4IJWA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) in complex with 3-[1-(4-chlorophenyl)cyclopropyl]-8-cyclopropyl[1,2,4]triazolo[4,3-a]pyridine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Optimization of 1,2,4-Triazolopyridines as Inhibitors of Human 11 beta-Hydroxysteroid Dehydrogenase Type 1 (11 beta-HSD-1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2012-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ijwA00
1H6DA 2EKQA 3EC7A 4B4OA 2ILTA 4L73A 4QSMA 3ASUA 5F3RA 3WJAA 1MB4A 1P33A 1EQ2A 3IQDB 3DAFA 3VKVA 2NVBA 3GAZA 3DMTC 3ZHBA 1LTHR 5A9TA 4IDCA 1ONOA 4O0LA 3PEFA 2HMUA 3G0OA 3OFSA 2DKNA 4OXNA 3GN1A 4XGIA 4BKOA 3BMCA 4BNXA 1Y7TA 3FHLA 1M76A 3Q1LA 4GVXA 1C0KA 4YACA 3JYLA 5EJ2A 1H94A 4CL8A 4UEJA 1NTOA 3D1LA 1ZK3A 2FHSA 2CVZA 3LU1A 4KOAA 1UP6A 1ID1A 1E5LA 1WMBA 3NJ4A 3CMMA 4U7WA 3IP1A 3MJSA 3W4IA 4WLOA 3GQVA 3PHIA 1SO8A 3JQ8A 1C14A 4LISA 3CTMA 5C3MA 3DONA 2BMAA 3HZZA 4DLLA 4DC1A 1AN9A 3HJAA 2YY7A 3KSZO 4ND5A 2AXQA 3V1YA 4WKGA 2AHRA 5JXWA 2UYYA 1NM5A 3BA1A 3NJ8A 5L53A 2BHLA 2HU2A 4RLSA 1XELA 3HFGA 3L6OO 2HMWA 1MC4A 2UUPA 3OJ0A 4Q3BA 4MPDA 4IDEA 1HSOA 2FY8A 4DMMA 4L4SA 3H9QA 1NWHA 4Q3EA 3TPCA 4WNCA 4FIZA 1HDYA 3ZNQA 3RUFA 1E1NA 2IXBA 2Q4EA 3VAZA 2B4RO 3WGIA 1E7MA 3FRJA 4JJIA 1PL6A 2VUSA 4Z3DA 4OKIA 4XR9A 1A5ZA 4M1QA 1BHSA 3PHGA 3QSGA 3RFVA 1UXHA 4BQRA 3KLPX 2GPTA 3KTDA 3PYXA 3OH8A 2VT2A 1G1AA 3AU9A 4OXKA 4QEDA 4AICA 4GMGA 3NTOA 4YCAA 1EVZA 4RVHA 5T64A 3TOXA 3DZFA 4HFNA 5G0VA 3WYEA 3LC1O 3UKOA 4CM8B 1QMGA 5ILGA 4BNLA 2D2IA 1BXGB 2Q50A 3WFJA 3SEFA 3KETA 4FC6A 3H6KA 4EYEA 3U4CA 2BGLA 2R2GA 4OGWA 3RASA 3CH6A 1X15A 3LQFA 3DZJA 4CR6A 5G0TA 2BKAA 2FR1A 1YRLA 3DXFA 1IUKA 4PLWA 3DBRA 3AUAA 3GLQA 1CETA 3VPGA 3F3SA 4DBVO 5KJEA 5JYDA 1GPDG 3SJUA 4Z9XA 1HDCA 3FTPA 1XR3A 2HAEA 4R54A 2VNAA 4PVDA 5JCJD 2YHUA 1UAYA 5DCWA 1I0ZA 3L07A 4MIOA 2FRDA 3OIDA 4K6FA 4I9UA 1WZIA 2VHXA 2IZ1A 5JMPA 1WPQA 2PK3A 1EZ4A 1N9GA 1N92A 1BDBA 1GV1A 3FF4A 2JFGA 3ENKA 3F1KA 1FDWA 3QLJA 3KYBA 3RVDA 2EJVA 5HM8A 4CM4B 3DTYA 2PWZA 1OFGA 1LJ8A 4BKRA 3ZHZA 1IZ9A 1GR0A 1FXSA 2EP7A 3TN7A 1ISMA 3BTVA 4E31A 2EWMA 4CLOA 1UAGA 4IJKA 4R01A 5T57A 5IG2A 5BNTA 5F1OA 4K1LA 5LCXA 3BMQA 5ITWA 3U4DA 3O26A 3F9IA 4L4RA 1GZ3A 1LLUA 2JHGA 3E5RA 1U8XX 3HDJA 4YPOA 1HDOA 2OL4A 2QIOA 3BMQB 3GUCA 1X14A 3IP3A 5IN4A 1V6AA 2PKRA 4GKVA 2ZQZA 1PS8A 1P44A 5EINA 1RM4A 4XX0A 2VYVD 3UN1A 3QVXA 4URFA 3CSDA 2YHIA 3QJ5A 5AXBA 4GLOA 1DLIA 2VWQA 2YHIB 3QWIA 3GGGA 3L9WA 5DT9A 5TJHA 1DIRA 1XEAA 4Z9FA 1JLLA 4AL4A 4LCJA 5ER6A 4X54A 4CMKA 4CV1A 5B4UA 2P9EA 3VKUA 2QYSA 3LT0A 3VTFA 4R3WA 4MP8A 1A72A 1RM0A 1YQDA 4B8ZA 1OBFO 3D4NA 1ZEJA 1BMDA 1WDLA 4F3YA 2ZCUA 4DIOA 1T25A 1JVSA 3JQAA 1LX6A 3WNQA 4D3SA 2Y99A 1KETA 4HY3A 1QRRA 4RCVA 1V9LA 3GK3A 5BR7A 2Q2WA 1UH5A 3PGXA 1HDGO 4OJNA 4G2NA 5JAZA 2BLLA 4E13A 3TZKA 1GFSA 2OP1A 4Y9DA 3WB9A 3TZ6A 3ZCXA 1F12A 1T4BA 4RF2A 4XYLA 4XYEA 4B79A 4XWYA 2GSDA 4JJGA 3AJRA 3UVEA 5BT9A 3ZV3A 4W9NA 4ALMA 1LLCA 5KJ1A 5EERA 2C2YA 4JX8A 4UUOA 4AJOA 4E2XA 4EJMA 1U7TA 5JDIC 3G17A 4OXYA 1C1XA 4QECA 1Y8RB 3GVCA 3GEMA 1Y1PA 4HV4A 4XIJA 1HE3A 2E48A 1U1IA 1ZFNA 2AQ8A 4K6CA 4Q39A 5TS3A 1H9AA 3EAGA 1O95A 1YBMA 4FJ0A 3DZGA 4A27A 5L95A 4LRTB 4BNFA 4E5KA 1ZIDA 4F6CA 2VWGA 4YT4A 1TT5A 1LQUA 1CEQA 4XEHA 1XGKA 3KLMX 4BO3A 4BNGA 5I7FA 2PLAA 1W8DA 4LVCA 4FOOA 5KWEA 4MIYA 3TOZA 3ZI0A 3DZIA 3QWFA 1WMAA 1DIBA 4BMNA 5EN4A 1HZJA 4A03A 4PLPA 2GDZA 3AWDA 4J4BA 5BQFA 1YB1A 3WXBA 1NVTA 2VZ9A 4ZQEA 4K28A 3C7AA 3R3JA 4YT8A 5CG2A 3I4CA 5JS6A 3ONEA 1NHGA 1V35A 4BVAA 2W90A 2Y66A 4JK3A 1LNQA 2EERA 5AXDA 4W82A 5IZCA 3WIDA 4XCVA 4GX2A 1DAPA 1R0SA 3OQ1A 4Y6PA 3BTOA 2Z1NA 4D0RA 1GEGA 4E5PA 1HE2A 1T1SA 3IKVA 4WEQA 3ANLA 3LK7A 2QQ5A 1T2FA 2D8AA 3I9NA 1U8FO 3DDNA 3B1KA 4AG3A 4CMAA 4YR9A 1CYDA 2UUOA 4J90A 1AE1A 2VOEA 3FR8A 3GDOA 3GVIA 4AJNA 4E2YA 3D5TA 4I08A 2X1HA 4XZ3A 5JDIA 1P45A 3GOHA 1LDBA 1DIAA 2YUTA 2QRJA 3JQEA 2ZKLA 4ITUA 1K6JA 1I3MA 2GLXA 1K5HA 1UZNA 2Q1WA 2NTJA 3VPXA 1BW9A 2VYND 2C7GA 2HMTA 1O9BA 4NNJA 4FBGA 3GG2A 3SVTA 1E3WB 3QVWA 2NVUB 1Z75A 1T2EA 4JGBA 5DF1A 3KM0A 1GCOA 1XSEA 1PJQA 3BIOA 1VM6A 1TVEA 4Z0HO 4YAKA 2IZZA 4NBVA 3TWOA 3ZHXA 1A4UA 4GBJA 5KJ6A 3OM9A 4I9NA 2UAGA 4EUFA 3VDQA 1QYCA 4WGGA 3AUUA 5JW6A 1XIVA 1LLQA 1E3LA 1NBOA 5DDIP 4AJ2A 6ADHA 2PD6A 3GNSA 4IUYA 1YO6A 5G4KA 4PZEA 4Z9YA 1C0LA 3K96A 4BNTA 1HLPA 4Y98A 2XXBA 1O0SA 2YV3A 2ZJ1A 4R5HA 2GZ1A 3B20A 4GPD1 3H7AA 1CQJA 5A5EA 2HUNA 2C7VA 1LI4A 2GCGA 4QXMA 2VOJA 2VHVA 4FFPA 2PD3A 4H16A 4WOKA 2ET6A 3TRIA 2Y05A 2OFPA 2JCYA 2AEMA 3NDIA 1GYRA 2RHRA 4ZICA 4KUGA 1TEHA 4W6ZA 1OI7A 4DWVA 3RQSA 3PJEA 4PGFA 5IAAA 2EW8A 1C0PA 4KDEA 3T4XA 3KSDO 2VN8A 2JHFA 4OH1A 4G5HA 3U9LA 4J7XA 2DPGA 3UCXA 4CLRA 4FFNA 1P3DA 1RKXA 1LSOA 3AI2A 3FWZA 1P0CA 3H2ZA 2UV8A 1E7RA 4TKLA 3WWYA 5KIAA 3IL2A 3TSCA 5EQDA 5LC1A 4YQYA 4HP8A 1EE2A 3EVNA 2P5YA 2DBZA 2DTXA 4CQMA 5L45A 2X8LA 3A14A 4LGVA 4ZJUA 2YDYA 2NTNA 4KWHA 3NDJA 4RF5A 3WS7A 1AHIA 3WGQA 1KY4A 3X2FA 5C7IO 1Z82A 4LN1A 3RUDA 1LRJA 5H83A 4W7HA 2OXIA 3JYNA 1DHTA 5B37A 1PJSA 4EEXA 3ZWXA 2OZPA 2AEJA 5IXYA 1X0XA 1MV8A 3AY6A 3QW2A 4MVJG 5K6AA 4FJ1A 4Y8VA 1DRWA 4TZTA 3IAHA 1SEPA 2VHYA 3UAGA 2DM6A 3PRJA 3QVOA 3E82A 4ALJA 1PU2A 4J91A 3VZPA 4CMHA 5JMWA 3MCVA 1ZZEA 2QYTA 3W8FA 1YWGO 1JAXA 1RJWA 3E5MA 4TSKA 5A5FA 1A7KA 2HK7A 4PZDA 3K2BA 2YFHA 2DFDA 4GQAA 1GYPA 1PJLA 2EG9A 1GQYA 2F00A 3ANMA 1Q1NA 3JQBC 3EVTA 2OHXA 4J6FA 3SJ7A 3G79A 3NT2A 3DOCA 2B35A 2W4QA 3JYQA 2EP5A 5C37A 4L75A 4XB1A 1KBZA 5GMOA 1MP0A 4IDBA 4NHEA 2HRZA 3H4VA 4TROA 5KVQA 5CDSA 1A27A 4DPLA 1PR9A 1OAAA 3G1TA 3KYCA 4DQXA 5GZ1A 1DOHA 3O8QA 1A9ZA 3OIFA 5L51A 4L8VA 3KBOA 2YQ5A 1P1FA 3U3XA 3DB2A 5L7YA 1L7EA 4E30A 2R6JA 2ZB7A 3KEOA 1SOVA 3F1LA 3RC9A 3U4HA 4N5MA 4D43A 4MO2A 2P9CA 4M8SA 5TGDA 5I9NA 4AJIA 3OEYA 1Q2XA 3UHAA 2VTDA 3D3WB 3GMDA 1ISIA 4IJVA 2I65A 3S2FA 1U3VA 3FBGA 2AQKA 3ASVA 4AJJA 5U4QA 3ETEA 4BO7A 4TQGA 4QTZA 3F4BA 4YA6A 1YB5A 1UZLA 3FCOA 5G4LA 1SOWA 3ZWAA 4OYRA 1Q7GA 3A9WA 4BMVA 1QXSA 2W2KA 1D1SA 2XAAA 5ER9A 2WMDA 4BB5A 3LVFO 2E4AA 4DVJA 4IY1A 2DT5A 1QR6A 4MJLA 1NP3A 3AU8A 1DBVO 4E5MA 4JP3A 3BYZA 3DBLB 5I7VA 4E33A 2X4GA 2O50A 4BHTA 2D59A 4UUPA 1U2GA 4I9HA 2RH8A 1P1RA 4KUHA 4RVSA 4ID9A 4HADA 1GY8A 3K5PA 4UEOA 4YJHB 3ZWBA 1E6WA 3NEPX 2X23A 1P31A 1LSUA 3IUPA 5MDHA 1M6WA 3JD3A 4H3VA 5TSDA 5KJCA 3HFSA 1WDKA 3DMYA 3W4JA 5AXCA 3TL2A 1EUCA 9LDTA 3RUAA 4XGKA 1UDCA 2D0IA 4XB2A 3JQAB 4MINA 2CDBA 4DLBA 1ZW1A 4DGSA 3JQDA 3QRWA 4BNVA 3UW3A 4N5NA 2NNLD 1ENZA 5A1TA 2E37A 4AVYA 4PLYA 4XGNA 3WYBA 5BSFA 4WK6A 5JFOA 3WGGA 4D46A 1LA2A 4D41A 1T2DA 3PZRA 4FFLA 2YYYA 3BMNB 1Z74A 2DPHA 3NDRA 3VVCA 3LZ6A 4MVJF 3JQ9A 2AW5A 1DRVA 5DN9A 2Q99A 2O3UA 1PJBA 2B4TO 3Q9UA 5JY1A 3BMNA 3WMXA 3U5TA 1WWKA 3S8MA 4IQ0A 5CPBA 4FSHA 3HHPA 1M66A 1QLJA 5JO0A 1GAEO 5JSFA 3GF4A 3R0IA 2QZ9A 3FTNA 5T67A 1X7GA 3I9JA 4JCOA 4CR8A 1GQQA 1MC5A 1EK6A 3KO8A 1GQ2A 2D5CA 3WSVA 2B4QA 2YV1A 1LC3A 2CVQA 2FN7A 3DFUA 4NPCA 4Q3DA 1GD1O 3ADOA 1H93A 3WBFA 3WSWA 4RO0A 3IC5A 4PRKA 1R37A 4XA8A 3WLEA 3WDSA 5K0ZA 4P38A 3GVHA 1CRWG 1IPEA 1ZO8A 2PZKA 5BNIA 3G49A 4XQEA 1ZVMA 4CMIB 2VUUA 5C5IA 4RV9A 2H6EA 3RFTA 3OJOA 2AQHA 1SEVA 1P77A 4E5YA 1EK5A 3WQQA 1W73A 2B36A 1R66A 3Q9NA 1OZAA 2I9PA 4DRYA 1R6DA 4EDFA 2WWRA 5IDXA 3H5RA 2ZCVA 3PLRA 3STHA 5JAMA 3FNEA 5IJZA 1N1GA 3DOJA 3ZH2A 3JQ8B 1HETA 1E7WA 5T6BA 3F47A 2HO5A 4MVJD 2G76A 4E21A 4ESOA 3TDKA 3TZHA 4BKQA 1ADCA 3U09A 4U0JA 1TLTA 4E32A 3GG9A 3KYCB 3O8QB 5JAIA 4CV0A 1TXGA 4J4TA 2YV2A 2O3TA 4M87A 4BO1A 2I5PO 5IXSA 3F46A 3IS3A 1GZ6A 3NKLA 5B12A 3PJDA 2VZ8A 1YGYA 4IDFA 5DBFA 1R12A 5JLAA 3INRA 4D79A 2XOXA 3HN2A 3F5QA 1C1XB 3JQ9C 2PZMA 3D64A 2VRBA 2ZATA 2BF7A 1G0NA 2CF5A 4YQZA 2FMUA 3ITDA 3O9ZA 4CMCA 4IGFA 5C7OO 3GUYA 2EKLA 3SBOA 4CQLB 3G1UA 3PQEA 3GFBA 2GRAA 3PYLA 1YBVA 4NMHA 5B4VA 4S3MA 2DBVO 2PH5A 3FD8A 3P2OA 2J6IA 2W2LA 1LDEA 4U0KA 3LLVA 2WD8A 2O4UX 1E3WA 1KC3A 4IDDA 3PZBA 2W8ZA 2HMSA 3V1TC 3OIGA 1HL3A 3ZV6A 1M67A 1X0VA 2PV7A 1X13A 2AG5A 3Q11A 5JC1A 4HUJA 3MJVA 3D4PA 2ZB4A 2DU8A 3ZWCA 1I36A 1QKIA 1R0LA 3UGKA 1B16A 4Z0TA 5TF4A 4CMEC 1P1IA 3KB6A 2VHWA 3RC2A 2B83A 3O38A 4HFRA 4DBZA 1KEUA 3DHEA 4BNMA 4RF3A 3WJ7A 1TI7A 4IM7A 3RD5A 1KY5A 4BUCA 3ZNPA 3JQCA 3QWBA 4OIMA 1PS0A 4NJMB 4XQ9A 1I2CA 4NR0A 1XHLA 5CAEA 1YQGA 1J6UA 1YQXA 3E8XA 4WASA 1HTBA 4ZQGA 5THKA 3RSHA 3X2EA 4II2A 1AXEA 1UJMA 2VT3A 4HNGA 3GHYA 5TX7A 4BNHA 2RBEA 2D1YA 1T26A 4EZBA 5KNLA 3FSRA 5MGBA 1Y5RA 2BI8A 3R3SA 2IE0A 3CIFA 1U5AA 2JAPA 4L4XA 4CMEA 4YXFA 3QY9A 3PFFA 4PLGA 4CLOB 2O3JA 5U1PA 1WDMA 4E5NA 3AOEC 3FWNA 3KV3O 2WD7B 1ENYA 3I9MA 3WQRA 4IZHA 1I5RA 1OMOA 2J5QA 4J1QA 4Q3CA 1YOVB 1FDUA 1UR5A 4MDHA 1IZ0A 2EHDA 1F06A 1Z73A 1XYGA 4LMPA 5I9LA 4DQVA 3GEGA 3JQAD 5ES3A 4AJHA 2GZ3A 3OA0A 5A05A 1E77A 1QV6A 2GUGA 4OAQA 4NK5A 5IDWA 4BNJA 4MVJE 2PY6A 4CL3A 1VJ1A 5COQA 4IS3A 4PCVA 3HB5X 3QWAA 4ILKA 4IS2A 2Q2QA 2TMGA 4DC0A 2FPPA 5ICMA 1L1FA 2HK9A 4QO7A 1XU9A 2VRCD 1CIVA 2PR2A 3W1VA 2CNBA 2IXAA 4R69A 4IQGA 4R1SA 4MKXA 3WG9A 4PZCA 1U7HA 1I3KA 3C1TA 1QV7A 4UUNA 4IQ8A 4B4WA 3JD2A 3OICA 4NU5A 3NYWA 4GL4A 3WLFA 4M55A 4OOFA 1LUAA 4UVDA 4KTTE 3PWKA 2D4AA 1ENPA 1JWBB 3GY0A 1O5IA 4J4HA 4D45A 1J5PA 4YJFB 3IJRA 1ZCJA 2ZQYA 1KEWA 1ZMTA 3GT0A 1O8CA 3PIDA 2X86A 1Z6ZA 5JCJA 3VPFA 4YWJA 3RAJA 5HBRA 4W7IA 4XYGA 5K9ZA 4OQYA 4KTVE 5L7WA 1Q7CA 5JNLA 4PVCA 3MZ0A 5A3VA 1EUZA 4ZQFA 2TMDA 3UCEA 4FFOA 1NQOA 1NFFA 1QG6A 1MXFA 1W0CA 4PRLA 4XIYA 2Q45A 1Z7EA 4D44A 5EIOA 3R1IA 4PLTA 1NX6A 2DLDA 1YS4A 4WLVA 4M49A 3B6ZA 4CMJA 1PZGA 2HDHA 3DL2A 3FI9A 1MLDA 3LLSA 3NGLA 1PR3A 3GZ4A 5JC8A 3JQBA 4BQPA 2ZB3A 4TMFA 3JCZA 2GERA 3BTSA 2Y0DA 2I3GA 3MJTA 3ZV5A 4CV2A 3HQ4O 5C7LO 1JTVA 1E6UA 3RU7A 1IHXA 2P9GA 2P2SA 2HKIA 3AFNA 4DYVA 3AOEA 4A10A 3D3WA 3ONFA 4WLNA 3WIEA 1U4SA 2B5WA 3M1LA 3U49A 7MDHA 4II3A 1MX3A 4LVUA 2G1UA 2CDCA 3PQDA 3VC7A 3NRCA 4BO6A 1PWXA 1CQIA 2Y0EA 2DQ4A 4U5QA 1E3SA 1MG5A 2D5AA 1EDOA 4WPGA 5TT0A 1KVSA 1RYEA 2ZB8A 5TT1A 5ITVA 2DC1A 5AYVA 2O2YA 1DJQA 3UUWA 4WCFC 4CM8A 4F6LA 1VL8A 3OEWA 5AOVA 5G2OA 1V3UA 3HG7A 1PSDA 2J3HA 3GAFA 2H9IA 1ULSA 3ZU3A 4RPHA 1HDZA 3ZNNA 3OMLA 1LXCA 4OOEA 1VPDA 4DXHA 1KVUA 3QQPA 5DNAA 3K30A 2YQ4A 2C5EA 2PGDA 1NFRA 5KKCA 5EESA 1B3BA 4IPTA 1V3TA 1C3VA 2AQIA 4FOSA 4GVLA 2FR8A 5IFLA 1NVMB 3GPDG 4HBGA 3W8EA 2V7PA 4J3FA 1E6EA 3CXRA 5A3JA 1Y8QA 1PTJA 3GC6A 3L4BA 3WGTA 5U9CA 2AMFA 2DTEA 4PLHA 5FWNA 1G6KA 4YT5A 2VYNA 1X7HA 3E9QA 3S2GA 4P4NA 4UULA 3FN4A 2F1KA 4IBOA 2PGJA 4QX6A 2BD0A 3ULKA 3DHNA 5KJFA 2SCUA 1LDGA 2VTEA 4NK4A 3RC7A 3R6DA 1B7GO 1LDYA 1S7CA 3S2IA 4HWKA 4D3DA 3IKTA 4BOYA 3ENNA 1R4MB 1DIGA 4ZU3A 5JO9A 1U28A 1GUZA 1MXHA 4DLAA 4A2CA 4E3ZA 3LDHA 2WYUA 5G0WA 1YONA 1NQ5A 1LLDA 5CPFA 2CVOA 2H1SA 2OMEA 1LDNA 3ICPA 4RL6A 3C7CB 5DBIA 3MJCA 1TA4A 1MA0A 3E18A 1HRDA 4EEZA 1NXQA 5H81A 1KS9A 4PIVA 1WZEA 3LSYA 4FN4A 5JPIA 2CD9A 2V6MA 4NJOA 4RPLA 5G4KB 3LT2A 2GF2A 3HWRA 4E2ZA 1T24A 4MVJH 1ISGA 4CUKA 5COAA 2EGHA 3EDMA 4NDNE 3LT1A 4IJWA 3GZNB 1SAYA 1B2LA 1EBFA 1YVEI 2C20A 5F5NA 2I3AA 1UXIA 3ABIA 1U4OA 1R4NA 2WSBA 2Y0CA 1JKIA 5HS4A 3UICA 2DAPA 2J3IA 4YAGA 3IIEA 3EUWA 2V65A 3RKRA 3GGOA 3VTZA 3IMFA 4AJ1A 4RPKA 2GO1A 1E1KA 1DC6A 3QHAA 3I9OA 1LRKA 2BELA 1DLJA 1DB3A 2DFVA 1O6ZA 1DFHA 4GWGA 1YDWA 2GYYA 3PI7A 4Q9NA 4RDHA 4L0QA 3VHRA 4BNIA 4YRAA 1LSJA 2B69A 2O2SA 2HLPA 2BGKA 1IY8A 2OOSA 3PHJA 2GNAA 4B3HA 3GN2A 3QP9A 3SLGA 4GH5A 3PJFA 4RZIA 2J5RA 4ZA2A 3DBHA 2VYVA 1GEEA 2IEDA 4LSMA 4O6VA 2BRUA 2IEBA 4YTEA 2QX7A 4UVHA 1GZ4A 4R16A 3H9GA 1D1TA 2OUIA 2A92A 1X1EA 1AXGA 3WTCA 1EEHA 1H6BA 3I6IA 1N7GA 4IZIA 3VOSA 4YJDA 4A0SA 3QIVA 3SXPA 4FR5A 5DZSA 4WLEA 4YYZA 1WAMA 2IYPA 1BXGA 1NPYA 2C2XA 2GR9A 2QW8A 1G0OA 1EBUA 4PG6A 4JXKA 2JAHA 2QRLA 4CMIA 3ZWNA 2RCYA 1IE3A 3NV9A 1FK8A 2C29D 3W6UA 3ZW8A 4XQGA 4ALLA 2NV6A 2X58A 4BKPA 3L6DA 2X22A 3GNTA 4TZKA 1DHRA 4MKRA 1I24A 3EZYA 4JN6B 4H15A 2P91A 3Q2KA 4RVUA 1HYEA 1ORRA 3EY4A 4OHUA 1IYZA 5HRUA 1B8VA 4FS3A 2GN4A 2VWHA 1MG0A 3T7EA 4HKTA 5CEJA 2Z1MA 2O3QA 2ZYDA 3MWDB 3DBRB 4J2HA 3RWBA 5FEUA 3WTBA 2PA3A 4BO4A 1K6IA 3Q3CA 3E9MA 2GD1O 1JQBA 5DCYA 4U6QA 4GLLA 5JE8A 1DXYA 2WYWA 1FF9A 4GGPA 2VNSA 3EW7A 1T2CA 4RORA 2Y68A 5G0SA 1FDTA 3TJRA 1C1DA 1K6XA 2ZTMA 3N74A 3M2PA 5EPOA 3EZLA 3U4IA 3LC2O 1K3TA 1DFIA 1E7QA 3ONDA 1RM3A 3VVBA 4WE3A 5JCXA 9LDBA 5L9AA 3WQSB 2WD7A 5JAQA 5TLSA 1Y9AA 1DJNA 2P4HX 4N7RA 5L3ZA 1PIWA 1ZJYA 2CF6A 1ENOA 2J8ZA 1ADFA 4J2OA 3V5NA 1EFLA 4CLHA 3L9XA 3QVSA 2Z95A 4R3NA 4IXTA 3EK2A 3VH1A 3DAGA 3HN7A 2DBRA 2W2KB 5L40A 1P1HA 2RAFA 5THQA 4ALKA 4Y67A 3H5AA 4R4JA 2EIHA 2RIRA 3DWFA 4XJSA 5A06A 3K92A 2Y1FA 4JJFA 1YL6A 3K31A 2Q2VA 1JA9A 3D4OA 1KEVA 1ZEMA 3F5SA 1Y9EA 3FNHA 4NFYA 4ZVVA 4DUPA 1I3LA 1B15A 3PDUA 4JQCA 3HUDA 3OF2A 4FD3A 4TRJA 3ZNOA 2I67A 4C4OA 1SNYA 3CEAA 3U0BA 2B0JA 1H2HA 4MKZA 1HZZA 3HDYA 4CM1A 4YB8A 2X0IA 3AY3A 4PG7A 4J7CA 4YAIA 3WX0A 4O1MA 1GV0A 4JBHA 4HFMA 5FI3A 1I32A 1RM5A 1E92A 1I01A 2GGSA 1NR7A 1DC3A 1EE9A 4CM9D 5TJ9A 4GX1A 1YXMA 4TVBA 3ROPA 5IZCC 2R00A 2ZIZA 4B8WA 1QYWA 3INGA 3K6JA 4KMSA 1ZJZA 1XU7A 3DZBA 4JBGA 1A9YA 1PGOA 4WOJA 1JVBA 3N7UA 1F17A 1PJCA 4J1SA 4EUHA 2ZTUA 4DIFA 3M2TA 1XWFA 4FGWA 1E1LA 2X9VA 5FFFA 4P4LA 2O7QA 2NLOA 4G81A 2WYVA 3CKYA 2XPCA 2V6FA 3VZRA 4BO5A 4UVIA 1I2BA 3ZWMA 3N58A 2PNFA 3KVOA 4PLVA 3VH2A 1DC5A 1PX0A 4J43A 3GR6A 1FMCA 3SLKA 3ZWPA 4A73A 5BSHA 4CLDA 5KOIA 1E7SA 3DBHB 4R1TA 1N2SA 4QFDA 3GRPA 4R9SA 4CUZA 2NU8A 5KCZA 1Y5MA 2NSDA 4MVJA 5B4TA 1NPTO 2CY0A 5T8KC 3RIHA 3WYCA 4HXYA 3C1AA 3OQBA 2NQ8A 2O3RA 2O7SA 3JQGB 1R15A 1GUFA 3D3EA 2JFHA 1GYQA 5ENDA 5ENVA 3W4KA 4RQUA 4OMUA 1YJ8A 2EF1A 4DPKA 2VQ3A 4I1IA 1WLYA 2Y1DA 5JY6A 2CDAA 3OHSX 1PGJA 3JQGA 5L4NA 1VSVA 2X6TA 3BZUA 5FYDA 3UFXA 3FNGA 3UOGA 2OP0A 4P22A 5BNFA 1ONNA 4OL9A 3DAPA 3E03A 2Z5LA 1T2AA 5LDGA 3ORFA 4IDGA 4FW8A 2PKQP 4YVFA 4XYBA 2DVMA 3HADA 2NQTA 3TNLA 3B70A 4NFSA 3H65A 3JQ7B 3VPSA 3VH3A 3GA0A 1HT0A 1K89A 5JYEA 3DFZA 1YH3A 4FFMA 1T4DA 4CR7A 1Z7BA 4I5FA 4I5DA 4GMFA 2QHXA 1B0AA 1PS9A 1DIHA 4DMLA 4ZRNA 4CODB 5CDGA 3BAZA 3AW9A 4XJTA 1PL7A 1Q0QA 2Y1EA 4TWRA 2NUAA 1O89A 4ZD6A 3PLNA 1SBYA 1HWYA 4BV8A 1R0KA 1ZSVA 3O4RA 3QA9A 4CM5A 3P5SA 2O4CA 1ZBQA 4ONEA 3K8ZA 2W2LD 3ZGYA 1W4ZA 1FJHA 3JQFA 3MTJA 4UEKA 1HLDA 1PJ4A 4EITA 4DPMA 1DC4A 4RPJA 3P7MA 4AJKA 3ZN2A 3WOHA 2IZ0A 1IL0A 4RVDA 1UP4A 3RBXA 1UXJA 4IMPA 2J5KA 3B1JA 4NFHA 3OQ6A 1X1TA 2I6TA 1EQUA 4N18A 3ZWWA 1QYVA 2YFQA 2BFPA 1P74A 1JW9B 3PVZA 4PG4A 4ND4A 5F1KA 2V6BA 1NFQA 4DA9A 2ZK7A 4KZPA 3SX2A 3K9QO 2GZ2A 2X7HA 1BVUA 3BMOB 1JAYA 1KVRA 3DZHA 4I8XA 1DFGA 4ZRMA 7ADHA 5HA5A 3ZWVA 1IPFA 1R16A 3UH1A 4TKMA 2YW9A 2EW2A 4C7KA 1P0FA 2GN6A 2DTDA 4D7AA 4D0SA 3PDJA 3CINA 4KP7A 5A04A 1QORA 4L9RA 5F21A 5J23A 1YKFA 4FQ8A 5H82A 1JWAB 1B8UA 4MVJP 4PG8A 1U5CA 3I5MA 1Y81A 4R51A 1CERA 3H3FA 1E3EA 3IDSA 4CQMD 5A03A 3VZSA 2A94A 2CMDA 5I9MA 3ICCA 2LDBA 1ZK2A 4OSPA 4UVGA 1HE4A 4NBUA 4W9NC 1I8TA 3OSUA 3IOYA 3MJ4A 1W6UA 1VC2A 4GSKA 3PPIA 4WJZA 1ISFA 4RJTA 4KQWA 3HDQA 3K2EA 5DCUA 3QE3A 4B7CA 4M86A 1FDVA 2Q1UA 3COSA 1F14A 5A4DA 3F4LA 3MJEA 2OORA 3DBVO 4LRSB 1YJQA 3DO5A 2VWPA 1EMDA 4A26A 1QYXA 1VLLA 1E3IA 2EKPA 1L7DA 2P4QA 4YEDA 1R4MA 2I66A 3OJFA 5KVVA 1Q0LA 4A5OA 1UXKA 2BFAA 2WM3A 1UZMA 1XA0A 1QSGA 3WGZA 1D8AA 4MP3A 6LDHA 3AFMA 1ZKMA 4ALIA 2Y1OA 2OO5A 4NI5A 4R41A 3WGOA 4B3JA 4KUEA 2X9NA 3OBBA 1NQAO 5TRTA 4NH4A 2O48X 4DL9A 5AXAA 1I10A 1N1EA 5CEFA 1RWBA 1PEDA 3FNFA 3WGHA 2A35A 3E48A 1BXZA 1S6YA 3KYDA 4OKNA 3I83A 2E6UX 1NWCA 1ML3A 1DRUA 4BS9A 4B7UA 4QUKA 2HMVA 5A02A 3KYDB 5CDYA 4BNUA 4FJ2A 1NYTA 4RQTA 4NBTA 3C1OA 5IN5A 4XKJA 1TB4A 4B3IA 4HNHA 5DP1A 3M6IA 1IHYA 3Q6IA 1BTOA 3V2GA 4U6SA 3I9KA 1BWSA 4R68A 1ZSNA 1H9BA 3PP8A 1R4NB 3D5QA 4O59O 4E2WA 4A7PA 3AK4A 5DOZA 1KEPA 3DOOA 3KXDA 1DAOA 4YJFA 4ROSA 4BL5A 2Q3EA 3HNPA 3RUIA 2X9GA 4EJ0A 4BO2A 5FI5A 1LEHA 5KVSA 1NVGA 3KZVA 1U3TA 2HCTA 5CDTA 3H5NA 4TVOA 4Y6SA 4TRMA 1GTMA 3GRKA 1B3RA 4WCFB 1DO8A 4FDAA 5GY7A 3TQHA 3ADPA 4RGBA 2NWQA 5HWSA 2P68A 3MTGA 3OA2A 4CM4A 1J49A 1UDBA 4NBWA 3WMWA 5EL0A 2ZTLA 1LRLA 2EJWA 4CM6A 1N5DA 3LT4A 4CPDA 1ZSYA 1ARZA 4MVJM 4PLCA 4I5GA 4ZHSA 4BNZA 5HTOA 3VZQA 1XDWA 3GEDA 1P1JA 2GASA 4W99A 1QLHA 2YDXA 4BNNA 3GVPA 3KSUA 4JIGA 1PZEA 2CUKA 2I99A 3C8MA 2JL1A 4UUMA 4PFJA 3A1NA 3HB4X 1E7YA 3H8VA 1ISJA 4O63O 5FF9A 3AUTA 4GX5A 3AM4A 4PLZA 1NAHA 1CDOA 3L0DA 4R5MA 3ST7A 2J3KA 3KEQA 3EYWA 4JROA 2JFFA 2QRKA 4W4TA 4QQRA 3NTRA 3TZQA 3LF2A 4J0EA 4BB6A 3GH3A 4JLWA 3UXYA 4CM3A 2W98A 1U2DA 4KWIA 4N54A 4P8RA 4YAEA 1J0XO 3L4SO 4WUVA 4XRGA 2RH4A 1XG5A 1RYDA 3VDRA 5CHEA 3ZZNA 4IIUA 2AG8A 3Q0EA 1ZMOA 3DBLA 1B14A 4GI2A 3UF0A 3INTA 3ZDFA 1KC1A 5TIIA 2GN9A 2I76A 3QVTA 4Z6KA 4CV3A 1NHWA 2FZWA 4UREA 1OC2A 1H6CA 1ZUD1 4BO9A 1E0DA 4GAEA 2H63A 2NU6A 3CE6A 1X7DA 2Q1TA 4IDAA 4YRDA 2JD2A 1PZFA 5ILOA 1D7OA 5CP8A 1BDMA 1GU7A 2E49A 3V2UA 1NAIA 3PTZA 4ND3A 4E0BA 2C5AA 4FGSA 3DZKA 4CLRB 1YL7A 4RPGA 1MFZA 1H5QA 2BH9A 2X0JA 3DR3A 1FDSA 3K73O 4GGOA 5KKAA 2AA3A 3DMTA 3OJEA 2VHZA 3S2EA 4D3FA 3M1AA 3PHHA 3OP4A 3I4FA 1LU9A 2AE1A 1VL6A 4BGVA 4WEOA 2A4KA 4H7PA 4MVJI 1GUYA 4LSWA 4CQMB 5JDCA 1MGOA 3KUXA 4FB5A 2BFMA 2C07A 1V0JA 2NACA 3AI3A 1YB4A 2R00C 1NASA 4OO3A 2CFCA 4ND2A 1E3JA 2WTBA 4LK3A 2B37A 1NQTA 3KRTA 1VE9A 4E12A 3DEYX 2HK8A 1IOLA 5A9SA 1PQPA 3C7DB 2FOIA 2FWMX 2E82A 2FSSA 2XF8A 1HE5A 3I6QA 1UXGA 1UP7A 2X0RA 1SMKA 4Q3NA 3KHUA 4J9UE 4IIVA 4C7JA 5A9SB 4WNIA 1V3VA 2FPIA 4J1TA 1JN0A 1H2BA 3EHEA 5COBA 3NAQA 1ZH8A 1VI2A 2ZJ0A 4FFRA 4LW8A 1WXDA 4IINA 1OOEA 3ON5A 3ANNA 4Q3AA 1ZXBA 4J0FA 4R1NA 3G3EA 2WJPA 3RU9A 3AOGA 3BMCB 4CM7A 2AE2A 4KDFA 5CFZA 4NU6A 4Z0PA 2V6GA 3D0OA 3LYLA 3RCBA 5JDCC 4DTIA 3FR7A 3GZNA 4PN3A 3ROQA 1HYHA 3WR5A 4JP2A 1JDJA 1A7AA 2HJRA 1U3WA 5K6AC 5ADHA 3PWSA 1DPGA 4DQUA 3JD4A 1VL0A 4RVGA 4QFCA 2Q49A 4WLFA 1PGNA 4ALNA 1N8KA 4NG5A 4XDYA 4LCEA 4QO8A 5T5QA 3MWEB 1A71A 4ND1A 4XYMA 3E6AA 4K26A 3KOUA 4L74A 1SPXA 3ZU4A 1HYGA 1IB6A 1PJ3A 4CM9A 5TQVA 3JYPA 1QP8A 3IJPA 1YL5A 2RHCA 4PLFA 3V1UA 3SC4A 1HSZA 1CWUA 1HF3A 4OQZA 4YJGB 1H0KA 5EQFA 1I3NA 1N9GB 3NT5A 3ETGA 1C1DB 2YZ7A 4S1VA 1EVIA 3ETDA 3I9LA 1Y8RA 4EBFA 1XQ1A 2HRBA 3HSKA 4M89A 3GFGA 3SC6A 3AUSA 3AI1A 1UUFA 4P4GA 4YRBA 1PGPA 4RVFA 1Q0HA 2OBNA 2DUUA 1T1RA 3CZMA 4J7UA 5I7SA 4RDIA 4CMGA 5CDUA 2C59A 4OM8A 1SCUA 1BRMA 3DTTA 2HSDA 1M6HA 1TT5B 3NT4A 3PJGA 4E6PA 1CJCA 2VZ0A 2JD0A 3V8BA 5L4SA 2BGMA 1V8BA 2OBYA 8LDHA 1ONPA 4ZGWA 2Q1SA 2ZYGA 3PFWO 4CMBA 3NX4A 4ZQHA 3DQPA 2PTGA 1DDOA 4WLUA 3RUCA 4BGIA 1PJTA 2X0NA 4Y6RA 5DBGA 3TL3A 3I52A 1PZHA 3RUEA 4BO0A 1UDAA 3PK0A 1GCUA 5GZ3A 3PIIA 1LQTA 3RJ5A 1F8GA 4YBZA 5IF3A 4BO8A 3BXXA 3QV1A 1D4FA 1XLTA 1Z45A 1E1MA 4YDRA 4CJXA 4GX0A 1SZJG 3TFQA 4DYDA 1KYQA 5A9RA 2VUTA 2C54A 3RUHA 3V2HA 1SB8A 2Q4BA 3AM5A 4AJEA 2H5LA 3CUKA 1GDHA 4BNYA 1O94A 4QT0A 3OETA 1YBAA 4R9RA 3S55A 2C82A 2PKQO 4F45A 4DREA 2BI7A 2DUWA 3HE3A 3EMKA 4NIMA 2WE8A 2PGLA 4JNKA 1H6AA 4AJPA 5CG1A 1GL3A 1NR1A 5DOVA 3LF1A 5F5LA 2CZCA 5EMHA 4HX5A 3BTUA 2WEKA 3H9JA 5G0UA 1EDZA 3RFXA 3GPIA 1SB9A 1EVYA 1KVQA 2O23A 3WFIA 4Z3KA 1IULA 4BKUA 5L7TA 1P9LA 4LMRA 5L4LA 1B8PA 3OJLA 1I30A 3P19A 4IGEA 5AVOA 3H3JA 4IMRA 4XRRA 4ZQBA 5DP2A 1F8FA 2XXJA 5KTKA 1KVTA 1NNUA 2VRCA 4TRNA 1HXHA 1M75A 4G65A 4BIIA 1QYDA 1WNTA 2G0TA 2QG4A 2LDXA 3E9NA 4J16A 2X5KO 3ZU5A 3FPCA 4EGFA 1K2WA 3GVXA 2UVDA 3A28A 1HDXA 1BXKA 1U3UA 3F6YA 1BSVA 5B1YA 2G17A 2VCYA 2IYOA 2Q46A 3L4BC 3W8DA 1ADBA 4EUEA 1RPNA 3FPLA 4EI2A 2NVUA 5ICSA 3BMOA 3GDGA 1GPJA 1YOVA 1KOLA 1ZK1A 4L76A 4J49A 1U9JA 8ADHA 3VH4A 3IUSA 1XCBA 3AY7A 4CLXA 1ADGA 5IZ4A 3TF5A 1ISHA 1PJ2A 3VPHA 2WE7A 1WVGA 4NBRA 2EV9A 1XKQA 3MOGA 1VSUA 1YE3A 1AUPA 2HQ1A 2IODA 3ZWYA 4D42A 4M54A 1AGNA 5F1PA 3DHYA 3TZCA 4BGEA 3JTMA 3BHIA 2Y93A 5GZ6A 1HKUA 4BNKA 3O03A 3RROA 3NTQA 3PWZA 2GN8A 3C85A 3ITKA 3RKUA 4ZN6A 2FZEA 4KQXA 1P1KA 1VKOA 4E4YA 1PL8A 2FP4A 3PXXA 2NTVA 4PG5A 3ROKA 1Y6JA 2FPGA 2IDZA 1TT7A 1KERA 4INAA 3AM3A 3E1KA 3GNQA 4GSLA 1K0UA 2FR0A 3PQFA 5I7EA 4BV9A 1VKNA 3T4EA 3HDHA 2JJYA 2JKVA 5DULA 1EFKA 4AJ4A 3PYMA 2PH3A 4J9VA 2YJZA 1ZNQO 4DIBA 3WNVA 4N5LA 3OECA 3ZHYA 1KIFA 1J4AA 1N7HA 4MP6A 2Y1GA 1LBEA 1ULUA 2EXXA 3QWHA 2C0CA 1YDEA 3S1LA 2B5VA 4FPXA 4WCFA 1I33A 4YJGA 5TNXA 3CMCO 5TC4A 1ZK0A 3MEQA 1Q7BA 1VJ0A 3GDFA 3JQ6A 5KVCA 4K9DA 2X5JO 1ZK4A 1I2ZA 4R1UA 4IJUA 4BNWA 4RF4A 1A4IA 4O5OA 3B1FA 1VJTA 1B26A 1F0YA 3CPSA 3JD0A 2BFOA 2NADA 3L77A 1NPDA 3LC7O 1HDRA 3PGJA 3JV7A 4FCCA 4HFJA 2HJSA 2JD1A 4B4UA 4CQLA 3WGYA 2POQX 3RI3A 3ZU2A 4MIEA 1PWZA 3A4VA 3H2SA 3JYOA 3WWZA 4B4VA 2A9FA 3DC2A 3JSAA 4U8GA 3H9EO 2OGUA 1SC6A 2J3JA 2AEFA 2CSUA 2ZTVA 3MOIA 4XD2A 5IDQA 1VRWA 4RLHA 1C0IA 3C24A 5T8KA 5JBIA 3ROMA 1LDMA 1LSSA 1GADO 3GHHA 5HS6A 3EGOA 3GMSA 3U62A 5CEEA 4IXWA 2Y67A 3H9UA 1MFPA 2ZYAA 3GGPA 4OSOA 2NU9A 3I1JA 1EUDA 2PZLA 4AFNA 2EEZA 5I8ZA 3ZWOA 1PGQA 2G82A 2X5OA 4AJLA 3JQ7A 3W6ZA 3BHJA 3ZW9A 1JKFA 4BGUA 1M2WA 3TFOA 2O3SA 1PQUA 5BSEA 1WW8A 3JQFC 3L6EA 1E5QA 1HEUA 1WP4A 4CUJA 1OC4A 2PD4A 1DEHA 2JCXA 3RC1A 1PQWA 4YJHA 4J1NA 4UVEA 1CF2O 4YAJA 2PZJA 1BVRA 1ZXLA 3I3OA 3ZV4A 4NZ9A 2NM0A 4FC7A 4UAGA 3T7CA 4NJMA 1BG6A 5BSGA 3WICA 4RZHA 4CLEA 1MUUA 2NU7A 5IDYA 3RBZA 3RBVA 2P5UA 2JCVA 4XR4A 4F46A 3RJ9A 3PHLA 1JU9A 3A06A 4NQZA 4WECA 4YT2A 1AHHA 4XQCA 4BMSA 3WBBA 3JD1A 1JKJA 4XDZA 4B7XA 3CZRA 5AQ1A 2UDPA 1Y8QB 1D3AA 2D3TA 4GWKA 4I5EA 3I23A 4MOWA 2Y1CA 4WCDA 1BGVA 5I8WA 4EJ6A 3Q2IA 3P2YA 5LDHA 2IRWA 3FBTA 2QZZA 2PFGA 3NUGA 1LC0A 3UCFA 2NVWA 3BHMA 3NGXA 4GKBA 2FSVA 2WDZA 1BW9B 2DBQA 2G5CA 3D7LA 4TRRA 4EW6A 1EVJA 3C3XA 4JBIA 1DSSG 1XQ6A 2EGGA
chains in the Genus database with same CATH superfamily
5FPKA 2CL7X 3CUWA 1L9XA 2XV1A 4L0CA 3LRXA 4HWGA 1G21A 3NBZC 1QGDA 1T9KA 1ZD8A 3RS3A 3UWMA 2VDVE 1MB4A 4MGZR 4MUNA 4BCBA 4DZRA 4PIPA 4F1JA 1P33A 5H9VA 3I2HA 4LXYA 3WGLA 4PS1A 4BEVA 3DMTC 3KR1A 1R6UA 1OXBB 4D3XA 2UVPB 3QFRA 1DKNA 2GXQA 4TYNA 3PEFA 4MEJA 2OT3B 3K32A 5KHLB 1UM9A 3HRIA 4NCHA 5CLIA 1GGEA 3GN1A 4N6GA 5K3FB 5BMVA 4BNXA 4JVSB 2GM3A 1RSZA 2IPXA 2PZAA 2G09A 1E2FA 3CLHA 1Y6GA 3P52A 1GAQA 3CRZA 3IYLW 2ZIWB 1N0HA 5TPWB 2FHSA 5IEBA 3ZHVA 3FUTA 3OLQA 3QYJA 3F7MA 4I81A 5HKOA 3U3MA 3LJKA 4U7WA 1Y89A 3G68A 3IP1A 3SFTA 1J42A 4N3NA 2ZLBA 5FR1A 2WOOA 2P11A 4LISA 3CTMA 1U7WA 3DONA 3RG2A 4LHEA 3TINA 4DLLA 1V5FA 1E98A 2C4WA 2DUJA 3GMTA 1YT5A 5K7SA 3DEZA 1UOEA 1USVA 1VG8A 3DVAA 3OC0A 4YP9A 3HXOA 2CEKA 3BA1A 2O0MA 5L53A 4WX2B 4CG1A 1T34A 2BHLA 4H9GA 2HU2A 2AF4C 4OHWA 5D84A 4WMLA 4UQPA 2HMWA 1MC4A 2G07A 5FBRB 5F64A 3H9QA 3LDFA 3ZY2A 5KYYA 1UOQA 3LYUA 4Q3EA 1L4FA 1KEEA 1C0EA 2O8EA 2H1FA 4FIZA 4BYMA 3VYVA 1WL8A 3R3HA 5I01A 1MU0A 2W9XA 2Q4EA 2XWQA 2W37A 2Z58A 4RK5A 3OJCA 1E7MA 3CY6A 5H3CA 5KYNA 4ZU1X 4JJIA 3O1LA 4RHXA 2Y0BA 5ALKA 5EJMA 5FP0A 1TFUA 5FPPA 2VUSA 3FLAA 4XR9A 3VKHA 3MQ4A 4ENWA 2F9MA 1KI4A 3AUFA 1VIAA 3QSGA 4R8RA 5DNWA 3RFVA 3VVMA 4E03A 1FRQA 4JLBA 4XIGS 2XW6A 3OH8A 2XB8A 3AU9A 1G1AA 3OWHA 2GESA 3AGQA 2DUMA 1ZN7A 2VNJA 3KAJA 3I53A 3BWDD 4QEDA 4AICA 4Q02A 3R09A 1Q50A 4IDQA 3ISJA 4RFSA 1CRZA 1MPTA 3IXMA 4HFNA 2A57A 5G0VA 2P9TA 2ZJ2A 5AVTA 3PVSA 1AZWA 4LZJA 4LK2A 4LTNA 4RD3A 3F9CA 3GW8A 3ZQKA 4UDXX 2D5LA 3SQWA 1VXOA 3A4LA 3D54D 1OFUX 2BMVA 1BOOA 3ZX5A 3HGMA 3SEFA 5E0OA 3FCSB 3NBAA 5TR9A 3GEIA 2FMKA 1GPWB 1KQPA 3LP6A 3SHTA 2P4EA 3CH6A 1EWRA 1X15A 2HC9A 4F11A 1ND5A 2OHVA 4WOBA 3T1OA 1L8OA 2YBEA 5KWSA 2KWIA 2WA1A 2R7AA 2ZROA 1GZVA 1YB6A 3FZNA 3AUAA 2BGUA 3GLQA 1WD5A 4K6HA 3C70A 4WW0A 3VPGA 5DM60 4D9FA 1KQOA 3KKEA 4GECA 3SJZA 5JYDA 3TLXA 2H2IA 3EDCA 4Z9XA 3LYHA 3WE7A 5J3JA 4MUAA 3FTPA 2V3WA 3T7SA 1N77A 1XR3A 4JYPA 4R54A 3UOWA 2NXWA 3MT7A 4NX2A 1I0ZA 1WZIA 2VHXA 2XQVA 2AOXA 1NVXQ 1YK0A 2ZKIA 3GP3A 4KB5A 3R2JA 1J2EA 1V1RB 2PK3A 1WY7A 4L5JA 4V1CA 2JRLA 3RYCB 3QX7A 5K2MA 4EKNB 3EEFA 4Q9AA 1T4GA 2NT3A 1IM5A 1Q0UA 3NLLA 1KRHA 2JFGA 4FCWA 3O47A 3L7MA 4KFTA 1T3ZA 3F1KA 4C4SA 4E08A 3RYCA 1M8PA 2DKOA 2WZQA 3KYBA 3RRMA 1Z0KA 3HI6A 3FPGA 3O0TA 4CM4B 3E22A 3GUUA 4GZ3A 1OFGA 1H1TA 3SE7A 3I5XA 4BZQA 4B48A 3Q7QA 1FXSA 4DCPA 4RZSA 1NULA 2QL6A 3Q3HA 4F5EA 3H05A 4DT1B 1QFMA 3LG2A 5AJXA 4DEVA 1TA9A 4JD5A 3BMQA 3ZDEA 4MCIA 3DMRA 2LKCA 2ICAA 1GZ3A 4L4RA 1TZMA 4P36A 2JHGA 1U8XX 5JTTA 1U6KA 4UEWA 2WTXA 4BE7B 4YPOA 2QIOA 3GUCA 3IP3A 4RK6A 3Q88A 4W5NA 1BU8A 1V6AA 4XGQA 4PX3A 2ANBA 2PKRA 1A96A 1KY2A 2PGXA 2WLSA 4MS1B 4ZT6A 1AQNA 4GKVA 2ZQZA 1NU6A 2Z30A 4QGHA 4RZ3A 3QBJA 4C4YA 1P44A 1H8EA 1Z5VA 2G9NA 2GLUA 3CZPA 3BXHA 2GX6A 2VYVD 3DM9B 4FUQA 2GEDA 4HNSA 4HNVA 2BFWA 3CSDA 5AXBA 3UNXA 4AY5A 2I4MA 4UMFA 3OPYB 1DLIA 5HE8A 1RXEA 3TNJA 4A8TA 3PC6A 1EGMB 3IPCA 4S0XA 1FDOA 5B55A 1U0NA 4B6SA 3QWIA 1HYQA 2BEUA 3ZG6A 2J3MA 1UPBA 2PT7A 1Y3CE 1Y7IA 1XNRB 4DUZB 2GXAA 3R9XB 3MS4A 3PEVA 4Y2VA 2Z2KA 3NVMB 5KYUA 4AO7A 1QKJA 4AL4A 5JAUA 1H0SA 2HT1A 1UKZA 3K9HA 3JWPA 3UXMA 1OH6A 4ZVPA 2DJIA 4PZ9A 4CV1A 1SHUX 1V8OA 2QYSA 3VTFA 1Z29A 1VJCA 4R0NA 4F71A 2O06A 2ZJ8A 5JCPA 5AKGA 2FMXA 4ARCA 5AVUA 3Q7RA 5FX2A 5ES4B 1GRVA 1P80A 2WJ4A 3ETJA 2JLQA 3S2ZA 3RAFC 2QDKA 2ZCUA 4DIOA 3KB8A 1YZLA 1SPBS 1A9XB 4RHFA 4BN4A 4LF4B 3MGBA 3WY9A 1QG0A 2Q7DA 4RMHA 3L8YA 1RYNA 3GL9A 1ZD9A 2ZJ7A 2H11A 4PPNA 2PMDA 3K0AB 5TQ0A 2X1VA 1JFRA 2C96A 3RANA 4V02A 2IF0A 1WD7A 1ZIPA 4A23A 2H1WA 5D5QA 2MMGA 3TZKA 3WB9A 4F91B 1NBME 3DV9A 1DZ3A 4HAZA 2GM5A 2D1SA 3QUTA 4N8SA 3EVZA 1UBKS 3DE2X 3DOUA 3TZ6A 1N8SA 4DWOA 4RF2A 3QI7A 4WXYB 4HLUC 2HZBA 5C8XA 1YA8A 4ZP1A 1C1HA 3AJRA 5BT9A 2QTWB 4ALMA 3D8UA 4FT2A 3KQYA 2A5JA 4QYWA 4AJOA 2JFNA 4O25A 1JJVA 1U7TA 1U8AA 3G17A 4XTCS 3SF0A 2V8OA 4QDZA 4Y1EA 3RSZA 3F6SA 1BHO1 5E8JA 2HM7A 3JW8A 4DSOA 4R8MA 2IKSA 3OT1A 2B0CA 2P9JA 4YHHB 1FJGB 3F5DA 3KU4A 3A6KA 5EJ9A 4Q39A 5TS3A 1L8XA 3EAGA 1O95A 5CLFA 3AC0A 3DZGA 5CIWA 3A4YA 1M1YB 4UBJA 5AMXA 4BNFA 5AI9A 1QHIA 1ZGJA 2ZI4A 3JY6A 3RRZA 2FJPA 2ZIUB 3NPAA 4F6CA 2QD5A 2VJLA 3TSYA 3GFQA 5KTRA 1II8A 1LQUA 3WB0A 2JA2A 3D7SA 5AKIA 5KOHA 4AMZA 4BO3A 1ZGBA 2VVTA 2PLAA 1N4AA 1TEXA 2NO1A 4LMAA 3EUEA 1OBCA 3LGAA 3WZLA 3AR2A 3JZMA 1WMAA 4MVYA 4PLPA 3AGPA 3C4VA 1Y1RA 1NW9B 4EYKA 3DH0A 5BQFA 4IYJA 5AI8A 1YB1A 4QU9A 3SC2B 2Y4OA 1CRQA 2VZ9A 1X7WB 1J2UA 3R3JA 3VR1A 4OFBA 2BC9A 3LWBA 3I4CA 4TXMA 5E7MA 2WG2A 3MT8A 3ONEA 1BNCA 1V35A 2ZSDA 5CXUA 1Z25A 4WXHA 5SY9A 4JK3A 1X7WA 5EIBD 3SKVA 2O1WA 1W93A 1XCGB 3AF1A 4QUEA 5IZCA 1TZKA 2NVOA 1KO7A 4GX2A 4XCVA 1A8IA 1A5SB 1EFAA 1E89A 1OSNA 4UC0A 2W42A 3U7FB 1JSRA 3D8BA 2PAAA 4INPA 1QS0A 3FFWA 3EGWA 4KAXA 2JGIA 5IMBA 4AK9A 1YZYA 2ZYWX 4M2LA 2YXPX 1Q2UA 3CX6A 3QITA 4CTNA 3QF4B 1R6AA 1DAIA 2WNIA 3H7IA 4WA7A 4D9EA 2HPAA 2QL9A 3C8HA 4WEQA 2NUTA 1T2FA 1WZ2A 1JHAA 1QNFA 4QBKA 2VXOA 2ZWPA 1FA9A 2IS1A 2J48A 2QLJA 1T9AA 2ODBA 4MV7A 4V0LA 3CLTD 1Y1KE 1G4HA 2KX7A 5LLTA 3G02A 3GDOA 2E4ZA 4E2YA 1BGXT 2IOFA 1JPNA 5CYOA 3PA6A 4CT5A 1B1CA 2A1UB 5JDIA 3GXBA 4FGJA 1I1NA 2O05A 4D9GA 2PXAA 4EGQA 2IHYA 5K0FA 2HX1A 1E5XA 1C2TA 3JQEA 1QQ6A 5JMTA 3GXOA 4RIEA 2IQIA 2UUAB 5AVXA 5BN5B 1VJDA 4O1HA 4QNNA 1RI1A 1JNYA 3FJYA 1QCZA 1OXTA 3VPXA 2VYND 4AN0A 2C7GA 2MR6A 5MF6A 1O9BA 4P34A 5AK0A 1AKRA 1VPVA 4I8DA 3GG2A 5CFOA 1AMUA 2PZEA 3SVTA 1ITZA 2OCBA 1G19A 4PTYA 4DKXA 2AUNA 3QVWA 1Z75A 2YIMA 2XUOA 5J9FA 1Q20A 1XSEA 4JAVC 2EDCA 2PKYX 4Z0HO 1EGHA 4U9UA 3NHLA 3TWOA 4BQFA 1P19A 5KJ6A 4POAA 2OYRA 1T3SA 3KCQA 3M3HA 3H0EA 4GC5A 3VDQA 3C0KA 2JRCA 2SKEA 1GTSA 1GSIA 2LCFA 1E9EA 4OX9Y 3RDPA 1LLQA 3MTBA 1E3LA 2DHQA 3S7ZA 2X2PA 1RABA 4FDTA 1U0EA 4HDKA 4IUYA 4B0OA 4C01A 3GDHA 10MHA 2EVWX 2RGXA 3CZ5A 4OGGA 1CDDA 1SURA 4QFMA 1DCMA 5ERXA 4G5FA 2BKUA 4Z9YA 3L7JA 4P3YA 3H1EA 3ELWA 3OVMA 3PGMA 1N78A 1E20A 3NUQA 1O0SA 4KE6A 3LS2A 3WWOA 4R5HA 2BMWA 3DNPA 5B3JC 5KX5F 2RHTA 3B20A 2F8SA 4WINA 2RI1A 5A5EA 2J9ZB 5JI2E 2C7VA 3CZCA 2GCGA 3HCNA 4FX2A 1HMYA 3E7WA 4QXMA 3DEKA 2P9BA 2QLMA 2ZVJA 3BF7A 2PD3A 4WOKA 5F5XA 2ET6A 1E5TA 2QMHA 1WR8A 2FWJA 3P9QA 5FPYA 3QYFA 3KJHA 3AHHA 4O2BB 5FOVA 1IY1A 3NIGB 4ZICA 1F20A 3AP2A 2B61A 5AI0A 1UANA 4UAJA 4YRKA 3KKOA 3B60A 4ZALA 3FPJA 2EW8A 3ZJYA 5KHAA 4Z53A 3VJLA 3EPLA 1FQOA 4XX1A 2LIPA 1TTQB 2XGMA 1QLWA 3BH6A 4KGXA 3H42B 1WKVA 3U9LA 2RSLA 2VSXA 1N0WA 1Y1TA 3MELA 4R7TA 5ARDA 1IH8A 1GLVA 5TV2A 1K7XB 5GVRA 3KFXA 1P3DA 3EEBA 3QF7A 2WM2A 3GCDA 2BFCB 2YIVX 3FWZA 3K9GA 4K3UA 1MOZA 2DFTA 3FVVA 5AKHA 1E7RA 3IL2A 1ZESA 3H83A 4X7BA 5LC1A 1F2TB 2AI2A 4Q1BA 1ES9A 1FTSA 3CT4A 2DBZA 4JKYA 5IJAA 2A0XA 4CQMA 4C7OA 2O2EA 1E8NA 5DYNA 4KI7A 1F6DA 3GLHE 1D2CA 4LGVA 1FB5A 2YDYA 2I7VA 5CK5A 4C06A 3WS7A 5C7IO 3EBLA 1G20B 1E5VA 1GKUB 4AZ3B 3PXDA 4L4ZA 2OB2A 1YS9A 4IIBA 4RHTA 5H83A 3DF7A 3VSCA 3M34A 1Q14A 1T8SA 2VA8A 2R1ZA 3JYNA 3PDIA 2OXIA 3TOSA 1PJSA 2QTCA 3EEQA 3FIJA 3WHLA 1JZSA 2ZYSA 2GDJA 2I2AA 5IXYA 3LBIA 1CKEA 1SG0A 4WBNA 2F3RA 4MVJG 3EWSA 5H3LA 1K7FB 1UPXA 3TTWA 4E4RA 1DRWA 3DDZX 4L5BA 4BASA 3B3GA 3FGZA 3FOCA 3KHKA 1SEPA 2WJHA 5EE5B 4RVCA 3ZBPA 1MAAA 2R6HA 3AESB 3PRJA 3E82A 1XPUA 4FEYA 2CK3D 1N5MA 1SD1A 2WTNA 2CKDA 3MCVA 2PMFA 2DQKA 1JAXA 3D8NA 4KIFA 1WXFA 5A5FA 1I4EB 4FMPA 4Z8YA 5GOTA 4DNFA 4ACAA 5AOAA 4DLKA 2AL7A 3WLJA 1GN8A 2DFDA 4ZREA 4ZODA 3B3QA 2WZBA 2VSNA 3G2OA 2VK8A 3IQZA 2F00A 1U7OA 5BSVA 2W6PA 3EMVA 4F8JA 4J0GA 1HM5A 3LDGA 2OHXA 3DZ8A 1F2UB 4HR7A 4BNDB 2JGLA 2O14A 4J6FA 2WAXA 1KYVA 2W4QA 3ABQB 4R9NA 3WKEA 3JYQA 1X8JA 1O08A 1NP7A 2EP5A 5C37A 3ADCA 5CT5A 3WDKA 4L75A 3W6UA 1SUIA 1BXRB 4Y9UA 2XB4A 3ADKA 1IC6A 4ZAZA 5CDSA 4FUTA 3QKRA 2QP9X 4ITVA 4C78A 1CVRA 5D3ZA 2J0UB 4Q3LA 3LLMA 4QULA 2QUIA 3G1TA 1ZUIA 3SJBA 3U4GA 1PDWA 1YS6A 1XRNA 1A9ZA 1JGTA 1OGJA 3IX7A 3OIFA 4H17A 3TTUA 4F04A 4DXAA 2YQ5A 3U7HB 3B1VA 3LQ2A 4TYYA 3TNDA 3Q8KA 4L50A 1MO2A 2R6JA 1K9SA 1M83A 2ZB7A 2FW7A 2W6OA 1DBRA 2XWJI 4R8SA 3U4HA 3W77A 1TRHA 3CUSA 4KDCA 2JZNA 2P9CA 1Q17A 1Y4AE 5KSPA 1JLMA 3AI7A 2PRZA 3OEYA 2M32A 3ESXA 1XRRA 3GMDA 4NYMQ 4D57A 1ORDA 3DTVD 4IJVA 3S2FA 3COZA 3TL6A 2XZTA 1PF7E 3FBGA 2AQKA 5EIEA 5AVYA 2PX2A 3M5PA 4BO7A 2IYXA 2R86A 3GP5A 1BHQ1 1WULS 1YB5A 1YAJA 2HF7A 1IN6A 5G4LA 4PO8A 2KYRA 3QTLA 5E6SA 2QZJA 3F6CA 1VKZA 3RFCA 4UDOA 1T5TA 3ZWAA 1QIFA 2BJHA 4G41A 3A9WA 2GJ4A 2FETA 2W2KA 4IRUB 2G25A 4IIDA 2RHOA 2PBLA 3AB3A 1JX6A 1TCUA 3L79A 3LBAA 1XTKA 4FYYA 2FEAA 3KQKA 4I50F 421PA 2VRNA 4ZZIA 4MB6A 1OHHD 1E63A 5HIAA 2C7QA 3AU8A 2B7LA 4DCOA 5I7HA 1FYXA 3LPCA 1R18A 4PPGA 1MIOB 1Z36A 3N6RA 3D6FA 4E5MA 1I51A 1L7BA 3M5DA 4IILA 5I7VA 2O59A 1SUDA 4E33A 4Q4HA 4MPPA 1LBTA 2GTIA 3R0VA 5ITZA 1SVIA 4BHTA 2D59A 4LHSA 2F3QA 5DK6A 1VMEA 1AY0A 3EIUA 4IIEA 2Z8XA 3CLRC 5DIZA 2RH8A 4RVSA 4KUHA 1FUKA 4ID9A 4HADA 1GY8A 4UEOA 4YJHB 5K3FA 1P7ZA 3ZWBA 4MYTA 2PDAA 1E6WA 2KBFA 4CKCA 1T1IA 2YVLA 4H1WA 4P2BA 3M3PA 4JGGA 1M6WA 2YV5A 4ZXPA 2CCGA 2QUAA 3HFSA 3TGLA 1IN5A 1EHIA 1XEFA 3PNYA 3DMYA 3K20A 2E2WA 4HYTA 3IPLA 4DIEA 2OCXA 3W78A 5DNYB 3GRCA 1KDPA 4FEEA 3RUAA 2ZUSA 3AERB 3GBVA 4IKOA 3VR5A 2GYWA 3QX9A 4W8OA 1MJ5A 1RXSA 3GCGA 3WLIA 5KTNA 2ZZKA 3SGLA 5ALQA 4ARIA 5JSKA 4HEHA 1SKMA 1IXZA 4LV5B 3WYBA 3QV2A 4D46A 1RKBA 3NNSA 4UZFA 1T9ZA 4MCJA 4G1VA 3VVCA 3NDRA 5EAIA 2DPHA 1W36C 2C4HA 2JBHA 1XZAA 1HURA 2HSJA 2Q99A 2XRZA 1XZQA 5JY1A 3UJNA 5HJ5A 1PLLA 3U5TA 2HEIA 1N6HA 2WWWA 3GWGA 3QK7A 4G07A 4IQ0A 5CPBA 5TEWA 3REFA 5EHZA 1L4GA 1VJGA 3EAFA 3V6MA 5JO0A 5JSFA 3BWCA 1OV4A 1WPRA 3PNVA 5IT4A 3RIGA 3I9JA 4WFQA 1GQQA 2BSAA 3G9QA 5B2ZA 2B4KA 4EJSB 1MC5A 2IA5A 5A7GA 3Q3VA 3UO8B 1QB8A 5B6PA 4JA2A 4MR8A 2YV1A 5IJ9B 1LC3A 5E7IA 4ZAWA 2P6PA 3DFUA 4NPCA 2X4IA 4TMYA 3ADOA 3WBFA 1H93A 2G63A 4ZU6X 1CY7A 5L3SA 4PRKA 1R37A 2RAPA 3HBNA 3STYA 1QQBA 1KGSA 1XRMA 4HZIA 2ZRAA 1WPGA 1UEIA 3TD2A 3CUYA 1Y7PA 3ESYA 1ZVMA 3KSAC 2VUUA 4BVEA 1FLVA 2YHSA 3AFOA 4NXMB 3OJOA 1RS0A 5EYPA 1OWNA 2YWRA 3QUCA 3R5XA 4E5YA 1EK5A 1RADA 4NFLA 4IIJF 2NUPB 5JSUA 1OZHA 2B36A 1T5SA 1ZQ9A 4FDMA 1DX9A 2AS0A 4YROA 3VAYA 1R6DA 3TZEA 1L3BA 4BFVA 3UWKA 5IJ0A 2FPGB 4PNEA 3PLRA 2XMSA 4MV0A 5J59A 4I4TF 3FNEA 5FV7A 2IOFK 2YMQA 5M7EA 1P3Y1 2BPOA 3DOJA 4QDOA 4NEQA 2AF3C 2BTQB 3OOYA 4RHYA 3ZH2A 3GRZA 4MVJD 5ALUA 5LKRA 2XTJA 3PV0A 4O29A 1F38A 1O94D 3P0RA 3OCJA 1PL0A 3Q87B 2YOFA 3ZGLA 5GV8A 3UWPA 4ZO9A 2PRJA 3M6FA 3NHWA 4RK7A 1ADCA 4F6RB 1VKRA 4U0JA 1ECBA 3KYCB 4TV8A 4K9NA 2PV0A 4CV0A 1TXGA 4J4TA 3OZAA 3V7UA 4Y2QA 1N8NA 2Q3MA 2O3TA 4M87A 4YMVA 3OCWA 1UPTA 5AK4A 2PBZA 1JDZA 1WHSA 3NKLA 3UYKA 4TSFA 5B12A 1OV6A 3PJDA 3TIXB 1NZDA 2ZXUA 5ALLA 5DBFA 2YX1A 3PCTA 4ZYTA 3SIRA 3INRA 1NVVQ 3OIYA 4FDLA 3J7TA 2BMFA 4H18A 2O7VA 5JJIA 4H3HB 3VYRB 1SXPA 2JBAB 2QM0A 2PZMA 3EYAA 3IAXA 3R20A 4YP5A 4EUKA 2VRBA 3AWIA 3N2GB 2LWIA 3MSCA 2AZDA 3P0IA 1PT5A 1KFJB 3I2FA 3Q7IA 1G0NA 2P8JA 2CF5A 3EXFB 4L51A 4OMFG 3L82B 3BEOA 3IOMA 1VMKA 4QJ4A 3ITDA 3A04A 2FSHA 4CMCA 2PL3A 5C7OO 3TE7A 2H7YA 3UOAB 1ZRHA 2EKLA 4EPTA 1XPRA 1IONA 4XVUA 3EBOA 1RPTA 3SMVA 5KREA 4M88A 3PL5A 3WA7A 3PQEA 1QRTA 5B4VA 1YBVA 2CJWA 3UMMA 1K98A 1TPZA 4AWBA 1E9CA 4D4MA 3B51X 4P83A 4PNZA 4EHHA 3DGEC 3R6TA 3I58A 4J76A 4U0KA 5CVEA 3WLTA 4CVNA 1EP9A 4OEHA 1PJRA 3BGVA 1E3WA 1KC3A 1NN5A 2H7VA 4IDDA 2H52A 3OX1A 3G2PA 4Y2JA 4U7DA 2AC7A 2GB4A 3P5BA 3LUHA 4KFRA 4BFCA 2FAXA 4IV8A 3E3AA 1ESCA 3QE2A 3WMGA 5GINE 2AG5A 2D2FA 3CO0S 1GGMA 1KJZA 2H1CA 1ZD5A 3D4PA 3PCRB 2JIBA 4BXOB 1SBTA 4XVQA 1B0PA 1I36A 1XQWA 2JFYA 3GGJA 1XXHA 4Z0TA 5TF4A 1TCAA 2E5FA 2Z4TA 3KPVA 2VHWA 1DOAA 1M6NA 4LFCB 5GTDA 2J6HA 1NI3A 2WWXA 5EZ6B 3O4IA 4M1TA 1OH7A 1VHJA 3DDWA 5KYUB 4BNMA 5I6DA 2QW1A 4H3SA 1KY5A 4IV0A 1VB5A 4QYSA 5FUXA 5JQWA 1WV0A 4BTLA 3T9BA 1F0NA 2J32A 1TO1E 2PZGA 3IKMB 3NAZA 1CUBA 4RXTA 1BE1A 2EX4A 3VR3A 1F0KA 1I2CA 4NV1A 1PFYA 1XHLA 1YQGA 1YQXA 1R64A 4CCYA 4WASA 1HTBA 4EAAA 4XPZA 3RSHA 1XZ8A 3WNCA 3NWPA 2RK4A 1CB7A 3X2EA 2RGCA 1WV1A 4II2A 3CE9A 5B1SA 2GCEA 1U9IC 3PTAA 1UC5B 2C92A 4GMHA 4W8HA 5HMMA 4EW3A 1TTTA 2PPVA 1V7QA 5JWHA 1OIXA 2WFLB 5AKJA 3RM3A 5BVHB 5KX5A 3IEVA 1VTKA 1PX2A 4OLBA 3IHKA 2F7SA 3BJMA 2IE0A 2NGRA 3BF8A 4LY0A 4ZVOA 1U5AA 2JAPA 1ZM4A 4L4XA 4PGAA 1M7HA 4ZYWA 4CTMA 1Q12A 3Q10A 4QXQA 5BW6B 3PFFA 4ZDWA 2AX3A 1GTJ1 1J70A 1KAQA 2PX3A 3STVA 5P8WA 4E5NA 4K2HA 3BC1A 3I9MA 4GDMA 2APJA 3OQJA 1I5RA 1MGPA 1OMOA 3CZ4A 1EAMA 5JSZA 3TJZA 3IEUA 2B78A 1IZ0A 4FXOA 4AF7A 1F06A 4JZYA 3INYA 1JZQA 2PE5A 3B7GA 3LKBA 5ES3A 2Q8NA 4O8ZA 3VNAA 1EXVA 4EJSA 2B8WA 1E77A 1Z5PA 2GUGA 3AONB 4DBLC 1PHPA 3SX0A 2EATA 1UMBB 2EGUA 2O2ZA 4ARZA 4EKGA 5IDWA 1B0ZA 5LIPA 4MVJE 4CL3A 5COQA 2BKXA 2YRXA 3T0GA 4P3XA 5BWLA 1DXQA 1NLUA 4BFLA 2TMGA 4AUNA 2A86A 1Z5UA 2GI4A 3HU5A 4UTNA 1A2KC 3D3KA 2GLTA 2HH9A 5C53B 4IQGA 4R1SA 4ACBA 3RVSA 4MKXA 2RGYA 1D1QA 4Z4CA 1CUGA 2FPPB 3ESRA 3MT0A 1FVFA 4KACA 1U7HA 3C1TA 4IQFA 5CH5A 2P1ZA 3O92A 4FMBB 1S3FA 3KXKA 2GHIA 3AR6A 2ATEA 1U3FA 2GBLA 1U8ZA 1HFJA 4ZWNA 4C4RA 4DA4A 1DJPA 2UU9B 5D1NA 3L6CA 3K16A 1WHTA 4PX5A 1DXHA 4C6TB 1YJXA 1CB0A 1LUAA 3LX5A 4KTTE 3G8BA 4H0CA 1DELA 1QG2A 4YLYA 2W2QA 1WU8A 1ZWKA 4WBSA 5HPYB 1FFYA 2FWPA 4DLWA 4J4HA 4LDRA 2WY2D 4KITB 2GFQA 2CB0A 3DMHA 3IJRA 1WUKS 2ZQYA 5I4KA 1IHDA 1KEWA 5JS8A 1J1ZA 1Z6ZA 3VPFA 2Q5EA 3EB9A 4YWJA 3LZDA 4W7IA 1AHNA 4KTVE 3TG8A 3A6FA 1X2BA 1EUZA 2V97A 4CE6A 1SKBA 4C5CA 2TMDA 3KDAA 1NFFA 4PRLA 4AAYA 2Q45A 5B2EA 4UOQA 4O4LA 2GJAA 4ZVQA 2GAOA 1SVLA 4PFKA 2GETA 1YHYA 3LRTA 2DLDA 2IDKA 4G9BA 2HXSA 4ZCIA 2ZDQA 1ZS9A 4EHLA 4CF4A 3FI9A 1MLDA 4WFKA 4QREA 5GONA 5JC8A 2OGSA 2R6GA 4BQPA 3SU8A 4JLSA 1FUEA 2QMYA 4TMFA 3KVRA 5C7LO 1Z0IA 2H5IA 2A67A 3ZVRA 1KZ4A 3AFNA 3OQMA 3AOEA 3THWA 2PL9A 3D3WA 4HTAA 5HRAA 1E1RD 2G5GX 3KKPA 1JR6A 1MH1A 2QSZA 1U4SA 1IZYA 2AOUB 3BUSA 1JVNA 2ZR8A 7MDHA 1NQXA 2OECA 1MX3A 3GAMA 3IEXA 4RD2A 1ACMA 2UXCB 2WVJA 3DWEX 2R96A 1T29A 2FQXA 2HF2A 4BO6A 2XUFA 5F3WB 4O4JF 4PQRA 4A82A 5JARA 1QK4A 1E3SA 2O52A 2W2PA 1EDOA 4KSCA 4UD2A 2NTYC 5ITVA 5F12A 1D2NA 1J9EA 3PFIA 3FCXA 1AKEA 3MF4A 4JB2A 1VBFA 3AKZA 1CQIB 4U7PB 2AJTA 1OBOA 1X87A 4OK5A 4F3KA 5AOVA 2LW7A 3HG7A 1PSDA 1T0JB 2FUCA 2H9IA 1CF9A 2XEDA 2PRIA 3FCAA 4IF4A 4YGXB 1NI4A 1LPNA 4KSYA 2NPFA 1A97A 3AUJB 4BFUA 1SULA 1LXCA 1VPDA 3FYHA 3JVUA 5CM9C 2EL9A 3HU3A 2QBYA 4LX0A 1EXMA 4C4XA 2ETVA 2FPOA 3L0PA 3IP6A 3KKNA 3QVGB 4KGVA 5D85A 4KX5A 2C5EA 3V4LA 3IILA 1NFRA 3AUYA 5IBPA 4KW7A 3U7GA 3HY3A 2BGNA 2AN3A 2BN4A 5E3IA 3R41A 2PT9A 4MKGA 4I50A 4GVLA 2JFBA 1QAOA 3ID6C 4FQ5A 4Q1CA 4Y7DA 1COWD 2FR8A 5L3VA 2P8SA 3Q9LA 3H9BA 1SQFA 4HBGA 1JEQB 2YN4A 4QUHA 5F7OA 4C9BA 2RI0A 2XKKA 1ND6A 1OH8A 2DQZA 3KUKA 2O20A 2PNJA 1Y8QA 5CA1F 2AMFA 4RC9A 2DTEA 5D5PA 3G5LA 1JT9A 3RHSA 1C7IA 3N6XA 2BY4A 4R9UC 4MI1A 5KX5B 5BWMA 1GGJA 3FF1A 4WZAA 2KHZA 1BO6A 2D2VA 2ZYUX 4P4NA 4QGBA 4BLWA 5MFPA 2RE8A 1TUGA 1U9CA 2E4YA 3B3AA 1Z9BA 2ARKA 3A9RA 2H48A 4GLBA 4KK3A 4UULA 3VX3A 1U1DA 4HF7A 1B00A 3FOWA 4DJJA 4B6RA 3DVLA 4G0MA 2XYGA 4QX6A 4YRRA 3ULKA 5HIIA 5B4TA 3FFXA 5ADUS 3DHNA 1GNLA 5LLSA 2PMEA 1A8SA 5KJFA 1MNAA 4YRLA 3PUZA 3RC7A 3N2KA 1WBDA 3BWXA 3EIEA 3KOOA 4HWKA 4L3VA 3IKTA 1MB0A 3ENNA 1DIGA 2W2OA 4J29A 1U28A 3H8SA 2TRSB 4A0GA 1MXHA 5HCIA 3JQPA 1GGNA 1HGXA 2CD7A 2C7RA 3ML1A 4A2CA 2C5HA 4GI3A 2Z9CA 1UMKA 1M2NA 2X15A 3NYIA 2ENWA 3HVUA 2A5FA 2CVOA 2FW0A 1XV5A 2H1SA 3O8NA 3RGGA 3TIIA 1JTEA 2COUA 1RWMA 3WHPA 4EYOA 2AFVA 3TLKA 4JB3A 5C51B 1Q7EA 2RHMA 5AW4A 3OJWA 4KMOA 2VJCA 1JDVA 3QMPA 3MJCA 1L5HB 1ODKA 1F1JA 2VRWA 1HRDA 5H81A 3ZDCA 4QRHA 2NZXA 4EIWA 2ILVA 5JPIA 3GELA 3VDMA 1QTQA 3QZUA 5I3ZA 1E2JA 1XZLA 2ADOA 2KE5A 4L95C 3RVBA 1QONA 1HY3A 2EL7A 3E2PA 1T24A 3FCEA 3DNMA 4IIXA 1ISGA 2QTVA 3QEOA 4WIAA 1UM9B 5COAA 3TI7A 4D3ZA 1NQUA 3LT1A 4TYPA 3ROTA 2NO6A 3GZNB 3EXG2 3LL4A 4G1BA 4GW3A 4KG7A 1YVEI 1CU1A 1UEJA 4WFIA 5TF0A 3WRVA 4A9AA 1ILWA 3EPRA 4QUDA 3WO1A 2YJ3A 1UXIA 5FA8A 4AYTA 3WB2A 5A4AA 4KRXA 3ZDYB 4G36A 5BN3A 4HAYA 1R4NA 2RGUA 5LKAA 1O95D 1V26A 2O7NA 5I9TA 3SDBA 4IVPA 1GXSA 4AO8A 5BNWA 2JFWA 2BFDB 4YAGA 3N7AA 3O8BA 2NO4A 4UM8B 2V65A 3STTA 3VTZA 3OU7A 3E70C 1DC6A 2YUIA 3QHAA 4DHEA 4G0OA 1LRKA 1DLJA 1DB3A 3RK1A 1L5NA 2CFTA 4FI3C 4R2WA 4GWGA 5IAEA 3OKAA 1YDWA 3WOVA 1UOOA 3RTDA 1PT9A 2EX1A 4Z2YA 5I7RA 4R6WA 4BNIA 2CN1A 3GRAA 1YI1A 5BOVA 2Y71A 2O2SA 1IY8A 4V2IA 4WK4B 3PHJA 3I61A 3GN2A 3M82A 3QP9A 5FOQA 3PJFA 2VPPA 5BPFA 3NVKI 1CS0B 2JIQA 4NV3A 1KJIA 4EB6B 3ASZA 5J2TB 4LSMA 1O3YA 1GEEA 2VYVA 1PDOA 2ZRLA 4O6VA 3HY6A 4Y2XA 3VO1A 2JAQA 4CDNA 2QPTA 4HZUA 4LOHA 3T1VA 2RBKA 3OPMA 4AD8A 2AN4A 3NJRA 4Z7NB 1H0HA 2PX6A 3H9GA 3OBIA 4TV8F 4A36A 4RY2A 1RRVA 4PAGA 2AHOA 4X1OA 4A0SA 3QBVA 5M34A 3T3EA 3QIVA 3D7KA 4IEFB 4FWBA 4TT8A 3QLEA 3R77A 3G8DA 2ZPTX 5LA6A 1M1YA 4DQDA 1V9SA 2R7NA 2CHVA 4DA6A 1M9NA 1RRKA 2Q9AA 3E1SA 3VMFA 3KPUA 4B85A 4PG6A 4ZYLA 1QJ4A 3TIGA 2JAHA 3ABOB 4E6EA 3GARA 3UJCA 3UJHA 4UHKA 5I7OA 3ZW8A 4E15A 2DH5A 4EELA 4XB6B 2RONA 3GLIB 4J0IA 1QHEA 4IIHA 5JVDB 4XPIA 4HL6A 4TZKA 5GIPE 1DHRA 2X7JA 4MKRA 2OESA 2OV3A 3EZYA 5IJWA 3H87A 3CW9A 2P91A 3Q2KA 1PW5A 2E21A 2OLEA 3EY4A 1ORRA 2G40A 5LQSA 4NF2A 1UC8A 1IYZA 4YMWA 4OHBA 4AUKA 5HNKA 3IB3A 4OI4A 4M7RA 2P5TB 2PSDA 4KVGA 3GX1A 4OYLA 4AMBA 3TR6A 4EABA 5A4KA 2DT8A 2OMKA 4BFYA 5DHQA 2Z1MA 1QGYA 3ENVA 3HUEA 1SXJE 3OUUA 3ZIAA 2HA5A 1CJMA 2V96A 2YL2A 1GGKA 1T3GA 3G9ZA 4RMNA 5DXFA 3CKKA 3RWBA 4UKDA 4BZWA 4UNRA 3WTBA 2PA3A 3HCPA 3UPUA 4BO4A 2RGGA 3VHLB 4DA0A 2GD1O 5EJFA 4GLLA 2TECE 4DQLA 5KTMA 1P1BA 5BN4B 1S2LA 3D6JA 1VYUA 4LJKA 5IAJA 1T2CA 2PUGA 1VHTA 3DJYA 4JV5B 4ZAYA 5EKTA 1FDTA 2XUKA 4H7KA 5KNCA 4WZAB 1UBRS 3HJFA 1J09A 2GKGA 1WUHS 3O4GA 5F3DA 3D6AA 5KYWB 1YFKA 2B1QA 2I6QA 4DV6B 5EPOA 3CGGA 1BKDR 2C4NA 3MS2A 3LC2O 1K3TA 4RZUA 4GPBA 1P4RA 1DFIA 2V7GA 2YZ2A 4MWEA 4WADA 4X85A 2O5RA 3VVBA 4B3DA 4EY6A 3BWEA 2XA2A 5EQJB 1JWLA 2CKMA 1WS6A 2WZDA 4YCDA 2XYRA 3WQSB 5BWOA 3OI7A 5KYGA 4CEHB 2B7CA 4J07A 3TMAA 3ISTA 2WD7A 2QPOA 4D1YA 5CLHA 4MQEA 5GV7A 1U2QA 3DYBA 4N7RA 4HRXA 4LF5B 2WI8A 2YOHA 2J8ZA 2ZRCA 1BVHA 4KXNA 3DYVA 4MQEB 3TXYA 2X4LA 3L9XA 4NU8X 2R6CA 3GRUA 4IXTA 4XD7D 3EK2A 4F12A 2QYOA 4U5XA 3HN7A 4WZZA 2VCEA 1XRLA 2OD9A 4FN5A 4M7OA 5THQA 1TKBA 1Y9JA 2H0AA 2ACKA 3H5AA 1KI8A 3LQ1A 4R4JA 5H1YA 3DWFA 2D7CA 3IVGA 4LRQA 5H7XA 3WGJA 1KI6B 1SXIA 4MV1A 3D4OA 1Z5OA 1CY4A 1ZEMA 2NPIA 1Y9EA 2VP9A 3AEUA 3KJEA 3PF8A 4Y0NA 3CUTA 4ZC1A 1NLYA 4TS3A 5KS2A 3OF2A 4FD3A 3MPUA 4NS1A 4CHTA 1YZNA 2HTEA 2I67A 4M8NE 4BFXA 4Q4HB 4CKXA 1GVNB 1D4ZA 1QH1A 1WW3A 4A0RA 3ZVMA 5A3RA 2CHGA 4YB8A 4Q82A 5AKLA 1T1JA 4KQGA 1LS1A 3D1JA 4DSUA 4F4DA 3ZD9A 3WX0A 5I47A 1GV0A 3HK2A 1X7YB 2PU5A 4BBPA 1Y8ZA 2P69A 1QP4A 4D8UA 3D1VA 2OFFA 4UNQA 4LBZA 3C14C 1U0TA 2ZJBA 3G85A 1B0UA 3CLVA 4P5DA 1XTTA 1EE9A 4MARA 2DSTA 2XNJA 3AHIA 1YXMA 1OXSC 3HA3A 3NTXA 4GX1A 5B7PA 4C2UA 1KXZA 2ZIZA 1M5UA 4M99A 3V9PA 1YZQA 1ZJ5A 3BWYA 1A5AB 1C80A 3D3QA 3A9UA 4KMSA 3LM8A 4KR0A 5AM3A 1XU7A 3DZBA 1P5FA 2M1XA 1A9YA 4JBGA 5LZ7A 7GPBA 5JUWA 1JVBA 3HKBA 3MCTA 2REOA 3NVAA 4IIJB 4LDJA 4EUHA 2VBCA 1MKYA 3HO8A 3UQZA 4YJ2F 2X9VA 3ME5A 5FFFA 2RD2A 3C2QA 1CUXA 2C9DA 2C99A 2XE8A 4KJXA 2V6FA 3VZRA 4QOGA 4UVIA 1I2BA 3Q8XB 3N58A 1BN7A 1D2MA 3KVOA 2J3QA 3M89A 3PQCA 4KU4A 2RAUA 1KMNA 3FNRA 4OGLA 4FYWA 3U7QB 2FW6A 1PX0A 2WTMA 3QTBA 4J43A 1E2KA 1FMCA 3ZWPA 4A73A 821PA 1RFLA 5LQMA 4X8OA 4P0TA 4EI7A 4C7OB 1JEYB 4FMDB 1Y5MA 2IF2A 2B4YA 3KQSA 3F6EX 4NP6A 2W6CX 1CIJA 3E5NA 4GR9A 4J7AA 4E09A 4Q9LA 1FMFA 3KQUA 2R8BA 1YMQA 2W4IA 2QMZA