JODA 1Q1AA 2R25B 3ECCA 3QMWA 4PC6A 1SG0A 3W04A 1ZWKA 3TTWA 1G5RA 1R00A 2FUKA 1U8XX 1AM4D 2QS9A 3GRZA 3K9QO 4P82A 4YXWD 2X86A 2C29D 1IH8A 1ADBA 3BDVA 2DRIA 1NVGA 1W47A 1L5YA 2HCTA 2I6QA 3FAZA 4KO2S 3D6VA 1V8PA 2ZE5A 1QTNA 2JGNA 1VP3A 3HDJA 2W11A 1Y1RA 4W7IA 3T7AA 2NU9A 2BZGA 2OE2A 4F4JA 2V8OA 4Z4QA 2AOWA 3KSZO 1X9IA 4Q02A 3GEIA 4S1TA 2DT5A 2N9UA 4QM6A 2AI3A 1SA0A 3OPMA 3VR4D 3OQVA 3I9JA 1WE2A 1ENZA 3FDJA 4ND5A 4CMHA 5C32A 5L3VA 4ZTBA 1MAAA 1ADJA 5K8JB 1JTVA 1JHRA 1YJXA 2BH2A 3VOTA 5CYPA 3KU1A 1KIFA 4QRIA 3SC2A 1WRBA 3L40A 1JDPA 4HYQA 1U9ZA 1S2GA 3QF4B 4DRXA 1QCDA 2F1HA 4FBLA 5E1MA 5E6SA 5C7OO 3PEYA 3E7DA 1Y7IA 2VWQA 4GICA 2VYND 4WH0A 3G7SA 4ZKEA 3BCSA 1QE3A 5AK0A 3FWPA 4G5XA 1SWWA 3TR0A 3AEKB 5DNWA 1UKVY 5IN5A 4R9NA 1UC4B 5IC4A 2G67A 1OYVA 1AK9A 2H2WA 5DISB 1LJLA 4GZLA 2XGSA 1ZYUA 3ZLVA 5JY1A 3WL3A 4P08A 1D8AA 1KXZA 2IYWA 2QGZA 2A7QA 3HN2A 4ETNA 1NF2A 4Y3UA 5JCZA 1C0KA 1E96A 1I2DA 1XYGA 2HK6A 3IKJA 4BQOA 1DBWA 5EIEA 3QVUA 4KQEA 5E6SB 3SBOA 2O5VA 3HV2A 5EMMA 5LNK6 4GLOA 4UVDA 3NKLA 2ODTX 4GYJA 3V4SA 4O2AA 2X0EA 2RHCA 5H80A 1HL7A 5SICE 2NU8A 4EGFA 1K5DA 1FP1D 1DKNA 2XTJA 1JQAA 3FPHA 2QUIA 3I92A 4Q7JB 4F6CA 3RBZA 5JJBA 2HDWA 2I4NA 4LSMA 2IHKA 1Y4SA 2VTBB 1ZUD1 1G5TA 1GAEO 1JQKA 1NN3A 2OC9A 1WW3A 2IOYA 2RHGB 3O2SB 3WE7A 5IAKA 2QB5A 3CZ5A 2IHNA 2PWPA 1FZTA 5J3JA 4NBWA 2GDJA 2C5HA 4EP1A 1XJQA 2RHDA 5FTKA 1UIRA 3RARA 1Q91A 2VTDA 4F4FA 5HQJA 2RAUA 2C3YA 2GPNA 3KL2A 1KRXA 3O4VA 1L5FA 5AIAA 1E18A