4PRZA

Caspase-8 specific unnatural amino acid peptides
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
240
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-8
publication title Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 240
sequence length 256
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4przA00
3NS7A 2C2KA 4EHLA 3GJRA 3H13A 1RWOA 2CNLA 1QTNA 3UO8B 4EJFA 5I9TA 3V3KA 4QU0A 3IBFA 1I51A 2CJYA 3K7EA 2AR9A 3NKFA 4JQYA 5H0IA 4NBLA 3DEIA 4N6NA 4NOKA 5IBPA 4ZVSA 2WDPA 1RE1A 4FXOA 4IYRA 4N6GA 4EHNA 3R5JA 1CP3A 2XYGA 4QU8A 3SIRA 3R7BA 5IABA 3P4UA 4ZVOA 3R7SA 2J33A 4NOMA 4EHKA 3V4OA 2HBQA 4QUJA 2CDRA 3DEJA 3H11A 4JR2A 4N5DA 3P45A 4D3YA 2K7ZA 3EDQA 4JR1A 3SIPA 4IEFB 4N7JA 1NMSA 2C1EA 3KJFA 2Y1LA 2P2CA 2QLFA 4PS1A 4NOLA 3V4LA 1SC1A 2C2OA 2XZDA 4N7MA 3V6MA 5LU9A 1F1JA 2C2MA 2DKOA 3D6FA 3D6HA 4ZVUA 3DEKA 4JB8A 4M9RA 2FP3A 4QU5A 1NMEA 3DEHA 5LUAA 1BMQA 3R6LA 2XYPA 5IAEA 1SC4A 3D6MA 4QUGA 3PD0A 1QX3A 1ICEA 3GJQA 2NN3C 1RWPA 4FEAA 4QTYA 3S8EA 3H0EA 3GJTA 1IBCA 4I1PA 4AW9A 3UOAB 4QUDA 4ZVTA 1CVRA 1RWXA 3RJMA 4D3XA 4NOJA 3E4CA 1RHJA 5K20A 4JQZA 2CJXA 4QUEA 1NW9B 4DCPA 2FQQA 3IBCA 1RWVA 1RWNA 4ZVQA 3KJNA 4I1RA 2QL5A 1K86A 4QUHA 2H54A 2Y0BA 3ITNA 4HVAA 4HQRA 4JJ7A 2CNOA 4PRYA 1SC3A 2H65A 2HBZA 1K88A 1RHQA 3QNWA 1RWWA 3R5KA 1PAUA 2XZTA 4FDLA 5IARA 3S70A 5IASA 1F9EA 3GJSA 4ZVRA 3V6LA 5IC6A 5IC4A 2H5JA 1RHMA 2J31A 1GQFA 1SHJA 4NBNA 3EDRA 2XYHA 4QULA 5IBRA 2CNNA 3KJQA 3H1PA 4QUAA 1NMQA 5IAJA 2HBYA 1GFWA 3H11B 5I9BA 4D3ZA 4QUBA 2QLJA 3R6GA 2J30A 4QUIA 4QU9A 4PRZA 3OD5A 1QDUA 2CNKA 5JFTA 4QTXA 4JJ8A 1RHUA 2H51A 2QL7A 4N6OA 1PYOA 1I4EB 1RWKA 2H5IA 1RHRA 2J32A 4DCJA 4ZVPA 1RWMA 2H48A 4PS0A 1I3OA 3BIJA 2C2ZA 1I4OA 2HBRA 3PCXA 1RHKA 4NBKA 2QLBA 4EHAA 2H4YA 4JR0A 4DCOA 5IANA 2H4WA 4AWAA 5LU8A 5IAGA 3NR2A 3PD1A 1SHLA 4HQ0A 4LSZA 4EHFA 5IBCA 4JJEA 3V55A 2QL9A 4FGUA 5LUBA 4EHDA 3R7NA 5IAKA 1KMCA 1JXQA 1M72A 4AWBA 2FUNB 4EHHA
chains in the Genus database with same CATH superfamily
4MUFA 3STHA 4PSCA 1E4VA 1WULS 3BKXA 3EE6A 4OA5A 1SXPA 1KR2A 2Z8ZA 5HGJA 2WNSA 4WACA 1SGWA 3C3XA 1P44A 5ADVA 4DOMA 1FTGA 1T4CB 4RFLA 4TSFA 2REBA 4CM9D 1MA0A 4BOYA 5HS4A 4L3WA 3WHIA 1XTIA 2WF9A 4P98A 4F60A 2MDTA 3EISA 5J23A 1HSOA 1EH5A 1P29A 2VR1A 2PLNA 3CNLA 4UM9D 5KYVA 4ZI5A 3QXHA 1MFZA 1A5AB 1CULC 2B20A 4G0MA 5L51A 5BYAA 3CF6R 1OXBB 1SB9A 2RGDA 1L8LA 3BCHA 2PL9A 4AKTA 1JA0A 1IRXA 3JYOA 3SHOA 1QR6A 3RJTA 1J8VA 2D1SA 4BO7A 2J4FA 5EC8A 1W47A 5JAHA 3ZDCA 4ZYTA 1P2UA 5JAPA 1U2RA 2CDAA 2DUNA 3V4SA 2EFHB 1RAIA 4BVGA 3H2HA 3WDMA 2YRXA 4YR7A 1JVSA 1LI4A 3H7IA 4BNTA 2XMRA 2DKOA 2AG8A 3G82C 1QORA 1FDUA 3FPJA 5CB8A 7REQA 1GNQA 2P9TA 3HR4A 1X3SA 2CBZA 4MGHA 5LUAA 4PHFA 1QSGA 2D4AA 2ZGVA 3HJUA 2R96A 1MB2A 5EE3A 2GCIA 2Q0QA 1OXTA 2O1EA 3ESQA 3HA2A 4DG5A 3E9YA 4TVSA 5AVRA 1H2YA 2E4XA 2SKCA 5HKKA 4XWAA 3CLTC 3J7AC 1QCZA 4G1CA 3SC4A 4KO8A 2H29A 2H2GA 4ZK2A 5JFOA 4B3RB 5BXQC 2X76A 2V6FA 4Q9NA 4I5DA 4PQEA 3SIXA 4ZEVA 4QOSA 1EFVA 1JNYA 1E9RA 1KDRA 1TL7C 3EUEA 4JH0A 4L8WB 4J0FA 4MI6A 1J5XA 2JI9A 5DMXA 1IK4A 5KNCD 3EDCA 2QBYB 4KAFA 3HKEB 2V9CA 1ECJA 3QF4A 1KERA 1NP3A 2V45A 1LX6A 3O4GA 1LWOA 2CE7A 4GOXA 4K9LA 1D9XA 4LJLA 4PRYA 2PR2A 5HE9A 4CHTA 2F3RA 4B3DA 4DXHA 3O74A 1CY4A 3E4DA 4IXWA 2G88A 5DU2A 4FJ0A 3HEBA 2G1AA 1USIA 3EDYA 3I0ZA 3MOGA 2PVSA 3NCTA 3OKPA 2DWPA 3QVSA 5KPDA 5HF8A 2XADA 2HMAA 3SM3A 1M75A 4LJ7A 4CODB 3R7WB 4PQGA 3T06B 2FA9A 2BFNA 1V8PA 3OLVA 2HQBA 2ZR7A 4JB2A 4RA9A 5TQ0A 5AW6A 5AW1A 1RYBA 4H7KA 4OI4A 1QF7A 1L5ZA 1VIAA 3R6DA 4JOQA 4Y1EA 1DMRA 1YUMA 3NWPA 4Q7EA 3OLXA 5KAMA 3ZI0A 2W2KB 4AJHA 1P2DA 2ZZKA 4M98A 3QU5A 5J2TA 1OFUX 4TLLB 3RV3A 4KMSA 4H17A 2Q4RA 3RF7A 5H80A 1ZK2A 4YYZA 4JNCA 1DV1A 2OG1A 2V7VA 2WR8A 1L4KA 3BZUA 4DTIA 4EPYA 4CN9A 4RTOA 4LF9B 5AI5A 4E4TA 1I2MA 5K7SA 1GR1A 3IUYA 2XT0A 1DAGA 2YZKA 3E9CA 4L51A 2ZZMA 1JH8A 2QL9A 4OKIA 1RJGA 2GPYA 3RDPA 4F11A 2AJTA 5ALVA 2L42A 2DR2A 1IN7A 2H7XA 3O73A 4FN4A 2RMKA 3JQBC 5DGHA 4R9VA 2ONKA 2QA5A 3FZEA 9ATCA 3L6OO 3VJMA 5CEEA 3H6HA 4HTFA 3Q87B 1BFKA 3QWFA 1E5TA 3OC0A 1ZUNB 3A3PA 3RNLA 5K6RA 121PA 3UTCA 2APJA 3X2FA 2IITA 4URZR 3A6PC 2XGJA 4X62B 16PKA 1RVV1 5KI6A 4KRGA 2YASA 2BEWA 3VRHA 4Q7MB 1JLLA 2YL2A 3A6HA 5GM1A 4AN1A 2HIMA 5JRJA 4N48A 5EYPA 2FG7C 4BRZA 5E7QA 1Q0UA 3PFCA 2HSDA 2OFPA 1L3IA 4PNHA 3UV7A 1G291 2RI0A 5EZSA 3GFTA 3WSWA 2CUZA 1W1WA 4G1EB 4UU8A 4CKBB 3PUZA 1RQGA 5BV0A 1HOTA 3DEJA 1SQGA 5E8JA 5DK6A 4F85A 1FDIA 5HG0A 4AMVA 3MGBA 2PUHA 2BM8A 2ZYTX 4JLNA 3A2NA 1YZLA 2YW9A 4XM1A 2HIGA 3TFOA 4J1TC 4WXEA 2XA1A 1TF7A 4BUZA 1LQ2A 5EFOA 4I55B 3A31A 1EUYA 2IZ0A 4FM9A 1ZY2A 2YRWA 3LX5A 1HFWA 1NUSA 5LQAA 2GDZA 3QA9A 5DBOA 1P4JA 2ZJFA 1QRUA 3MTIA 2OK8A 1KEEB 2CBXA 1DRKA 4Y6GB 1E7QA 2XGMA 2EKDA 1SKQA 2Y27A 3B1YA 4I1IA 1T0HB 4JB8A 4K2HA 3O8OB 4NI5A 5AKGA 5HQ3B 3PICA 4DWWA 1O89A 4Q03A 1NW6A 1AK9A 2VBCA 2C2XA 2DGDA 5TPZA 1NT4A 4HDAA 4A2WA 3JQDA 3C3EA 4YRSA 2UZ3A 1YQ9A 2I2BA 1UC8A 3EN0A 4OL0A 4F71A 1X86B 4R9NA 2EQAA 4CQLB 4YCAA 1ORHA 2JFHA 4YRZA 4RZXA 1DQNA 1U99A 4OSPA 5A2GA 1I4LD 2R66A 2ODNA 3G2OA 1Q19A 4A10A 3DKIA 4PYMA 5IU6A 1MIHA 2QRHA 4TT8A 1QIIA 4YCCA 3IOYA 2V7UA 3AK4A 3RHSA 2JIOA 1KARA 1ZAKA 5JOQA 4CF4A 3TOXA 2VDJA 4U6SA 3SFVA 2Z8YM 3ETJA 1GQFA 4MCHA 4PFKA 4RUKA 2PGIA 1NYRA 2HMVA 3I8XA 4EO9A 3SZRA 3EVBA 5E9AA 1E7SA 2VI5A 3KDAA 2ZYWX 3B6KA 4I7EA 4MV7A 4C7JA 2JBAB 3HU1A 4BAGA 1ZXBA 1GGHA 3CA8A 4QUIA 2YFYA 1MHTA 4ACBA 5EHGA 4L02A 1V71A 2O7NA 2PT6A 2QYHA 4JJ8A 3BKWA 2R6R1 3BGSA 2R4UA 2Y6UA 1IY1A 1PO7A 3DBRB 3F5FA 4HDNA 4ZHQF 1T3HA 4RVGA 1PFGA 4P5EA 1V11A 3KT8A 1E5QA 2AN4A 1JTVA 3EXG2 3EZ7A 4TYYA 4OJNA 2AN3A 4IDDA 2WUVA 5FPYA 1NBMD 5D86A 1E9SA 3OECA 4BBZA 1YL7A 2IY9A 2VXYA 5JLJA 3E9RA 2R9VA 1OXMA 2AXNA 3D3KA 3PDIB 1SBNE 2EQ5A 3FSGD 5HP4A 5GOTA 1QF6A 3JASB 1RRKA 4CF3A 2J5RA 2PVCA 4MPPA 3N8IA 1NJ2A 1FNMA 2I34A 1ZISA 4XYMA 1STOA 2X41A 3PCTA 1X1QA 4KJXA 3UJ8A 4I1UA 4FGSA 1EB8A 2JD0A 3K05A 5TGZA 3ZWNA 4YLYA 5ICEA 1NM5A 3TZQA 3CZPA 5F1KA 2OZPA 1W88A 4OHWA 3R7AA 4C07A 2ZWMA 3LUFA 5F4ZA 5JO9A 3IP3A 3WLQA 1HDGO 1QLJA 2C7BA 3FTNA 4BB6A 3CGWA 1U65A 1Y80A 1FQKA 1N2SA 3PC4A 5ALRA 3RBAA 2XTNA 2W58A 1QYVA 3DB2A 1JIKA 4EHKA 5CIWA 4BP8A 5A7FA 4AB1A 1CR1A 2GARA 2ZM5A 5DGDA 5EESA 5A04A 4WZBE 2WA1A 1RXUA 2AK2A 2CK3A 3FI0A 4OXQA 3RTDA 2R00C 3EZGA 4PXSA 1H2FA 3OD1A 3TB6A 3COYA 1DDIA 3FSRA 5GZ6A 1XDGA 3EVFA 1NATA 5FF9A 2WFMA 3K1JA 3AF1A 1N8NA 1YB6A 2BCGY 3FJ1A 2E4WA 4QOFA 4KRYA 1H1LA 1P2VA 3B8HA 3M0EA 1JIXA 1B0UA 3FBTA 2Q3EA 3RIHA 5KKCA 4LYYA 2OFWA 4C7MA 5DTRA 3LP5A 3BIFA 2XW6A 3GUHA 3LX6A 1P5JA 1KK2A 1IE3A 3R6LA 3ASZA 4DQDA 3HADA 1JR3E 2NU9A 5M04A 3S8MA 3WMEA 1ORRA 1RXEA 5G41A 3TMKA 8ATCA 4EFKA 3CSSA 2IZOA 2P78A 5I7VA 4MR8B 3PEWA 2IQIA 1PJTA 2GN6A 4G67A 3H8WA 3U7QB 3T3DA 2WWGA 1YBHA 2PBZA 4KDEA 3UJ9A 5CB4A 4YMTA 1SUDA 1ND6A 1QH9A 5A7GA 3PDHA 5DCWA 3W78A 3O3NB 4XI9A 4LN1A 4QD3A 4H4DA 4LYEA 1SOAA 4G4IA 3KT6A 3OQNA 1OFTA 2Z6VA 1QHYA 1KGDA 2AOTA 3AP2A 4CGYA 4FNOA 2OESA 1YS1X 4G65A 2X2PA 3VU3A 2FVXA 5C1PA 2A0KA 2P3QA 2ZQ5A 5JH7A 5KNCH 1KO4A 3BGIA 3BORA 1H05A 5ICMA 2ZCUA 1TTTA 2O2YA 2WW8A 1XZLA 5M5BA 5BVGB 3VOTA 1YQXA 3UENA 5CFPA 2C5BA 4IOMA 3G2PA 2O14A 4E51A 4QUBA 5LQUA 1N5DA 1DXYA 1JFFA 4PVDA 4REMA 4CMEC 4AU1A 2G72A 3EXFB 1AQUA 1FDRA 2QTWB 4ZIRB 5A2QA 1K89A 1W6RA 1RWMA 4U8HA 1LNQA 4S0ZA 3Q7IA 5J4VA 1XKLA 3K96A 3A1SA 1EX7A 1NRWA 3LXMA 2IKSA 4QDJA 3ZQUA 5KNBH 4N5MA 3Q4GA 3C6YA 3AM4A 1YK0A 4IO1A 4BX0A 3MJFA 3FFWA 1LK5A 5P21A 1PN3A 2JCXA 2P5YA 4JY7A 3MBIA 1XEXA 3IVAA 4LZZA 4B76A 1DQPA 4DDTA 4MLDA 5FO0A 3VDNB 3HGQA 1M6HA 1HG1A 1Z0KA 3GFSA 4IX1A 3S81A 1XJCA 2XE7A 3C3PA 5AI8A 3U7GA 1Z33A 1FLVA 1QQ7A 2WIKA 4U2EA 1KH2A 3EG9B 1G3MA 2QX9A 2H57A 3D8RA 5E7IA 1GG2A 4H1TA 3ZHOA 5CDSA 2FWRA 4IEEA 5SZKB 1RJ9B 4NCJA 2VF4X 3L0ZA 3AF5A 4B3HA 1ONOA 1A9YA 2R48A 3OLQA 1V3TA 2V7BA 4HYQA 4ZANA 4QU0A 3MB8A 3OCXA 1PE0A 2A9KA 2FR1A 1X1DA 4X6YA 4BDSA 2WNIA 3QY0A 3URKA 2PQ6A 2P1RA 3REFA 2VUIB 3DZHA 3UFXB 4D79A 1H4SA 3T5GA 4M0FA 1DNPA 2GEBA 4DVJA 5IVKA 1OI7A 2GWHA 4A2QA 2RGNC 3AR5A 2QXTA 2IDJA 1DHTA 2YBDA 5C4GB 2FWMX 4L72A 1WPQA 1EESA 2I7CA 3FMFA 3M5WA 4ISCA 3R40A 1Z18A 4W7SA 4R2LA 3EJ6A 1RLMA 4NMLA 1XCBA 1SRQA 2JDIA 2DBZA 3GDFA 5HFAA 3TL6A 4TTSA 4WX2B 4RHUA 2IU0A 1EXVA 5BN1A 4BRUA 1X1BA 2W0SA 4F84A 1KYYA 3MD9A 4GXRA 1SBCA 5DASA 4ZMBA 2PH1A 3MSXA 1HE8B 1HDEA 1OB2A 3VR6H 6LDHA 1DG3A 2O2EA 4K5QA 4P7BA 1SHKA 1BTOA 2NUTB 3CV3A 3O47A 4B8YA 3CZQA 1DKLA 3SYLA 4AJPA 3BS4A 3N8NA 3U4AA 4G63A 2DU8A 2YJZA 2W2LA 3A1NA 1JN0A 2CT8A 4YAGA 5CDFE 2YV4A 3EFBA 1Z88A 1ZX1A 2NZYA 3LAWA 3PYMA 1RLOA 1U0JA 3GN2A 4HQNA 5BW6B 4YAUA 4WN9B 4XUDA 1SH7A 2ZUVA 3RR2A 3G02A 3CNHA 2FEPA 1J70A 3A2MA 1T4CA 4H1WA 2QT9A 2B4KA 5FWXB 4DV3B 3VX3A 1IOLA 2P2ZA 2ZIGA 3QNUA 1O0SA 3ETHA 2HDHA 2F1OA 3WR5A 3R74A 4BQSA 4IDQA 5IXSA 1PT9A 1BROA 3IE2A 3UAZA 4BMYA 1GSHA 1GWNA 1V16B 3BDAA 2IHZA 5IARA 1GEGA 5ENZA 3ZD7A 1IQRA 1YIDA 4FKZA 4BNXA 3ML1A 4J1NA 1ESZA 3CURA 3OQOA 2JLBA 3DGFC 4M0DA 2R5NA 3ZDFA 5INTA 2ISQA 1YR7A 5JXGA 3D7NA 2I54A 4CTKA 1BN7A 1FLDA 4U00A 3W6PA 1GUBA 1DAEA 1GKLA 3SBDA 1CDEA 5DIFA 2H92A 3UGJA 1HYBA 3MUFA 3HVJA 1L1FA 1YK1A 3HXPA 2C58A 3O83A 4FP9A 1A8SA 4NU0A 4H6PA 4DEYA 1X7GA 1AO3A 2IXBA 1CT9A 3PNLA 4UBNA 3R76A 1SA0A 2Q8PA 2P4EA 1TO2E 4IIJF 4ECEA 4WVFA 1YONA 4BZXA 4EGCB 3SKYA 3SMVA 4INOA 3M4JA 4LXQA 3NDBB 1I8TA 9LDTA 4E08A 4P7FA 4P58A 3EIFA 2CVFA 4D9MA 4HSGA 2XB6A 3IQHX 1FSPA 3A9WA 4YFYA 1OX5A 5ENDA 3QBVA 1H22A 1DUSA 4FC6A 1QLHA 4DCTA 3N28A 2JFXA 2N1BA 4FD2A 2IEIA 4ZOQI 5HHTA 2W6NA 1OTHA 1UEIA 2A1IA 2GSWA 2HLDA 2WWHA 2VQFB 2RGRA 2DMRA 1LY1A 5EHZA 5DYIA 2OV2A 1CNEA 5FWYA 1WCWA 2BE7A 4MUBA 4TQAA 2PK3A 3IAXA 4CLOB 4URVR 2QZJA 3A37A 3HSKA 1DLJA 1C7ZA 2ZYDA 1Q1BA 4RJJA 3VPSA 4I6EA 4U63A 3VYSB 2BIFA 1UIMA 4LHXA 3V1NA 3TPCA 2WDPA 5T57A 4ZO6A 9ABPA 4ENRA 5KNDD 4K05A 3H9QA 1ECLA 2UKDA 2OBFA 4NE2A 1MAAA 4ZVOA 5TVGA 1WVIA 3P9YA 4LISA 5CFRA 4G0WA 1H0RA 4QM6A 4HADA 3RSHA 2DHCA 2VRWA 2CL0X 2J3DA 2Q6LA 1RYNA 2M6RA 3SIWA 4MK4A 5AFSA 5F1YA 2CFTA 1YHNA 4GR9A 1U6KA 4BS9A 5BSHA 3BOSA 2HM7A 4NJEA 2XUKA 3HB7A 4D45A 3AVYA 2QVCA 3IDQA 2XTAA 3S5UA 1D5WA 1E6WA 3ZE7A 1PFQA 2IHYA 5FOTA 3VR4D 3F49S 3MWFA 4RSRA 5CDHA 5LU9A 5AM4A 1FL9A 5CH3A 4JFRA 1QZ3A 4M9RA 3LY7A 4IV5A 1E92A 3HVUA 1U3VA 3AQ4A 3D1VA 3U0VA 3ZZMA 4JBXA 3GVCA 1QQAA 4J2HA 4CLOA 3ZBUA 2PZLA 1G3QA 4FD3A 1BHQ1 1SG6A 1ZCJA 2H1FA 2PKYX 4QTUB 2OBYA 4M87A 4Q5IA 1FBNA 2QTFA 5JCJD 1ISRA 1K2WA 3RVSA 1Y3BE 4OM7A 2X8BA 3U3DA 3QTLA 3CPHA 4K86A 1JAIA 5D6OA 2QZ4A 3C1OA 1RP1A 2C8JA 4G6ZA 3OMWA 1ID8A 3NIBA 3TUIC 4FZ3A 4IMJB 4J0JA 1EJBA 2HWUA 2IYFA 3HEMA 2HCFA 4HQRA 4RL6A 1XL0A 1HURA 2GZAA 4DLXA 1FSGA 1SC3A 2IYRA 2WJIA 3B60A 1HDCA 2NTYC 1Z83A 1JU9A 2OORA 4KTVE 4UEJA 4XGRA 1E2HA 2ZBUA 1U7XA 3N2KB 3TDMA 2ZYRA 4ZVRA 4LG1A 4ZCQA 3ES9A 4BNWA 1UOQA 4DHEA 1W5FA 1X9IA 3DHWC 3KVNA 5BWOA 1X87A 5KWIA 1Y1RA 1JQEA 2CC2A 3FUXA 3G49A 2VPQA 3B1KA 4AMBA 5HM8A 1ORDA 4YQYA 1F2TB 1GADO 2JIZD 3TK1A 5CA1F 2NT3A 3QLUA 1GDDA 5JJIA 5DWQA 2P2YA 2VT7A 1JLRA 5KSYA 1YJ8A 2G82A 3IV9A 4RKYA 4RY0A 1W36C 1ES9A 2OLEA 2ADMA 4FWBA 4YMVA 1YZGA 4AKSA 3NC0C 1I4EB 3AXTA 4G1BA 4BZQA 3O82A 1JXOA 4D97A 3E48A 1RJEA 2PFGA 1U2ZA 3FAKA 3K4PA 3PR3A 5I7UA 2A30A 4MJ3A 4EHIA 3HXOA 4IX9A 2AOXA 1XXLA 3G5TA 3S4YA 2Q8NA 4N82A 5DXJA 5I7FA 9GPBA 4KXNA 4M60A 2YWCA 2ZYGA 4KBYA 4WESA 4R40A 4RPHA 3ZQ4A 4UCQA 2F2TA 3MYRA 5AMXA 2Y68A 5ESWA 2QRNA 2ZKIA 2EL9A 5CHYA 2W6ID 3A36A 1R0WA 4FGUA 2GN4A 4IMRA 2CXQA 5HMMA 1YS7A 4K9MA 1XTKA 4RIEA 3KKOA 3V7UA 1I2ZA 5BORA 4AG3A 4L8VA 5CLJA 1THTA 5M2QA 4LDPA 3B3JA 4XLZA 1DDGA 3BA6A 1V9SA 2QGNA 3JPWA 1PSDA 3VO9A 1ZUNA 4NEGA 3CG0A 1GUZA 3K9BA 3OX1A 4S05A 2I6QA 4OFBA 2XWSA 3AJ8A 1JDNA 3F7MA 5TS2A 3AERA 4NOKA 2DPYA 3DF7A 3PPIA 2IW3A 5JQWA 2BEJA 4MVJE 3QE9Y 1HPLA 2NYVA 4P22A 3CUEF 2PZGA 2I7DA 5HW0A 1ZM2A 4X65B 3TGLA 1QCDA 1NP7A 3LH5A 2FKAA 3AFIA 4FQ8A 4Y2HA 5I7AA 3R7SA 2C4VA 4GPBA 2P90A 4Q82A 5ULLA 4QBTA 2OCKA 2VHXA 1N7JA 2I4OA 4GPZA 2M32A 4ND6A 4Z9FA 5HKBA 4HDSA 3DZCA 1HYQA 4RTLA 2JFUA 4BWVA 3OZFA 1M2HA 2ZBFA 4EY5A 4R69A 4DW8A 2OG2A 4GZMA 4JLDA 3UEOA 1A1VA 3PQ7A 2QLLA 4P83A 2B36A 4B45A 2GAJA 3II6X 3IEXA 2CNDA 3NO4A 1HY3A 1E6MA 3KLBA 3PUWA 4L7QA 1ABBA 4R6WA 3WKCA 4K9KA 3OCYA 2Z08A 1KTIA 3DHVA 1SQFA 1P45A 4G5QA 3EGWA 3O8RA 2GCPA 3KSDO 4ODIA 4D3DA 2G6BA 4Q4JA 1CR4A 3OQJA 2F3QA 1E6EA 3H05A 4H3VA 5EMNA 3VYVA 5LMUB 5AW9A 1BEUB 1E79D 1XKTA 2D3TA 4NLLA 1TM1E 2ETXA 4IHKA 4JL6A 2NT4A 3PXUA 3THYA 3GLFE 3VO1A 1A7UA 1ZITA 3V7FA 1LSOA 4X3CA 4QPCA 3K8ZA 3DL2A 1VHJA 4BVLA 3ND7A 4EOGA 1RBQA 4LX8A 1Q6YA 5FDFA 5F4BA 1R00A 1V8OA 5CYFA 2D2XA 1NA5A 2VPPA 1IFXA 1I0ZA 3O8OA 2FXVA 3G5AA 3OIFA 3ORRA 1JBKA 3QEMB 1GPJA 1QHEA 4UDOA 2TS1A 2EP5A 4O1HA 1ZZGA 1RAHA 1U7PA 1XALA 3QJ5A 4KUHA 4CE6A 5EZ5A 3OZUA 2P6PA 3FB1A 4B7AA 4L0MA 4CMKA 3ZWQA 2RBGA 5GM2A 4G37A 5CMLA 1HXHA 4B5LA 5L40A 3J81k 3BD6A 4IGFA 4AX4A 4JHXA 2HRCA 4NULA 1JV2B 4EB6B 2C3YA 4GXQA 2RBEA 1E2FA 4R7GA 2AK3A 2WB2A 1UBHS 3HY4A 3PVZA 4YXWA 2CUNA 4WGFA 1O58A 3PC8A 3DLHA 4YRQA 1M2OA 2NVUB 4BQRA 2FLKA 4D4JA 1LCIA 1RC1A 4UXHA 3W0LB 2PMCA 3KEQA 2VHZA 1EPUA 2OENG 4WNIA 1VIYA 5KSOA 2NV0A 2OGUA 2RGYA 4IDCA 4TXNA 2W70A 1J23A 1I94B 4UULA 3T94A 1E99A 2CXXA 4KXQA 1WZ2A 1AKNA 1ZGBA 1GUAA 2WFZA 4TOIA 2DR0A 1J2YA 1MO5A 3FWYA 2ZZNA 4NV1A 2HRZA 2ZRMA 1W5TA 3QNMA 2V3WA 2M1XA 1FUIA 1ZM9A 4ZOLA 1JEAA 1JXQA 2BFOA 1S02A 3L01A 1HE2A 2RGNA 2GN0A 3GDHA 4EYOA 2FR8C 4L9AA 4UCWA 3LDGA 2IXDA 1BDMA 3P27A 4HL6A 4RQBA 2J41A 5EP4A 5K6TA 3IX7A 5DWDA 4XGKA 3MTEA 1DAFA 2PRYA 2FOLA 1O7JA 1W88B 5JMTA 5ARCA 4PO9A 1WVGA 5CYPA 2E48A 4JX8A 4BFVA 3LPDA 4L07A 1SCQA 1FP4A 3HJTA 3ZBTA 1KDYA 1IN1A 1L4GA 2X58A 3VZSA 3THXA 3C3KA 2R6AA 3DE5X 4BLSA 4N41A 3KXKA 4CDMA 3J7TA 1EBFA 4BVEA 4BLOA 5K45A 3I2HA 2QJTA 4OQYA 3JASA 4BVKA 4X6XA 1XNRB 3OLCX 2XD9A 5FOVA 1PF7E 5DI9A 4P34A 3DO5A 3CR7A 5AVUA 1NQ5A 4B4KA 2HO5A 1KJ9A 3LUHA 4DQ0A 4ZA2A 4UVEA 1T36A 3QKIA 3RARA 5IUJC 5IZ4A 4P3PA 3SLRA 4AJ1A 3UT0A 4KVAA 2I33A 2TMGA 5CPBA 4JUDX 7GPBA 2KE5A 1NUPA 3V8NA 4RA6A 4RD2A 5CXUA 3FMVA 5DW3A 3ZEAA 3VKHA 4QXOA 5E3HA 4PLVA 4JXKA 1M2JA 2QTLA 4I19A 5FV4A 1EIWA 1FYDA 1XZEA 2DFDA 1TD1A 3CINA 1UK6A 4L8YA 1WMBA 4TL6A 4UOEA 2IX3A 4MUAA 3B7PA 4M7RA 3TW8B 3N8KA 3OZGA 1VOTA 3AINA 3F4BA 2H9IA 4KPEC 5DPMA 2FWBA 4B6FA 1W36B 4CG2A 1DC6A 2G9NA 4BNYA 2ZT6A 4WZAB 3CW8X 4WZBB 4RHFA 4O2AF 3SXUA 5CX1B 3Q9LA 2ASVA 1H9BA 1OAOC 3U09A 1I7DA 3AI2A 3I6BA 5K8UA 4LI3X 3LECA 4E4YA 2NSHA 4US2R 1RHJA 1TM5E 2QVLA 1XCMA 1H1LB 1X2EA 3BMOA 1E62A 2IA5A 3HB9A 4ARBA 2GA9A 1W87A 4WDQA 5IT9A 5EFZA 2I2AA 3ITNA 3ZGZA 2D5CA 3KO8A 1QJ4A 5IT5A 2PRSA 5A7HA 2QMQA 4X64B 4RIIA 2PXCA 2GBIA 1VECA 2NXEA 2BGMA 1IHYA 1CY0A 5ELLA 1T24A 1C80A 4GMDA 2X9QA 5LN1A 2R6DA 1RC0A 1ZH8A 2E6UX 3GRYA 4JDPA 3JQQA 4LNAA 1EDOA 4PO8A 1JKIA 4PPGA 1L8XA 1ULUA 2ODBA 1U0LA 4EDHA 3WGMA 4KWCA 5KJFA 4RY9A 2WUDA 3FF4A 5B1YA 5DX1A 2FV8A 1C7JA 3HYCA 1V7CA 2W8BB 3JYQA 1UC9A 4C30A 2VZ9A 1IU9A 1C1YA 3NB0A 4GR4A 3GVPA 4FJ1A 3W06A 1CB7A 3U3MA 2YJ4A 5AW8A 5HQ3A 3CX3A 4RHXA 1I3CA 3K8YA 4J94A 1LQUA 4V1CI 1PYOA 3B3AA 3AJDA 5H3HA 2R0QC 4HBGA 3PC6A 3FFBA 4DR6B 4CF7A 1C8LA 1H8EA 1Z07A 2AE2A 2NUPB 3AY7A 3OSZA 1N2CA 4BMCA 4C0HA 2BH2A 1OH6A 2FEWB 5K0NA 2I1WA 2XEXA 1NJ1A 5EJGA 1NXOA 4RV5A 4JXXA 3V3TA 2BD0A 1LW7A 3ETCA 3SOPA 4NCBA 4FOSA 4C5BA 3OQIA 3SG0A 5F52A 2ZFUA 1JQJC 2GUWA 2CB0A 5A1TA 1NRIA 2VCYA 4HMOA 3LUKA 2VFAA 4FNAA 4JJ6A 1CP2A 4UVIA 4YRDA 4DCCA 2XRZA 2VYFA 1XYGA 1A69A 1FTWA 4HH0A 4XD7D 4YRCA 5ERXA 2GBCA 4WTOA 3GZJA 1TA9A 3EXEA 3L05A 1JFVA 1OF1A 3C1TA 4G1FA 1EVJA 3WZ2A 3NIFB 2CNLA 1VM6A 2P4UA 3R4CA 3DLIA 2ZJ8A 1NVGA 3OF3A 1QHHA 3IB3A 1RXVA 3RYTC 3VI4B 4EUSA 1VKNA 3AVQA 5LDDC 3KU4A 5EE9A 2XZOA 4LE2A 1Z45A 3GF4A 3LC0A 3UWDA 5TIIA 2WWVD 2QT1A 3UK1A 1KVTA 3HYLA 3TIGA 1BSVA 2XYVA 4XUCA 1FRNA 2WTNA 4X41A 1JFRA 1OCEA 1OZ0A 1GGEA 3DBOB 1OZAA 3X1ZA 4YS6A 3R0XA 1IQPA 2BE9A 5FJIA 1ULZA 2DCUA 1BYIA 4KEAA 1YFJA 4BO3A 3QV2A 3P5BA 2JBHA 1B8NA 1ZGAA 4V2UA 2CVHA 3L0SA 1LA2A 3I64A 4MGYR 5GP1A 3SXUB 3WKBA 1AQIA 2QLFA 3KOZA 4TPKA 2QW1A 3FOEC 3VKGA 1G21A 4WXHA 4CNBA 1Z82A 2Y1FA 3PUKA 4TXHA 2BBWA 1L5HB 1N6NA 2Z3ZA 5CAEB 1U3FA 4MX8A 2J46A 1EM6A 4W5HA 3LS2A 3PD7A 1YCGA 1NI4A 3PPVA 4XD7A 3L06A 3D6FA 3IPLA 4R3UC 5T41A 1YUBA 4AXXA 2AEJA 3HV0A 1W6UA 2GZDA 3N53A 4F1JA 3I34X 4ZZ1A 2N47A 4X20B 3ASUA 3IVGA 4WNAA 4CLHA 2IH4A 2D74A 1U0EA 3PFIA 5ALDA 3FDZA 3NBQA 1N5JA 3AWIA 1EEXB 4M9CA 3LVFO 3M4ZA 1EMDA 4FBGA 4HKTA 4MWTA 5D51S 3F5SA 3RLFA 1Z5OA 3UC5A 3Q1LA 1ODKA 1Z2PX 1NSFA 1EWVA 2H7VA 2H9YA 2VAXA 2VCEA 2VTEA 2RJ3A 3E4CA 4HAIA 2VPXA 4YYEA 2JIPA 4YDSA 1X19A 1RMYA 2BUCA 1KMNA 1P4AA 2E37A 3QELB 5HCIA 1R74A 2WIAA 3CX7A 3K0CA 1X15A 3DV2A 3PBKA 4LVCA 4G0ZA 2XT9A 4AS3A 1XZDA 4E21A 3OIYA 2O8BA 4AZ3A 4B6SA 1MD9A 3W3ZB 1H3FA 2G83A 1Y5RA 1YNSA 3LDUA 3VZBA 3QI2A 3ZNPA 4DR1B 3U39A 1ZEJA 2RAUA 3GGSA 2E55A 4D5EA 4YV2A 3PDUA 1HK7A 2Z98A 5FYDA 3NMUF 4M0UA 3QIVA 3L93A 3N39C 5AO9A 3O92A 4XM2A 1GFWA 4QQKA 4I3HA 3W9UA 3C7KA 1UJBA 3GH3A 3OD5A 5FAXA 2F3UA 2AVDA 3LXUX 2C9DA 2AQIA 1SKUA 1WQ1R 3NRBA 1SBZA 5A06A 5KOJA 4JI4B 1PWHA 3EUWA 2R8PA 4FOOA 4CLDA 1I30A 3GC6A 1Y6RA 3GPLA 1N6OA 4URFA 5JDCA 2J6BA 5KINB 1PR3A 3PUJA 3IUQA 3A06A 1L4UA 1Q12A 4BKQA 2O1WA 4KIJA 3VHLB 3VR1A 1QM5A 2D3WA 4BLUA 2ZT5A 1Y7LA 2OQ2A 4Z49A 5CFQA 1I2BA 1EU1A 2YY6A 4GU5A 1BC5A 2X5XA 3IAHA 3KQPA 4G3XA 4XASA 1RQNA 1M76A 2EF1A 2WEKA 3PZRA 4FZ5A 4FPXA 1E1CA 3PQ5A 4ZALA 2PWYA 4A5SA 4N0DA 4YAWA 5FOUA 2NZWA 1VSQA 3L8MA 5LA6B 5LP6C 3VVCA 3CLSC 3GBPA 4UU1A 3H13A 1JVBA 2E1PA 2HF9A 4PC6A 4X9XA 3K7EA 1EFUA 1F2VA 1TE2A 4GWLA 2JVIA 2NPIA 2W2VA 4H7FA 3VH2A 3AVTA 4AZWA 4WOKA 3W34A 3UPUA 4HOYA 4CZ2A 2PX6A 3PR1A 2YZGA 2PRJA 2AG0A 4QYTA 1KZ7B 4OYHA 1YI1A 5IABA 4EQ6A 4P0PB 2X0EA 1V8FA 1XTVA 2QMEA 2AI2A 5C3UA 2BSQA 3AUSA 8ABPA 1M2WA 2XCOA 4C6TA 2IYOA 2RAVA 1YFZA 5JS6A 1WLYA 4H6VA 5KVCA 2RE8A 4IHJF 2P7HA 2P5SA 1MEJA 3BJMA 4YMIA 1CQZA 2HA5A 4GUAA 4IIGA 2Q1SA 2RK6A 2D2VA 4GFDA 4E7OA 3DO8A 5L3ZA 1QYWA 3IQIX 3OA0A 4U7DA 4DDVA 3OMXA 4J16C 4HJXA 3QVOA 1OLSA 4DIOA 2GWRA 4Z5XA 2GXSA 4DMRA 5LDGA 5AI6A 3WAJA 1AGPA 3W1VA 1X74A 3W7VA 4NE9A 2GD2A 5A71A 3ROZA 1DRVA 2W00A 4Y1RA 3SF0A 5I45A 5IHPA 3MINA 4BMDA 3AVUA 5JZOA 3T5TA 1NNUA 1OBVA 1XK6A 1UJCA 3FLEA 4RYDA 1ZL2A 1JLSA 1NKTA 1OWNA 1RMQA 1W85A 2W4IA 2PL5A 3OIWA 4HZUA 2BF7A 1WY5A 2XE8A 3ABQB 1MABB 1W49A 1K06A 2JIBA 3C43A 3G9TA 3NIGB 2IZ6A 3NOQA 4UXJA 4ZODA 5E38A 1DQRA 4F38A 2Q9UA 1NW3A 2YHSA 2Z0MA 4IS2A 3AO0B 1CVRA 4PLCA 3ZW9A 2I9KA 4MQBA 5ECDA 4RLHA 4GX0A 3RVPA 3A6ZA 4J3JA 3KLPX 4MB6A 1G8FA 3I9V6 3W5AA 3R3ZA 1KAHA 4M0LA 4R1QA 2VK8A 4P0TA 4N12A 2GKGA 3X44A 5MFPA 3B6MA 4P7GA 3OJ0A 1NPTO 1XTBA 1H94A 3IPAA 4QWWA 3PHGA 1IY8A 2NPFA 5KQLA 5BR8B 5EOVA 1MPXA 1EUCA 3LPMA 4L85A 1A8IA 3BICA 1DCKA 3T0GA 3MMPA 2G0TA 1NV9A 2YVAA 5AVKA 3CZCA 4F8YA 2E4VA 2N3ZA 5DXAA 3ZEIA 1X14A 4CU5A 4Q9LA 3RADC 2R00A 3T7EA 4O2AB 4PBRA 2ZUFA 1R4NB 4Y0VA 3L84A 4KR2A 1LPNA 4INJA 1UL1X 4CKXA 2H5IA 2WAAA 3DE2X 3H9EO 2Q41A 3TCKA 4Z7NB 2DRIA 3CLSD 2YCBA 1J1UA 2AC4A 1QPBA 3CLUC 4W82A 1VKRA 3TLXA 3WWOA 4BV2A 2GJKA 5THXA 3TG8A 3FTDA 3TTYA 3WBFA 2O3QA 4Y2VA 1GTZA 5EIBD 3RJ5A 3VGJA 3L0IB 4WAUA 3B82A 3UWSA 3PFGA 1KMCA 3Q10A 3TVDA 4AWBA 1OLXB 4HJRA 5CDTA 3AEQA 4D9NA 2QRQA 2GD6A 4L78A 4QJ3A 5B37A 3TF5A 3WMRA 4A73A 1O1YA 4G01B 4AG5A 5JEEA 2OFOA 3H1BA 2RONA 3OHSX 4A8JC 3HJAA 1BYUA 2ORVA 3KR0A 1YR3A 1LBTA 1H5QA 2OCAA 3AB7A 3MAGA 4HAWA 1IY0A 1UPUA 3G13A 4R51A 4NJEB 4X84A 2CJWA 5AOBA 1IUPA 2BLNA 1Y1PA 2Q5IA 1K8RA 1MAWA 4UHHA 2IYXA 3P2YA 4YJKA 4EI2A 2I3ZA 3P32A 1KJNA 1WOMA 1WU8A 1AKTA 4FFVA 5HVNA 1DWUA 3P2IA 1GDTA 4LDQA 3RVRA 1TD9A 3DZFA 2CEKA 1KEKA 1UJ2A 3EPHA 1LI7A 4Y2SA 4EL5A 1NAHA 5BMVB 2ZI7A 3EY9A 2XCUA 2N1MA 4C5AA 1ACJA 1QOQB 3R3WA 3B5EA 1T1EA 3SBOA 1P0FA 5JZSA 5DTQA 1R16A 3MERA 3NFRA 4U39A 4BECA 5J4YA 1VMDA 2BGWA 1L7XA 3QLJA 3D9QX 4GBED 4ZAXA 1T5BA 1TYEB 1T5DX 3EXHA 5EMMA 3DVLA 3C6XA 2NU6B 3O3MB 1JSRA 3PFWO 3PX3A 4OLJA 4QELA 4UDXX 1QO9A 3QFTA 4RYLA 1ZWKA 4I36A 1YZKA 1OT5A 5AVOA 1NVUQ 5CD9A 1JJAA 5IM5A 3AR3A 3T99A 4PRKA 3I62A 3L7IA 3LYUA 4PG8A 4F4DA 4OJYA 1E4OA 1RWQA 2FW1A 2FN8A 2VUTA 2AEFA 2WYOA 3M6XA 4HDSB 4IUYA 4LRYA 3EGCA 3ZDYB 2H8GA 5A4FS 1UBGA 3TMYA 4DM4A 1UPAA 1KO5A 3GJTA 2B78A 3QKRA 2UUOA 2X6RA 2SBTA 4I50F 3CX4A 2XOEA 3DT8A 1P31A 5LFAA 2XA9A 1DADA 4Q15A 4EAQA 5JI3E 2N9UA 3GMDA 5EUCA 1GKKA 3EIUA 5BNTA 4PCAA 1E0JA 4P36A 2AFVA 3PRKE 4WGGA 2O8NA 4GM0A 3KUKA 5ALXA 5KYGA 2IF2A 1N2OA 3LYHA 5AIAA 1YOBA 2PU5A 5K1ZA 4ECAA 1MABA 2HUPA 2RIRA 3HWX1 3ROPA 1SXJE 2POCA 1DCMA 4R1UA 4ZO9A 2YMMA 5FWNA 1TUEA 4CI9A 2IHUA 3PGMA 2EV9A 4OK3A 4TROA 2CLDX 4WNYA 5DHRA 4LF5B 4R8KA 2RHOA 1S2MA 5JISA 3RHTA 4ETMA 4DC1A 3L7JA 1J25A 4CJXA 4LF6B 3SE0A 1N6KA 3PE4A 1C81A 2E7ZA 2FK7A 3NTUA 1G42A 2IT1A 5JSZB 2DY1A 4OGFA 5IK2A 3DAYA 3WJ1A 1U02A 3OUZA 5FCDA 1AXRA 1UZLA 3A9UA 4LTDA 3VKVA 1V41E 3QPUA 5CVTA 1JHYA 2DHRA 2EARA 2VYND 3ROEA 2BFEB 4PG4A 1Z63A 1ZNXA 2GDJA 3KB2A 1F51E 2Y99A 4QEDA 3H3FA 4HG2A 4MRAA 4GQAA 1OAOA 2BFBA 4B6GA 1TUBB 1CY2A 3BK2A 4KR0A 3JU3A 1RKXA 1VE1A 4GKBA 2PL1A 1EFRA 4QEKA 3ZDQA 2AOUA 3RRBA 3DPIA 5EHIA 4MCIA 1LV7A 3AB8A 4ATNA 4MS1A 4E2ZA 1TYCA 3H2GA 1VPTA 3JD2A 5TT1A 1PUIA 2HF7A 3V00A 3OZSA 1T13A 1ILEA 1QRTA 3BMCB 1C0PA 1KEZA 1NBWB 4INAA 5DHAA 3ENZA 2CXPA 3DQZA 3GDOA 3NTQA 4Z2YA 3TSWA 2VHVA 3BERA 4LIPD 1HLPA 1LFAA 1ZGCA 2ZSIA 2D5BA 3DOIA 4OH1A 1JKJB 4ID3A 5IKOA 4QO7A 3IUMA 4IH4A 1DG1G 1CUGA 3WADA 1EGHA 3UWOA 2Y1EA 3GJ3A 1JPNA 1F2UA 3P0JA 3R9XA 3I6YA 4DY4A 3REQB 5IRCD 3BHJA 1QRRA 4RTMA 3RWMB 3W2IA 1BHSA 1NXXA 4TUYB 4TS3A 4YGYA 1KJWA 1R0LA 1RI5A 3JYPA 4LXGA 3S2SA 3GNLA 4FHZA 3SVZA 3TRJA 3UQYS 2FJPA 1IBMB 4Y67A 2ERYA 1VGVA 3P26A 2NYRA 1GYQA 3QG5A 4JLWA 1XRSB 1A9PA 3TQOA 3C3BA 2HREA 2I4NA 2XD4A 4IZHA 4AF8A 3LC7O 2WZCA 4FCVA 4LX0A 5IJWA 1RCFA 5LB2A 1JIQA 4I46A 5B3KA 2FWAA 5IZCA 1JE0A 1XZIA 3FVVA 3AVPA 3UJ3X 1G20A 4HNVA 5JALA 3U3KA 2H08A 3AEKB 4LE1A 1S0UA 1XSEA 1CQIA 1YRYE 3MWGA 2B83A 3WX0A 1SM4A 1JDBC 1T4MA 3CJQA 4YMWA 1PCXA 4AF6A 2W7TA 4IKOA 3EWNA 1NMXA 1HTTA 2R1UA 3R4VA 4C06A 4EKDA 2RB5A 1U3UA 2UZ1B 1XPOA 5KYUB 4RGVA 2HGSA 3DOJA 3GB9A 4FYVA 2B2XA 3H8VA 1P18A 3I8OA 3KP1A 4QAQA 3R8CA 5FULA 3TEMA 3T1QA 1KZ6A 4NCXA 1S7GA 5IMSA 3KVRA 5KCZA 1LF5A 5B3LA 2ZAGA 3FUTA 3QPWA 2HBZA 4KUEA 1ILWA 3KB8A 3ERCA 1OFGA 2Q0SA 4OFWA 4OKNA 4WKGA 4GP7A 1OLUA 4PX9A 2H4HA 1U8XX 2RIPA 2VDRB 1NQAO 3AHEA 3IT1A 5KSPA 4ER5A 5LMCA 3W04A 1EZ1A 5FR1A 2YNMD 1AS0A 2R47A 4GH5A 3AR8A 4JLAA 3D81A 2CNNA 4WZBA 4P93A 2XCQA 1E7WA 2WJVA 1J4AA 2DT5A 4MR7A 3CEAA 2ZSFA 1NE7A 5IAJA 5K0EA 3OZEA 3CF0A 4K8OA 4ZPJA 2XF2A 1IG0A 3DQQA 4GBJA 3A1CA 3KAQA 1T0UA 5CT9A 3BWYA 3HXLA 2GK3A 3KCNA 5D3ZA 3WK9A 1NN5A 1JECA 3TQFA 2EC5A 2FLVA 4P6VF 2IYTA 5EJ9A 2EZUA 4L6CA 5TR9A 3SF8A 2ZDQA 2O2JA 2QTCA 3HM9A 3KS9A 4NBKA 1CJUC 2CZCA 3MJVA 2Z57A 1XQYA 3Q88A 5IANA 2XAAA 1J0XO 2IXAA 2Q46A 2VLIA 4JI8B 4Q7LA 1TFRA 3M1YA 3C8DA 3MSCA 5C4MA 4B81A 3H9JA 1CLUA 3LW7A 5KAPA 4AMUA 3ZVKA 3RWBA 3RIMA 4PZYA 3GEIA 4MYUA 4UHFA 1T15A 3RAPR 2SKDA 1OWMA 1SVLA 3ESRA 4HLCA 3F3MA 1K7XB 5DGTA 1Y9DA 4B4VA 2O3SA 3ZI4A 6PFKA 2ZJ4A 3Q8WA 1JRLA 3SX4A 3RYCB 2YNMA 1V9LA 5D85A 4EUHA 5A03A 2FWNA 3R6WA 3T9EA 4FDMA 4O8ZA 2EWVA 1KPHA 5AXAA 5B4UA 4Q9KA 1HOXA 3G85A 3GG2A 1P2GA 3GOHA 4NBLA 1NG9A 5B7PA 2G08A 3DLPX 3CVUA 1U4OA 5HTKA 2R1VB 2MMGA 3N75A 3L02A 4WI1A 2VRBA 3QEOA 3LQ4A 1MAHA 3NH9A 4M46A 4F5WA 1R0RE 2GHRA 3F5QA 1N2IA 1HZZC 3N6RA 1N1DA 2HHCA 2PLFA 3G5LA 1RM0A 4G0NA 3KLNA 1BDHA 3KHUA 1K6EA 5HZKA 1JJ7A 3B7WA 3ZTWA 1KGSA 3WMXA 1JUDA 3B8EA 3L79A 1QYXA 2H59A 1EIZA 3QFSA 1K5GA 4L0CA 1QF9A 2ZRJA 4MGEA 4DA9A 4H1VA 1XRMA 1H66A 3AJ9A 2VAPA 2QI9C 3ETLA 4S2EA 1V8ZA 1ZI8A 2NGRA 4MIKA 4LFBB 3NTVA 2VNHA 5EYPB 4CQLA 1U8EA 1YDHA 2A1TR 2JIQA 3G0BA 3QX9A 4FUQA 2ZXFA 1OIVA 4R41A 4X1YA 1VRCA 1FZQA 4GLLA 1TUGA 4E7PA 1BMQA 2K6GA 3LQ1A 3KC2A 4RGQA 1B41A 1BKSB 1QBGA 1QHXA 1U81A 4NABA 2PXXA 2W6JA 4KNYA 5IT0A 3IMEA 4P4NA 2NU7A 4J0HA 4DLBA 5ITVA 4GLOA 3UCXA 2JFYA 4JSRA 5ALYA 2GZ3A 2RGBA 1Y81A 2PUTA 4N7BA 4R0MA 2XCTB 3V97A 3T9DA 1RR6A 1QG0A 1SVNA 4DG9A 2XRMA 4EFNA 1IXZA 2QJFA 4Q4CA 3QTTA 1W7AA 1RW4A 1YIOA 3F74A 4M9ZA 1E1RD 3RRXA 2OP1A 1THGA 2ATVA 2GOYA 2W2LD 5A9RA 3BRCA 1CIPA 2QLTA 1PZHA 1J7KA 1JFLA 1SVIA 3MLBA 4XX0B 3WMWA 3L8GA 1EX6A 1NVWQ 1ZUIA 3E5RA 2HSJA 3VNSA 4AYTA 4G5XA 3R9KA 2NXWA 4YAFA 3E6AA 1V6SA 4FSXA 4NH0A 4OIFA 2BL4A 4RC9A 2B5VA 2WF5A 3A4VA 1Z12A 4RPIA 2ZYSA 2FUEA 4N5NA 5COBA 1SXIA 5REQB 1RD4A 2QG4A 4X54A 1AZSC 1PRYA 3DF9A 3KJGA 2VP0A 1ZW6A 2FUCA 4BE7B 4JDUA 3RPEA 1HFJA 4EX6A 5K3OA 3C3JA 4EX7A 4L9SA 3NETA 3ZK9A 1N3BA 1KQ3A 3LP8A 4Z8YA 2IBTA 3Q40A 5C7YA 4KXFB 1R6AA 1ZCAA 2Z5LA 3O94A 3TCXB 4EO4A 1U3GA 4MGKR 2JAOA 3IJPA 2CW5A 4CKCA 4E94A 5JYEA 2WSSD 3FXAA 3W8RA 2XGOA 2AZMA 4RWZA 4BUCA 4HUTA 1DWOA 1QVRA 1MB3A 5JTUA 3T3OA 2VP2A 2Z1DA 3E5NA 3B5JA 1KVUA 4LHWA 4D9KA 2E6KA 1HRDA 1HLDA 1T9BA 1QQ5A 4HDNB 3NGMA 1Q16A 5AOCA 2VNIA 2VP9A 3MMSA 4MQEA 4DV6B 2QD2A 3IDZA 4ENSA 2M9MA 3CVXA 3RCBA 1L1QA 3DP9A 5A4KA 2QX7A 3UA4A 1X9HA 5BR7A 2FQWA 1CJVC 3NLLA 1RZVA 2VNAA 2EU8A 1HKUA 2A57A 1YDGA 1KH3A 5EWLB 3GBSA 3OQ1A 4HWPA 1E3WA 3TH5A 5MGBA 2PUDA 1CR0A 1TRHA 2ZIEA 3AHJA 3IIJA 4LHYA 5I48A 2ZYUX 3EGDA 4YHHB 5CNJA 3I01A 2V7WA 5G3ZA 4M86A 3O8CA 3N7UA 1ACMA 1D8TA 5KOYA 4G36A 3I0NA 4FKBA 8AT1A 1FK8A 4HAVA 3TW4A 1EM8B 3ZXXA 2PRIA 4M83A 4N9WA 4IDOA 1CEXA 2FJUA 4HSEA 1KI1A 4B83A 2O6HA 4NYIQ 4YX9A 1PBNA 1ZQ1A 4LY9A 4ZAVA 4DYDA 1M66A 1PV4A 1QHIA 1QWSA 2VJQA 4RFSB 4QPDA 4P7KA 4R8LA 5TARA 2PZKA 3HO1A 1J0AA 5DF1A 1SOMA 3ZCXA 2BMEA 1MRSA 2BUBA 2RHBA 2QU8A 4XYGA 3H87A 1DC8A 1QRSA 3ZI7A 3R23A 2KYRA 3LT1A 3OLZA 1F1JA 2XR1A 4K87A 3W5HA 3GK3A 4ARUA 4IGAA 3S40A 3VZQA 3TPFA 3RRNA 3R41A 4LYJA 4EF4A 1O9GA 1CKEA 1WDTA 3PXEA 4M1OA 1U9CA 3SQXA 1Q3TA 3CW9A 1JSLA 1LB1B 4TUYF 3FR7A 1ZN7A 3IP7A 1FRVA 4H08A 3KAKA 2VHJA 4GQIA 4MPJA 4ER0A 4DIFA 5F9MA 4MDYA 1R9MA 5BN3A 2Y4NA 2XODA 1G55A 2ZRCA 4FFPA 3TKLA 1M2VA 1E2QA 1OYWA 1WUJS 2BEVB 2WQ7A 1P2FA 2GKSA 1MP0A 3GIDA 4WNAB 4QASA 1VLZA 2XSZA 2RJOA 4UNIA 3K70D 4TZ6A 2WPDA 3BRWA 4MB2A 1N6RA 4UFNA 1O2DA 1BG6A 3PS9A 4MULA 4TTRA 3RG2A 4ZQFA 3ZH9B 4BYGA 1NZFA 3GP5A 3ZVLA 2J0QA 4BLWA 1XQ6A 4Y7DA 4LRSB 5HE8A 4CI0B 3IMGA 2BZSA 2F9LA 4HDRB 2NO0A 2WBLC 2XDWA 3OX4A 2HB6A 2N42A 2ZI6A 3R3SA 3A4NA 2XTZA 3EDRA 1PWEA 1M2NA 1Q2UA 2XYHA 4D46A 5L9AA 4N8DA 4EHJA 1C8VB 2HWXA 2VZ0A 4O2AA 1S2NA 3S2IA 3NAZA 1TT5A 5ELMA 1UWLA 3QVGB 2YXPX 1Y4UA 3B51X 3RK1A 3S2GA 2FPOA 1X8JA 4G4SP 2FAXA 1Z6AA 1I6KA 3DZDA 3Q2IA 4DFDA 4BLTA 4CM4A 1MLDA 2BMWA 2SECE 4EECA 3QU4A 3RAFC 2XUJA 3TL2A 1W5EA 3PUXA 1SUBA 1Z6ZA 4G86A 4YJFA 4DQXA 5GINE 2CV1A 5JS1A 1ODTC 1RHKA 4MCAA 3AR9A 1MDBA 2PWPA 2XUPA 2DWCA 2PTGA 3D3EA 5JCZA 1GCIA 3E82A 2WLTA 4FYXA 1MT3A 5AJVB 2BEVA 3MRSA 5C31A 4Y2RA 1LNSA 1TPYA 3BJIC 3ZK7A 2IP4A 2CXOA 3S2EA 2C2WA 4MVJM 1RQ2A 2CVPA 3V4PB 4YASA 3WO1A 3LC2O 4UM7A 3ZWAA 4RLSA 1DINA 3BJEA 4ESOA 3DKKA 4R5HA 1UKBA 1G98A 3PENA 5J2TF 3CB2A 3QI7A 3JWEA 2QR5A 2AX3A 3H7AA 3RSQA 5MN6A 5JJKA 1MQAA 1UQUA 4F2DA 3ZXYA 2H18A 4HTAA 5L3SA 1JH9A 1YVRA 2YWXA 3G9XA 2B6NA 3LZCA 4BNDA 3AETA 3Q9SA 1RMTA 1J56A 5KTMA 4RJTA 5LNK1 3RIEA 2B8JA 5MHTA 5K3DA 2A9VA 2HXSA 1DO8A 4EELA 4QU8A 2QTBA 1Z22A 3SD7A 1OT3A 2B1QA 4JOSA 3QQ5A 1HGXA 1T1SA 1H9AA 1WF3A 1WM1A 1DFGA 1UK8A 2A5JA 5AHKA 3OJFA 1C30B 5MDHA 1FFEA 2RGXA 3GJXC 3DMNA 2ODEA 2FFHA 3DDZX 4BP1A 1DCTA 2FY8A 5KOHB 3EGXB 1CE8B 1GEEA 5HUHA 2F1HA 3G8YA 4FR5A 1DT5A 5BY2A 1ONBA 3L41A 1JDTA 1Q83A 2EEZA 1YBFA 3P0HA 3G9UA 1J0BA 4PGMA 5JAUA 1CD5A 2EFEB 4H1UA 4IJ5A 4PEVA 4CMHA 3AU8A 3L8YA 1OVGA 4PQRA 4S1TA 5DN6A 1D09A 4YRKA 1QMGA 5K3AA 1TJNA 4EKYA 1DEOA 1SAYA 3V34A 3W2FA 4CLRA 3D3QA 3ZWWA 2J3LA 4BNIA 4KWEA 1L5VA 4DDWA 1OVMA 1XEAA 4A91A 4L5IA 1YXMA 3U7HB 5DSZA 1ZJ5A 4DLKA 1XO1A 1T2VA 2LVBA 1OGJA 3B1WA 2AYZA 4Z1MD 2FR8A 1IN6A 1MJ5A 2EVWX 2AHOA 2ON6A 3ANTA 2R44A 4MV0A 2VWPA 2ZSAA 1ZNWA 3LF2A 3D7SA 3MUNA 4FE3A 3ZJ4A 3TNFA 2Z6AA 1YR8A 2YFHA 4PXAA 1QKKA 3ZV4A 1IRIA 2MU1A 4CF6A 3KSAC 3EVDA 1YNOA 2MSWA 5C46F 3C5CA 1NDHA 3GUYA 4J75A 2BJWA 2J6IA 4J0DA 4CIVA 2I99A 5K09A 5LP1A 3A6EA 1O95C 5BN4B 2W37A 2GCNA 1VJCA 3C8ZA 3IA7A 1C3JA 3PL1A 1XAJA 3WQRA 2WIJA 4NZMA 5AJHA 1SIBE 3OZDA 1L5NA 3ICQB 4G5GA 4K40A 1QBKC 5AK6A 4UNNA 3WGHA 2OOSA 4JJZA 4D0GA 1FRFS 4YC7A 4A7PA 2QNRA 1I9CA 4JJKA 4YT5A 3TR0A 3EG5A 1P1JA 2JGEA 2BGIA 1BVHA 1Y42X 1E3DA 3WJAA 3NFYA 1YH3A 4JX9A 1NVFA 4PZAA 4D4KA 3N87A 2IHJA 4E2FA 2C98A 2OGSA 2P77A 4M1EA 3FYSA 1QP8A 3BJZA 1KY5A 2ZSHA 4QTXA 4BIMA 2Q4TA 2VYVD 1ZH2A 3K5IA 4UVHA 4J91A 1IBRA 3WGLA 3IH5A 3LCCA 3BXFA 5DM2A 2JIDA 5AW7A 1PLLA 5HDQA 1RKBA 1NQWA 3BHNA 1OX4B 2OKGA 3N2IA 4LY6A 1WO8A 1IQUA 1HDXA 1Z5PA 1Z7BA 5DT2A 3V46A 4A8HA 5KYXA 1V7ZA 1N5LA 1JGTA 1CHNA 4BQPA 1LDBA 3WL8A 1WBBA 4YWHA 4L27A 4LNHA 1R4NA 5E2BA 3GGOA 3FPAA 1QAMA 3T5CA 3V1KA 3MCVA 1UXOA 1E8DA 3B78A 4ME6A 3WGOA 2DERA 2JJ8A 3VTFA 5HCNA 5ER6A 1RXIA 2B1IA 2ZBQA 3KUDA 3MG9A 2OYRA 2H4XA 1HFEL 1DUVG 2H1IA 2I78A 1PD1A 3L92A 1L3CA 4S1NA 4Y98A 3IDAA 2HFJA 5EQJB 3ZX5A 4PZEA 5AQ1A 1CERA 4JELA 4LKOA 1UAAA 2JI8A 3KKNA 1DKUA 2LKCA 4R7ZA 1SIUA 4ZHQA 1TFUA 2GEKA 2GM5A 5EXDA 3VUEA 2PYZA 1JDZA 1X6VA 1I7LA 1ENOA 2M6KA 1E2DA 1FLNA 2FZVA 1Q20A 4R4JA 1OGYA 1Z75A 1A76A 3EBPA 3UB2A 4LHEA 3ZBQA 1MA3A 1REQA 2HQOA 2XZLA 2RAPA 1L8AA 4DLVA 1P4GA 1DJPA 3B53X 2DM6A 1VFPA 1BDBA 1PVDA 2PH3A 3N2GB 5ER9A 3VV2A 2GM4A 1SN7A 3RSSA 2UVPA 1ZGJA 4MP6A 4OCZA 1V5GA 4FYMA 1QANA 3O8QA 2X5OA 3LG2A 1M2EA 1T4BA 3PR2B 4IH1A 1Z06A 2OLJA 4JAVC 4Q16A 4UD2A 1E7MA 4KHPB 2FSSA 4J0QA 1C2YA 1FUUA 2BKEA 1I7NA 1U2TA 1ODFA 1EHCA 1O6GA 1QH1B 2JLRA 3RVDA 3WB1A 1N2HA 4C03A 3T5BA 4E5MA 1XTQA 8ADHA 2WY2D 1G6OA 2I1QA 4Y2YA 1XAIA 1Z9BA 3E1SA 2C9ZA 3PJRA 5KTOA 1PR2A 3QJYA 4HFMA 5KQSA 5HNKA 1Q22A 4X60A 2EG9A 3OBBA 3WLNA 1DBQA 1CQIB 3CMCO 3QPAA 5DE3A 3QE4A 4F7DA 1NLYA 3LL4A 3PDWA 1A98A 2IJGX 1CZKA 2NVWA 3OFND 2WKQA 1BE1A 1R0XA 2P35A 4OHUA 4OQPA 4V03A 1X42A 1JBEA 1GQSA 2P65A 2QGZA 3AYZB 3O93A 2V7PA 4NYIR 3OM8A 4TMWA 2YYAA 1G5QA 3ONWA 4OMUA 4NZPA 1I3NA 1R0YA 2GX6A 3BIXA 3JPYA 3DZKA 3NBMA 3O2SB 2H2WA 4NRDA 4RSGA 5LBTA 1F2TA 3HRHA 3WKEA 1IL0A 4D96A 4MV3A 4O4JB 3ZJYA 3QLVA 4FFBB 1UBOS 3WJ2A 5AVXA 3UQZA 3MTAA 4FX2A 4YUZA 3WNZA 5JNVA 1RHQA 1DAIA 3RAGA 3GRVA 1YFKA 4ZARA 1G8HA 1JX6A 5FEMA 4EYEA 1RM4A 1AHIA 3FJOA 3LM8A 2E89A 4JK3A 2FPGB 5H1YA 4A03A 4DXAA 1WR8A 4AY2A 4BC0A 3B52X 3TVYA 3L0CA 5JAIA 1FPMA 4RMIA 1CV2A 1NJFA 3B1JA 4DLPA 3FFTA 2QTAA 2QU7A 4LW8A 4ZCIA 1RXSA 4ND1A 2RH5A 1UMBB 1IOWA 1YCDA 2BFAA 3TGPA 4MKXA 1UJNA 3F96A 4CM1A 1U8YA 2ERXA 3LO8A 3NT4A 3R0VA 4UHEA 2G3YA 3ELUA 5EIHA 3QEAZ 4LWQA 4IJVA 5GQSA 5KYWA 1K97A 1IONA 4GPTA 1FNCA 1N2GA 1XU7A 5ALFA 3PJEA 3GT7A 1YZYA 2Q5FA 1PJSA 4DY6A 5E1MA 1C8BA 3C7AA 2G28A 3FWZA 3LHKA 4GBGA 4JBWA 7YASA 2I91A 1YCFA 1I33A 2ZBGA 1C7QA 2IYQA 5AHWA 3TIFA 4QOHA 1JXMA 3PZBA 5U4XA 3GYGA 1H2RS 2VTVA 4JA0A 1Z8DA 3H84A 3KSUA 2CV0A 1AGXA 1XELA 3AZPA 5K05A 4TQUS 1N3YA 1HLFA 4P4LA 3VZDA 3W2TA 4ZOEA 1FYVA 5CFNA 3OJLA 1V5IA 3Q0EA 1FE8A 1JFSA 4EBFA 1ZU4A 1WB4A 1XNGA 4W8GA 4XDHA 2QQEA 3BCRA 2X23A 4DAOA 3GOQA 4YBZA 1Q0RA 4JJGA 3DD5A 1RIIA 1OWLA 3Q3EA 2ATCA 1XCLA 4HHEA 1JALA 3BF8A 3OTWA 3RYHA 5JBNA 1KNXA 1DGQA 1P4RA 3HVIA 5EE1A 1GNLA 5J58A 4NPAA 5THKA 2Z58A 2P2DA 3K0FB 3STVA 2AN9A 3VR4A 5LIRA 5HIJA 4A36A 3H9CA 3UCEA 2C57A 4B8ZA 4G5HA 3OESA 3PPXA 4MEJA 1BHO1 4X61A 1GNPA 3DNFA 1T9AA 4X1KB 3V8PA 1A4IA 2GD0A 1WAMA 4ISBA 1FSFA 2X9NA 1RPZA 4XTCS 2QZ9A 3REQA 4FWIB 3HABA 1CUJA 4Z4HA 1SUAA 2UYQA 4ZGBA 4MCJA 4XQ9A 3U17A 4GI7A 1WG8A 1P9LA 4YACA 1W93A 3WY9A 3WGVA 1L1EA 3UHFA 2BT4A 4EUKA 3Q8XB 4ZU3A 4YP7A 3DZJA 4P80A 3JVUA 2VPIA 3SSMA 3NASA 5EVJA 3WGNA 2B7CA 3UY4A 1EUDA 2FMKA 1WXHA 2C82A 4EGSA 3OTGA 3T3PB 4DCMA 3QUQA 2JHGA 5L7TA 1G21E 1R0ZA 1VL0A 4M1TA 3IAS1 1GPNA 4BVJA 1CRPA 4MKIA 2QEQA 2IIBA 3MWEB 2GN1A 1YQTA 1ZMOA 2YMLA 4JROA 4ZAGA 5SY9A 3TD6A 4PN7A 1C5KA 1Y0BA 1UXJA 2V98A 3KQLA 2BKVA 2HQ1A 3QPBA 5FKJA 1TI7A 2WJZB 3KOYA 4MVJP 1JT9A 3IBCA 1PS9A 1KO7A 2QVZX 3G1TA 3OVMA 4EATA 5LP6B 3IOMA 1Z4NA 4XJSA 2GAFA 5CEFA 4MVYA 1TKRA 1MO4A 1PZGA 2I71A 3NU1A 4KMRA 2BMFA 4X1YB 1QG2A 5CW1A 4AQDA 4E07A 1DC4A 4TKMA 5JSUA 5J3JA 3OI7A 1NR5A 1ZYUA 1ISFA 2G7MC 2VYVA 5JPIA 1NFQA 4FK8A 4IUCS 4B44A 3KQQA 3RVQA 4CTMA 4C0JA 2OL4A 4QGSA 1J1ZA 1TKCA 1QG6A 4IFTA 2C20A 2GFQA 2YWHA 3E3LA 3PQEA 1F06A 1UBMS 2ILVA 1C9NA 2ISSD 3O5AA 1F4PA 3D0QA 3DXZA 3WLOA 5GVSA 1KOFA 4IFEA 4UQOA 2OCGA 3WLPA 5CCEA 4M8KA 2I6SA 3HE3A 3I4FA 3DDCA 1IM5A 4DT1B 2I0FA 3STWA 3T3GA 1CFZA 2GZSA 2PSJA 2Q3JA 3L9WA 5D87A 2Y05A 1PQYA 5JJCA 1U90A 5IH3A 3AYXB 1JQLB 4LJYA 1D3AA 2F1KA 3QEMA 4J6EA 3SU8A 1U5BA 3CNNA 1F2DA 1NQXA 4UD6A 4OAQA 1L5MA 1KZHA 1GPMA 4JR0A 4EW1A 5ITZA 3KYIB 3EH2A 1KVQA 2VN8A 5BV1A 1FFXB 3NBKA 3NI2A 4C2AA 1CLEA 1QCCA 3DTNA 3WE7A 5KC9A 4RNDB 3GRKA 1JI0A 2PCJA 4G5FA 3SYMA 1ZRSA 1KAEA 1DIHA 3MQ4A 2WV7A 4WA7A 3CO0S 1UXKA 2JL1A 3C6BA 3MCUA 3KOXA 1OSNA 1C7EA 2O2HA 3DEAA 2OM2A 4UAVA 4FZVA 3W5DA 1JVNA 3C6MA 2XJ9A 2QF7A 3PEEA 4FU0A 4N18A 2JLYA 1LPBB 3HB1A 2A33A 3K31A 5TY0A 3SZUA 1F60A 2Q5QA 1L5OA 1PJZA 3ZNOA 3FPHA 3E03A 1N7HA 1PGOA 3SSAA 3WRVA 4CKCB 3I9OA 2XTJA 1ZRMA 1PLKA 2WJJA 2R87A 1R8SA 3NYQA 4UZEA 6NULA 3R5FA 5I8PA 1B23P 2X0NA 5CXQA 2QMZA 1VE7A 3CE9A 3B6ZA 3ABZA 4R16A 1MQSA 1A8HA 1RTKA 2PGNA 4II3A 4ZTBA 3QOXA 1JHXA 2B7BA 5CGZA 2QGFA 4FS3A 1P3Y1 2ILTA 3IRVA 5DNVA 3VZPA 4F6LA 1ETHA 4B85A 1RACA 2WE8A 1VJ0A 1HSZA 4DJ5X 4J76A 1Z73A 2QRVB 4HZIA 1CW2B 3O1IC 3R44A 5DTMA 5FQOA 5A4MS 2B21A 3KOMA 2KMLA 2BHRA 2BZ0A 5GJBA 4ZJZA 2IYAA 4CMJA 1EZ4A 2BBSA 5ALNA 4LXUA 4JGGA 4ARIA 3NC1C 4O3FA 4NTZA 1N3LA 2FPMA 2H0AA 1J00A 2OV1A 3QWHA 5AHOA 2IHNA 1KI7A 4UHDA 1RLTA 1E3MA 5JFGA 2F8MA 3ODPA 5ALJA 1JEDA 4DR4B 1D2EA 3AIKA 4MVXA 2B4AA 3OCUA 3UMVA 1SC4A 2PA3A 3PC3A 4GG1A 4TYWA 2NACA 3PWKA 4MUGA 1FCJA 3IEPA 1KIMA 2QK4A 2Q29A 3CMMA 2JA2A 4OQLA 4Z0HO 4C08A 3K0SA 2O5CA 3D6TB 3R7WA 2ZSEA 3UG6A 2IIQA 1VCHA 5IDXA 5G0VA 3TXYA 4KIGA 1QONA 2B98A 5C52B 3SZLA 1Y5LA 3BB4A 3ZS9A 5K20A 3IEVA 1SUWA 2JFWA 4IOLA 2VJDA 1AKMA 1IWBB 3DMGA 1Y3CE 3NEJA 3LUCA 3QLTA 4WMLA 4KQCA 3V32A 1P19A 3DMHA 4RGBA 4ZQBA 5IFKA 1KSHA 2XQJA 3ZE8A 1ZBDA 1F7UA 3CKKA 4GIBA 1BU5A 1POWA 1FXWF 1B2RA 3JQBA 3N07A 5DLDA 4CQMA 1UM8A 1XZFA 1T8YA 3NT2A 2NG1A 1RRVA 1JDVA 3VPAA 4MYHA 3RUPA 1Q11A 2PU7A 3V2UA 3RIGA 1M1YA 2KBEA 1QGDA 3KD3A 1MT0A 2C2YA 2B6HA 3DEYX 3M9WA 3O3CA 4FFWA 4UEOA 2PUFA 3A2KA 3CPJB 3GR6A 2JLWA 4N5LA 3FVRA 3AM1A 5JW6A 1QFXA 1K68A 1ZINA 4YQFA 1BVUA 1C7IA 4KO4S 1NI4B 1NUAA 3BZBA 4B3XA 4B9EA 1IB6A 2ZB3A 1HQDA 2BI7A 1JQAA 4LJRA 1Y5NA 3BMXA 4LNUA 4QQNA 3W5UA 1W2GA 1GZ7A 2XXBA 5CPFA 1QV9A 4LZLA 1YSCA 4Q3LA 2YN2A 5EZYF 4IIEA 1MIOA 1S3FA 2CN1A 4LSZA 3RYIA 4XYLA 2VG8A 3TZLA 3CRZA 4KQEA 4MVCA 4ZKDA 5CA1A 2HT1A 3GJ4A 3WYFA 1EGVB 1CU1A 4XGQA 1ULAA 1W5AA 3AY3A 4OYRA 4R2HA 4YWJA 1A27A 1L7AA 1ZKMA 1X1EA 3LFHA 1F20A 2WE7A 3OHMA 4C87A 1NR7A 1FVFA 1MX3A 1R8JA 3VPHA 3FR8A 1BQ4A 1NF3A 2VHQA 3MELA 3NBXX 1FB5A 2GK6A 4KLCA 4PSDA 2AKYA 1XCGB 5DNAA 1EQAA 3ND8A 4BIIA 5CB4B 1Z4QA 3T3HA 3TLJA 3MXTA 2QX6A 3JAKB 3W3AA 4MEAA 1XZKA 5IZCC 4HNQA 2P9GA 1P9RA 3FYHA 3CWCA 4FNGA 5EP3A 4B71A 4CIWA 1FYWA 1HE4A 1IN5A 1FRZA 1VL2A 1XZQA 1RZRD 3ENQA 1BE0A 3EIXA 1MNQA 3LIPA 3ZZUA 1M2OB 2NVUA 4FI3C 3KVOA 4RV9A 1YZQA 3NHYA 2Q9AA 2HMTA 1ZD9A 4RO0A 1T9DA 5BVGA 3M6LA 4NYJQ 2YOFA 3PKZA 3Q7SA 4BVAA 1GITA 1RKUA 2JAHA 2ACKA 2XTMA 3VXKA 2FQYA 4JSYA 4D9GA 3ORYA 2R2GA 4DC0A 2A3NA 3ND9A 2QLNA 3A6KA 4E32A 4A15A 3V2GA 1RRFA 2FUG6 1UINA 3FRHA 2FCRA 2R8OA 1FXSA 2WSYB 3HBAA 1EB9A 1TK2A 1G5HA 1LSJA 1VYUA 2EDCA 2CB9A 2PZJA 2I80A 2ZJZA 3AOGA 4CFSA 4YRMA 3K5HA 2Q21A 3OT1A 4IMIB 4BMNA 2BONA 3DFFA 4PVCA 2BFFA 5EEHA 2H8KA 1HDOA 3SXPA 4C0XA 2NWQA 3RU3A 1EJ0A 2OMKA 2PMKA 3AEXA 4WLVA 4C89A 1VYVA 3JAMA 3HUDA 3E27A 4XWOA 2P79A 1MJHA 1O95D 1ONNA 2XYQA 3WWYA 4AW9A 2OHVA 3I2IA 2Y1WA 2PGXA 3VTKA 4DADA 5DBEX 1UMDA 2H6EA 4PRLA 1L5HA 1WUKS 3GG9A 5CAEA 4E1AA 1H5NA 3DW3X 3SEQA 2WKWA 4JBHA 4Q93A 5F5LA 4KN9S 2G1PA 3Q3VA 3AWDA 3PIDA 2IKQA 3IQDB 3CB4A 2PNFA 3GGCA 1U8AA 3ONDA 2QY6A 1NONA 3EEQA 1JG2A 1AS3A 4BN4A 5K0GA 2IHBA 2Q1WA 3IEKA 4GKJB 1F6DA 1B8VA 1DL5A 1MGPA 4TTQA 2C1ZA 3TRDA 5DBFA 1T1IA 4Q37A 2OBNA 1NUQA 1EGAA 1KAQA 1VB5A 3NDJA 4DCVA 3HCBA 1D6NA 4CKZA 2JFQA 1YF3A 1I4WA 3ADDA 3G7SA 1XRLA 3O95A 1TZJA 3PVCA 2BSXA 3CTMA 4RJLA 1U3TA 1E6KA 1FFAA 3TTUA 4B09A 5EVCA 2WJAA 5KVSA 3K0HA 4Q9HA 5AVQA 4X66B 1DXQA 1T35A 2BEUA 5F7OA 4F12A 3QVVA 3ZWYA 4CQMD 2BHLA 2V97A 1N34B 2X5NA 3FF1A 1DJLA 3UXHA 4TN5A 4V1CB 5CLIA 3LCJA 2PWZA 1CRZA 1T8RA 1KZ1A 2QSZA 3MT7A 5BNFA 3QOWA 3PXGA 4KCGA 3EMVA 1U7OA 2X13A 1MKYA 3RJ9A 3H75A 2HMSA 4C4PA 4UEKA 2GF2A 4D9FA 2X8LA 3C8UA 3NBFA 5BMOA 3RGGA 2HPAA 1H8ED 3AUYA 2JIRA 3GLHA 4B7CA 4F3CA 5FB3A 3SE7A 3OQMA 5HRCA 1VG8A 4KXUA 2HH9A 3LOQA 4RORA 5EUMA 4YPFA 4XB6B 4CM7A 5A3RA 1WXQA 1PFYA 1ZN8A 1OX4A 3GH1A 3K2EA 5D3MB 5G1NA 5IEJA 2OP0A 4AQYB 3VHXA 2I2WA 4ZT7A 5FX2A 2BY4A 4NQRA 1ZESA 4PNEA 4LDRA 1KDOA 4F97A 1X9GA 5KJCA 1L5QA 5LL6P 4EHNA 4WE3A 2ZCJA 4PHTA 5AUQA 4BE4A 1SXJD 4ZZIA 1K3FA 5LB4A 1GG5A 4RANA 1S8NA 2QYSA 5FNVB 3AHGA 4BL5A 2XIQA 4QUJA 5DN6D 1Y3IA 3BIOA 4EVIA 7ADHA 3RAEC 1PR9A 2O2XA 2O57A 2CFIA 1W5BA 3KR9A 5ARDA 2KSQA 3IBSA 4UBOA 4NBUA 3HHPA 1NQVA 4JZKA 4TTTS 1QZUA 1T29A 2HNBA 3NHBA 1I7SB 2IYEA 5TEVA 2QX4A 3EVAA 4JQCA 1UFQA 1SC1A 1Z2NX 3WYAA 1QGZA 4PGFA 4XPIA 4TWJA 3JX9A 2A9OA 4S0XA 2QN8A 2BGKA 4W7IA 5ILQA 1F2UB 3INRA 1WB5A 2ZJ6A 1QIDA 1FEZA 1UWVA 1ONSA 4L4ZA 4A8JA 4JS0A 1VBKA 5KNCA 4WH0A 4GS5A 1JZTA 4AJLA 2O20A 4TRNA 3DYBA 3FBWA 1L5LA 3DC7A 4C4OA 2MSCB 2XT6A 3KQSA 4TTIA 3ZH2A 3SBEA 3QBDA 4UTVA 1W35A 3E9MA 2RGAA 1PJ2A 1JW9B 1DQZA 1E2MA 1Q7CA 1KS9A 2NZXA 2ZREA 4ZVTA 4KX5A 2YIVX 5T8KA 4RHYA 4DNOA 5JI2E 3H5LA 4BZZA 4X97A 4GPAA 5G4LA 1LQTA 2AOUB 4WXPA 2H0QA 4K26A 2J0SA 4X95A 1YMVA 2JK0A 4G8BA 3WOHA 1O0CA 2A5YB 4CCWA 5IUNC 3IUNA 3V8RA 4MRMB 1W8IA 3BRQA 4QYXA 1XDSA 3L7NA 2AOWA 3TSAA 2YFQA 1MX9A 3HA5A 2O48X 3RRJA 1M6NA 4QUKA 4EW3A 1AXGA 2EGHA 4TUYA 2BM9A 2GASA 5ESRA 4C88A 3FPCA 3VR4H 4DG8A 3VH1A 4ZQHA 4ONEA 4TXLA 1FTQA 3EVEA 2CDNA 3COVA 4PYRA 4AUMA 5JXJA 1H65A 1U7ZA 1HL7A 4DCUA 2BKAA 4RSHA 5AM0A 1OX6A 3K0KA 1IAVA 4I4NA 1JDBB 1ZH0A 4MVJI 4OJTA 2XH8A 4L9WA 5B4VA 1G2QA 4FFBA 2AA3A 2UVDA 2V7GA 3ICWA 4D0LB 5JV5A 2EOAA 1UBUS 1G9SA 1ZMTA 3ZQJA 3GLFA 1YKFA 2HMUA 3AKZA 3THWA 1Q0HA 1RVDA 2EKZA 2Q7XA 5BN5A 3AP3A 3AHCA 4EYQA 1ZRHA 1VC2A 1H3NA 1W44A 4LHVA 4LRWA 4W6QA 5F33A 4G84A 2NU8A 1JG3A 1UBSB 1OZGA 1ZVKA 4F5DA 4P2BA 3T38A 2ZB2A 4EVSA 2ZIUB 3DVQX 1N9KA 1PL8A 1MW8X 3PXBA 1USGA 3CH6A 3DDWA 2ENUA 4PR3A 2XE4A 3RM3A 4C04A 4EHHA 4HB0A 1ORVA 1ZXLA 2E4ZA 2QNBA 4HPXB 2M6LA 4EYSA 1FXUA 1EFPB 4BNFA 2R65A 2CFRA 1OXKB 2X22A 3U61B 3DZBA 4F3RA 3QMPA 2AXEA 4M37A 3EWSA 4BNHA 4QX6A 2PD3A 1SOVA 1UDXA 5AM5A 2GHTA 2C9BA 2R2AA 3RUDA 3H5WA 4BMSA 4C4XA 5G0UA 1W48A 4GICA 4XPIB 3T7JA 2I8CA 3FVQA 2YV2A 4NAVA 3SIRA 3AY6A 5I4IA 5JZVA 3TOVA 2Q5OA 1M34E 2DBYA 2ORIA 5LLSA 3FTFA 1JEQB 3E8XA 4I9NA 1N75A 3QYAA 2C1XA 1Z7WA 5K2OA 2GPSA 4H7EA 1OFUA 4CL8A 2QYTA 3BXOA 4WLFA 1E32A 1GZHB 5CNMA 1NW5A 1CDZA 4B7UA 1TPZA 4M0KA 4PLZA 4D3YA 3GLFB 3EARA 2FE4A 3V1YA 2C97A 1GZDA 1Z0JA 2IUFA 3PA6A 2J45A 1O96A 1XZPA 1FJHA 2BRUC 4CKEA 2CXUA 3NPAA 2ZRAA 3ACDA 3JWJA 4MV9A 1DKNA 3LLMA 4PAOA 3WL7A 3ZE6A 1U80A 4KE9A 4F1WA 4LWOA 1S4MA 2WJYA 3JATB 1FFXA 2CF6A 3ZDAA 4BZPA 3QUTA 2HCBA 5B58C 2QBYA 3GXOA 1VLLA 4GQBA 3G5UA 2P6OA 5IBQA 1QK5A 2C4WA 3PHBE 1FC0A 3M6FA 3QXJA 2C59A 2QTHA 2I2FA 4B32A 4IY1A 4ZJYA 2YN0A 4CM9A 3CVWA 2OB1A 4XQCA 1EGMB 2UVQA 1ABEA 1CRQA 1M9NA 3WZLA 5A02A 4U0KA 3NDIA 1D6JA 4U3JB 4JUFA 3VYTB 1VG1A 1CF2O 4CW7A 2VZ8A 4INPA 2QUJA 3NOOA 1J2UA 2W6PA 3B2EA 5AJUA 1ZUWA 5L3VA 1E8MA 1EAYA 5E1OA 3I9JA 5EPEA 3VKFA 4URYR 1C4KA 3EEBA 1VA5A 2FFJA 4J3NA 1M5TA 5M7EA 5FPKA 1A8PA 4ZAZA 2WHPB 3WJ7A 1R9JA 3TO5A 4DV0B 3KE8A 4WLUA 1G5TA 2Q2OA 3F6BX 1E3IA 1DI0A 1H4VB 5I4CA 5A5GA 3T52A 4BEWA 4YMUA 5BV2P 2GT1A 2GJ4A 4MICA 4W5WA 4YTEA 4EGQA 2NP7A 2WJPA 1RI2A 3NHRA 3L7CA 2OHFA 3AUXA 3M2TA 6REQA 1UFVA 3GGJA 1Y8RA 4HRVA 1A9TA 1LLDA 1AU9A 4JP3A 2UDPA 4OL9A 4RCVA 2XUOA 3KT3A 3SM9A 1E2IA 2QP9X 2V4UA 4P92A 2FEOA 2J3HA 5C8YF 3Q5EA 3ZN2A 2AOVA 3E35A 3EZ2A 3MCAA 2IPMA 3COSA 4KO1S 1P61B 4LVOA 2KS6A 3ELYA 3PFKA 4YR9A 1XNJA 3TD9A 1J21A 2EWWA 4UTOA 4YONB 4EA8A 1U0OC 2FX5A 2IU3A 1GILA 2WG2A 5JNWA 3IDFA 3F7NA 5B58T 1SVWA 1FMCA 5DI3B 4E13A 3C5VA 3CSDA 3PIRA 2I8LA 3HUUA 5JAOA 1GGVA 3KPUA 4MKRA 4OM8A 1U98A 2OUIA 3NVDA 4DM7A 4JJIA 2PV0A 4DUYB 1FP7A 3THYB 1R27A 5A9SB 1PTJA 3C6QA 2GPWA 4Q21A 1C1DA 3NG1A 2GEUA 2WVHA 3HC7A 1HI9A 1OLUB 1QIKA 3A4MA 3H5TA 3ZJVA 3CY6A 4FGLA 1F6BA 1I6MA 3DMRA 4MPDA 4TT3D 3LV8A 3C41J 1NGSA 1WCIA 1CJMA 2IFTA 4OJKA 1MZPA 4BGUA 4EJ6A 1P4SA 1E9BA 1R6BX 1SY7A 2OD9A 3LFTA 2NTVA 1IMOA 1JMKC 3OAAD 3KQUA 2FXIA 5JSQA 4KQJA 5JZ9A 5KNDH 4NCNA 2PEYA 2CDRA 2CLLB 2GEFA 2XNKA 4QXRA 1UJMA 5JJ5A 5IXJA 4PC7A 1JPUA