2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (33-MER)
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
2XIGA 4PSAA 2C77A 1RRCA 1ZLKA 3R9IA 1T3LA 5TRDA 1YYVA 4ENMA 2VLIA 1DG1G 1JQLB 1G7SA 1IXSB 1SHKA 2D06A 2ZRBA 3C16C 4EFMA 4UVAA 4PHTA 3O2PE 5J8CA 1XMSA 4WZ6A 4BFTA 2ZRJA 4YQFA 1LW7A 5F6FA 2Q9AA 3AVTA 1Q12A 2R8RA 4FIDA 4EJTA 2W2TA 2F1HA 2GA8A 3TSOA 3U4QB 5JEDA 3KXIA 1Z6AA 3LA7A 2BGCA 5GJBA 1IF1A 1EFRA 4Q4ZF 1YZKA 1ZG1A 2SHKA 3HSFA 1KI9A 4LJ4A 5GADl 2CVFA 3K0SA 2NTYC 4HLUC 2NG1A 3IHWA 4ESHA 4WWCA 4Q5SF 2AXNA 2W00A 4MYCA 3ZLJA 4GO1A 3H0KA 4FMBB 1EH8A 2DT5A 3LLMA 2GBLC 1E2DA 2KE5A 2QTHA 3CW2A 5EXPA 4LJ8A 1KKMA 2J7PD 4HAWA 3T35A 3GFMA 1ZM2A 3K0CA 3Q5EA 2KJBA 3COAC 1P2SA 2K4JA 2W57A 2O8XA 2XSZD 3E70C 4JSYA 5KPDA 3KQUA 3R8FA 4JBAA 2P5VA 1T2KA 5DIFA 4AWXA 1FMJA 2XTZA 1GFIA 4NBSA 2ZI7A 2YC4C 3RKWA 4A4DA 2QPAA 4MTEA 1W4RA 2OXRA 3QPWA 4GP6A 4DLTA 1GNPA 1E2FA 4DEYA 4TYWA 2L3DA 3CRMA 3F8BA 4LRSA 1N6HA 4JBXA 4LK2A 4ZDJA 5A4JA 1E32A 1T5LA 4W7SA 3EIQA 2CL6X 3U1DA 4A6PA 2XKOA 4RGUA 2EFWA 3KKOA 4CEIA 2JJ2D 2Q8KA 4HB0A 1QZYA 3GPLA 2RHDA 3BH6A 3EUHA 1LF0A 2QRZA 1Z63A 4TT3D 3VR4A 4CZ2A 1QDEA 4QBGB 1W7AA 2F55A 2C03A 2QQAA 2G0NA 2IC5A 3SE0A 1EH7A 2MD5A 2F43B 1FT9A 3NHAA 1KI2A 2Y75A 5LGUA 3NRVA 2HDNB 2EU8A 1I2DA 2VP9A 3U3JA 2YWFA 4DJTA 2PI0A 3CIOA 3PJRA 2ECKA 4HZIA 4CF7A 2GJKA 2QAGC 1E2HA 3GFPA 2J5OA 3TDZC 4TN1A 4DHEA 4MYTA 3VMFA 4D80A 2DK5A 2FWRA 1XB2A 4HDOB 3GLGA 2ZYUX 2A5GA 4XTCS 4ZDIA 4ZKDA 4KMFA 4Y0VA 3WP1B 4G5SA 3KKNA 4S35A 2IA1A 3B1VA 5DCMA 2O8FB 2FMXA 5LRSA 4EDHA 4EPXA 1TLHB 1NN0A 3GQBA 2GAUA 4NHJA 2RGNA 4G5QA 1T98A 5EEGA 3WTUC 3GO5A 1HQCA 3EARA 2F7SA 2ZIAA 4BFUA 2ZRKA 4OIOF 5FTNA 1IBRA 3DPUA 2ONKA 1DOAA 4NTZA 1FFHA 1W36C 1Z29A 3GF2A 3LA3A 4RZ2A 1TBXA 4EJUA 1AGRA 4LPKA 2XAJA 4HDVA 4HX8A 2GESA 1ZJ6A 5TARA 5IRCD 4XSZF 2YKGA 3A36A 3IPYA 2P7VB 1AKYA 1E1RA 1YR6A 1ZD1A 2C04A 2EWVA 3B1YA 3FYHA 4AYWA 5L8VA 3ZD7A 1K6OA 1GRRA 1Y63A 1XMVA 1WBBA 4F91B 4GXOA 4EJWA 1O87A 2QMOA 3HTSB 3MD0A 3HTUA 2X19A 4PPNA 3RANA 1EX7A 3RS5A 3RABA 2W6IA 2HT1A 2AD1A 2OE2A 1CS4C 1OKKD 3SJCA 5EQTA 3CUEF 2KI5A 2O0JA 4WAUA 2DW4A 4NKRA 2WV0A 4NMMA 1US8A 4U5XA 2XASA 3L43A 1P2FA 3WTZA 4MQVA 4UUVA 1X8JA 1LNZA 1QBKC 3B1WA 4HX4A 3KKMA 3MSXA 3PVSA 2AFHE 5TVKA 3TUIC 2E7WA 2H57A 4H9GA 4CXFA 3JTHA 2A5FA 1DP7P 2ZXJA 1G5RA 1S8NA 5BYJA 1GVJA 3QPTA 3EAQA 1US8B 1F60A 1QO0D 3PIRA 3R60A 2ZM5A 3E5UA 4WIAA 1KTVA 1ZUHA 2R65A 1V43A 3HYTA 2ORVA 2MH2A 5DD8A 2FZLA 2P67A 2QU8A 1XWIA 3NIBA 5HS7A 4JYCA 3PQCA 4IOJA 5SZHB 2Q3MA 4QXAA 3VR6A 4ASUA 3F8NA 1N6OA 5JI3E 4MHGA 3LFUA 2JJ8A 3EETA 3X1YA 1R5GA 4HB3A 4C0QC 3WE2A 4B33A 2JPBA 1P2TA 4D81A 1ZHFA 2HKXA 2YC2C 2HCBA 3U2RA 2DY1A 2XXAA 4HB2A 1NG9A 3MEXA 4O2RA 1W7PA 3ZQ7A 3QBTA 3QXHA 5C4MA 4JLVA 1OYIA 1IRGA 5JFGA 1RRPA 3WNDA 3QY0A 4YMVA 1NVVR 4CIDA 1H8HA 1GKIA 3SJBA 5AR1A 3U5ZB 2DFLA 3HSEA 2CMKA 2V7QA 3VR2A 3NBYC 1K78A 2E9SA 4RZ3A 3VTKA 3LQQA 4UXIA 3HU1A 1XEXB 5B58C 4US0R 3EPLA 2Q21A 1SD6A 4M2LA 2AWNA 4GDFA 2JEOA 4CT5A 3GJ5A 3LAJA 2NOAA 2G0TA 4DCVA 3NKVA 1HXDA 2LDUA 3WHKA 1TF7A 3H84A 2GXGA 3ZPLA 2IEYA 3RRZA 2PJRA 1XFAA 2CL7X 4ZIRA 3ISPA 3C15C 4PZZA 1JXSA 5DI3B 4Z1MA 4E09A 2YU3A 3SDZA 1LY1A 3GJXC 3B7GA 2OG2A 1DDNA 1D2MA 1SVMA 1RJ9B 2ORIA 3UATA 3QOFA 1A04A 2VF8A 3WYAA 5JSZA 3WBJA 4XSXF 1XTRA 2R3SA 4LLLA 1LEBA 4TZ6A 2VYFA 1HSTA 3BB1A 1HW2A 3F6VA 2XRNA 2V54A 3ZS8A 3IBGA 1OXTA 3PR1A 5LB2A 3W34A 4ON9A 1Z0FA 3GLHA 3V8JA 2ANBA 2ZRNA 4KITB 1J8YF 4XVUA 4L0ZB 3L9FA 2VH5R 3A4LA 3ZZUA 2GZHA 4KIGA 4I0AA 3DEFA 4TL7A 2NNNA 3L09A 3LFKA 5EXXA 1RNLA 4B47A 1H8HD 4XIGS 4F93B 2FSIA 4IKEA 1Z6RA 2JLYA 3F3YA 1QVAA 1E79D 4TL6A 3HJNA 3K0AB 1U0JA 3L2OB 2IWHA 3BPXA 4BHPA 1KMHB 2WSMA 4P4UA 4G7OF 1YE8A 4ZI3A 2IPQX 4CYDA 1XTKA 3T5XA 3KCCA 4IXNA 3PUXA 4AK9A 2ZCWA 3ADKA 1JR3D 1B0UA 2XITA 4LRWA 1D5CA 3K0EA 4EQ6A 3AGPA 2XZOA 1QG2A 4XH9B 1FYKA 4OBEA 3MCAA 5FPHA 1B23P 4YMSA 2JLUA 2QMHA 3TW8B 5FL7D 5LD2C 4AD9A 4RD4A 2QP4A 5EP4A 4QNMA 2XAGA 3PFIA 3NEYA 4IEIA 2QL6A 2FGJA 3WTSC 1CJVC 3C1DA 4LJYA 1YS7A 2EFGA 2VHUA 3QPVA 5FD5A 3T06B 1NBMA 3FKQA 4UV9A 3K9HA 5H8WA 1HA3A 4C0HA 2STTA 2YOFA 4M73A 4PO9A 2GEUA 1T91A 4HQEA 5KK1A 2YOGA 4MQBA 3CNLA 4MTDA 4R8HA 3FKSA 1T0HB 3LO5A 1MO4A 4GBMA 4ZCMA 2K27A 4B6FA 4BQSA 2IXEA 1HSJA 2NPIA 4WBSA 2J46A 3KQLA 5L3GA 4U02A 5IK2D 3C8UA 4OQMA 5KDOA 2QP9X 1E2PA 2F5FA 2MC3A 2BJVA 4Q47A 4WW0A 2QP3A 4ESFA 3ZMVA 2IBMA 3PUYA 5CYPA 4URVR 1GAJA 2Y0MA 3DPTA 3GFLA 3TJZA 3ND8A 3AVUA 1K78B 3N2EA 3FVQA 4C0KA 2ZU0C 1S96A 3MLEA 3L8ZA 1KSGA 4M22A 1S9HA 4HOBA 1KK1A 1NVWQ 2B21A 2UZKA 2ZYWX 3LXRA 1XN7A 3FFAA 3TAUA 2X8AA 4PO1A 1KSJA 3ELKA 2DWOA 1FZQA 3WTYC 3P32A 4GMXA 3SHFA 1D8KA 1ANKA 4LPSA 4FMCF 4DB4A 2PX0A 5F9FA 5HLHA 1E79A 2H27A 1TMKA 4I1VA 3N97A 4RFSB 5BQTA 4LOAA 2H16A 1T8UA 3IKJA 4PC1A 4B48A 3PEVA 1YRBA 4OQXA 1E2MA 4GP7A 2L54A 5LHHA 4L5IA 5D5UB 1T3HA 2OLJA 3OIUA 4RCYA 5DNYB 3BJOA 1XBTA 3F6OA 1OH5A 5KSYA 2D2EA 1T39A 1E69A 3ZVNA 1F1ZA 3ZMUA 4YFNF 2EFCB 4QGAA 5E7JA 1CJMA 2IA5A 1GRQA 4K81B 2W0SA 3HRSA 3GJ7A 1ZRCA 2QAJA 5E1WA 5D5WB 4TQUS 4EPWA 3LAPA 2RDPA 3A1TA 2L4AA 3I4LA 1W0JD 2LKCA 4AIJA 1ZW6A 2JTVA 4IVQA 5M04A 2EYUA 1E2XA 5CYOA 2BIFA 3QE0A 4B8XA 4TT3A 3TK1A 1S29A 4PANA 1W2HA 2FFBA 3U3OA 3KETA 3AKEA 4DQ2A 4I09A 1ZCBA 2JJ1A 1I1GA 1UJ2A 2O0HA 1FBUA 2AKYA 2F5DA 3I32A 4X8LA 3L0OA 3CTAA 5FOSA 2YSRA 3I71A 2HQRA 5JFRA 1S9DA 2V9VA 2C6YA 5JCZA 1Z08A 5HLGA 3QVVA 4HLUA 4OI4A 2AKAB 5EE1A 5DGXA 3BJ6A 3F23A 1I1SA 1UKEA 1DAGA 3ASYA 4RVCA 1CEEA 3HRMA 2H92A 2P65A 5CDFE 1JGSA 1W36B 2GJAA 1RUNA 1N5IA 1WBDA 3SYNA 4RD1A 4MA4A 2WTUA 1Z0AA 1SKQA 3RVBA 4AVPA 4B32A 4CEJA 2MH9A 3EQLF 3RS0A 4DEXA 4BLQA 5H6QA 3ADDA 3JSOA 3PUVA 3JAMK 1DPRA 4TMXA 1NJGA 2GWRA 4KYUA 1GUAA 4ESJA 3H2YA 3ZMDA 1FY7A 4NQWA 1QHHB 4URUR 1U0LA 2QTFA 1UPTA 1ZD9A 3CUQB 3NH9A 1DVRA 2X4HA 3J81K 1FTSA 2OCPA 3RS2A 4C0BA 1YZGA 3OIYA 1XD2A 1FSEA 3VHXA 3B02A 3J80Z 3NEJA 2HCJB 1Y3AA 2K86A 1TNDA 2IYTA 2WMNB 3S1AB 1UF9A 4OINF 2BDTA 2BKEA 1WE2A 1KJZA 1R0ZA 4NCHA 4NZYA 1BBYA 1WDTA 2A5JA 4LUCA 4RFVA 5CLQA 2FF4A 3CKLA 3D3QA 3F3XA 1GL6A 1JHHA 5FOWA 4D0PA 1J9IA 1B6AA 1ZCAA 1X3UA 4CRWB 5JZVA 3CUOA 1XMKA 1I2MA 3HIFA 5JCPA 4EQ6B 5BPDA 1NF3A 4JSTA 1R23A 2GK7A 5FTJA 4KFUA 4OHVA 1NNEA 2NIPA 4MUAA 2ISYA 4CHUA 1GOTA 1KMHA 4P5OA 1KK0A 1Z0JA 1GKYA 4GGGA 1NMYA 2Q0HA 3VR5A 2L02A 3P9KA 1NBME 5JS8A 1CIPA 5HS8A 2H7VA 3QI2A 3UG7A 1GNQA 1XDBA 3CM0A 1OPXA 5FOUA 1E0AA 4B3CA 1FQJA 4OKSA 1ZRHA 4P33A 3E5QA 1IQPA 2Z99A 1NVVQ 4RY2A 4OMZA 3P26A 2FEMA 4Q1CA 1GL7A 4MGRA 4B74A 3D8BA 3HDTA 4G6QA 2O8EB 3HP1A 4UNRA 4Q4AA 3X1XA 2OZUA 4I2OA 1T8TA 4IVPA 5G40A 4R79A 3UKDA 3EXAA 3IDQA 4DIEA 3BOSA 1DAFA 3CJNA 4RKEA 2GXSA 1LS6A 2AK2A 5AUQA 2X2FA 1XGSA 4A82A 3I8SA 2HLDA 2GJSA 5DV5A 2L0XA 3QAHA 1F2UA 5FGMA 3T1VA 4BFWA 4E5UA 1G3YA 1FOEB 1XPOA 2IYVA 3NXSA 1KO5A 1S7OA 2BCJQ 5ANRB 2VL7A 4I1SA 3O8CA 1OJLA 2RQPA 4BLTA 4CT4B 3FX3A 4A36A 5HZKA 2YYZA 4JIMA 4RAYA 5ERIA 1ZINA 4V0MA 3TNFA 2WM9B 2M5WA 1ZNWA 5JHUA 5DHFA 5DO9A 1R5HA 2B8WA 2P6UA 1HE1C 4RZUA 2IYXA 4RGSA 2FQ3A 4DLRA 1VCIA 1W49A 1WWXA 1FLIA 1HEIA 1YZNA 4CEJB 4B09A 3WP0A 2GWHA 3LBHA 4W5WA 1I6XA 2YR2A 4YXWA 5K8LA 1ZLJA 1X6VA 4WXPA 1GL9B 2ZSAA 3KKPA 2ISZA 2EW1A 1AKEA 1OR7A 3W3AA 4IOKA 4EVIA 4O2LA 4TLDA 4XJXA 1E2LA 1X8LA 1AQUA 3RPQA 2AK3A 3PG5A 4URZR 4X8MA 5JJIA 4QLCU 1ZRFA 2GCPA 2DFIA 3WNBA 4WK8F 4YG2F 4H1VA 3IRQA 1KMQA 5DI9A 1Z05A 3ICEA 5GJCA 2IEZA 4BFYA 2QBYA 3EIEA 3U7FB 2QAGA 3TQNA 1DBSA 3U61B 3FXRA 4KT5C 2AWOA 3WRXC 2REBA 1E9EA 1Z28A 2UWMA 4KO8A 3CF2A 4KMUX 2KRKA 3R20A 4EFNA 2OCBA 5BOXA 2RGEA 1DAMA 1IXCA 3NHBA 3PENA 2WICA 4NDZA 1IJFA 1VIYA 5LHGA 1SFXA 1J90A 2XB4A 4LK0F 2KJCA 4ITRC 1JBKA 3LV8A 2C9CA 1F9NA 4P96A 5J47A 1KJWA 3PEUA 3R9WA 2RGGA 4PSVA 4IJAA 3K69A 3GLFA 1BYUA 121PA 2JRTA 2OA4A 1R0YA 2Y48A 2GHIA 3AUYA 5DHAA 3V7RA 2DR3A 3DMDA 3V8KA 2D45A 4P3YA 2BEKA 1L4UA 1F48A 1J59A 4N3NA 1FWZA 4JLPA 4TYNA 3QQ5A 4LWZA 5EJEA 2DQRA 3KUDA 1YFHA 2IX3A 2KIFA 2UXNA 3B5JA 1TUIA 1QZZA 2VBYA 2CW0F 1N5LA 3ZP5A 2FOLA 1YW9A 1TQ6A 5SZJA 5AJXA 1TNTA 2Z33A 1E9FA 3ZN1A 5CM8B 5BN5A 3W6JB 1E96A 5F3WB 1QHXA 3DKVA 1MOZA 5UKDA 2GETA 4C0LA 2IF2A 3AB3A 3FMPB 3F8FA 3RLFA 1IJEA 3B60A 2V79A 2YHSA 3AP1A 4DZZA 5HZHA 3E3VA 5LHIA 1OHHD 3ECCA 4XOIA 1F5NA 2QN6A 3SU8A 4ESVA 3ECHA 5DCMB 2W58A 4UNOA 4LCBA 1BYIA 2RGCA 3K1MA 1NSTA 1G1MA 3C41J 2CJWB 2ODBA 4P32A 1G4UR 4QWQA 5JI2E 1VG1A 4IHSA 1XCVA 4IDNA 5HKKA 2VOOA 1XJ0A 1A5TA 1CBUA 1KDPA 2DYKA 3SFZA 3EWAA 1OHHA 4F4CA 2XZLA 2EK5A 3F8CA 4QC2A 1WI9A 3F5FA 4PHGA 1HT2E 1P9RA 4ABYA 3SBEA 2ADUA 2P6SA 4MGIR 2QSZA 3K0AA 5JRJA 3ZD6A 1AQYA 2BMEA 1RUOA 1TEXA 1U9IA 2ZSDA 3KEQA 1JI0A 3FTQA 1UBEA 3Q7QA 4GI7A 5E95A 2KWIA 1BMFA 4KJZA 1E9DA 2RMKA 1BIFA 3KP6A 2ZSBA 3I5YA 3T61A 1JXOA 3GLHE 5AJWA 3C5CA 1R5OA 1XXHB 3I3SR 3E1SA 1KYIA 1SVIA 1OXUA 2ZKZA 1XEWX 4IRUB 2VXZA 3DKWA 5BMZA 2P6NA 1TF5A 2DTRA 1E98A 3A4MA 3QG1A 4LYJA 4WZAE 4OOIA 5BWMA 821PA 2QQBA 2QQ9A 2NRAC 1CR1A 3LX5A 5DSZA 2NAZA 2ATXA 2J7KA 2VP6A 5DUIA 4OI2A 2CG4A 1QNTA 3FFBA 4JLOA 2A78A 2Z3YA 1N25A 4MYHA 3KFVA 4TWZA 1XD8A 5BS6A 5K5QA 1AZSC 4GRAA 4M9SA 2ZYTX 4KFCA 3FPAA 3LVQE 1XSXA 2DFTA 2N1BA 3A1VA 3IQXA 4UNSA 5E7IA 2RN7A 4BLSA 5IT9Z 3AKYA 4OJKA 4D6PA 1IAWA 4LRTA 1XDSA 1QHYA 1O3SA 3QKTA 4GNKA 3UPUA 3KZZA 3L0IB 5BW8A 1XD9A 1J75A 1KHTA 5D3MA 1I5ZA 3IIKA 5KNDA 3B9QA 5D3QA 3OFNA 1T6SA 4JT2A 1EFRD 1ZNZA 4IW3B 1L8QA 1JAHA 1W4AA 3V8LA 2W85A 3PITA 3QBVA 4PSKA 4Q7KA 5CM9C 3ZIAD 4DVGA 4P9FA 3GFOA 4IDPA 4O5VA 4QHSA 1COWA 4A2WA 2MA3A 5JSZB 1G291 4L15A 3VFDA 1Q3TA 4LJ6A 1U2WA 5ICFA 1M7GA 3DOEA 1OFHA 3DFGA 2XXAB 1EH6A 2Q9CA 1U81A 1NI3A 1U8YA 4YDSA 1C1YA 2CWEA 4ZCIA 1G6HA 4PAQA 3W8NA 3WMEA 3X1WA 1B9NA 2O8BA 1XGOA 1OXVA 1XSDA 5FLXZ 1JQJC 4Q4HB 5A2QZ 1VPLA 4I81A 4JVMA 3MWMA 4N1AA 1E4VA 1BIBA 3C18A 1WF3A 5LGTA 2KBEA 2OXCA 1IXZA 4LG0A 2F1RA 2ZJBA 5H68A 1OB5A 3RC8A 1U99A 3GW2A 3A6PC 4TYYA 1FP6A 1LJ9A 4TMZA 1Q3HA 2WJVA 1AGPA 3BROA 1BS1A 4Q5IA 1ZRDA 4JBYA 4A3VB 4ENJA 1AWCA 4LBWA 3HOTA 4NPHA 1ZN2A 2HXSA 3Q7PA 5AUOB 5AWFC 3U44B 2GK6A 4JVSB 4B71A 1KYZA 2EA4A 1P75A 5BXQC 4IDOA 3MWJA 4L8GA 3WGGA 3UANA 4EJSB 2QORA 2ZAMA 4AIIA 4E22A 2ZAOA 1X86B 2ATVA 2J5XA 5DI3A 2ZRLA 5EXSA 4TTRA 2WJIA 4F92B 2H94A 1JPNA 1Z47A 4LI0A 3UXMA 1RZ3A 3D5LA 3TR5A 2GJ8A 2WWFA 2PMHA 1MZBA 1G3RA 3MJHA 3KZ1E 4YDHB 5JWHA 4ZPXA 4EPVA 5LGNA 3KW6A 3WU1B 1M2OB 3C3WA 1S1CA 5IDVA 2V55B 1NVUQ 2V6ZM 1SVWA 3M1EA 6PAXA 1XF9A 3DHWC 5H1YA 1V3FA 4FXPA 3T0YA 1EV7A 2RGVA 2HXYA 1E99A 3K0FB 3BPVA 1W36D 1Q1EA 3Q72A 1ZREA 4A2PA 3MUFA 4DCUA 3CRQA 3T1BA 1H9TA 2A9KA 2QTVB 4BRUA 1PUJA 4KBFA 1NL3A 4R7ZA 2IYZA 2WZQA 2J87A 3CX7A 2PMKA 5F2EA 4A0ZA 4BASA 5B57C 4D4KA 1NY5A 4A0YA 3CX8A 4AKHA 4A6XA 2CJWA 4JYBA 3EA0A 5FBVB 1G3UA 3RPUA 2HQNA 5J4HA 1C0WA 1II0A 4GOXA 1Z6YA 1W46A 5CK4A 2QI9C 3RWMB 5L3SB 5F1RA 3TMKA 3ZZ0A 4NCIA 2KJQA 2OAQ1 3B82A 4KSBA 1ON1A 2GIVA 4A92A 1VCMA 5IHPA 2GXAA 2UZIR 3BC1A 1RIFA 1YR8A 3G3ZA 2XZPA 5K5OA 4CO8A 2ZI3A 3BFXA 4Q4JA 2IYUA 3K0LA 4TMKA 2IHYA 3REFA 4YFXF 5C46F 5J4LA 1Z7UA 1HQYE 1ZM7A 5KNCA 3HRUA 5F98A 1JJ7A 3L00A 4G6DA 2A30A 4KIBA 2HS5A 2WWXA 2ERXA 3GJ8A 4M53A 4NCKA 4R2HA 2P4WA 2OBPA 4ZYGA 3I5UA 2GTPA 3HR7A 5C4GB 3SQXA 1OYYA 3L2CA 3EZ9A 3QKRB 2YINC 4M9QA 4M1MA 2YX4A 3HYRA 3CRW1 1N0WA 1P4AA 3BD9A 1ZGAA 1GHCA 2WIBA 2WWWA 5FH9A 4ILEA 4A0XA 2DPDA 3NG1A 2DI3A 4KDPA 3KX2A 2CO5A 4P31A 4C2UA 1PV4A 2E1RA 1AS0A 2WPDD 4Q4HA 2STWA 4NU0A 3RYTC 3UMFA 2Z9OA 4EUNA 5DUKA 2ZRPA 3FE2A 3K1NA 4BHBA 1Q1QA 2I1QA 3H86A 1MT0A 3QP5A 1W4BA 2FMLA 2EV5A 3R0JA 2W6ID 4ZO4A 2G6BA 2KKOA 5GVRA 2WJJA 2V6CA 3TAHA 5BQ5A 1E94E 4E03A 3KQKA 1KA8A 3GVAA 1R22A 2F5CA 1IN8A 3LDAA 3ZQJA 3JZAA 4UHTA 1MV5A 2ANCA 1XGMA 1PP8F 4B2IA 1FBQA 4LD5A 4HAVA 2O52A 1T3SA 2V6JA 3MWLA 2CE7A 4JLJA 2EA2A 3DF8A 3M7GA 4L9VA 4D4LA 2CVHA 5CVIA 1R6BX 3GZ6A 2G7UA 2JLXA 1EFUA 4BEBA 3CONA 3AVVA 4U0WA 1G6NA 3K1PA 3MGCA 4BAYA 1Q22A 2H5EA 2YNMA 4JL5A 2PJZA 3TQCA 1MR3F 3P4XA 1AIPA 3RC3A 1G5PA 2RC4A 3DOFA 4RD2A 4JQFA 2FEOA 1P62B 2FN4A 4WOPA 3F0TA 2WC2A 1ONBA 3SN6A 3TW4A 2P0EA 3U44A 2WJGA 3KP2A 2V1DA 1K6MA 4XSHA 1FOKA 3RDIA 3TE6A 4AYTA 4G5GA 1UFQA 4QRHA 1UHMA 1GIAA 4OI1A 5LLQA 1H0MA 1C4OA 3BZ6A 1NLFA 1NP6A 2OO7A 2ZSFA 3GEHA 3VB2A 3G5UA 4YLGA 3GLFE 1FL9A 1P2VA 2EV0A 3G82C 4PC3A 4CEIB 3IWFA 1HBXG 3AP2A 4F7ZA 2JLVA 2BMDA 4H1UA 3TLXA 1XEXA 4LYHA 3F21A 1Z2AA 1SD7A 4UNNA 1O7FA 1W47A 3LRPA 2P8TA 5LPNA 1AOYA 1XD7A 5EP3A 3CR8A 3LVRE 3R61A 1E9AA 3E6BA 2OFXA 2NO1A 2F6RA 1FBSA 1YQAA 3LA2A 4DB2A 4KFTA 2BM0A 2EV6A 4LZZA 3CO6C 2HR3A 3A1WA 3AH8A 2IK8A 4EAQA 1EESA 3E6MA 1D8JA 1K5DA 1DG3A 2DWQA 2GKSA 2V4ZA 3ZIAA 4BLRA 3QJYA 3QPUA 3V7CA 4AG5A 2FPMA 1XPUA 3VU9B 4FWHA 4DSNA 2CSOA 1VYTA 4Q1BA 4B2PA 2OU2A 1IONA 2WPDA 2ZE7A 4GSYA 4B3DA 3OF5A 5CDFA 2ETHA 2C2HA 1TW3A 3FOZA 4Q7MB 3RNLA 2VBWA 3CUQA 3KFXA 1KQ8A 3IC7A 1U5TB 2QRNA 1WSUA 2ERYA 3KFWX 1ZARA 1DPUA 3M6AA 1VTKA 2A61A 1M1YE 2C8VA 2WV9A 3DMNA 2FBHA 3RS4A 1I4DD 4C0SA 3QXJA 4OIRF 4LB6B 1PP7U 1EGAA 1O3QA 1G18A 3T5GA 1UKZA 2GNOA 2J3EA 5L3QA 1HW5A 1N6RA 2O0YA 4KBGA 1ZH5A 4MUBA 4RB3C 4NONA 4CEHB 1U0HC 1NJFA 2IP2A 4KYWA 3OHMA 3DKPA 2VHJA 3QU6A 1LVAA 1M7BA 5D8KB 4UJ5A 3C4JA 5FOVA 2FZ4A 3TKLA 5JVTA 1KK3A 1TF2A 2JPCA 3RKXA 3I72A 3KQNA 1NIJA 4JL6A 2DLLA 4QJ3A 3T1QA 1XCBA 4B75A 1YW7A 4KODA 1U3EM 3BK7A 2JCSA 2R2AA 4Y0AA 5CJ2A 2KRFA 3QRFF 3QKRA 4NYMQ 1YKSA 1EWQA 2A5YB 1A7JA 1AZTA 2P2LA 5EUMA 1U9IC 3DM9B 1SVOA 1OLOA 3ABTA 1TX4B 3IWZA 5CB8A 4R98A 4EKDA 5J8FA 1REPC 1ZD8A 3FB4A 1IM2A 1Z5ZA 2JAQA 3H3ZA 1KU2A 4DDVA 4NCJA 4TMTA 1W44A 3W5IA 3ZDQA 2RKOA 1U6GA 1LB2A 1NSFA 3K09C 1N5JA 4GYIA 3VX3A 2WWIA 4IEEA 2XTNA 3WMGA 2C9YA 2IT1A 4C9BA 5KSZA 4RZXA 1RVDA 1ZNXA 3TBKA 4P55A 3T5DA 3PEWA 2GCNA 3NC1C 4DUGA 3THXA 3ZYCA 4L9TA 5KPJA 1QRAA 1MH1A 1XTQA 4LV5B 3GEZA 5CJPA 1KDTA 2GF9A 2JZYA 2AFIE 3N2IA 2ZE6A 1XMJA 2KB0A 5EEHA 2WVJA 4Z1MD 2C5LA 3FGNA 4DRZA 4M74A 5EP1A 2BBWA 4MGKR 1R2QA 3EX7C 1FW6A 3V4FA 1LQ1A 4OIPF 1ZIOA 1E0KA 5DE3A 3NDBB 1ZAOA 4QBIA 4R71A 1YR9A 2JDID 5FOXA 4YONB 2PH1A 4K2EA 1CF7A 4FINA 4CVNA 1IW7F 4HLYA 2ZRGA 4QG7A 4JJKA 3AP3A 3RDPA 1GDDA 3X1DA 3A37A 4O25A 1P73A 5CITA 3EZ6A 1VCOA 4KHZA 2K02A 4HBLA 2RHMA 3ASZA 5KUTA 5HDKA 4PZJA 2QVOA 1W48A 3AVQA 5FTKA 5FFMA 2PFBA 4BXUA 1GNRA 1L3LA 2FOKA 4JLBA 4PZYA 1P4WA 3EPJA 1B59A 1YIOA 1R36A 4ASUD 3P1JA 3WGIA 5A5GA 2Q9BA 2R62A 1YLFA 3F72A 3LAWA 1E9CA 2XJ9A 3LA6A 3HU2A 1D2NA 5ICEA 1YJ5A 4IFEA 1YG2A 5TMPA 3KQHA 2FNAA 4QBHA 5JHGB 2EVWX 1G4DA 1R0WA 2WJYA 5FBQB 4PC6A 2GVDC 4MDFA 4DC9A 2J9RA 5HCIA 3KTAA 1II8B 1N0VC 3QSYA 2B92A 4AIHA 4A15A 3FHOA 4XWOA 2EWNA 4I02A 1K5GA 4DDTA 1J99A 1E1QD 4XVQA 4EPYA 4I0BA 2G88A 5EE3A 2XAHA 1Z2CA 2FU4A 3RRMA 4JK1X 3OOPA 1PLLA 2CNWD 3LWFA 4AYXA 5JECA 1DARA 2JASA 3UG6A 3KTAB 1P4SA 4KIFA 3NBXX 3SI7A 4LJAA 1YR7A 421PA 1P4XA 1FX0B 3Q9SA 2IYYA 4II7A 4B3FX 1FYMA 1LF5A 2FG5A 2IYWA 3WTXC 2FFHA 2K7LA 4HEJA 1FNNA 1OPCA 3N5CA 4ZV4A 4F4JA 2BV6A 2A3RA 2KIMA 2QMEA 4B3XA 4L9JA 1KSHA 5DN6A 2PCJA 1OXSC 2ZS7A 2XAFA 1OFIA 3M9AA 1KZGB 1GM5A 2J0VA 2QWWA 1XZQA 4EMSA 2H8KA 3KXKA 4HDQB 1CGPA 1SD4A 1Q20A 3CNNA 4KFRA 2ZR9A 4PGGA 3MQ0A 1JR6A 1Z07A 2QA5A 2D2FA 2C98A 3I92A 2VC1A 2GEDA 2GA2A 1GG2A 4URYR 4BQAA 4MITA 5L3SA 5LEKA 2GXUA 3WG9A 2A3SA 4S05A 2VP2A 1WMSA 2P5TB 3THOA 4TYPA 2G83A 4TL8A 4YC7A 2F2EA 4FW9A 5JEEA 2D62A 4Q9IA 1JECA 2PBIA 5G3ZA 4C30A 4D25A 3FWEA 4ACAA 1W7PD 1YZLA 1KY2A 5JI6A 2ZE8A 1CR4A 2IF0A 3HOSA 2GJ9A 4KLZA 3DM5A 4JMPA 4D4JA 4KICA 2WBLC 2JSCA 1QHNA 2Z5FA 1R58A 2IJLA 1EFHA 2FX3A 3NC0C 3LBIA 3QENA 5CLSA 1G5TA 2Z4RA 2AHOA 2OQGA 2EWWA 2RB4A 5A0FA 3G0HA 3BAFA 5EE5B 2PLFA 5FPKA 1WRJA 4I7HA 3AJIB 2VN2A 1CJUC 4EQQA 3T34A 3RYRA 1TNSA 2CK3A 4XD7A 3HUGA 3CBQA 2CBZA 4DKXA 4M8NE 3OE7A 2W84A 4NB5A 3T8RA 3BB4A 1N6LA 1ZVQA 1SFEA 1U90A 2WKQA 4L5BA 2BM1A 3VR3A 3BH7A 1KO4A 1S7AA 4FWGA 2FBIA 1CP2A 3T15A 2H09A 1JPJA 4DSTA 3IUYA 3IGFA 1GZSA 5AIQA 2XB2A 3AV0B 3IEUA 3LY5A 3H1TA 1UKVY 2GEVA 3GJ6A 1UDXA 2GF0A 3ICQB 3HSRA 5FOTA 521PA 3SJAA 2XSZA 3PQJA 2C9OA 4JLAA 5HE8A 5L3BA 3Q5FA 1E17A 1F2UB 4CYMA 1CF7B 3OEHD 3QXXA 3I5XA 2DK8A 4KN4X 5HS9A 3TVTA 1S3SA 4URXR 3GLGB 3SQNA 4G7HF 5KO2A 1ODDA 4DLVA 1Q1BA 3LBNA 1P2UA 3B1XA 3WRYC 1CXZA 2R6CA 2B0LA 2HJGA 4OMYA 4DSUA 2HV8A 3N4MA 3QF4A 4A8JA 3CPHA 3VAAA 2D7DA 3U60B 1BOAA 3BJAA 2LKPA 2RGNC 3DL0A 3I0TA 2XEXA 3WXMA 4ZIRB 3IIMA 1GILA 4TYQA 1AS3A 4GZMA 4DSOA 5SZIA 2OQRA 2YPRA 2CCJA 2MLGA 1M34E 2G7HA 3UWKA 1TL7C 4ZI2A 1RC8A 1G3SA 4MEYF 1OIWA 1VIAA 4HAMA 1W1WA 2WAYA 3AEZA 4N0DA 4Q1FA 2Z6VA 1DAKA 5FPTA 1CJKC 4QHTA 2QM3A 2TDXA 1XEFA 2OAP1 2Z83A 2QMUA 3C7JA 1G3MA 3CLVA 4RGXA 2WSSD 1DUXC 4NP6A 3K1JA 2W6JA 1M74A 2V9PA 3GEIA 4MKIA 4HDCA 1WQ1R 1BI0A 5ILSA 4QNRA 4LFUA 1A2KC 3N70A 8OHMA 3AF4A 2PEZA 5JMTA 1U5TC 1II8A 4B73A 2HWVA 2J0QA 2AD5A 4ZDKA 2FSWA 2CYYA 2W0MA 2BBYA 4AI6A 3QU3A 1G17A 4HX7A 4A0FA 2GZAA 2CL0X 4P4SB 1QZXA 1N6IA 4Z54A 3U6BA 3RKYA 1YZQA 2IUUA 3MHVC 1TU4A 5ELXA 5DH9A 1U8AA 3OEEA 3FMFA 2HYIC 3KKQA 2VE9A 3B13B 1ZU5A 4MNUA 2FBKA 4NCNA 5HE9A 4P4TA 4BZPA 1U98A 1COWD 2O8CA 4M6YA 4HATA 1E0SA 2L4MA 3FM3A 1O57A 1E2EA 1D6JA 3DZ8A 4LG0B 1E2KA 4Q7JB 3AF1A 4RCZA 3S2WA 4U00A 4KLNA 4OYHA 2X2EA 4QM6A 3E5XA 1OYWA 1TTTA 2ZS8A 1XTJA 3RYPA 5FO5A 1ZU4A 3L82B 4TLCA 2VHQA 1AA9A 3A1SA 5JR3A 3REOA 1IUYA 4Z51A 4DUGD 1OSNA 2A7QA 1P6RA 2PG4A 1OH8A 4US2R 4A1FA 3T1OA 2NPFA 1W7PB 1FX0A 3DP7A 3ABUA 2VRWA 5EZ6B 2VT3A 2RAPA 1NMZA 3DV8A 4Q02A 1FNMA 2ZI4A 4ZDWA 3TGPA 1C1KA 4RD3A 1DEKA 3WODF 2AS5F 1VTNC 1M7HA 1Z83A 5JWRA 3VLFB 1ULYA 4FN5A 1R5NA 2AXLA 2ORWA 4NYIR 4D0NA 1IHUA 4A0RA 3AVXA 1W2GA 5B64A 4D26A 2NYXA 3O8DA 4L9NA 4PFSA 1JJVA 2NGRA 3BWGA 4QHYA 3KB2A 4M71A 1XTSA 5KOYA 2PLYA 1Z22A 1EFCA 5HKKD 5K1YA 3RSLA 2MMCA 4ZH4F 5D6EA 1BN5A 1BJAA 4MEXF 1V5WA 3U7HB 5LBQA 2HYDA 4PC2A 3IKTA 2VIIA 2ZMEA 4YXWD 3E5HA 3EZ7A 1WB9A 2IYLD 2XAUA 4OK6A 4ZYHA 1NLYA 1XXHA 1UB9A 4V0KA 1FZPB 2VC0A 2IRFG 1ODFA 1XCPA 3THYA 3T8TA 1W0KD 2VE8A 2ZUCA 1R7JA 2FSHA 2HTJA 4LV6A 5JLJA 2ZJ8A 2QGNA 2D1HA 1UHWA 1ETUA 2LF8A 1ESMA 1VHTA 1R1VA 2IYRA 5E17F 1TADA 2FA9A 1RZ4A 4RGRA 4QKQA 1XSVA 2VPPA 5GJVC 1IZ1A 3J81Z 1FC3A 1M6NA 1KNXA 1OV4A 5HPYB 1K79A 4M1OA 2PJPA 3QP6A 4XRFA 1T38A 2FJUA 3BWDD 4GITA 1R5BA 3CZPA 5ICCA 4GOJA 2K4BA 1U8RA 2YV5A 1Q44A 1AS2A 4LJ5A 1QHIA 2F3TA 3K9LA 3W9YA 1MABA 4OJQA 5FI1B 3SC3A 4BHCA 2ZUDA 2OCAA 1ON2A 3MG9A 1OF1A 1KI8A 1SXJB 2RGDA 2F1IA 1PLJA 4JJZA 4HB4A 3BFVA 2XNSA 1E9RA 5CJ9A 1FUUA 2O03A 4EGYA 2OCYC 3LW8A 3TRFA 3FMIA 3JVVA 2VHCA 3WU0A 1VKJA 4EJSC 1ONVA 3DO6A 2JLSA 2OV2A 3I8XA 2BOVA 5FD6A 2FE3A 2MLKA 4JBWA 1QF9A 4EM1A 3RSOA 3ECOA 1MABB 3JW4A 2ZRMA 3KXLA 4RFSA 1R10A 2FPLA 3KP3A 4LC1A 1J7KA 2FXAA 4Q00A 1HKQA 2PEYA 3SXYA 1SVKA 3ZQ6A 3QKSA 4W5HA 5EZ5A 3BRWD 2ZRDA 4MRNA 5ICGA 3SBDA 4BE7B 2IXGA 3GJ3A 1KDOA 1D9ZA 3PQKA 1E9BA 1G9XA 1NIPA 3ROUA 5LEJA 2R6GA 2OBMA 3RS7A 4AKEA 1PLKA 2DO7A 1KI7A 4MDEA 2EYQA 4FCTA 1BH2A 3B8HA 3K70B 2W24A 5AK0A 3CPEA 1QG4A 2HZTA 2G1KA 3X2SA 1KOFA 1LVGA 3HYIA 1MO6A 4MKGA 2PT5A 1KO7A 2JLWA 1QZMA 2ZFWA 1AN0A 3SYKA 4CEHA 2BEOA 2I4IA 4DLUA 2OM2A 4HLCA 4IJMA 4DNCA 3DQVC 4MQ9F 1JXMA 2A68F 4M1KA 1J2JA 4Q9LA 2YOHA 1ZG3A 1SXJC 5DD4A 1F3OA 2CXXA 2O0KA 4MH0R 4PR0A 3BXZA 1D9XA 2ACJA 1P60A 2ZEJA 4LJ9A 2GQQA 3TSWA 4EJSA 5D4RA 2JJ2A 1SZPA 4C2TA 3K0CC 3BP8A 1YO5C 1SXJE 4PTLA 1IY1A 4W5JA 4QBFA 2C99A 2E7XA 1ZUIA 1ZBDA 2FSGA 4BNCA 5KSPA 1FYLA 1Z8FA 4FWIB 5J5CA 2GXQA 2ZXUA 1A2BA 1AJEA 3P4YA 2D74A 1O7LA 4Q1EA 1OKKA 1J5YA 5ED4A 4U7DA 2MSCB 1E6CA 1KU7A 2ODWA 2ZITA 3AF3A 5TXGA 5FBRB 1XP8A 5F9HA 3UIEA 3QKSB 1E2GA 1F2TA 4DWJA 1XCGB 2P5LC 1DTSA 2VSOA 4OHZA 3W5JA 1GTVA 1M8PA 3KJIA 3CF6R 3REGA 1GP2A 1E4YA 3EA5A 3R0AA 2GVZC 3AVPA 2TMKA 1SVSA 1XEWY 1OH7A 1AM4D 2NS0A 3LW7A 4PHFA 5L3FA 3VX4A 3FZVA 3PUWA 1IN6A 1MDMA 2AR7A 3CPJB 4OHYA 4ZYDA 4FCWA 1Z91A 4ASNA 4AKIA 2XOKA 4EPTA 3K2ZA 3MJRA 2FU5C 3GFTA 4LK1F 4LJZF 3QEOA 3ML6A 1D5VA 2QEQA 3D31A 4OK3A 4YMUA 2GA1A 3GMTA 5AJZA 1TEVA 2R6DA 4HF1A 4EM2A 3GJ0A 3LWNA 1IN4A 4LGMA 2BMJA 1G4AE 4UQOA 4QOSA 1U78A 3OZXA 2L01A 2BKUA 3I4PA 3IKVA 5L3CA 4HAUA 5IF9A 5K8IA 2GZWA 1KGDA 1TQ2A 1GITA 2ZRCA 1T9HA 3WTTC 1VHLA 4LHVA 4XLNF 2V1UA 3RRNA 5H6RA 3HPQA 1E2JA 1MJBA 1ZM3A 1RYFA 4NYJR 4EPRA 4M9ZA 1KZ7B 3E2IA 3B6EA 2NO0A 3CR7A 4HUTA 2VONA 1HUQA 4S2EA 4W9MC 1X8KA 2EFHB 1JHFA 4Q9HA 3K53A 4EFLA 3OV8A 3WYGA 1OFTA 5D3MB 4O0MA 3TO6A 4URWR 1G8YA 4PXAA 4D0LB 2HYFA 4LX0A 4NH0A 4LY6A 1OT3A 4BYYA 4HDUA 2IYSA 2MSEB 1QVRA 2M87A 2ZMEB 1JEDA 1KSFX 2J45A 3K09A 4BECA 1PJRA 1TQIA 2W2XA 3WYFA 4LHXA 1O3TA 1BI2A 3ZVMA 1HW1A 1DAHA 3KJGA 4FWDA 4BRWA 1IAQA 1VDZA 1P9NA 1B9MA 3GYHX 1KQ9A 1P7CA 4N0EA 1JNYA 4PO8A 4V0ME 1VMAA 3P9IA 3R7WB 3IHUA 2QG6A 4A8JC 3V4RA 3R9XA 2O8DA 3U3KA 3IIJA 5TV2A 1RYHA 4WXHA 1RJ9A 5DYMA 1JALA 3WBKA 1EWRA 2KBFA 2QM7A 1MRSA 3LXXA 5J6XA 1G3TA 3MAAC 3KLNA 3WTVC 4V03A 5HDGA 1S3JA 1OXXK 4A12A 4HUQB 1W5SA 4ZYEA 5FPSA 4KA4A 1S2MA 1G41A 2GZDA 3ZJYA 4A0GA 2ZJ5A 4DLYA 3EASA 2Q6TA 1TW2A 1E2IA 1GVNB 1Z3IX 3IBYA 3UMSA 4B44A 3E6DA 3ADCA 4KCGA 2WAXA 3CWZA 4TTQA 1S6LA 2MMGA 3IPXA 4OIQF 1G8PA 3U6KA 2EQBA 2PZFA 3VODA 4JLNA 4BFVA 2CEAA 2W2VA 4UJ3A 3K70D 3VOEA 5TB5A 3F22A 1H8EA 2V3CC 3DEUA 2A69F 3ONWA 2ZO4A 5L3EA 1II9A 3IL2A 5DYIA 5K8TA 3BDDA 3VKGA 4B3GA 4ERNA 3TO7A 2ODEA 1YZUA 4A2QA 1T6NA 2VQSA 3GLIE 4UVCA 2ESHA 1BMFD 2DHRA 1EX6A 3H92A 2EFEB 3OIWA 1L0OC 3QUSA 3ULQB 1KI3A 4Q66C 1DE0A 4LSGA 2G9WA 2FFAA 2WOOA 4JN6A 4KSCA 2JATA 4TLBA 4C3ZA 3EYYA 4V0LA 1FP1D 5KNBA 3I62A 3RRYA 6Q21A 3BORA 4EJOA 1YTYA 2YWGA 2BHRA 2ZRHA 2BC9A 1VYVA 3HR8A 2FRHA 3QXSA 1PUIA 4EIWA 2V1XA 1HE8B 3OIVA 3QG5A 4LHZA 3ETLA 4L9SA 3W6OA 1J2XA 1T5IA 3LH5A 3M8FA 1P6XA 1KIMA 3GLIB 2NMVA 2ZSEA 4MRPA 1G64A 3RJPA 3SEAA 1W0KA 3FMSA 4LB5A 4MYUA 5L3VA 5C2JB 4BH9A 2FA5A 1OIVA 1O3RA 3BS4A 4M4SA 5FR1A 3PEYA 1HT1E 3RAPR 2REOA 3SJZA 4M72A 4N0BA 5HVQC 3U7GA 4Q1DA 1NN5A 2PZEA 3ZMZA 2ZJ2A 1LB1B 3K0FA 1X1RA 5CIWA 5GVSA 4QM7A 3GFJA 5D8LB 1OH6A 1CTQA 2VOPA 4Q4LA 1P92A 2OILA 3OFND 3J81k 1WKMA 2DU9A 2HKOA 4HLQB 3VHLB 1H8ED 1JR3E 2C95A 2V8OA 3P9CA 2DAOA 2AN9A 2J5PA 2CDNA 2WKRA 3A4NA 3FKSD 1S4QA 3I54A 5FLXK 3V7SA 1GSIA 1Z6GA 1KNQA 2OFWA 1FPQA 1HYQA 4KU4A 4MKFA 4MRRA 4P9UA 4LLNA 2XNDA 1RKBA 5CB6A 1NG1A 3SZRA 1KGSA 2BJWA 5L3QB 3NVAA 1G7CA 4ZCLA 2GRJA 2BMFA 2QGZA 2QBYB 3K9TA 1KK2A 2WWGA 2ZJOA 4HI0E 5CLLA 4B3BA 1USTA 4IOLA 5EXTA 4S04A 1NKTA 3JZMA 1EG7A 4K46A 3AAFA 4IRIA 2ZS9A 1ZP6A 1YRAA 2XNDD 4YMWA 1SULA 1B4AA 2IL1A 3KEOA 1UBCA 4TQAA 3W8RA 2DPXA 1DAEA 1FP7A 2ZROA 2R6AA 4RB0A 1RPZA 1R8SA 1G6OA 2OSBA 3B9PA 4OI0A 2EFQA 2ZVPX 4DT1B 2PMUA 1NBMD 4AC9A 2QUFA 1SD5A 1DS6A 1ZYUA 3QNUA 3OESA 2P5SA 5E7MA 1LS1A 2O8EA 3E6CC 2FE4A 4KFSA 3B85A 3G73A 2J0UB 2O8BB 2MBFA 3U9GA 2NNYA 1D2EA 1JEEA 3IILA 3WTWC 4V0NA 3IRRA 4N9IA 2BBOA 1A82A 4XBFA 3Q85A 2F1JA 4XTRA 3SFVA 3Q3JB 2OESA 3CO5A 4O3MA 1LNWA 5EP2A 5FB2A 1KAGA 3AGQA 4UKDA 3AQ4A 2YVUA 4Y17A 1S1MA 3F8MA 1PVOA 2NZJA 4RJLA 1XRJA 1U8ZA 3U3RA 3FM5A 2B7BA 3FF5A 2RGXA 4HZUB 1ZNYA 2ZJYA 5KSOA 1DADA 4JLMA 4QGHA 4F38A 2P5KA 1JB1A 2RGBA 4I1OA 5EE0A 3TSZA 3NBZC 4HA8A 4GZLA 4BLOA 5KYKA 2AXPA 2FV8A 2ZJZA 1KI6A 1F4KA 2CCGA 1IXRC 3KLOA 1OIXA 3GCGA 2F3RA 4X8OA 2VSFA 4ENKA 4O6JA 2XOKD 4PZLA 2GILA 4WF2A 3WGHA 3Q9LA 4AWXB 1XX6A 3SHWA 2ASEA 3HHGA 4MKHA 1HY3A 2ZRIA 1OMIA 5CVJA 4DLXA 1R00A 1CJTC 2QSYA 2XTMA 3EC1A 4P4SA 4H0EA 1USSA 5DDGA 2EFOA 4EV0A 3ZS9A 1XGNA 4IRGA 4RS8A 3P20A 1DELA 3WMFA 3D0SA 2WWYA 1R0XA 3SZPA 2IS4A 3DVLA 1R1UA 1H9GA 4HV5A 4TLAA 1XJCA 1G19A 4GOKA 3FHCB 2BBSA 2EFDB 3TO9A 2FNPA 2HOEA 2RCNA 3GLHB 4I99A 5H70A 5LDDC 3ZVLA 4J0QA 1KI1A 2QROA 5E3HA 2O8CB 4HYEA 3SYLA 1CLUA 4HSEA 4R2IA 1QHHA 5J40A 4LGWA 5FFZA 1G8GA 1SQ5A 2GDJA 2GAOA 2ZRAA 4LBYA 1VG0B 1XB4A 2A5DA 4HF0A 1XTIA 2IXFA 5JHHB 1G21E 5ILVA 3I58A 4RB1A 1TQMA 4JLKA 2M45A 3NTUA 4A5MA 3NEUA 2QPOA 2QPTA 2VBZA 3M1IA 4YMTA 3BBPA 4OQNA 1FSHA 4DIDA 4FX4A 2D2WA 2XVCA 2DCUA 4XWKA 4IRHA 2OZEA 3E97A 2BV3A 2BYVE 2VP5A 5CVRA 4M9XA 5HOOA 1XMAA 2IUSA 4LC0A 2XAQA 4WXCA 2ESNA 5KHOC 5KVRA 4KVGA 4B2LA 3QPHA 3U3MA 4I01A 1XPRA 5K8UA 3PV0A 2IS1A 3CRRA 3KZYA 4RB2C 4ENNA 4ESBA 1LV7A 1KQ0A 2N42A 1NKSA 2H18A 3OAAD 4KYIB 2NO7A 3KB1A 4HAYA 4RSGA 1MJAA 4D4MA 1DO2A 2IA0A 4ZZDA 2RGAA 2HFHA 5BYKA 3BOQA 5AIPA 1E0JA 1N2CE 4QL3A 3ADBA 2YJTD 1YQTA 3BH0A 2XJ4A 1VG9B 1A4RA 3D7MA 4AD8A 3ERED 1BI3A 2ZBKA 1BO6A 1F2TB 2WOJA 3PCRB 1HKSA 2IS6A 2G3YA 1IN5A 2FSFA 4I98B 1YHNA 4Q9JA 3ZZTA 2C96A 1LTQA 3CWQA 2D3WA 4MGYR 1Q1HA 2FF7A 4PAMA 4Q18A 4KN7X 1ZM9A 4Q4JB 5FUWA 5JJKA 5JWOA 2P7CB 1X37A 2IS2A 2ELHA 2EFNA 1YZTA 2GCOA 1ZYRF 3FWYA 2IUTA 3VR1A 3R6SA 2R7FA 3L0PA 1DAIA 2GBLA 3FXQA 3QXCA 4F4IA 3GX4X 4IHQA 4E07A 2OD5A 2O5VA 3RTRA 2BEJA 2HJVA 1VCNA 4A6DA 3B2EA 3AVWA 4HAXA 2N46A 2EFPA 3MRSA 3QF4B 4A8JB 4OU0A 2DBBA 2JJ1D 2Z43A 5E20A 1ELOA 4LDJA 2DWZB 1I4LD 2VTKA 2QAGB 5AJYA 4G94A 5TDHA 3TR0A 2BWJA 4JVLA 4KI0A 5JRZA 3CH5A 1T4GA 4CGZA 4XLPF 2O3FA 1EK0A 3OEHA 4RD0A 5GJWC 3I61A 4HW0A 3K9NA 4PPFA 3SOPA 3SZTA 2ZYVX 3M4YA 3H4MA 2QQEA 4IOMA 5HDNA 4FMDF 5FL3A 2H6BA 2E87A 2XGJA 4E70A 4JS0A 4OQLA 2PZGA 5L3DA 4QGGA 1CKEA 4OK5A 4R9UC 1SMTA 2ZREA 1TUEA 4R1HA 3L8YA 3D6TB 5F64A 3EIHA 2YWHA 4BGDA 2CHVA 5A2QK 1WP9A 4Y15A 2UXXA 4ARZB 4KV9A 5E8IA 3IO3A 4ZZLA 2XUBA 1LEAA 4M6XA 4BFXA 1UCRA 2CK3D 4XD7D 2M1BA 3OAAA 3K8YA 3W6NA 2VBCA 1FP2A 4GYGA 2O6GE 1E1QA 1G3QA 1MJ9A 1HTWA 1PZNA 1TAGA 2PN6A 1XCMA 2HEIA 2ZPTX 4U0VA 2OHFA 4MRSA 3TQFA 4FWTA 3TUJC 4DCNA 1RRFA 3RI4A 221PA 4A0HA 4B76A 1K7AA 1UBGA 2O8FA 3T12A 5DCFA 3MCZA 1CULC 1XXHE 3P7NA 4Z2YA 4POAA 3THWA 1R8QA 4IHTA 4Q9KA 1FX7A 3EG5A 5CYVA 2CLCX 4M1YA 4PPQA 4HUQA 4TSFD 4V02A 1TPZA 3THYB 4G5RA 2VT2A 4IVNA 1Z1DA 4C7OA 3C14C 2JDIA 4FCVA 3X1ZA 4JKYA 3HHHA 3VFZA 1Z9CA 1UEJA 3TGNA 3UK6A 4RD6A 4GL2A 4NHOA 5P21A 1BKDR 4U0YA 1SVLA 4BFZA 1LFDB 4A6EA 2NO6A 3ZMSA 3AF2A 5FPYA 2HDCA 2HF8A 4IXMA 3ZH9B 4AG6A 4KNYA 1UM8A 3MFYA 3QF7A 1ESNA 5AJVB 3BY6A 5DN6D 1NN1A 2OZ6A 3I73A 2NZ8A 1TQDA 3GLXA 1XU4A 3CRVA 5TY0A 3IO5A 3KUCA 2PT7A 2LF7A 2DZOB 3O6BB 1BC8C 2VF7A 4V0OA 2J41A 1VYUA 2P3SA 3EPHA 2COMA 4OHWA 1KJYA 2PMDA 1CR0A 1SMYF 3JVUA 4JT4A 2Z4SA 1LDJA 2P6TA 3FMOB 3TDUC 4TL9A 3FMQA 2K5UA 4UXHA 2ZR0A 1IY2A 4L18B 1W0JA 3GP8A 3AVOA 2D4HA 3KE2A 2J1LA 2JLQA 4D82A 4UV8A 1PUEE 2JIZA 2VSXA 3MFKA 3O3KA 3MAJA 4G1UC 3SS8A 3LNCA 1GRNA 2FEZA 5L3RA 5CK5A 2JLZA 4P0TA 1T0FA 4LYFA 2DFKB 2UZ3A 1O3YA 3CUQC 4G01B 1G7TA 3W90A 4XSGA 1G8FA 4WA7A 5CIQA 3AVYA 3IEVA 5E18F 1GWNA 2LWIA 2FMYA 5DISB 2HYGD 2WJHA 4KXFB 3LD9A 3EW9A 5KDDA 1CRQA 2WTEA 1KKLA 1R1TA 3TKYA 5G41A 2OBLA 2IWRA 3EPKA 2KSQA 4HV6A 4TMWA 2XROA 2X1VA 2OEPA 2RVCA 4PAOA 3RS3A 3TOBA 1GXPA 4TLEA 621PA 4AY2A 1R4AA 3GLGE 4PGHA 4JL8A 5LRRA 4US1R 3Q8XB 2CFXA 2ZNYA 1Z0DA 2IHBA 3A1UA 2IT0A 1S3GA 1Z0IA 4PQYA 1BC7C 3V9PA 4DBLC 3LSTA 4WXRA 1P9WA 1FPMA 1G3WA 2A07F 3GJ4A 1AK2A 5D5VB 2HLDD 3BIFA 3WY9A 4PQRA 2BE5F 2B8TA 3QIAA 2J0UA 1DPFA 1W4MA 3VKWA 1N6NA 3C7KA 1XJQA 4DDUA 3CLOA 5ILUA 5D6FA 2ZE5A 1VG8A 3NWJA 2WKPA 2WWHA 2CHGA 3EWSA 3AF0A 1HV8A 3NH6A 2Z0MA 3RWOA 4PHHA 3UMRA 1ZC3A 2GAAA 4OQFA 3VQTA 3WNCA 2B7CA 5IT3A 3ND9A 2DWPA 3EDPA 3TH5A 2ZJAA 5KDLA 1MDMB 3PUZA 3SNHA 2Q0OA 4U7BA 2G77B 1JAIA 1MO3A 4NE2A 1TTYA 3NDPA 4HYYA 3RIRA 2PQ8A 2IYQA 4TV7A 3ZVRA 2RKHA 1KAOA 2UVQA 4MRVA 2ONJA 3ZGXA 1V4RA 1L2TA 1HH4A 4L16A 5AUPB 4UVBA 1NRJB 4M0LA 3W6KB 3GZ5A 4XWAA 2ZR7A 2LKDA 4WVFA 2M30A 4B6EA 5LB4A 3I59A 5FL7A 3EC2A 5FUXA 1D8TA 4GCVA 3J80K 1NLZA 4BWYA 1MD0A 3MWKA 2XHKA 1EFTA 5FUVA 4KAXA 1E1RD 2F9LA 4LV8B 5D5XB 1SFUA 5LD2B 2CLDX 1OE0A 2ZI6A 3TIFA 4X8HA 2LCFA 1ZIPA 1SKYB 1QGPA 4ON0A 4OL0A 3THXB 2VBXA 4LLGF 1IN7A 2LSOA 3J7AO 5D4SA 2DB3A 4KVAA 2CE2X 1JR3A 2QE7A 2HUPA 3TOAA 1IRFA 2JT1A 3UWOA 1KO1A 1STZA 3GFIA 4TSFA 2RNJA 5KTYA 1YW8A 3GLFB 5DYGA 1DO0A 1WRBA 4JZKA 4M1TA 4FMDB 5SZKB 4QJ5A 1L4YA 3BERA 4NYMR 4HLDA 4L0YB 4A5NA 1Z06A 1G8HA 4C4PA 3DZDA 2CNWA 4M21A 3LLUA 1SKYE 4BPBA 4TZ0A 4RAZA 4DXAA 2R44A 2OT3B 4HAZA 1S0UA 3DPLC 3MZYA 1G7RA 2Y8EA 3OEED 5AUNB 4WXDA 2RH5A 4C7OB 1CF4A 1BM9A 2FGKA 3CNOA 3QKUA 4B35A 4UNQA 2W25A 1RRGA 2UKDA 2ZI5A 4IVRA 4DCTA 2HTSA 4AKGA 1P3JA 2JLRA 3C5HA 1RIOH 3P27A 3Q5DA 1XDUA 1SXJA 4YIIA 4G9YA 1S8FA 2IW5A 4TTPA 2OAZA 4DLZA 2CHQA 1Q57A 2DBYA 3AM1A 1N5KA 3MWYW 4HQMA 5C1BA 3O8BA 5JS7A 3DDCA 3BE4A 1YS6A 2QENA 2PX3A 2ZU6A 2XV4S 4IF4A 4HLXA 3GLIA 4G7ZF 1G16A 5H20A 2F43A 2X0LA 1T0JB 4FT8A 5CVUA 2VP4A 4D2IA 2IVMA 1KI4A 3GUDA 2X77A 4L4UA 1EXMA 1UKYA 4BLPA 2QZ8A 2G1JA 4FMCB 2WHXA 3R7WA 2QM8A 2CLSA 2D7CA 1B1BA 2JA1A 3WE3A 1YVDA 1UBFA 3AKDA 1MO5A 2HGCA 4DCSA 1ZGJA 1NHAA 3KP5A 1G20E 4PX9A 3R8CA 5DLQC 3U2QA 1N0UA 4FHTA 2IA2A 3HRTA 4FX0A 3M0EA 1RE0A 1Q0UA 3S1AA 5J4VA 3VKHA 4BEJA 3HPRA 3KDSE 1IY0A 3VU9A 1L7VC 3BFKA 3GEEA 4A2UA 1KYWA 3HU3A 2R7DA 1C9KA 3FHZA 1IOZA 1MKMA 2EJRA 1P5ZB 1Q21A 3KL4A 5BPIA 1UDWA 2REXB 2JGNA 3WHLA 1CRPA 1OB2A 1ZAKA 2FFQA 2NQ2C 2A2ZA 3F8TA 4DLSA 3VNVA 5C18A 4Q4AB 1TQPA 2OFOA 1MKYA 2Q2EA 1XNJA 1Q1ZA 1SXJD 3JTGA 1LDKB 3ZMTA 1I27A 2VA8A 2C78A 1E2QA 1BIAA 2RV8A 4IPAA 2HT6A 3LX8A 4GMDA 4Q1AA 4EGZA 4BFSA 1CU1A 2PCLA 1HKTA 2ZI9A 3OE7D 2FDCA 2F9MA 4LYAA 4QGFA 4C0AC 3CB4A 1RW4A 2H6CA 5FR2A 3QOPA 3EYIA 1WA5A 1YU9A 1MRNA 4G0NA 4DT1A 2WMOB 1E2NA 1VECA 2CQKA 3FMRA 2PBRA 2ZQ5A 2QZ4A 5K5RA 1UADA 2ODNA 4JLDA 2OLKA 5E8GA 2XX3A 5CVVA 1XD2B 4YIFA 2G9NA 4AURA 1OW3B 3U4QA 2PEXA 1N6PA 3TVDA 3W6PA 3PXGA 4UNPA 2QNRA 3SR0A 1R7RA 4IDHA 2DZNB 3KP7A 2FPKA 1ZMXA 2ZTSA 2Z5UA 1G3IA 1X3SA 2VEDA 4PCQA 4CW7A 5IK2A 1NN3A 2IW3A 3VNUA 4Q48A 2YWEA 3EZ2A 4Z8YA 5J4KA 2JIZD 2XGXA 4Y13A 4GFDA 4M1WA 2DFNA 2QT1A 1U5TA 4YFKF 2M8EA 1UAAA 1QHGA 5TJJA 1BI1A 1ZC4A 2QE7D 3CF0A 4BZQA 4HZUA 4LJ7A 4M1SA 3RHFA 4C0JA 2A6EF 2PL3A 1F5TA 4HF2A 3THWB 5EE9A 3Q9VA 4PDKA 5DEQA 1D3YA 4PC7A 4QJ4A 5IT5A 1E3MA 5FBWB 4GT1A 1I4TD 4LBVA 4DDWA 2DQLA 2O8DB 2CCKA 1CR2A 5E4FA 1FMLA 3FHTA 3BGWA 1Z6TA 2ZVQX 1XMIA 3QEJA 4B34A 2QT0A 5G53C 1N6KA 2QY9A 3GD7A 3K9GA 5HR5A 1W5TA 2QUZA 3U7EB 4ETSA 3QVUA 5EUQB 2DPUA 4WZBE 1BOFA 1J8MF 2D1VA 2QQ0A 5J4YA 2A6HF 4PPGA 2FH5B 2VODA 3IHLA 3MMPA 3JAMZ 2E1CA 1XZPA 1N3BA 1ZUNB 4Q03A 3NQOA 2GXBA 3W3ZB 2BVNA 2P6RA 1NVMA 5HTKA 1ZG5A 3BJIC 2F5EA 5JJLA 1ZM4A 1U94A 2CGPA 2O61A 3FDIA 2WSSA 3CX6A 1P72A 3SQWA 2ZUBA 1KU3A 721PA 4CZZA 3K70C 2VP0A 4Q7LA 3CDHA 1Y0UA 4LMYA 2BBTA 4JKIA 2ZRFA 3A8TA 4Q01A 4Q19A 3AKCA 2KIUA 2OUKA 1FUKA 2PLRA 3GXOA 2Q3HA 3B73A 4L9WA 2V6IA 5BN3A 3MZHA 4TQ9A 1H65A 3KP4A 5E1XA 1KDRA 1WCV1 2AL7A 3KJHA 4LHYA 4QFMA 3I64A 1K8RA 3B1ZA 4ARZA 2BCGY 2J0SA 2HF9A 4IXAA 1QBJA 1NMXA 3CZQA 1Z6XA 4LBZA 1A1VA 1E9SA 4LHWA 2I3BA 3GWZA 4ACBA 5KU1A 1TU3A 3H3UA 4D0GA 4EM0B 2ZNZA 3ZN0A 2B6HA 2VO1A 2ZANA 2R6FA 5FFXA 2QYOA 3CO7C 2W6JD 1SGWA 1U2RA 2WIAA 1J0RA 4UXJA 5FTMA 3VEPA 3HWSA 4FI3C 2R9VA 5B2ZA 3I53A 2H17A 3IQWA 1UFMA 1KY3A 4G3XA 3BB3A 5IT9K 4G5OA 4IDQA 4NYIQ 3V00A 4XVRA 3V4GA 4Q21A 4RKFA 5BN4A 1SAXA 1JE8A 1UEIA 2J7PA 4OHXA 2Q3FA 2E1NA 2YX7A 1KO8A 2I1VB 4DLWA 5FTLA 4L5JA 4WCGA 1OFUX 1QHSA 1SHZA 1FTNA 4A9AA 1F6BA 3LQRA 2H1LA 2J59A 3T1TA 5B30A 1MGTA 4ZKEA 1J70A 1P61B 4NYJQ 2GCOB 4EJVA 1X1SA 3L7WA 4CDGA 4N9HA 2HEOA 3O8RA 1KU9A 4JVNA 4NL4H 2W83A 2MSDB 4GPTA 4F7WA 4K8OA 3FXUA 5HCNA 1WQ2A 3JSPA 1PDNC 2YZ2A 4MGZR 4KUMA 1Z0KA 5FI0B 2LNBA 4U88A 5E1ZB 1QPMA 2ZETA 5FUYA 3EZFA 4AIKA 2V7QD 1LDDA 2QLZA 4IFBA 5HLIA 1GKUB 5LBIA 3CH4B 1FQKA 1TQ4A 5JBQA 3M8EA 1NY6A 1OKRA 4WX9A 4HZFA 2OBNA 4I1UA 5G3YA 3NBFA 4I4LA 3I59B 1HURA 3KJEA 5AONA 4CICA 1W4CA 2VHTA 2XKPA 3A58B 4BZXA 1NVXQ 4TMVA 1RFLA 4G8XA 1QQIA 3I1FA 3B78A 4FD2A 5FBLB 1GXQA 2AX4A 1RI7A 3R4KA 1KI6B 2DVWB 3AUXA 3L0SA 4BUJA 3TUZC 4Z8XA 2EB7A 4UXNA 3O47A 1WXQA 4B43A 2NO9A 3DXJF 4PQFA
chains in the Genus database with same CATH superfamily
1IH8A 2C77A 4FQ8A 3LNTA 4DCCA 1NKVA 4PHTA 3G1TA 1YHQI 3RVNA 3PDWA 2WJZB 3HGIA 3RU3A 1WW3A 4HQLA 1BOOA 3SQMA 1OU0A 2G82A 3B1FA 3MWEB 4FHEA 2Z7JA 1Z4PX 1GFSA 3AR6A 4LJ8A 3WLSA 2O8XA 4N9QA 4JBAA 4UUSA 4FKBA 1PRBA 2L2OA 3INYA 1W4RA 3NGXA 4A0QA 2BGWA 1OI7A 2DLCX 2BW3A 2R7AA 1Z4JA 1N7IA 3S2YA 5IAEA 5CGQB 2JJ2D 4HZGA 4IZHA 4CZ2A 2ZYDA 4O4JB 3NNSA 2R1VA 4DANA 4WD3A 3SE0A 2I55A 3NHAA 5LGUA 2G1UA 3JR3A 1A5AB 4Y0VA 3KKNA 4K6MA 4NBKA 5KPZA 3AYXB 1L4MA 4ERXA 3FIUA 3NI2A 2BWEA 3VC2A 4UB6C 2CUZA 4OIOF 1M2NA 1FFHA 4DA7A 1KWKA 3EEQA 2EWVA 5HIJA 1K6OA 4HAOA 3NYIA 2FW8A 4BNHA 4GXOA 1S01A 1Z4IA 3N2KB 1EX7A 4JLSA 3LUHA 2J33A 5I01A 1BXGA 2WT4A 3P9NA 4U5XA 2XASA 3Q12A 2IV2X 2MWMA 4IDCA 4N48A 4RA9A 4MO2A 2XB5A 3F7MA 4MPRA 4BDYA 1ZK2A 1U0FA 1R5GA 2XUPA 4EEZA 2XXAA 3IHPA 4I9GA 5EXEA 5G0VA 5JFGA 3IB3A 1NVVR 1LD3A 1VJ0A 2UXDB 2V7QA 4KKVA 3HU1A 3L6OO 2Q21A 4CT5A 4BEHA 2A9PA 1HXDA 3WHKA 3RZOJ 4Y1GA 1XFAA 2CL7X 1GSOA 3RFCA 3K73O 1SVMA 2P2DA 2LUOA 2W5UA 4KSYA 5JH7B 4AJOA 1UODA 1N7HA 4W5QA 3K0AB 3ZLTA 1WSDA 1EG2A 4WNIA 5KIAA 4A69C 1JIVA 4M6VA 3TW8B 3BMNA 1QKKA 4DOZA 3E3MA 2ZCVA 3QU4A 4NJEB 3W2AA 2ECBA 5FD5A 4KQWA 4C0HA 1XWFA 3TF5A 1SCNE 1C3LA 5HIMA 5EESA 2NPIA 5CH8A 2WUWE 2F8SA 2WDPA 2EC5A 1X7GA 2HW8A 3TQSA 3FZGA 3SLGA 3BXPA 1QUFA 1TT5A 1R8XA 4LMRA 4GH5A 3LT0A 1NUSA 5IC4A 3HFGA 4NBNA 3ENNA 1ODSA 2OVFA 5CA1F 4DV5B 1T8UA 4KQHA 5LHHA 2O54A 1T39A 3OQBA 5DLYA 5FQNA 3AEKA 1C7QA 5D5WB 4YJ2A 3L5OA 2VYQA 4RBNA 4G8DA 4L2IA 5M04A 2VAXA 2FZCA 3H4TA 1ZOOA 5C8DA 4DQ2A 2AKYA 2F5DA 1ZGBA 4MAAA 2UUBB 5HLGA 4CKWB 3BR0A 1N2IA 4RVCA 1XA4A 3EBPA 4ND3A 4CEJA 4BLQA 2NU7B 4LGYA 3G5MA 3CUQB 3ZI0A 1KE1A 1UF9A 4PLYA 2DWCA 2GIZA 3MXTA 5FOWA 1J9IA 4DFDA 1OVGA 4JSTA 2AFIA 4G5XA 3SF8A 4JQCA 3V4PB 2KQUA 1DCKA 1VE3A 4YH1A 1FJXA 4GGGA 1WTCA 3RYCB 5JS8A 4JNKA 1CIPA 1MH4A 5SY9A 3S2GA 5K09A 2P1DA 3SEZA 1ZRHA 3HYCA 4MCHA 4N4OB 4ITUA 4UNRA 4HFJA 5EA2A 1QONA 4NHEA 4KVFA 3ZWPA 5K6AC 4BKOA 2GJSA 5FGMA 2R92J 2HMAA 3FX3A 1PKXA 5A2GA 5HZKA 1JSRA 1KOLA 5DBHX 2IYXA 1ZZGA 1OTXA 4AZSA 5LXTF 3KVWA 1IG3A 1I6XA 5BWNA 4NOLA 5K8LA 3ZUGA 2XQGA 2XDVA 1AQUA 2IFTA 3PG5A 2QCOA 2F64A 5D5HA 4XX0A 5AOVA 3ASVA 4EHHA 4EFNA 2XB4A 5LHGA 1MT3A 2H48A 2YFYA 1Z6PA 4WT7A 1XVLA 4IMRA 4D9HA 1CZOA 5JAOA 1BXZA 4U2BA 3HBLA 3OZIA 3ZOBA 1SUSA 1LQTA 2ZK7A 4BFCA 3KUDA 4XQFA 2IX3A 3ZP5A 3ZN1A 3N8HA 1Q0ZA 3TLMA 3OZAA 4FJ1A 3CY6A 3GAZA 3EDMA 1F5NA 1I6LA 3DL4A 4RTRA 3K1MA 2XZDA 2CJWB 4K6GA 3H1GA 5FWXA 2NVXJ 1D0ZA 5F33A 3IRVA 3UVEA 2X4GA 2CDBA 2VKTA 5C1PA 1X19A 2FUNB 1UBEA 1I9GA 1BMFA 4G63A 4NU8X 3C3PA 3KP6A 1BMQA 3E1SA 1Z37A 4RK7A 1BFDA 1BQ3A 2P6NA 4E2WA 2DTZA 2NRAC 2MU1A 2J7KA 2YHUA 3MPOA 3EIFA 3FFBA 3SM3A 4WLVA 4GRAA 4M9SA 2LHGA 1GTZA 3OOWA 2QZPA 4UD2A 3GGSA 3Q8XA 4F8EA 4MFDA 1QR2A 2G0EA 4U6QA 3B9QA 1T6SA 3AR2A 2V0CA 3G2HA 1FB5A 4Q3BA 2WAFA 1JIKA 5ALZA 3DOEA 4G5HA 3W2IA 1MMSA 3LSIA 1P5FA 3RC8A 5AT1A 1K9VF 5DNVA 2X58A 4NPHA 3PQFA 4YRFA 2O3UA 1KYZA 2O7RA 1OLUB 2VT7A 2ZAOA 2EFJA 3V4OA 2H94A 1VDMA 4L5AA 5FLXS 5H2FC 4OFXA 1MZBA 2TECE 1S1CA 1XU7A 3OLVA 4H3HB 1WPRA 5JYEA 1RAHA 2HXYA 3G0DA 3BPVA 3LO8A 3DQQA 5LQRA 4PLZA 4YRBA 5U1PA 2BFFB 4RCVA 4R7ZA 5IT0A 4KDRA 2BY3A 4OHMA 1AE1A 2OAQ1 3HL0A 1T6BY 3MMNA 1KRXA 2ZI3A 3K0LA 3PC2A 2ZR8A 2FUG2 1MNMC 5JRDS 1FZTA 1FK8A 4ZYGA 2VBIA 1N0WA 4DRXB 2KFDA 1GHCA 3RUDA 4LZPA 1RHKA 1TXGA 3F47A 3UMFA 5FO0A 2CV1A 3H1EA 2FMLA 4FZJA 2V6CA 1FP4B 2PBFA 1IN8A 1CUGA 3I83A 3JQBA 3JYHA 1D0LA 3RFUA 4JLJA 1N36B 5B53A 3G85A 1FBNA 2RK4A 4BEBA 1Q22A 4HP8A 3LBYA 3U4CA 1WY7A 1IC6A 4G41A 5BRJA 1YBVA 3GQVA 2WC2A 4FC7A 1MAAA 1UHMA 3GEHA 3O0TA 2WWRA 3GX1A 9LDBA 2OOBA 1ZKDA 2RGWA 1UELB 4GC5A 1DKQA 3I3OA 3TPFA 4RDIA 3E6MA 1DG3A 4AUNA 5KTRA 4E08A 2AHMA 3H9CA 3EODA 5DBOA 3JVIA 1ODTC 4E5SA 3DMNA 2A61A 1M1YE 2PUVA 4H4CA 1HE2A 5DDIP 3RVQA 2WTXA 4AP6A 2BP7A 5FKNA 3G2OA 2DLLA 1LW6E 1SG9A 4DR7M 4ZVSA 1OTRA 3BK7A 3QRFF 4Y6RA 1OLOA 2V96A 5HNKA 5J8FA 1REPC 4OAYA 1F06A 5JW6A 3IPAA 4DDVA 3ZDQA 3C3DA 2RB5A 1LZKA 4OJTA 2QSFX 4CMIB 2C9YA 4V2IA 1AKWA 2NUBA 1VDDA 3DAGA 3B6CA 4REMA 2ZE6A 1EI9A 1UC4B 3GT4A 4FCCA 4ZPJA 5HKAA 1FW6A 3KSUA 2NPOA 1J5PA 2HCFA 3V3KA 2HJRA 1R0KA 1U8CB 5EJGA 1SAUA 4KHZA 1SC4A 3TMOA 1C7JA 3AVQA 4C1NA 1RT9A 1ZH4A 1IIBA 5A5GA 1L5ZA 5LMCA 3UGKA 1YG2A 1K66A 2J9RA 3I0NA 1II8B 3TKAA 2MD0A 3W4KA 3IP8A 3SKXA 2UUAM 3IDOA 2KHHA 4AYXA 2Q5OA 1VL1A 1W5FA 1PGYA 2YUSA 2IBTA 1Y1WJ 2ZS7A 3B2NA 3G49A 2O2JA 2QWWA 4TMFA 2CZGA 2ZR9A 2AFHB 2GEDA 1VL5A 2XBUA 4M6WB 5IJWA 1PS0A 3FLMA 1J20A 1E3SA 3RODA 3NUQA 1OQYA 3A0UA 3TL2A 2JSCA 3G0HA 4F1IA 2P5YA 5IWCA 4L5BA 5KYWB 1N32B 3F5QA 3UWPA 4PX5A 4YPVA 2JJQA 1UKVY 4JX9A 3NV9A 3CVOA 3H2KA 1KC1A 3HX3A 1DT5A 1MNEA 4P3NA 1Q1BA 4P4LA 4XFKA 2K9LA 4CFYA 4N40A 2WLTA 1OH5A 2WAYA 1W1WA 5IKEA 4HDCA 2A33A 1ZY2A 1AU7A 2JCGA 4RJKA 1G17A 4IF6A 4NEQA 5B5EC 4JV5M 3B13B 3F9CA 1U98A 3ON5A 3WX0A 1L7RA 1OYWA 3ZU2A 3FK6A 4XGQA 2FMHA 3DP7A 1MBHA 3CCFA 2O7SA 3K1AB 1MB9A 4URHA 5KYYA 3CSSA 4R8RA 4PCAA 4D0NA 3E2PA 4D26A 3P2KA 3BWGA 2G09A 1YJQA 2RHOA 4G0YA 4CQJA 1G5IA 2VIIA 2WA2A 1SIOA 2K7FA 4WADA 1EK5A 1Q02A 5E3IA 1IBMB 3LUKA 1UMCB 5CDHA 4PZUA 5GJVC 3KVNA 3E3LA 2LTPA 4U2FA 1T38A 1ISGA 2K4MA 5M5YJ 4JC4A 1E59A 2B37A 1E9RA 3LW8A 4KN9S 3UXHA 2FWAA 3UAZA 4DCOA 4HRYA 4QXQA 1TQHA 4EDFA 4OQDA 3S29A 5ICGA 1H5UA 2ASVA 1VMEA 1YJCA 1PYGA 1W19A 1AUPA 1OA0A 1RYBA 4B4DA 1KO7A 1R2YA 3GRKA 2K6GA 1J0CA 2VJBA 4WKGA 2V7FA 4XIYA 1CSEE 1ORDA 2JJ2A 4PTLA 4FDAA 2C99A 5EDNA 4M76B 3BR1A 2GXQA 1CYEA 4CLXA 4Q1EA 1J5YA 3ET4A 1F2TA 4XQ9A 3HJAA 1PR1A 1ZEJA 3U6DA 3CZ4A 1Q1VA 3E22A 4BO2A 4CKBA 2MSYA 4EM2A 5MFPA 5EJ7A 3ZLVA 5KVSA 3WTTC 2V6MA 5FORA 2D54A 4CCOA 1KZ7B 1MMNA 2VONA 2NVUB 4O0MA 2M87A 2ZMEB 3TRJA 1NXOA 2QD4A 4KLCA 4O2BF 2AXEA 3BG9A 4OQQA 2X6RA 3JASA 4EHJA 1ULAA 3K10A 1AN9A 3FCEA 5LUBA 4CR7A 3UNXA 3MAAC 1DXHA 2XF7A 4RMGA 1S2MA 3NWOA 4HDMA 4W6ZA 3IEKA 5SY6A 1UJCA 3ZQHA 1Q2XA 3IPXA 4BFVA 2VNKA 5DYIA 1A50B 4ERNA 2VWGA 1KP3A 1T6NA 5HUHA 5EMKA 3H92A 4DW8A 3D4LA 1YTYA 2ZRHA 1ID1A 1KKUA 1YE5A 4Z99A 1T5IA 1XTTA 3UCXA 4RM3A 4PV7A 5L3VA 5KNCH 3SJZA 4N0BA 2PGDA 4TTSA 4Q1DA 1TR8A 1UWVA 4I19A 3HB5X 5HOQA 5EGOB 1POXA 3WQSB 2C95A 1W1IA 2OFWA 4GMFA 4IX1A 4S3MA 4EI9A 2NP6A 1HR0M 2WWGA 4B3BA 3AIMA 1M8KA 1EVJA 3SIRA 2HVRA 5I3ZA 3P97A 2R6AA 1XMPA 3ME5A 3P5BA 3IECA 2EFQA 1Y48E 5E7MA 1QZUA 3FHJA 5IDYA 3TW6A 2WHPB 3Q3JB 3GELA 3GQ3A 2OHJA 4TTIA 1XRJA 4NATA 3FM5A 1H4QA 2KRUA 2KRCA 4QGHA 2RGBA 3CZCA 2VTVA 1OIXA 4A3LJ 5TMEA 4YJGB 2GILA 4WF2A 1J24A 1VLHA 4AIRA 1D0XA 3HXMA 3T7CA 3SZPA 1ISJA 3WJ1A 4NBVA 3BE6A 4EITA 2J09A 3OI7A 4JP3A 2O8CB 1WJGA 4B2YA 4FFVA 3VI4B 3HCRA 5JHHB 4XPIB 4RETA 3NTOA 2QPOA 2Q99A 5FNVF 4IRHA 5F51A 3E97A 2H3EA 3MVEA 3GPYA 2WJPA 5KVRA 5ALUA 1LC3A 2FRXA 1FFCA 1K89A 4ZAYA 2IS1A 3JWJA 2AOVA 4MVYA 2H18A 1JBQA 3EHEA 1NRIA 3NLLA 3GMIA 2WG1A 1YQTA 2E4AA 1NAHA 3M2TA 2G3YA 3EXG1 4E2ZA 4F96A 2C96A 2FF7A 4I8XA 4L8LA 4PAMA 5JJKA 2BGJA 3FWYA 3R6SA 4ND8A 2QUHA 1VCNA 2N46A 1X1AA 3L7KA 4Q9DA 2ON6A 2H7XA 1FQOA 1I4LD 3TR0A 2PX2A 4BNUA 1IDN1 1RXCA 2XPWA 5DNEA 2WAQN 3I0MA 4GLOA 2UXBM 3ZCXA 2CHVA 3HRIA 4PO3X 3IJPA 2XUBA 4Q3KA 4TS4A 7YASA 2N1MA 3W6NA 4H7PA 1G3QA 1O0BA 4FWTA 2OP1A 1LBIA 2ZB7A 1XXHE 1YE9A 1LDNA 4TSFD 2FPIB 2JDIA 5K6AA 1JR2A 4MQ5A 2DAMA 4B3SB 3E7PA 4BRZA 4MULA 1V11A 1XS9A 4NWIA 2VF7A 3IDAA 3OZTA 2ZBDA 1BRMA 3V33A 3SS8A 2QVXX 3MFKA 3O3KA 4RK6A 2P6OA 1Z2DA 1GWNA 2FMYA 5DISB 1P4HA 3EW9A 3JQDA 4E7IA 5INTA 4ALLA 4PGHA 3WJ2A 4US1R 2CFXA 5B4UA 3W0FA 3VH3A 1FPMA 2GLUA 1AK2A 4YUZA 1W4MA 2FLKA 3W68A 2NXWA 2VHZA 2Z0MA 1Y42X 3ANLA 3E9DA 2ESRA 3FNHA 1VA5A 4IILA 1E6UA 2Y1CA 2PLWA 5JFTA 4B0PA 4HYYA 4IHJA 4RDXA 4MRVA 2ONJA 3COPA 3L9XA 3D8UA 1D8TA 3KR2A 2V7TA 2ZI6A 1IPFA 1V7QA 3THXB 4ON0A 3QWIA 4LLGF 3J7AO 4YCSA 3UWOA 3GFIA 2BUBA 2X48A 2W6OA 1YE3A 3DZDA 1N2CB 3F6RA 2YWJA 3UM9A 1H2RS 3STVA 2OT3B 3HHEA 1BM9A 3BZUA 2W25A 2UKDA 2P2CA 2TMYA 1DGGA 3AIIA 1VZ2A 1ETKA 1QH1B 1RKQA 1Q57A 4R3DA 4HQMA 1M54A 5K2MA 4DN6A 4TWBA 4HLXA 2CVQA 4LRXA 1T0JB 4WFQA 2WHXA 1U8UA 1ZS9A 1ZGJA 4FHTA 1H6DA 4E7KA 4OQ4A 4DQVA 2VJKA 1Z3XA 2HWJA 2BSXA 4MEBA 3ADPA 2A2ZA 3F8TA 3VNVA 5TQ0A 2FDCA 2HVSA 3HJTA 5TJHA 2ZQ5A 1VE9A 4BBJA 2ODNA 2NT4A 4X84A 3I2YX 5F4ZA 2DZNB 4B3JA 4U39A 4F1KA 4EB3A 2FR8A 1U5TA 1B8NA 4CKWA 3KP1E 2PL3A 2J5RA 1NVTA 2XKKA 4DDWA 2VDJA 3RBAA 5HJ2A 1N5RA 1Y0BA 2A6HF 2F4NA 1WZEA 2VDRB 3G59A 5D84A 4Y7NJ 4YCLA 3BJIC 4EOGA 2CFIA 3L2UA 1O6ZA 1P72A 1Y0UA 4CL0A 1GTMA 5D51S 1PS9A 1M76A 4K9OA 2XUFA 4ODIA 4HWTA 5L4NA 1E9SA 2I3BA 3U4IA 3QEBZ 5FTMA 1U5BB 3NHLA 3GFBA 1I4OA 3NIGB 4G3XA 3X2QH 4AAYA 2YX7A 1YMQA 1RBZA 1ZIDA 4HK4A 4K8OA 4C07A 5JDCC 4E4YA 3LLVA 5A6SA 1FQKA 4DV1M 5B4VA 2V7BA 5C8ZA 5ER9A 4BDZA 1D0YA 3R0QA 2CXPA 3TUZC 2EB7A 2W71A 5IBCA 3S3OA 4PSAA 5CLFA 4P86A 2VLIA 1JQLB 1IXSB 1SHKA 5FUBA 1MN3A 4EGJA 3A9SA 2E4VA 1QGYA 2IZ7A 4DMMA 2AE2A 3HG7A 2FLWA 4DV6M 4QOHA 3ZBPA 3WHCA 4WWCA 1KA9H 3G9UA 3T35A 4INOA 4JSYA 1RWBA 2XUKA 2P5VA 1K6YA 1UOPA 2WYUA 3F96A 2XTZA 2GKGA 3UT5B 1P0IA 5A7FA 4F3RA 4LOCA 4LRSA 2ZJ3A 4PVCA 1HYEA 2NUTB 3CU5A 2FFRA