2E7LE

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
GPHSMRYFETAVSRRGLGEPRYISVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 175
sequence length 175
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2e7lE00
5FA4A 1P7QA 3PWUA 3WL9A 1GZPA 4JRXA 2D31A 3C8KA 5D7IA 3I6GA 3BGMA 1INQA 1HHJA 5C07A 1T0MA 3D2UA 5E9DA 3HCVA 1E27A 4K7FA 5ENWA 5HHNA 4L4TA 3DBXA 4U1KA 1ZHNA 4HUUA 1T20A 5HGBA 1ZSDA 1RJYA 1KTLA 3QUKA 4JFFA 4EI5A 3MA7A 5E6IC 3WLBA 4PGEA 3O8XA 4U1HA 3O3AA 1FFNA 4PR5A 2XFXA 4JQXA 4PGDA 4EUPA 3RWHA 3TJHA 4NO2A 4I4WA 2X4SA 5DDHA 4G8IA 1B0RA 3UTQA 1L8JA 4GKNA 3B6SA 4LNRA 4MJ5A 3LKQA 5MENA 3MGOA 3ES6A 4PG9A 5F1IA 3DMMA 3BO8A 4L8CA 2C7UA 2XPGA 3KWWA 1CD1A 4PRPA 4L8DA 2VLRA 3H7BA 3BW9A 1S9XA 3JTTA 1S7XA 5J1AA 4F7MA 4V3EB 1ZHKA 3U0PA 4ELMA 1B0GA 4MQ7A 1JFMA 4HS3A 5C0CA 3QI9A 3L3HA 3O3BA 5IM7A 1VADA 1M05A 3MR9A 1CE6A 3KLAA 3RZCA 5C0JA 5B38A 4G9FA 5C08A 2CIIA 3MGTA 3SKMA 4HX1A 1ZHLA 3X11A 5DEFA 2FIKA 3CC5A 4WWKC 4JFPA 4PRDA 2X4NA 1K5NA 4E5XA 4G59A 5AD0A 1ZVSA 2H26A 4LCCC 2FZ3A 3KPLA 1YN6A 1DE4A 1N3NA 1BZ9A 2VABA 4PJIA 4Y4KA 5HGAA 5C0GA 2Q7YA 5C0FA 5C0BA 4HKJA 1QVOA 5IROA 3MRPA 3L3DA 1JGDA 5INCA 3CCHA 4ZUUA 1N5AA 4NQXA 2E7LE 4PRAA 3MREA 4N5EA 1KJVA 2BNQA 5HGHA 1WBXA 1JHTA 1S7SA 4PJBA 1QQDA 4PJAA 5F1NA 3V5KA 1FO0H 1JPGA 2GUOA 1Z5LA 4PP8C 5EU5A 4F7CA 4LCYA 2WY3A 3TA3A 1A1NA 3QZWA 1SYVA 3BVNA 2P5WA 1HHHA 5HYJA 4HUVA 3UTTA 2FYYA 2AV7A 3BXNA 5F9JA 3D25A 3KPNA 5EU3A 3GIVA 1QLFA 1ZAGA 2AXFA 3VFMA 3FRUA 3T8XA 1S7QA 2AKRA 4U1SA 4JFEA 1A9EA 2X70A 3VFVA 3BEWA 3D18A 1ZT1A 3O3EA 3P4MA 1PQZA 1OGAA 3VXRA 1KPVA 3VJ6A 1E28A 1WBZA 3OV6A 4QRPA 3ERYA 1KCGC 4HWZA 2VLKA 3ARBA 2CIKA 1YPZA 3L9RA 3LKNA 1VACA 3PABA 3JTSA 5IB3A 3HE6A 1N59A 4HV8A 3RWFA 1VGKA 4I48A 4Y4FA 4NO3A 3VWJA 1IM3A 1T80A 2F54A 4L9LC 5D2LA 4PRIA 1OF2A 1U58A 2FWOA 2X4UA 1UXWA 3FT2A 3P77A 5J6GA 5SWZA 4U1NA 3DX6A 4CW1A 3RWIA 3E2HA 1LDPH 1KPUA 4Y4HA 3H9SA 1A1OA 2OI9A 3P9LA 4G9DA 1LK2A 3RL2A 3GMLA 4N0UA 1I7RA 3FT4A 5EUOA 4D0CA 2ZOKA 5D5MA 3SCMA 3TN0A 2RFXA 1XH3A 3FOMA 3B3IA 1T1XA 1T21A 4PGBA 4U6XA 2A83A 1AGDA 2F53A 5E8OA 3UTSA 1C16A 3HAEA 4V3DB 3BUYA 4WU5A 3MRBA 5EU4A 1KBGH 1LP9A 3DX7A 3BP7A 3CVHA 3ILPA 2UWEA 3KPPA 4WDIA 1ZT4A 4PRNA 3SJVA 4D0BA 5ISZA 1T1WA 4F7EA 4MXQA 5IB4A 1AGEA 4LCWA 3GMPA 4MNQA 3NFNA 2P5EA 3S6CA 3VXNA 3TBVA 4FFEX 4IHOA 4PJDA 5EU6A 4PJCA 3MRHA 3MRDA 1KJMA 3MRLA 1T7YA 3V5DA 1XR8A 1SYSA 3H9HA 2AK4A 4QRRA 3BHBA 1KJ3H 3DX8A 3FTGA 5GSRA 5HGDA 3RL1A 1BQHA 1NAMH 4ZAKA 2VLLA 5MEPA 3MV8A 4F7TA 4S0UC 3OXSA 5D7JC 4HUXA 5HHQA 1AGBA 5J6HA 1FZMA 3LKPA 3QUYA 1WBYA 3TIEA 5C0AA 4N0CA 3LKRA 3CPLA 4PJ8A 3KYOA 4PV8A 3VXOA 3BH8A 3TF7A 4U1JA 1M6OA 2ZSVA 4NHUE 4NNYA 4NNXA 3SDCA 5MEQA 3SDXA 3PWPA 2NX5A 5E8PA 2BVOA 1DUYA 1HSAA 4NQEA 1G7QA 3AM8A 4PRBA 2HN7A 4G42A 2GTWA 1RK1A 3MRRA 4HUWA 3VRJA 1A9BA 1LQVA 1UQSA 2CLVA 1ZHBA 3TFKA 5JHDA 4G43A 5IB2A 1NEZA 1XR9A 5MEOA 2HJKA 1RK0A 1FZJA 4NSKA 1W72A 4ZUTA 4Y2DA 5EO1A 5C0IA 4L3CA 1HHIA 4K71B 1FFOA 3TIDA 3SPVA 4X6EA 4ZFZA 3FFCA 1JF1A 4PRHA 1HOCA 2BVPA 4IRJA 3PWLA 1T7WA 3V5HA 3FQUA 4X6DA 5E00A 3X12A 2MHAA 3MV7A 3VFUA 2BNRA 2AV1A 2BVQA 3GSRA 3SDDA 3KPOA 3VFRA 3MRMA 3WUWA 3ECBA 3TZVC 4Z76A 4G8GA 1AKJA 5C0DA 3O9WA 5HHOA 1TVHA 1P1ZA 3OX8A 3TO4A 3TBSA 3E3QA 4CVXA 3VH8A 3RWEA 1ZS8A 3GSNH 4PJ5A 5MERA 2GTZA 1X7QA 3QQ3A 4PJGA 3BP4A 4L8BA 3TPUE 1MHEA 3MRCA 3MYJA 3FQRA 3RWGA 5IEHA 3P4OA 4WU7A 3GMNA 4N0FA 1EXUA 4NQCA 3GSQA 3BZFA 4QRQA 5D9SA 3SDAA 2GAZA 2X4RA 2V2WA 3KPRA 3GSWA 5D7LA 1TVBA 4O2FA 2PYEA 4MJIA 1LD9A 1I1FA 1FG2A 1LEGA 3LKSA 4IIQC 4UQ3A 3PWJA 1T7VA 3MRNA 3QDJA 4PJEA 1QO3A 4NQVA 5SWQA 5H94A 3TO2A 1P4LA 4MX7A 4U6YA 5L2JA 2YPKA 4MJ6A 2GITA 4NT6A 1QSFA 1S7WA 1EFXA 3QUXA 4Y16A 3I6KA 3CDGA 4QOKA 3FQWA 1HHKA 1EEZA 1K8DA 3VXUA 1GZQA 4PJFA 3VFPA 3LV3A 1I1AA 3AREA 1LEKA 3GMOA 1DDHA 3GMRA 3MRIA 3VFNA 5IB1A 1R3HA 3BEVA 2X4QA 5D2NA 3ROOA 4FTVA 1NANH 3L3JA 2F74A 1JGEA 3X13A 5B39A 2OL3H 1W0VA 3VCLA 4JFOA 3MRKA 3QDMA 1T7XA 1HSBA 1T22A 3JTCA 1HHGA 1S8DA 2J8UA 2X4OA 4JFDA 4QRSA 3T1FA 1T1ZA 1G7PA 4L8SC 2CKBH 3RWDA 2CLZA 3VXPA 4L4VA 1FFPA 3W0WA 3W39A 4E0RA 2ZSWA 1Q94A 3DXAA 1QR1A 3BH9A 3MRJA 2AXGA 4NO0A 3LN4A 4PJXA 3QUZA 3JVGA 4NQDA 3E6FA 3P4NA 3M17A 4PREA 3FONA 4X6FA 5FDWA 4MNGA 1S7VA 5INDA 3X14A 1AO7A 3AU1A 1ONQA 3KPMA 3O3DA 2BSTA 5IVXA 3TBTA 3TBYA 1I1YA 1A1MA 1W0WA 5C09A 1KJ2H 3ROLA 3UBXA 3G08A 2V2XA 3VFTA 5EO0A 3RWJA 3TVMA 4PV9A 4UQ2A 3QFJA 4CVZA 2ESVA 3ARGA 2VLJA 4GKSA 4WO4A 3L3KA 4WUUA 3QQ4A 3PWNA 3CZFA 4QRUA 5F7DA 1T7ZA 4NO5A 3GMQA 3MRQA 3RWCA 3GMMA 1QRNA 1FZOA 3MV9A 4O2CA 1OSZA 2GJ6A 3BWAA 4LHUA 4PG2A 3SKOA 4D0DA 1JE6A 4IRSA 3ARDA 3VXMA 1I7TA 1RJZA 1JUFA 1G6RH 4MVBA 3GSVA 4Z77A 1EEYA 2YPLA 3FQTA 3LKOA 4ZUWA 2NW3A 3KPQA 2YEZA 4PJ7A 3VFSA 3D3VA 3QEQA 4L3EA 2BCKA 1MWAH 3VRIA 1S7TA 4ZUVA 2GT9A 3QFDA 3RUGA 4PDCE 3VXSA 3KXFA 4PJHA 2FO4A 3REWA 1XZ0A 5BJTA 1OGTA 3VFWA 5EFIA 3IXAA 1FZKA 1I7UA 1ZT7A 3KPSA 3QULA 3VWKA 1ED3A 3HG1A 5HHMA 4X6CA 1IM9A 3D39A 1AGCA 1T1YA 3IT8D 1QSEA 3QDGA 3WS6A 3I6LD 4L29A 1S9YA 3UPRA 2CLRA 2HLAA 1JPFA 4ZUSA 2H6PA 3HE7A 3ARFA 3OXRA 3LN5A 3O4LA 3M1BA 1MHCA 2VE6A 1HYRC 1T0NA 3MRGA 3L3GA 4EN3C 1B3JA 3C9NA 4MS8A 3HPJA 1N2RA 1YN7A 2BSSA 2DYPA 2VAAA 5BRZA 3RTQA 4PJ9A 1TMCA 4Z78A 5IB5A 5IEKA 5BXFA 1KPRA 3ILQC 1YDPA 3GSOA 3MRFA 4ONOA 3CH1A 3GJFA 5C9JA 3BZEA 1MI5A 2HJLA 2BSRA 3PQYA 3HUJA 4U1IA 4U1MA 3RGVC 1QEWA 4O2EA 3L3IA 3GSXA 4GUPA 3FQXA 4U1LA 5E8NA 1BIIA 4N8VA 5C0EA 2JCCA 3TBWA 5L2KA 3FT3A 1AGFA 1S7RA 1S9WA 3GSUA 4QRTA 5GSVA 4APQA 3FQNA 3MROA 4WW2C 2X4PA 4WJ5A 5BS0A 1A6ZA 2PO6A 3PWVA 3FOLA 3KYNA 1S7UA 3VFOA 5HHPA 3E6HA 3P9MA 1UXSA 4XXCA 4F7PA 1BD2A 5DEGA 4JFQA 5FKPA 1CG9A 5FA3A 5EOTA 1I4FA 2X4TA 5SWSA 3WS3A 2ZOLA 3P73A 4PGCA 4JQVA 1DUZA 4JRYA 3HLAA 3DTXA 5ACZA
chains in the Genus database with same CATH superfamily
5FA4A 1P7QA 3PWUA 3WL9A 1GZPA 4JRXA 2D31A 3C8KA 5D7IA 3I6GA 3BGMA 1INQA 1HHJA 5C07A 1T0MA 3D2UA 5E9DA 3HCVA 1E27A 4K7FA 5ENWA 5HHNA 4L4TA 3DBXA 4U1KA 1ZHNA 4HUUA 1T20A 5HGBA 1ZSDA 1RJYA 1KTLA 3QUKA 4JFFA 4EI5A 3MA7A 5E6IC 3WLBA 4PGEA 3O8XA 4U1HA 3O3AA 1FFNA 4PR5A 2XFXA 4JQXA 4PGDA 4EUPA 3RWHA 3TJHA 4NO2A 4I4WA 2X4SA 5DDHA 4G8IA 1B0RA 3UTQA 1L8JA 4GKNA 3B6SA 4LNRA 4MJ5A 3LKQA 5MENA 3MGOA 3ES6A 4PG9A 5F1IA 3DMMA 3BO8A 4L8CA 2C7UA 2XPGA 3KWWA 1CD1A 4PRPA 4L8DA 2VLRA 3H7BA 3BW9A 1S9XA 3JTTA 1S7XA 5J1AA 4F7MA 4V3EB 1ZHKA 3U0PA 4ELMA 1B0GA 4MQ7A 1JFMA 4HS3A 5C0CA 3QI9A 3L3HA 3O3BA 5IM7A 1VADA 1M05A 3MR9A 1CE6A 3KLAA 3RZCA 5C0JA 5B38A 4G9FA 5C08A 2CIIA 3MGTA 3SKMA 4HX1A 1ZHLA 3X11A 5DEFA 2FIKA 3CC5A 4WWKC 4JFPA 4PRDA 2X4NA 1K5NA 4E5XA 4G59A 5AD0A 1ZVSA 2H26A 4LCCC 2FZ3A 3KPLA 1YN6A 1DE4A 1N3NA 1BZ9A 2VABA 4PJIA 4Y4KA 5HGAA 5C0GA 2Q7YA 5C0FA 5C0BA 4HKJA 1QVOA 5IROA 3MRPA 3L3DA 1JGDA 5INCA 3CCHA 4ZUUA 1N5AA 4NQXA 2E7LE 4PRAA 3MREA 4N5EA 1KJVA 2BNQA 5HGHA 1WBXA 1JHTA 1S7SA 4PJBA 1QQDA 4PJAA 5F1NA 3V5KA 1FO0H 1JPGA 2GUOA 1Z5LA 4PP8C 5EU5A 4F7CA 4LCYA 2WY3A 3TA3A 1A1NA 3QZWA 1SYVA 3BVNA 2P5WA 1HHHA 5HYJA 4HUVA 3UTTA 2FYYA 2AV7A 3BXNA 5F9JA 3D25A 3KPNA 5EU3A 3GIVA 1QLFA 1ZAGA 2AXFA 3VFMA 3FRUA 3T8XA 1S7QA 2AKRA 4U1SA 4JFEA 1A9EA 2X70A 3VFVA 3BEWA 3D18A 1ZT1A 3O3EA 3P4MA 1PQZA 1OGAA 3VXRA 1KPVA 3VJ6A 1E28A 1WBZA 3OV6A 4QRPA 3ERYA 1KCGC 4HWZA 2VLKA 3ARBA 2CIKA 1YPZA 3L9RA 3LKNA 1VACA 3PABA 3JTSA 5IB3A 3HE6A 1N59A 2O5NA 4HV8A 3RWFA 1VGKA 4I48A 4Y4FA 4NO3A 3VWJA 1IM3A 1T80A 2F54A 4L9LC 5D2LA 4PRIA 1OF2A 1U58A 2FWOA 2X4UA 1UXWA 3FT2A 3P77A 5J6GA 5SWZA 4U1NA 3DX6A 4CW1A 3RWIA 3E2HA 1LDPH 1KPUA 4Y4HA 3H9SA 1A1OA 2OI9A 3P9LA 4G9DA 1LK2A 3RL2A 3GMLA 4N0UA 2NYKA 1I7RA 3FT4A 5EUOA 4D0CA 2ZOKA 5D5MA 3SCMA 3TN0A 2RFXA 1XH3A 3FOMA 3B3IA 1T1XA 1T21A 4PGBA 4U6XA 2A83A 1AGDA 2F53A 5E8OA 4G59C 3UTSA 1C16A 3HAEA 4V3DB 3BUYA 4WU5A 3MRBA 5EU4A 1KBGH 1LP9A 3DX7A 3BP7A 3CVHA 3ILPA 2UWEA 3KPPA 4WDIA 1ZT4A 4PRNA 3SJVA 4D0BA 5ISZA 1T1WA 4F7EA 4MXQA 5IB4A 1AGEA 4LCWA 3GMPA 4JO8A 4MNQA 3NFNA 2P5EA 3S6CA 3VXNA 3TBVA 4FFEX 4IHOA 4PJDA 5EU6A 4PJCA 3MRHA 3MRDA 1KJMA 3MRLA 1T7YA 3V5DA 1XR8A 1SYSA 3H9HA 2AK4A 4QRRA 3BHBA 1KJ3H 3DX8A 3FTGA 5GSRA 5HGDA 3RL1A 1BQHA 1NAMH 4ZAKA 2VLLA 5MEPA 3MV8A 4F7TA 4S0UC 3OXSA 5D7JC 4HUXA 5HHQA 1AGBA 5J6HA 1FZMA 3LKPA 4BKWA 3QUYA 1WBYA 3TIEA 5C0AA 4N0CA 3LKRA 3CPLA 4PJ8A 3KYOA 4PV8A 3VXOA 3BH8A 3TF7A 4U1JA 1M6OA 2ZSVA 4NHUE 4NNYA 4NNXA 3SDCA 5MEQA 3SDXA 3PWPA 2NX5A 5E8PA 2BVOA 1DUYA 1HSAA 4NQEA 1G7QA 3AM8A 4PRBA 2HN7A 4G42A 2GTWA 1RK1A 3MRRA 4HUWA 3VRJA 1A9BA 1LQVA 1UQSA 2CLVA 1ZHBA 3TFKA 5JHDA 4G43A 5IB2A 1NEZA 1XR9A 5MEOA 2HJKA 1RK0A 1FZJA 4NSKA 1W72A 4ZUTA 4Y2DA 5EO1A 5C0IA 4L3CA 1HHIA 4K71B 1FFOA 3TIDA 3SPVA 4X6EA 4ZFZA 3FFCA 1JF1A 4PRHA 1HOCA 2BVPA 4IRJA 3PWLA 1T7WA 3V5HA 3FQUA 4X6DA 5E00A 3X12A 2MHAA 3MV7A 3VFUA 2BNRA 2AV1A 2BVQA 3GSRA 3SDDA 3KPOA 3VFRA 3MRMA 3WUWA 3ECBA 3TZVC 4Z76A 4G8GA 1AKJA 5C0DA 3O9WA 5HHOA 1TVHA 1P1ZA 3OX8A 3TO4A 3TBSA 3E3QA 4CVXA 3VH8A 3RWEA 1ZS8A 3GSNH 4PJ5A 5MERA 2GTZA 1X7QA 3QQ3A 4PJGA 3BP4A 4L8BA 3TPUE 1MHEA 3MRCA 3MYJA 3FQRA 3RWGA 5IEHA 3P4OA 4WU7A 3GMNA 4N0FA 1EXUA 4NQCA 3GSQA 3BZFA 4QRQA 5D9SA 3SDAA 2GAZA 2X4RA 2V2WA 3KPRA 3GSWA 5D7LA 1TVBA 4O2FA 2PYEA 4MJIA 1LD9A 1I1FA 1FG2A 1LEGA 3LKSA 4IIQC 4UQ3A 3PWJA 1T7VA 3MRNA 3QDJA 2IA1A 4PJEA 1QO3A 4NQVA 5SWQA 5H94A 3TO2A 1P4LA 4MX7A 4U6YA 5L2JA 2YPKA 4MJ6A 2GITA 4NT6A 1QSFA 1S7WA 1EFXA 3QUXA 4Y16A 3I6KA 3CDGA 4QOKA 3FQWA 1HHKA 1EEZA 1K8DA 3VXUA 1GZQA 4PJFA 3VFPA 3LV3A 1I1AA 3AREA 1LEKA 3GMOA 1DDHA 3GMRA 3MRIA 3VFNA 5IB1A 1R3HA 3BEVA 2X4QA 5D2NA 3ROOA 4FTVA 1NANH 3L3JA 2F74A 1JGEA 3X13A 5B39A 2OL3H 1W0VA 3VCLA 4JFOA 3MRKA 3QDMA 1T7XA 1HSBA 1T22A 3JTCA 1HHGA 1S8DA 2J8UA 2X4OA 4JFDA 4QRSA 3T1FA 1T1ZA 1G7PA 4L8SC 2CKBH 3RWDA 2CLZA 3VXPA 4L4VA 1FFPA 3W0WA 3W39A 4E0RA 2ZSWA 1Q94A 3DXAA 1QR1A 3BH9A 3MRJA 2AXGA 4NO0A 3LN4A 4PJXA 3QUZA 3JVGA 4NQDA 3E6FA 3P4NA 3M17A 4PREA 3FONA 4X6FA 5FDWA 4MNGA 1S7VA 5INDA 3X14A 1AO7A 3AU1A 1ONQA 3KPMA 3O3DA 2BSTA 5IVXA 3TBTA 3TBYA 1I1YA 1A1MA 1W0WA 5C09A 1KJ2H 3ROLA 3UBXA 3G08A 2V2XA 3VFTA 5EO0A 3RWJA 3TVMA 4PV9A 4UQ2A 3QFJA 4CVZA 2ESVA 3ARGA 2VLJA 4GKSA 4WO4A 3L3KA 4WUUA 3QQ4A 3PWNA 3CZFA 4QRUA 5F7DA 1T7ZA 4NO5A 3GMQA 3MRQA 3RWCA 3GMMA 1QRNA 1FZOA 3MV9A 4O2CA 1OSZA 2GJ6A 3BWAA 4LHUA 4PG2A 3SKOA 4D0DA 1JE6A 4IRSA 3ARDA 3VXMA 1I7TA 1RJZA 1JUFA 1G6RH 4MVBA 3GSVA 4Z77A 1EEYA 2YPLA 3FQTA 3LKOA 4ZUWA 2NW3A 3KPQA 2YEZA 4PJ7A 3VFSA 3D3VA 3QEQA 4L3EA 2BCKA 1MWAH 3VRIA 1S7TA 4ZUVA 2GT9A 3QFDA 3RUGA 4PDCE 3VXSA 3KXFA 4PJHA 2FO4A 3REWA 1XZ0A 5BJTA 1OGTA 3VFWA 5EFIA 3IXAA 1FZKA 1I7UA 1ZT7A 3KPSA 3QULA 3VWKA 1ED3A 3HG1A 5HHMA 4X6CA 1IM9A 3D39A 1AGCA 1T1YA 3IT8D 1QSEA 3QDGA 3WS6A 3I6LD 4L29A 1S9YA 3UPRA 2CLRA 2HLAA 1JPFA 4ZUSA 2H6PA 3HE7A 3ARFA 3OXRA 3LN5A 3O4LA 3M1BA 1MHCA 2VE6A 1HYRC 1T0NA 3MRGA 3L3GA 4EN3C 1B3JA 3C9NA 4MS8A 3HPJA 1N2RA 1YN7A 2BSSA 2DYPA 2VAAA 5BRZA 3RTQA 4PJ9A 1TMCA 4Z78A 5IB5A 5IEKA 5BXFA 1KPRA 3ILQC 1YDPA 3GSOA 3MRFA 4ONOA 3CH1A 3GJFA 5C9JA 3BZEA 1MI5A 2HJLA 2BSRA 3PQYA 3HUJA 4U1IA 4U1MA 3RGVC 1QEWA 4O2EA 3L3IA 3GSXA 4GUPA 3FQXA 4U1LA 5E8NA 1BIIA 4N8VA 5C0EA 2JCCA 3TBWA 5L2KA 3FT3A 1AGFA 1S7RA 1S9WA 3GSUA 4QRTA 5GSVA 4APQA 3FQNA 3MROA 4WW2C 2X4PA 4WJ5A 5BS0A 1A6ZA 2PO6A 3PWVA 3FOLA 3KYNA 1S7UA 3VFOA 5HHPA 3E6HA 3P9MA 1UXSA 4XXCA 4F7PA 1BD2A 5DEGA 4JFQA 5FKPA 1CG9A 5FA3A 3I0TA 5EOTA 1I4FA 2X4TA 5SWSA 3WS3A 2ZOLA 3P73A 4PGCA 4JQVA 1DUZA 4JRYA 3HLAA 3DTXA 5ACZA
chains in the Genus database with same CATH topology
5FA4A 1P7QA 3PWUA 3WL9A 1GZPA 4JRXA 2D31A 3C8KA 5D7IA 3I6GA 3BGMA 1INQA 1HHJA 5C07A 1T0MA 3D2UA 5E9DA 3HCVA 1E27A 4K7FA 5ENWA 5HHNA 4L4TA 3DBXA 4U1KA 1ZHNA 4HUUA 1T20A 5HGBA 1ZSDA 1RJYA 1KTLA 3QUKA 4JFFA 4EI5A 3MA7A 5E6IC 3WLBA 4PGEA 3O8XA 4U1HA 3O3AA 1FFNA 4PR5A 2XFXA 4JQXA 4PGDA 4EUPA 3RWHA 3TJHA 4NO2A 4I4WA 2X4SA 5DDHA 4G8IA 1B0RA 3UTQA 1L8JA 4GKNA 3B6SA 4LNRA 4MJ5A 3LKQA 5MENA 3MGOA 3ES6A 4PG9A 5F1IA 3DMMA 3BO8A 4L8CA 2C7UA 2XPGA 3KWWA 1CD1A 4PRPA 4L8DA 2VLRA 3H7BA 3BW9A 1S9XA 3JTTA 1S7XA 5J1AA 4F7MA 4V3EB 1ZHKA 3U0PA 4ELMA 1B0GA 4MQ7A 1JFMA 4HS3A 5C0CA 3QI9A 3L3HA 3O3BA 5IM7A 1VADA 1M05A 3MR9A 1CE6A 3KLAA 3RZCA 5C0JA 5B38A 4G9FA 5C08A 2CIIA 3MGTA 3SKMA 4HX1A 1ZHLA 3X11A 5DEFA 2FIKA 3CC5A 4WWKC 4JFPA 4PRDA 2X4NA 1K5NA 4E5XA 4G59A 5AD0A 1ZVSA 2H26A 4LCCC 2FZ3A 3KPLA 1YN6A 1DE4A 1N3NA 1BZ9A 2VABA 4PJIA 4Y4KA 5HGAA 5C0GA 2Q7YA 5C0FA 5C0BA 4HKJA 1QVOA 5IROA 3MRPA 3L3DA 1JGDA 5INCA 3CCHA 4ZUUA 1N5AA 4NQXA 2E7LE 4PRAA 3MREA 4N5EA 1KJVA 2BNQA 5HGHA 1WBXA 1JHTA 1S7SA 4PJBA 1QQDA 4PJAA 5F1NA 3V5KA 1FO0H 1JPGA 2GUOA 1Z5LA 4PP8C 5EU5A 4F7CA 4LCYA 2WY3A 3TA3A 1A1NA 3QZWA 1SYVA 3BVNA 2P5WA 1HHHA 5HYJA 4HUVA 3UTTA 2FYYA 2AV7A 3BXNA 5F9JA 3D25A 3KPNA 5EU3A 3GIVA 1QLFA 1ZAGA 2AXFA 3VFMA 3FRUA 3T8XA 1S7QA 2AKRA 4U1SA 4JFEA 1A9EA 2X70A 3VFVA 3BEWA 3D18A 1ZT1A 3O3EA 3P4MA 1PQZA 1OGAA 3VXRA 1KPVA 3VJ6A 1E28A 1WBZA 3OV6A 4QRPA 3ERYA 1KCGC 4HWZA 2VLKA 3ARBA 2CIKA 1YPZA 3L9RA 3LKNA 1VACA 3PABA 3JTSA 5IB3A 3HE6A 1N59A 4HV8A 3RWFA 1VGKA 4I48A 4Y4FA 4NO3A 3VWJA 1IM3A 1T80A 2F54A 4L9LC 5D2LA 4PRIA 1OF2A 1U58A 2FWOA 2X4UA 1UXWA 3FT2A 3P77A 5J6GA 5SWZA 4U1NA 3DX6A 4CW1A 3RWIA 3E2HA 1LDPH 1KPUA 4Y4HA 3H9SA 1A1OA 2OI9A 3P9LA 4G9DA 1LK2A 3RL2A 3GMLA 4N0UA 1I7RA 3FT4A 5EUOA 4D0CA 2ZOKA 5D5MA 3SCMA 3TN0A 2RFXA 1XH3A 3FOMA 3B3IA 1T1XA 1T21A 4PGBA 4U6XA 2A83A 1AGDA 2F53A 5E8OA 3UTSA 1C16A 3HAEA 4V3DB 3BUYA 4WU5A 3MRBA 5EU4A 1KBGH 1LP9A 3DX7A 3BP7A 3CVHA 3ILPA 2UWEA 3KPPA 4WDIA 1ZT4A 4PRNA 3SJVA 4D0BA 5ISZA 1T1WA 4F7EA 4MXQA 5IB4A 1AGEA 4LCWA 3GMPA 4MNQA 3NFNA 2P5EA 3S6CA 3VXNA 3TBVA 4FFEX 4IHOA 4PJDA 5EU6A 4PJCA 3MRHA 3MRDA 1KJMA 3MRLA 1T7YA 3V5DA 1XR8A 1SYSA 3H9HA 2AK4A 4QRRA 3BHBA 1KJ3H 3DX8A 3FTGA 5GSRA 5HGDA 3RL1A 1BQHA 1NAMH 4ZAKA 2VLLA 5MEPA 3MV8A 4F7TA 4S0UC 3OXSA 5D7JC 4HUXA 5HHQA 1AGBA 5J6HA 1FZMA 3LKPA 3QUYA 1WBYA 3TIEA 5C0AA 4N0CA 3LKRA 3CPLA 4PJ8A 3KYOA 4PV8A 3VXOA 3BH8A 3TF7A 4U1JA 1M6OA 2ZSVA 4NHUE 4NNYA 4NNXA 3SDCA 5MEQA 3SDXA 3PWPA 2NX5A 5E8PA 2BVOA 1DUYA 1HSAA 4NQEA 1G7QA 3AM8A 4PRBA 2HN7A 4G42A 2GTWA 1RK1A 3MRRA 4HUWA 3VRJA 1A9BA 1LQVA 1UQSA 2CLVA 1ZHBA 3TFKA 5JHDA 4G43A 5IB2A 1NEZA 1XR9A 5MEOA 2HJKA 1RK0A 1FZJA 4NSKA 1W72A 4ZUTA 4Y2DA 5EO1A 5C0IA 4L3CA 1HHIA 4K71B 1FFOA 3TIDA 3SPVA 4X6EA 4ZFZA 3FFCA 1JF1A 4PRHA 1HOCA 2BVPA 4IRJA 3PWLA 1T7WA 3V5HA 3FQUA 4X6DA 5E00A 3X12A 2MHAA 3MV7A 3VFUA 2BNRA 2AV1A 2BVQA 3GSRA 3SDDA 3KPOA 3VFRA 3MRMA 3WUWA 3ECBA 3TZVC 4Z76A 4G8GA 1AKJA 5C0DA 3O9WA 5HHOA 1TVHA 1P1ZA 3OX8A 3TO4A 3TBSA 3E3QA 4CVXA 3VH8A 3RWEA 1ZS8A 3GSNH 4PJ5A 5MERA 2GTZA 1X7QA 3QQ3A 4PJGA 3BP4A 4L8BA 3TPUE 1MHEA 3MRCA 3MYJA 3FQRA 3RWGA 5IEHA 3P4OA 4WU7A 3GMNA 4N0FA 1EXUA 4NQCA 3GSQA 3BZFA 4QRQA 5D9SA 3SDAA 2GAZA 2X4RA 2V2WA 3KPRA 3GSWA 5D7LA 1TVBA 4O2FA 2PYEA 4MJIA 1LD9A 1I1FA 1FG2A 1LEGA 3LKSA 4IIQC 4UQ3A 3PWJA 1T7VA 3MRNA 3QDJA 4PJEA 1QO3A 4NQVA 5SWQA 5H94A 3TO2A 1P4LA 4MX7A 4U6YA 5L2JA 2YPKA 4MJ6A 2GITA 4NT6A 1QSFA 1S7WA 1EFXA 3QUXA 4Y16A 3I6KA 3CDGA 4QOKA 3FQWA 1HHKA 1EEZA 1K8DA 3VXUA 1GZQA 4PJFA 3VFPA 3LV3A 1I1AA 3AREA 1LEKA 3GMOA 1DDHA 3GMRA 3MRIA 3VFNA 5IB1A 1R3HA 3BEVA 2X4QA 5D2NA 3ROOA 4FTVA 1NANH 3L3JA 2F74A 1JGEA 3X13A 5B39A 2OL3H 1W0VA 3VCLA 4JFOA 3MRKA 3QDMA 1T7XA 1HSBA 1T22A 3JTCA 1HHGA 1S8DA 2J8UA 2X4OA 4JFDA 4QRSA 3T1FA 1T1ZA 1G7PA 4L8SC 2CKBH 3RWDA 2CLZA 3VXPA 4L4VA 1FFPA 3W0WA 3W39A 4E0RA 2ZSWA 1Q94A 3DXAA 1QR1A 3BH9A 3MRJA 2AXGA 4NO0A 3LN4A 4PJXA 3QUZA 3JVGA 4NQDA 3E6FA 3P4NA 3M17A 4PREA 3FONA 4X6FA 5FDWA 4MNGA 1S7VA 5INDA 3X14A 1AO7A 3AU1A 1ONQA 3KPMA 3O3DA 2BSTA 5IVXA 3TBTA 3TBYA 1I1YA 1A1MA 1W0WA 5C09A 1KJ2H 3ROLA 3UBXA 3G08A 2V2XA 3VFTA 5EO0A 3RWJA 3TVMA 4PV9A 4UQ2A 3QFJA 4CVZA 2ESVA 3ARGA 2VLJA 4GKSA 4WO4A 3L3KA 4WUUA 3QQ4A 3PWNA 3CZFA 4QRUA 5F7DA 1T7ZA 4NO5A 3GMQA 3MRQA 3RWCA 3GMMA 1QRNA 1FZOA 3MV9A 4O2CA 1OSZA 2GJ6A 3BWAA 4LHUA 4PG2A 3SKOA 4D0DA 1JE6A 4IRSA 3ARDA 3VXMA 1I7TA 1RJZA 1JUFA 1G6RH 4MVBA 3GSVA 4Z77A 1EEYA 2YPLA 3FQTA 3LKOA 4ZUWA 2NW3A 3KPQA 2YEZA 4PJ7A 3VFSA 3D3VA 3QEQA 4L3EA 2BCKA 1MWAH 3VRIA 1S7TA 4ZUVA 2GT9A 3QFDA 3RUGA 4PDCE 3VXSA 3KXFA 4PJHA 2FO4A 3REWA 1XZ0A 5BJTA 1OGTA 3VFWA 5EFIA 3IXAA 1FZKA 1I7UA 1ZT7A 3KPSA 3QULA 3VWKA 1ED3A 3HG1A 5HHMA 4X6CA 1IM9A 3D39A 1AGCA 1T1YA 3IT8D 1QSEA 3QDGA 3WS6A 3I6LD 4L29A 1S9YA 3UPRA 2CLRA 2HLAA 1JPFA 4ZUSA 2H6PA 3HE7A 3ARFA 3OXRA 3LN5A 3O4LA 3M1BA 1MHCA 2VE6A 1HYRC 1T0NA 3MRGA 3L3GA 4EN3C 1B3JA 3C9NA 4MS8A 3HPJA 1N2RA 1YN7A 2BSSA 2DYPA 2VAAA 5BRZA 3RTQA 4PJ9A 1TMCA 4Z78A 5IB5A 5IEKA 5BXFA 1KPRA 3ILQC 1YDPA 3GSOA 3MRFA 4ONOA 3CH1A 3GJFA 5C9JA 3BZEA 1MI5A 2HJLA 2BSRA 3PQYA 3HUJA 4U1IA 4U1MA 3RGVC 1QEWA 4O2EA 3L3IA 3GSXA 4GUPA 3FQXA 4U1LA 5E8NA 1BIIA 4N8VA 5C0EA 2JCCA 3TBWA 5L2KA 3FT3A 1AGFA 1S7RA 1S9WA 3GSUA 4QRTA 5GSVA 4APQA 3FQNA 3MROA 4WW2C 2X4PA 4WJ5A 5BS0A 1A6ZA 2PO6A 3PWVA 3FOLA 3KYNA 1S7UA 3VFOA 5HHPA 3E6HA 3P9MA 1UXSA 4XXCA 4F7PA 1BD2A 5DEGA 4JFQA 5FKPA 1CG9A 5FA3A 5EOTA 1I4FA 2X4TA 5SWSA 3WS3A 2ZOLA 3P73A 4PGCA 4JQVA 1DUZA 4JRYA 3HLAA 3DTXA 5ACZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FA4 A;  1P7Q A;  3PWU A;  3WL9 A;  1GZP A;  4JRX A;  2D31 A;  3C8K A;  5D7I A;  3I6G A;  3BGM A;  1INQ A;  1HHJ A;  5C07 A;  1T0M A;  3D2U A;  5E9D A;  3HCV A;  1E27 A;  4K7F A;  5ENW A;  5HHN A;  4L4T A;  3DBX A;  4U1K A;  1ZHN A;  4HUU A;  1T20 A;  5HGB A;  1ZSD A;  1RJY A;  1KTL A;  3QUK A;  4JFF A;  4EI5 A;  3MA7 A;  5E6I C;  3WLB A;  4PGE A;  3O8X A;  4U1H A;  3O3A A;  1FFN A;  4PR5 A;  2XFX A;  4JQX A;  4PGD A;  4EUP A;  3RWH A;  3TJH A;  4NO2 A;  4I4W A;  2X4S A;  5DDH A;  4G8I A;  1B0R A;  3UTQ A;  1L8J A;  4GKN A;  3B6S A;  4LNR A;  4MJ5 A;  3LKQ A;  5MEN A;  3MGO A;  3ES6 A;  4PG9 A;  5F1I A;  3DMM A;  3BO8 A;  4L8C A;  2C7U A;  2XPG A;  3KWW A;  1CD1 A;  4PRP A;  4L8D A;  2VLR A;  3H7B A;  3BW9 A;  1S9X A;  3JTT A;  1S7X A;  5J1A A;  4F7M A;  4V3E B;  1ZHK A;  3U0P A;  4ELM A;  1B0G A;  4MQ7 A;  1JFM A;  4HS3 A;  5C0C A;  3QI9 A;  3L3H A;  3O3B A;  5IM7 A;  1VAD A;  1M05 A;  3MR9 A;  1CE6 A;  3KLA A;  3RZC A;  5C0J A;  5B38 A;  4G9F A;  5C08 A;  2CII A;  3MGT A;  3SKM A;  4HX1 A;  1ZHL A;  3X11 A;  5DEF A;  2FIK A;  3CC5 A;  4WWK C;  4JFP A;  4PRD A;  2X4N A;  1K5N A;  4E5X A;  4G59 A;  5AD0 A;  1ZVS A;  2H26 A;  4LCC C;  2FZ3 A;  3KPL A;  1YN6 A;  1DE4 A;  1N3N A;  1BZ9 A;  2VAB A;  4PJI A;  4Y4K A;  5HGA A;  5C0G A;  2Q7Y A;  5C0F A;  5C0B A;  4HKJ A;  1QVO A;  5IRO A;  3MRP A;  3L3D A;  1JGD A;  5INC A;  3CCH A;  4ZUU A;  1N5A A;  4NQX A;  2E7L E;  4PRA A;  3MRE A;  4N5E A;  1KJV A;  2BNQ A;  5HGH A;  1WBX A;  1JHT A;  1S7S A;  4PJB A;  1QQD A;  4PJA A;  5F1N A;  3V5K A;  1FO0 H;  1JPG A;  2GUO A;  1Z5L A;  4PP8 C;  5EU5 A;  4F7C A;  4LCY A;  2WY3 A;  3TA3 A;  1A1N A;  3QZW A;  1SYV A;  3BVN A;  2P5W A;  1HHH A;  5HYJ A;  4HUV A;  3UTT A;  2FYY A;  2AV7 A;  3BXN A;  5F9J A;  3D25 A;  3KPN A;  5EU3 A;  3GIV A;  1QLF A;  1ZAG A;  2AXF A;  3VFM A;  3FRU A;  3T8X A;  1S7Q A;  2AKR A;  4U1S A;  4JFE A;  1A9E A;  2X70 A;  3VFV A;  3BEW A;  3D18 A;  1ZT1 A;  3O3E A;  3P4M A;  1PQZ A;  1OGA A;  3VXR A;  1KPV A;  3VJ6 A;  1E28 A;  1WBZ A;  3OV6 A;  4QRP A;  3ERY A;  1KCG C;  4HWZ A;  2VLK A;  3ARB A;  2CIK A;  1YPZ A;  3L9R A;  3LKN A;  1VAC A;  3PAB A;  3JTS A;  5IB3 A;  3HE6 A;  1N59 A;  4HV8 A;  3RWF A;  1VGK A;  4I48 A;  4Y4F A;  4NO3 A;  3VWJ A;  1IM3 A;  1T80 A;  2F54 A;  4L9L C;  5D2L A;  4PRI A;  1OF2 A;  1U58 A;  2FWO A;  2X4U A;  1UXW A;  3FT2 A;  3P77 A;  5J6G A;  5SWZ A;  4U1N A;  3DX6 A;  4CW1 A;  3RWI A;  3E2H A;  1LDP H;  1KPU A;  4Y4H A;  3H9S A;  1A1O A;  2OI9 A;  3P9L A;  4G9D A;  1LK2 A;  3RL2 A;  3GML A;  4N0U A;  1I7R A;  3FT4 A;  5EUO A;  4D0C A;  2ZOK A;  5D5M A;  3SCM A;  3TN0 A;  2RFX A;  1XH3 A;  3FOM A;  3B3I A;  1T1X A;  1T21 A;  4PGB A;  4U6X A;  2A83 A;  1AGD A;  2F53 A;  5E8O A;  3UTS A;  1C16 A;  3HAE A;  4V3D B;  3BUY A;  4WU5 A;  3MRB A;  5EU4 A;  1KBG H;  1LP9 A;  3DX7 A;  3BP7 A;  3CVH A;  3ILP A;  2UWE A;  3KPP A;  4WDI A;  1ZT4 A;  4PRN A;  3SJV A;  4D0B A;  5ISZ A;  1T1W A;  4F7E A;  4MXQ A;  5IB4 A;  1AGE A;  4LCW A;  3GMP A;  4MNQ A;  3NFN A;  2P5E A;  3S6C A;  3VXN A;  3TBV A;  4FFE X;  4IHO A;  4PJD A;  5EU6 A;  4PJC A;  3MRH A;  3MRD A;  1KJM A;  3MRL A;  1T7Y A;  3V5D A;  1XR8 A;  1SYS A;  3H9H A;  2AK4 A;  4QRR A;  3BHB A;  1KJ3 H;  3DX8 A;  3FTG A;  5GSR A;  5HGD A;  3RL1 A;  1BQH A;  1NAM H;  4ZAK A;  2VLL A;  5MEP A;  3MV8 A;  4F7T A;  4S0U C;  3OXS A;  5D7J C;  4HUX A;  5HHQ A;  1AGB A;  5J6H A;  1FZM A;  3LKP A;  3QUY A;  1WBY A;  3TIE A;  5C0A A;  4N0C A;  3LKR A;  3CPL A;  4PJ8 A;  3KYO A;  4PV8 A;  3VXO A;  3BH8 A;  3TF7 A;  4U1J A;  1M6O A;  2ZSV A;  4NHU E;  4NNY A;  4NNX A;  3SDC A;  5MEQ A;  3SDX A;  3PWP A;  2NX5 A;  5E8P A;  2BVO A;  1DUY A;  1HSA A;  4NQE A;  1G7Q A;  3AM8 A;  4PRB A;  2HN7 A;  4G42 A;  2GTW A;  1RK1 A;  3MRR A;  4HUW A;  3VRJ A;  1A9B A;  1LQV A;  1UQS A;  2CLV A;  1ZHB A;  3TFK A;  5JHD A;  4G43 A;  5IB2 A;  1NEZ A;  1XR9 A;  5MEO A;  2HJK A;  1RK0 A;  1FZJ A;  4NSK A;  1W72 A;  4ZUT A;  4Y2D A;  5EO1 A;  5C0I A;  4L3C A;  1HHI A;  4K71 B;  1FFO A;  3TID A;  3SPV A;  4X6E A;  4ZFZ A;  3FFC A;  1JF1 A;  4PRH A;  1HOC A;  2BVP A;  4IRJ A;  3PWL A;  1T7W A;  3V5H A;  3FQU A;  4X6D A;  5E00 A;  3X12 A;  2MHA A;  3MV7 A;  3VFU A;  2BNR A;  2AV1 A;  2BVQ A;  3GSR A;  3SDD A;  3KPO A;  3VFR A;  3MRM A;  3WUW A;  3ECB A;  3TZV C;  4Z76 A;  4G8G A;  1AKJ A;  5C0D A;  3O9W A;  5HHO A;  1TVH A;  1P1Z A;  3OX8 A;  3TO4 A;  3TBS A;  3E3Q A;  4CVX A;  3VH8 A;  3RWE A;  1ZS8 A;  3GSN H;  4PJ5 A;  5MER A;  2GTZ A;  1X7Q A;  3QQ3 A;  4PJG A;  3BP4 A;  4L8B A;  3TPU E;  1MHE A;  3MRC A;  3MYJ A;  3FQR A;  3RWG A;  5IEH A;  3P4O A;  4WU7 A;  3GMN A;  4N0F A;  1EXU A;  4NQC A;  3GSQ A;  3BZF A;  4QRQ A;  5D9S A;  3SDA A;  2GAZ A;  2X4R A;  2V2W A;  3KPR A;  3GSW A;  5D7L A;  1TVB A;  4O2F A;  2PYE A;  4MJI A;  1LD9 A;  1I1F A;  1FG2 A;  1LEG A;  3LKS A;  4IIQ C;  4UQ3 A;  3PWJ A;  1T7V A;  3MRN A;  3QDJ A;  4PJE A;  1QO3 A;  4NQV A;  5SWQ A;  5H94 A;  3TO2 A;  1P4L A;  4MX7 A;  4U6Y A;  5L2J A;  2YPK A;  4MJ6 A;  2GIT A;  4NT6 A;  1QSF A;  1S7W A;  1EFX A;  3QUX A;  4Y16 A;  3I6K A;  3CDG A;  4QOK A;  3FQW A;  1HHK A;  1EEZ A;  1K8D A;  3VXU A;  1GZQ A;  4PJF A;  3VFP A;  3LV3 A;  1I1A A;  3ARE A;  1LEK A;  3GMO A;  1DDH A;  3GMR A;  3MRI A;  3VFN A;  5IB1 A;  1R3H A;  3BEV A;  2X4Q A;  5D2N A;  3ROO A;  4FTV A;  1NAN H;  3L3J A;  2F74 A;  1JGE A;  3X13 A;  5B39 A;  2OL3 H;  1W0V A;  3VCL A;  4JFO A;  3MRK A;  3QDM A;  1T7X A;  1HSB A;  1T22 A;  3JTC A;  1HHG A;  1S8D A;  2J8U A;  2X4O A;  4JFD A;  4QRS A;  3T1F A;  1T1Z A;  1G7P A;  4L8S C;  2CKB H;  3RWD A;  2CLZ A;  3VXP A;  4L4V A;  1FFP A;  3W0W A;  3W39 A;  4E0R A;  2ZSW A;  1Q94 A;  3DXA A;  1QR1 A;  3BH9 A;  3MRJ A;  2AXG A;  4NO0 A;  3LN4 A;  4PJX A;  3QUZ A;  3JVG A;  4NQD A;  3E6F A;  3P4N A;  3M17 A;  4PRE A;  3FON A;  4X6F A;  5FDW A;  4MNG A;  1S7V A;  5IND A;  3X14 A;  1AO7 A;  3AU1 A;  1ONQ A;  3KPM A;  3O3D A;  2BST A;  5IVX A;  3TBT A;  3TBY A;  1I1Y A;  1A1M A;  1W0W A;  5C09 A;  1KJ2 H;  3ROL A;  3UBX A;  3G08 A;  2V2X A;  3VFT A;  5EO0 A;  3RWJ A;  3TVM A;  4PV9 A;  4UQ2 A;  3QFJ A;  4CVZ A;  2ESV A;  3ARG A;  2VLJ A;  4GKS A;  4WO4 A;  3L3K A;  4WUU A;  3QQ4 A;  3PWN A;  3CZF A;  4QRU A;  5F7D A;  1T7Z A;  4NO5 A;  3GMQ A;  3MRQ A;  3RWC A;  3GMM A;  1QRN A;  1FZO A;  3MV9 A;  4O2C A;  1OSZ A;  2GJ6 A;  3BWA A;  4LHU A;  4PG2 A;  3SKO A;  4D0D A;  1JE6 A;  4IRS A;  3ARD A;  3VXM A;  1I7T A;  1RJZ A;  1JUF A;  1G6R H;  4MVB A;  3GSV A;  4Z77 A;  1EEY A;  2YPL A;  3FQT A;  3LKO A;  4ZUW A;  2NW3 A;  3KPQ A;  2YEZ A;  4PJ7 A;  3VFS A;  3D3V A;  3QEQ A;  4L3E A;  2BCK A;  1MWA H;  3VRI A;  1S7T A;  4ZUV A;  2GT9 A;  3QFD A;  3RUG A;  4PDC E;  3VXS A;  3KXF A;  4PJH A;  2FO4 A;  3REW A;  1XZ0 A;  5BJT A;  1OGT A;  3VFW A;  5EFI A;  3IXA A;  1FZK A;  1I7U A;  1ZT7 A;  3KPS A;  3QUL A;  3VWK A;  1ED3 A;  3HG1 A;  5HHM A;  4X6C A;  1IM9 A;  3D39 A;  1AGC A;  1T1Y A;  3IT8 D;  1QSE A;  3QDG A;  3WS6 A;  3I6L D;  4L29 A;  1S9Y A;  3UPR A;  2CLR A;  2HLA A;  1JPF A;  4ZUS A;  2H6P A;  3HE7 A;  3ARF A;  3OXR A;  3LN5 A;  3O4L A;  3M1B A;  1MHC A;  2VE6 A;  1HYR C;  1T0N A;  3MRG A;  3L3G A;  4EN3 C;  1B3J A;  3C9N A;  4MS8 A;  3HPJ A;  1N2R A;  1YN7 A;  2BSS A;  2DYP A;  2VAA A;  5BRZ A;  3RTQ A;  4PJ9 A;  1TMC A;  4Z78 A;  5IB5 A;  5IEK A;  5BXF A;  1KPR A;  3ILQ C;  1YDP A;  3GSO A;  3MRF A;  4ONO A;  3CH1 A;  3GJF A;  5C9J A;  3BZE A;  1MI5 A;  2HJL A;  2BSR A;  3PQY A;  3HUJ A;  4U1I A;  4U1M A;  3RGV C;  1QEW A;  4O2E A;  3L3I A;  3GSX A;  4GUP A;  3FQX A;  4U1L A;  5E8N A;  1BII A;  4N8V A;  5C0E A;  2JCC A;  3TBW A;  5L2K A;  3FT3 A;  1AGF A;  1S7R A;  1S9W A;  3GSU A;  4QRT A;  5GSV A;  4APQ A;  3FQN A;  3MRO A;  4WW2 C;  2X4P A;  4WJ5 A;  5BS0 A;  1A6Z A;  2PO6 A;  3PWV A;  3FOL A;  3KYN A;  1S7U A;  3VFO A;  5HHP A;  3E6H A;  3P9M A;  1UXS A;  4XXC A;  4F7P A;  1BD2 A;  5DEG A;  4JFQ A;  5FKP A;  1CG9 A;  5FA3 A;  5EOT A;  1I4F A;  2X4T A;  5SWS A;  3WS3 A;  2ZOL A;  3P73 A;  4PGC A;  4JQV A;  1DUZ A;  4JRY A;  3HLA A;  3DTX A;  5ACZ A; 
#chains in the Genus database with same CATH topology
 5FA4 A;  1P7Q A;  3PWU A;  3WL9 A;  1GZP A;  4JRX A;  2D31 A;  3C8K A;  5D7I A;  3I6G A;  3BGM A;  1INQ A;  1HHJ A;  5C07 A;  1T0M A;  3D2U A;  5E9D A;  3HCV A;  1E27 A;  4K7F A;  5ENW A;  5HHN A;  4L4T A;  3DBX A;  4U1K A;  1ZHN A;  4HUU A;  1T20 A;  5HGB A;  1ZSD A;  1RJY A;  1KTL A;  3QUK A;  4JFF A;  4EI5 A;  3MA7 A;  5E6I C;  3WLB A;  4PGE A;  3O8X A;  4U1H A;  3O3A A;  1FFN A;  4PR5 A;  2XFX A;  4JQX A;  4PGD A;  4EUP A;  3RWH A;  3TJH A;  4NO2 A;  4I4W A;  2X4S A;  5DDH A;  4G8I A;  1B0R A;  3UTQ A;  1L8J A;  4GKN A;  3B6S A;  4LNR A;  4MJ5 A;  3LKQ A;  5MEN A;  3MGO A;  3ES6 A;  4PG9 A;  5F1I A;  3DMM A;  3BO8 A;  4L8C A;  2C7U A;  2XPG A;  3KWW A;  1CD1 A;  4PRP A;  4L8D A;  2VLR A;  3H7B A;  3BW9 A;  1S9X A;  3JTT A;  1S7X A;  5J1A A;  4F7M A;  4V3E B;  1ZHK A;  3U0P A;  4ELM A;  1B0G A;  4MQ7 A;  1JFM A;  4HS3 A;  5C0C A;  3QI9 A;  3L3H A;  3O3B A;  5IM7 A;  1VAD A;  1M05 A;  3MR9 A;  1CE6 A;  3KLA A;  3RZC A;  5C0J A;  5B38 A;  4G9F A;  5C08 A;  2CII A;  3MGT A;  3SKM A;  4HX1 A;  1ZHL A;  3X11 A;  5DEF A;  2FIK A;  3CC5 A;  4WWK C;  4JFP A;  4PRD A;  2X4N A;  1K5N A;  4E5X A;  4G59 A;  5AD0 A;  1ZVS A;  2H26 A;  4LCC C;  2FZ3 A;  3KPL A;  1YN6 A;  1DE4 A;  1N3N A;  1BZ9 A;  2VAB A;  4PJI A;  4Y4K A;  5HGA A;  5C0G A;  2Q7Y A;  5C0F A;  5C0B A;  4HKJ A;  1QVO A;  5IRO A;  3MRP A;  3L3D A;  1JGD A;  5INC A;  3CCH A;  4ZUU A;  1N5A A;  4NQX A;  2E7L E;  4PRA A;  3MRE A;  4N5E A;  1KJV A;  2BNQ A;  5HGH A;  1WBX A;  1JHT A;  1S7S A;  4PJB A;  1QQD A;  4PJA A;  5F1N A;  3V5K A;  1FO0 H;  1JPG A;  2GUO A;  1Z5L A;  4PP8 C;  5EU5 A;  4F7C A;  4LCY A;  2WY3 A;  3TA3 A;  1A1N A;  3QZW A;  1SYV A;  3BVN A;  2P5W A;  1HHH A;  5HYJ A;  4HUV A;  3UTT A;  2FYY A;  2AV7 A;  3BXN A;  5F9J A;  3D25 A;  3KPN A;  5EU3 A;  3GIV A;  1QLF A;  1ZAG A;  2AXF A;  3VFM A;  3FRU A;  3T8X A;  1S7Q A;  2AKR A;  4U1S A;  4JFE A;  1A9E A;  2X70 A;  3VFV A;  3BEW A;  3D18 A;  1ZT1 A;  3O3E A;  3P4M A;  1PQZ A;  1OGA A;  3VXR A;  1KPV A;  3VJ6 A;  1E28 A;  1WBZ A;  3OV6 A;  4QRP A;  3ERY A;  1KCG C;  4HWZ A;  2VLK A;  3ARB A;  2CIK A;  1YPZ A;  3L9R A;  3LKN A;  1VAC A;  3PAB A;  3JTS A;  5IB3 A;  3HE6 A;  1N59 A;  2O5N A;  4HV8 A;  3RWF A;  1VGK A;  4I48 A;  4Y4F A;  4NO3 A;  3VWJ A;  1IM3 A;  1T80 A;  2F54 A;  4L9L C;  5D2L A;  4PRI A;  1OF2 A;  1U58 A;  2FWO A;  2X4U A;  1UXW A;  3FT2 A;  3P77 A;  5J6G A;  5SWZ A;  4U1N A;  3DX6 A;  4CW1 A;  3RWI A;  3E2H A;  1LDP H;  1KPU A;  4Y4H A;  3H9S A;  1A1O A;  2OI9 A;  3P9L A;  4G9D A;  1LK2 A;  3RL2 A;  3GML A;  4N0U A;  2NYK A;  1I7R A;  3FT4 A;  5EUO A;  4D0C A;  2ZOK A;  5D5M A;  3SCM A;  3TN0 A;  2RFX A;  1XH3 A;  3FOM A;  3B3I A;  1T1X A;  1T21 A;  4PGB A;  4U6X A;  2A83 A;  1AGD A;  2F53 A;  5E8O A;  4G59 C;  3UTS A;  1C16 A;  3HAE A;  4V3D B;  3BUY A;  4WU5 A;  3MRB A;  5EU4 A;  1KBG H;  1LP9 A;  3DX7 A;  3BP7 A;  3CVH A;  3ILP A;  2UWE A;  3KPP A;  4WDI A;  1ZT4 A;  4PRN A;  3SJV A;  4D0B A;  5ISZ A;  1T1W A;  4F7E A;  4MXQ A;  5IB4 A;  1AGE A;  4LCW A;  3GMP A;  4JO8 A;  4MNQ A;  3NFN A;  2P5E A;  3S6C A;  3VXN A;  3TBV A;  4FFE X;  4IHO A;  4PJD A;  5EU6 A;  4PJC A;  3MRH A;  3MRD A;  1KJM A;  3MRL A;  1T7Y A;  3V5D A;  1XR8 A;  1SYS A;  3H9H A;  2AK4 A;  4QRR A;  3BHB A;  1KJ3 H;  3DX8 A;  3FTG A;  5GSR A;  5HGD A;  3RL1 A;  1BQH A;  1NAM H;  4ZAK A;  2VLL A;  5MEP A;  3MV8 A;  4F7T A;  4S0U C;  3OXS A;  5D7J C;  4HUX A;  5HHQ A;  1AGB A;  5J6H A;  1FZM A;  3LKP A;  4BKW A;  3QUY A;  1WBY A;  3TIE A;  5C0A A;  4N0C A;  3LKR A;  3CPL A;  4PJ8 A;  3KYO A;  4PV8 A;  3VXO A;  3BH8 A;  3TF7 A;  4U1J A;  1M6O A;  2ZSV A;  4NHU E;  4NNY A;  4NNX A;  3SDC A;  5MEQ A;  3SDX A;  3PWP A;  2NX5 A;  5E8P A;  2BVO A;  1DUY A;  1HSA A;  4NQE A;  1G7Q A;  3AM8 A;  4PRB A;  2HN7 A;  4G42 A;  2GTW A;  1RK1 A;  3MRR A;  4HUW A;  3VRJ A;  1A9B A;  1LQV A;  1UQS A;  2CLV A;  1ZHB A;  3TFK A;  5JHD A;  4G43 A;  5IB2 A;  1NEZ A;  1XR9 A;  5MEO A;  2HJK A;  1RK0 A;  1FZJ A;  4NSK A;  1W72 A;  4ZUT A;  4Y2D A;  5EO1 A;  5C0I A;  4L3C A;  1HHI A;  4K71 B;  1FFO A;  3TID A;  3SPV A;  4X6E A;  4ZFZ A;  3FFC A;  1JF1 A;  4PRH A;  1HOC A;  2BVP A;  4IRJ A;  3PWL A;  1T7W A;  3V5H A;  3FQU A;  4X6D A;  5E00 A;  3X12 A;  2MHA A;  3MV7 A;  3VFU A;  2BNR A;  2AV1 A;  2BVQ A;  3GSR A;  3SDD A;  3KPO A;  3VFR A;  3MRM A;  3WUW A;  3ECB A;  3TZV C;  4Z76 A;  4G8G A;  1AKJ A;  5C0D A;  3O9W A;  5HHO A;  1TVH A;  1P1Z A;  3OX8 A;  3TO4 A;  3TBS A;  3E3Q A;  4CVX A;  3VH8 A;  3RWE A;  1ZS8 A;  3GSN H;  4PJ5 A;  5MER A;  2GTZ A;  1X7Q A;  3QQ3 A;  4PJG A;  3BP4 A;  4L8B A;  3TPU E;  1MHE A;  3MRC A;  3MYJ A;  3FQR A;  3RWG A;  5IEH A;  3P4O A;  4WU7 A;  3GMN A;  4N0F A;  1EXU A;  4NQC A;  3GSQ A;  3BZF A;  4QRQ A;  5D9S A;  3SDA A;  2GAZ A;  2X4R A;  2V2W A;  3KPR A;  3GSW A;  5D7L A;  1TVB A;  4O2F A;  2PYE A;  4MJI A;  1LD9 A;  1I1F A;  1FG2 A;  1LEG A;  3LKS A;  4IIQ C;  4UQ3 A;  3PWJ A;  1T7V A;  3MRN A;  3QDJ A;  2IA1 A;  4PJE A;  1QO3 A;  4NQV A;  5SWQ A;  5H94 A;  3TO2 A;  1P4L A;  4MX7 A;  4U6Y A;  5L2J A;  2YPK A;  4MJ6 A;  2GIT A;  4NT6 A;  1QSF A;  1S7W A;  1EFX A;  3QUX A;  4Y16 A;  3I6K A;  3CDG A;  4QOK A;  3FQW A;  1HHK A;  1EEZ A;  1K8D A;  3VXU A;  1GZQ A;  4PJF A;  3VFP A;  3LV3 A;  1I1A A;  3ARE A;  1LEK A;  3GMO A;  1DDH A;  3GMR A;  3MRI A;  3VFN A;  5IB1 A;  1R3H A;  3BEV A;  2X4Q A;  5D2N A;  3ROO A;  4FTV A;  1NAN H;  3L3J A;  2F74 A;  1JGE A;  3X13 A;  5B39 A;  2OL3 H;  1W0V A;  3VCL A;  4JFO A;  3MRK A;  3QDM A;  1T7X A;  1HSB A;  1T22 A;  3JTC A;  1HHG A;  1S8D A;  2J8U A;  2X4O A;  4JFD A;  4QRS A;  3T1F A;  1T1Z A;  1G7P A;  4L8S C;  2CKB H;  3RWD A;  2CLZ A;  3VXP A;  4L4V A;  1FFP A;  3W0W A;  3W39 A;  4E0R A;  2ZSW A;  1Q94 A;  3DXA A;  1QR1 A;  3BH9 A;  3MRJ A;  2AXG A;  4NO0 A;  3LN4 A;  4PJX A;  3QUZ A;  3JVG A;  4NQD A;  3E6F A;  3P4N A;  3M17 A;  4PRE A;  3FON A;  4X6F A;  5FDW A;  4MNG A;  1S7V A;  5IND A;  3X14 A;  1AO7 A;  3AU1 A;  1ONQ A;  3KPM A;  3O3D A;  2BST A;  5IVX A;  3TBT A;  3TBY A;  1I1Y A;  1A1M A;  1W0W A;  5C09 A;  1KJ2 H;  3ROL A;  3UBX A;  3G08 A;  2V2X A;  3VFT A;  5EO0 A;  3RWJ A;  3TVM A;  4PV9 A;  4UQ2 A;  3QFJ A;  4CVZ A;  2ESV A;  3ARG A;  2VLJ A;  4GKS A;  4WO4 A;  3L3K A;  4WUU A;  3QQ4 A;  3PWN A;  3CZF A;  4QRU A;  5F7D A;  1T7Z A;  4NO5 A;  3GMQ A;  3MRQ A;  3RWC A;  3GMM A;  1QRN A;  1FZO A;  3MV9 A;  4O2C A;  1OSZ A;  2GJ6 A;  3BWA A;  4LHU A;  4PG2 A;  3SKO A;  4D0D A;  1JE6 A;  4IRS A;  3ARD A;  3VXM A;  1I7T A;  1RJZ A;  1JUF A;  1G6R H;  4MVB A;  3GSV A;  4Z77 A;  1EEY A;  2YPL A;  3FQT A;  3LKO A;  4ZUW A;  2NW3 A;  3KPQ A;  2YEZ A;  4PJ7 A;  3VFS A;  3D3V A;  3QEQ A;  4L3E A;  2BCK A;  1MWA H;  3VRI A;  1S7T A;  4ZUV A;  2GT9 A;  3QFD A;  3RUG A;  4PDC E;  3VXS A;  3KXF A;  4PJH A;  2FO4 A;  3REW A;  1XZ0 A;  5BJT A;  1OGT A;  3VFW A;  5EFI A;  3IXA A;  1FZK A;  1I7U A;  1ZT7 A;  3KPS A;  3QUL A;  3VWK A;  1ED3 A;  3HG1 A;  5HHM A;  4X6C A;  1IM9 A;  3D39 A;  1AGC A;  1T1Y A;  3IT8 D;  1QSE A;  3QDG A;  3WS6 A;  3I6L D;  4L29 A;  1S9Y A;  3UPR A;  2CLR A;  2HLA A;  1JPF A;  4ZUS A;  2H6P A;  3HE7 A;  3ARF A;  3OXR A;  3LN5 A;  3O4L A;  3M1B A;  1MHC A;  2VE6 A;  1HYR C;  1T0N A;  3MRG A;  3L3G A;  4EN3 C;  1B3J A;  3C9N A;  4MS8 A;  3HPJ A;  1N2R A;  1YN7 A;  2BSS A;  2DYP A;  2VAA A;  5BRZ A;  3RTQ A;  4PJ9 A;  1TMC A;  4Z78 A;  5IB5 A;  5IEK A;  5BXF A;  1KPR A;  3ILQ C;  1YDP A;  3GSO A;  3MRF A;  4ONO A;  3CH1 A;  3GJF A;  5C9J A;  3BZE A;  1MI5 A;  2HJL A;  2BSR A;  3PQY A;  3HUJ A;  4U1I A;  4U1M A;  3RGV C;  1QEW A;  4O2E A;  3L3I A;  3GSX A;  4GUP A;  3FQX A;  4U1L A;  5E8N A;  1BII A;  4N8V A;  5C0E A;  2JCC A;  3TBW A;  5L2K A;  3FT3 A;  1AGF A;  1S7R A;  1S9W A;  3GSU A;  4QRT A;  5GSV A;  4APQ A;  3FQN A;  3MRO A;  4WW2 C;  2X4P A;  4WJ5 A;  5BS0 A;  1A6Z A;  2PO6 A;  3PWV A;  3FOL A;  3KYN A;  1S7U A;  3VFO A;  5HHP A;  3E6H A;  3P9M A;  1UXS A;  4XXC A;  4F7P A;  1BD2 A;  5DEG A;  4JFQ A;  5FKP A;  1CG9 A;  5FA3 A;  3I0T A;  5EOT A;  1I4F A;  2X4T A;  5SWS A;  3WS3 A;  2ZOL A;  3P73 A;  4PGC A;  4JQV A;  1DUZ A;  4JRY A;  3HLA A;  3DTX A;  5ACZ A; 
#chains in the Genus database with same CATH homology
 5FA4 A;  1P7Q A;  3PWU A;  3WL9 A;  1GZP A;  4JRX A;  2D31 A;  3C8K A;  5D7I A;  3I6G A;  3BGM A;  1INQ A;  1HHJ A;  5C07 A;  1T0M A;  3D2U A;  5E9D A;  3HCV A;  1E27 A;  4K7F A;  5ENW A;  5HHN A;  4L4T A;  3DBX A;  4U1K A;  1ZHN A;  4HUU A;  1T20 A;  5HGB A;  1ZSD A;  1RJY A;  1KTL A;  3QUK A;  4JFF A;  4EI5 A;  3MA7 A;  5E6I C;  3WLB A;  4PGE A;  3O8X A;  4U1H A;  3O3A A;  1FFN A;  4PR5 A;  2XFX A;  4JQX A;  4PGD A;  4EUP A;  3RWH A;  3TJH A;  4NO2 A;  4I4W A;  2X4S A;  5DDH A;  4G8I A;  1B0R A;  3UTQ A;  1L8J A;  4GKN A;  3B6S A;  4LNR A;  4MJ5 A;  3LKQ A;  5MEN A;  3MGO A;  3ES6 A;  4PG9 A;  5F1I A;  3DMM A;  3BO8 A;  4L8C A;  2C7U A;  2XPG A;  3KWW A;  1CD1 A;  4PRP A;  4L8D A;  2VLR A;  3H7B A;  3BW9 A;  1S9X A;  3JTT A;  1S7X A;  5J1A A;  4F7M A;  4V3E B;  1ZHK A;  3U0P A;  4ELM A;  1B0G A;  4MQ7 A;  1JFM A;  4HS3 A;  5C0C A;  3QI9 A;  3L3H A;  3O3B A;  5IM7 A;  1VAD A;  1M05 A;  3MR9 A;  1CE6 A;  3KLA A;  3RZC A;  5C0J A;  5B38 A;  4G9F A;  5C08 A;  2CII A;  3MGT A;  3SKM A;  4HX1 A;  1ZHL A;  3X11 A;  5DEF A;  2FIK A;  3CC5 A;  4WWK C;  4JFP A;  4PRD A;  2X4N A;  1K5N A;  4E5X A;  4G59 A;  5AD0 A;  1ZVS A;  2H26 A;  4LCC C;  2FZ3 A;  3KPL A;  1YN6 A;  1DE4 A;  1N3N A;  1BZ9 A;  2VAB A;  4PJI A;  4Y4K A;  5HGA A;  5C0G A;  2Q7Y A;  5C0F A;  5C0B A;  4HKJ A;  1QVO A;  5IRO A;  3MRP A;  3L3D A;  1JGD A;  5INC A;  3CCH A;  4ZUU A;  1N5A A;  4NQX A;  2E7L E;  4PRA A;  3MRE A;  4N5E A;  1KJV A;  2BNQ A;  5HGH A;  1WBX A;  1JHT A;  1S7S A;  4PJB A;  1QQD A;  4PJA A;  5F1N A;  3V5K A;  1FO0 H;  1JPG A;  2GUO A;  1Z5L A;  4PP8 C;  5EU5 A;  4F7C A;  4LCY A;  2WY3 A;  3TA3 A;  1A1N A;  3QZW A;  1SYV A;  3BVN A;  2P5W A;  1HHH A;  5HYJ A;  4HUV A;  3UTT A;  2FYY A;  2AV7 A;  3BXN A;  5F9J A;  3D25 A;  3KPN A;  5EU3 A;  3GIV A;  1QLF A;  1ZAG A;  2AXF A;  3VFM A;  3FRU A;  3T8X A;  1S7Q A;  2AKR A;  4U1S A;  4JFE A;  1A9E A;  2X70 A;  3VFV A;  3BEW A;  3D18 A;  1ZT1 A;  3O3E A;  3P4M A;  1PQZ A;  1OGA A;  3VXR A;  1KPV A;  3VJ6 A;  1E28 A;  1WBZ A;  3OV6 A;  4QRP A;  3ERY A;  1KCG C;  4HWZ A;  2VLK A;  3ARB A;  2CIK A;  1YPZ A;  3L9R A;  3LKN A;  1VAC A;  3PAB A;  3JTS A;  5IB3 A;  3HE6 A;  1N59 A;  4HV8 A;  3RWF A;  1VGK A;  4I48 A;  4Y4F A;  4NO3 A;  3VWJ A;  1IM3 A;  1T80 A;  2F54 A;  4L9L C;  5D2L A;  4PRI A;  1OF2 A;  1U58 A;  2FWO A;  2X4U A;  1UXW A;  3FT2 A;  3P77 A;  5J6G A;  5SWZ A;  4U1N A;  3DX6 A;  4CW1 A;  3RWI A;  3E2H A;  1LDP H;  1KPU A;  4Y4H A;  3H9S A;  1A1O A;  2OI9 A;  3P9L A;  4G9D A;  1LK2 A;  3RL2 A;  3GML A;  4N0U A;  1I7R A;  3FT4 A;  5EUO A;  4D0C A;  2ZOK A;  5D5M A;  3SCM A;  3TN0 A;  2RFX A;  1XH3 A;  3FOM A;  3B3I A;  1T1X A;  1T21 A;  4PGB A;  4U6X A;  2A83 A;  1AGD A;  2F53 A;  5E8O A;  3UTS A;  1C16 A;  3HAE A;  4V3D B;  3BUY A;  4WU5 A;  3MRB A;  5EU4 A;  1KBG H;  1LP9 A;  3DX7 A;  3BP7 A;  3CVH A;  3ILP A;  2UWE A;  3KPP A;  4WDI A;  1ZT4 A;  4PRN A;  3SJV A;  4D0B A;  5ISZ A;  1T1W A;  4F7E A;  4MXQ A;  5IB4 A;  1AGE A;  4LCW A;  3GMP A;  4MNQ A;  3NFN A;  2P5E A;  3S6C A;  3VXN A;  3TBV A;  4FFE X;  4IHO A;  4PJD A;  5EU6 A;  4PJC A;  3MRH A;  3MRD A;  1KJM A;  3MRL A;  1T7Y A;  3V5D A;  1XR8 A;  1SYS A;  3H9H A;  2AK4 A;  4QRR A;  3BHB A;  1KJ3 H;  3DX8 A;  3FTG A;  5GSR A;  5HGD A;  3RL1 A;  1BQH A;  1NAM H;  4ZAK A;  2VLL A;  5MEP A;  3MV8 A;  4F7T A;  4S0U C;  3OXS A;  5D7J C;  4HUX A;  5HHQ A;  1AGB A;  5J6H A;  1FZM A;  3LKP A;  3QUY A;  1WBY A;  3TIE A;  5C0A A;  4N0C A;  3LKR A;  3CPL A;  4PJ8 A;  3KYO A;  4PV8 A;  3VXO A;  3BH8 A;  3TF7 A;  4U1J A;  1M6O A;  2ZSV A;  4NHU E;  4NNY A;  4NNX A;  3SDC A;  5MEQ A;  3SDX A;  3PWP A;  2NX5 A;  5E8P A;  2BVO A;  1DUY A;  1HSA A;  4NQE A;  1G7Q A;  3AM8 A;  4PRB A;  2HN7 A;  4G42 A;  2GTW A;  1RK1 A;  3MRR A;  4HUW A;  3VRJ A;  1A9B A;  1LQV A;  1UQS A;  2CLV A;  1ZHB A;  3TFK A;  5JHD A;  4G43 A;  5IB2 A;  1NEZ A;  1XR9 A;  5MEO A;  2HJK A;  1RK0 A;  1FZJ A;  4NSK A;  1W72 A;  4ZUT A;  4Y2D A;  5EO1 A;  5C0I A;  4L3C A;  1HHI A;  4K71 B;  1FFO A;  3TID A;  3SPV A;  4X6E A;  4ZFZ A;  3FFC A;  1JF1 A;  4PRH A;  1HOC A;  2BVP A;  4IRJ A;  3PWL A;  1T7W A;  3V5H A;  3FQU A;  4X6D A;  5E00 A;  3X12 A;  2MHA A;  3MV7 A;  3VFU A;  2BNR A;  2AV1 A;  2BVQ A;  3GSR A;  3SDD A;  3KPO A;  3VFR A;  3MRM A;  3WUW A;  3ECB A;  3TZV C;  4Z76 A;  4G8G A;  1AKJ A;  5C0D A;  3O9W A;  5HHO A;  1TVH A;  1P1Z A;  3OX8 A;  3TO4 A;  3TBS A;  3E3Q A;  4CVX A;  3VH8 A;  3RWE A;  1ZS8 A;  3GSN H;  4PJ5 A;  5MER A;  2GTZ A;  1X7Q A;  3QQ3 A;  4PJG A;  3BP4 A;  4L8B A;  3TPU E;  1MHE A;  3MRC A;  3MYJ A;  3FQR A;  3RWG A;  5IEH A;  3P4O A;  4WU7 A;  3GMN A;  4N0F A;  1EXU A;  4NQC A;  3GSQ A;  3BZF A;  4QRQ A;  5D9S A;  3SDA A;  2GAZ A;  2X4R A;  2V2W A;  3KPR A;  3GSW A;  5D7L A;  1TVB A;  4O2F A;  2PYE A;  4MJI A;  1LD9 A;  1I1F A;  1FG2 A;  1LEG A;  3LKS A;  4IIQ C;  4UQ3 A;  3PWJ A;  1T7V A;  3MRN A;  3QDJ A;  4PJE A;  1QO3 A;  4NQV A;  5SWQ A;  5H94 A;  3TO2 A;  1P4L A;  4MX7 A;  4U6Y A;  5L2J A;  2YPK A;  4MJ6 A;  2GIT A;  4NT6 A;  1QSF A;  1S7W A;  1EFX A;  3QUX A;  4Y16 A;  3I6K A;  3CDG A;  4QOK A;  3FQW A;  1HHK A;  1EEZ A;  1K8D A;  3VXU A;  1GZQ A;  4PJF A;  3VFP A;  3LV3 A;  1I1A A;  3ARE A;  1LEK A;  3GMO A;  1DDH A;  3GMR A;  3MRI A;  3VFN A;  5IB1 A;  1R3H A;  3BEV A;  2X4Q A;  5D2N A;  3ROO A;  4FTV A;  1NAN H;  3L3J A;  2F74 A;  1JGE A;  3X13 A;  5B39 A;  2OL3 H;  1W0V A;  3VCL A;  4JFO A;  3MRK A;  3QDM A;  1T7X A;  1HSB A;  1T22 A;  3JTC A;  1HHG A;  1S8D A;  2J8U A;  2X4O A;  4JFD A;  4QRS A;  3T1F A;  1T1Z A;  1G7P A;  4L8S C;  2CKB H;  3RWD A;  2CLZ A;  3VXP A;  4L4V A;  1FFP A;  3W0W A;  3W39 A;  4E0R A;  2ZSW A;  1Q94 A;  3DXA A;  1QR1 A;  3BH9 A;  3MRJ A;  2AXG A;  4NO0 A;  3LN4 A;  4PJX A;  3QUZ A;  3JVG A;  4NQD A;  3E6F A;  3P4N A;  3M17 A;  4PRE A;  3FON A;  4X6F A;  5FDW A;  4MNG A;  1S7V A;  5IND A;  3X14 A;  1AO7 A;  3AU1 A;  1ONQ A;  3KPM A;  3O3D A;  2BST A;  5IVX A;  3TBT A;  3TBY A;  1I1Y A;  1A1M A;  1W0W A;  5C09 A;  1KJ2 H;  3ROL A;  3UBX A;  3G08 A;  2V2X A;  3VFT A;  5EO0 A;  3RWJ A;  3TVM A;  4PV9 A;  4UQ2 A;  3QFJ A;  4CVZ A;  2ESV A;  3ARG A;  2VLJ A;  4GKS A;  4WO4 A;  3L3K A;  4WUU A;  3QQ4 A;  3PWN A;  3CZF A;  4QRU A;  5F7D A;  1T7Z A;  4NO5 A;  3GMQ A;  3MRQ A;  3RWC A;  3GMM A;  1QRN A;  1FZO A;  3MV9 A;  4O2C A;  1OSZ A;  2GJ6 A;  3BWA A;  4LHU A;  4PG2 A;  3SKO A;  4D0D A;  1JE6 A;  4IRS A;  3ARD A;  3VXM A;  1I7T A;  1RJZ A;  1JUF A;  1G6R H;  4MVB A;  3GSV A;  4Z77 A;  1EEY A;  2YPL A;  3FQT A;  3LKO A;  4ZUW A;  2NW3 A;  3KPQ A;  2YEZ A;  4PJ7 A;  3VFS A;  3D3V A;  3QEQ A;  4L3E A;  2BCK A;  1MWA H;  3VRI A;  1S7T A;  4ZUV A;  2GT9 A;  3QFD A;  3RUG A;  4PDC E;  3VXS A;  3KXF A;  4PJH A;  2FO4 A;  3REW A;  1XZ0 A;  5BJT A;  1OGT A;  3VFW A;  5EFI A;  3IXA A;  1FZK A;  1I7U A;  1ZT7 A;  3KPS A;  3QUL A;  3VWK A;  1ED3 A;  3HG1 A;  5HHM A;  4X6C A;  1IM9 A;  3D39 A;  1AGC A;  1T1Y A;  3IT8 D;  1QSE A;  3QDG A;  3WS6 A;  3I6L D;  4L29 A;  1S9Y A;  3UPR A;  2CLR A;  2HLA A;  1JPF A;  4ZUS A;  2H6P A;  3HE7 A;  3ARF A;  3OXR A;  3LN5 A;  3O4L A;  3M1B A;  1MHC A;  2VE6 A;  1HYR C;  1T0N A;  3MRG A;  3L3G A;  4EN3 C;  1B3J A;  3C9N A;  4MS8 A;  3HPJ A;  1N2R A;  1YN7 A;  2BSS A;  2DYP A;  2VAA A;  5BRZ A;  3RTQ A;  4PJ9 A;  1TMC A;  4Z78 A;  5IB5 A;  5IEK A;  5BXF A;  1KPR A;  3ILQ C;  1YDP A;  3GSO A;  3MRF A;  4ONO A;  3CH1 A;  3GJF A;  5C9J A;  3BZE A;  1MI5 A;  2HJL A;  2BSR A;  3PQY A;  3HUJ A;  4U1I A;  4U1M A;  3RGV C;  1QEW A;  4O2E A;  3L3I A;  3GSX A;  4GUP A;  3FQX A;  4U1L A;  5E8N A;  1BII A;  4N8V A;  5C0E A;  2JCC A;  3TBW A;  5L2K A;  3FT3 A;  1AGF A;  1S7R A;  1S9W A;  3GSU A;  4QRT A;  5GSV A;  4APQ A;  3FQN A;  3MRO A;  4WW2 C;  2X4P A;  4WJ5 A;  5BS0 A;  1A6Z A;  2PO6 A;  3PWV A;  3FOL A;  3KYN A;  1S7U A;  3VFO A;  5HHP A;  3E6H A;  3P9M A;  1UXS A;  4XXC A;  4F7P A;  1BD2 A;  5DEG A;  4JFQ A;  5FKP A;  1CG9 A;  5FA3 A;  5EOT A;  1I4F A;  2X4T A;  5SWS A;  3WS3 A;  2ZOL A;  3P73 A;  4PGC A;  4JQV A;  1DUZ A;  4JRY A;  3HLA A;  3DTX A;  5ACZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...