2E7LE

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
GPHSMRYFETAVSRRGLGEPRYISVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxic Tcell receptor
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 175
sequence length 175
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2e7lE00
1QRNA 2PYEA 4MNGA 3CDGA 1T20A 3P9LA 4PGDA 3O8XA 1WBZA 3QFDA 3L9RA 5BRZA 3MR9A 5SWZA 3GMQA 3AM8A 3GSRA 3BGMA 4PRAA 3O3AA 3MRCA 1FZMA 1I7RA 4QRSA 1I4FA 3VXNA 2ESVA 1AGFA 4Z78A 5EOTA 4I48A 3MRBA 4NO5A 3TVMA 1S9YA 3SDAA 3H9HA 3RWCA 4HUVA 4N0CA 4NSKA 4ONOA 5FDWA 1FFPA 3QUKA 3LKOA 4NO3A 2AXFA 1HHGA 1S7WA 3O9WA 4PJEA 1HHHA 3LN5A 4D0BA 3BZEA 3OV6A 3PWLA 3FT4A 4WWKC 3MRDA 3P9MA 4EUPA 4ZUSA 3VCLA 3MGOA 2XPGA 4PJ7A 3TJHA 4QRUA 3P4MA 3GIVA 3PWVA 4O2FA 4UQ2A 3UBXA 3VH8A 4F7PA 5IB5A 1YDPA 3CC5A 3MROA 4MQ7A 3TFKA 3JTTA 3VFUA 2D31A 2GUOA 2X4SA 4Y2DA 4NQDA 5C0BA 2FYYA 3O3EA 1I7UA 2MHAA 4NO0A 3GSNH 2Q7YA 3UTTA 4NQVA 4L4TA 2VABA 2ZSVA 4G59A 4U6YA 2CLZA 1VGKA 5IB4A 4G42A 3SDXA 4X6DA 4PJIA 4JQVA 4LCWA 4Y4HA 1JFMA 5D2LA 3MGTA 4JFQA 5C07A 3KPSA 4HV8A 3QQ3A 1B0GA 5HYJA 2CKBH 3VXSA 3VFTA 3X11A 4MX7A 3MRNA 4D0CA 3ARGA 4QOKA 1AGCA 3FT3A 3FTGA 1N3NA 3D3VA 4WDIA 3DX8A 5F7DA 3GMNA 1QSEA 1HHIA 4NQEA 3UPRA 1I1AA 4PRDA 1KBGH 3QUZA 1NANH 3TO2A 5HGDA 2CIIA 5JHDA 3LKRA 4PG2A 1W72A 3GMRA 5MEOA 3X13A 3L3JA 3P73A 4L9LC 1CE6A 5INCA 1S9WA 5C09A 1E27A 1T80A 3PQYA 4F7CA 3FQNA 3TN0A 3RUGA 3MRPA 3E2HA 2CLVA 4ZUVA 4L4VA 2GT9A 4PJXA 1WBYA 2FWOA 3B6SA 4GKNA 3VXMA 4I4WA 3PABA 3TBSA 5C0EA 5GSVA 1QO3A 1NEZA 5L2JA 1BQHA 3AREA 3QDGA 3C9NA 1QSFA 3KXFA 3I6KA 3LKQA 1P7QA 3L3KA 3QQ4A 2A83A 4JRYA 2VE6A 3E6FA 3V5DA 5E9DA 3FFCA 4PP8C 1P1ZA 4ZFZA 5C08A 3KPOA 1JPFA 4G8GA 3WL9A 4F7MA 1RK1A 4Y4KA 2F74A 1T7WA 4PRPA 3TZVC 1CG9A 2AV1A 4WUUA 4GUPA 1ZT1A 3RWFA 3ARDA 3MV7A 1RJZA 2ZOLA 5MERA 3VFSA 1QR1A 2AKRA 1AKJA 4UQ3A 2ZOKA 3FQTA 3QDMA 1HHKA 2GITA 1S9XA 4JFPA 1T7ZA 5IVXA 3MA7A 4CW1A 2OI9A 2ZSWA 4K71B 5C0AA 1ZVSA 1ZT4A 3MRHA 5IM7A 4PDCE 3U0PA 3GSXA 3KPRA 5HHNA 4D0DA 1A6ZA 4PJHA 1R3HA 1RJYA 1T0NA 1N5AA 3D39A 1JGDA 4JFOA 4PRIA 3QZWA 4PR5A 5DEFA 3P4NA 3FQUA 3KYOA 4MXQA 4IRSA 3TA3A 1OGTA 1TVHA 1ZHLA 3VJ6A 3VRIA 4F7TA 3T8XA 1FFOA 3UTQA 3GMLA 3HPJA 3JTCA 5SWQA 3KPQA 4MJIA 3HUJA 5ACZA 4QRQA 3FOLA 1A1OA 4G43A 3OX8A 2FIKA 4JFDA 3LKSA 3BXNA 5B38A 3FT2A 4X6FA 3RWIA 5MENA 3GJFA 1I1YA 3WS6A 3NFNA 4O2CA 4EI5A 1CD1A 1KJ2H 1QLFA 2BSSA 4MJ6A 1KPVA 1P4LA 5D9SA 3SDCA 5BXFA 3MRFA 2PO6A 5AD0A 3DTXA 3GSVA 4LCYA 3ES6A 4G8IA 1KPRA 3FQRA 5EU6A 3VXPA 3MRIA 3P77A 1OF2A 5HHQA 4HS3A 5C0FA 1KTLA 1MHEA 1A1NA 4NQXA 5EO0A 3QI9A 2X4OA 3BH8A 4N0FA 5IEHA 3DBXA 1KJ3H 2CIKA 4LCCC 3I6LD 2BVPA 3E3QA 3BW9A 5E8PA 4ZUUA 3TBYA 3VXOA 1S7SA 3MRMA 5IB2A 4GKSA 3FONA 1XR8A 3FQWA 1LP9A 1FG2A 1ONQA 2YEZA 3QDJA 1KCGC 5IB3A 1LK2A 1JUFA 3ARBA 4ELMA 5IEKA 3PWPA 3PWUA 3PWJA 1BZ9A 3GSOA 3H9SA 1LQVA 3GSUA 3ERYA 5EUOA 1JPGA 4E0RA 5MEQA 5EU4A 4U1IA 1INQA 1XH3A 2F54A 1Q94A 3VFVA 5EU5A 1FO0H 1JF1A 2VLLA 3BH9A 3HE6A 5D7LA 4PREA 5E6IC 3MYJA 1T7VA 3BHBA 4MJ5A 3D18A 4U1NA 4PGEA 3ILQC 1M6OA 5BS0A 4WU7A 3OXSA 3WS3A 1N2RA 1MHCA 1W0VA 3DMMA 1S7TA 4U1LA 3WUWA 4CVZA 3RWHA 1TMCA 5HHPA 3VRJA 1X7QA 2GTZA 3VFRA 2NW3A 1EXUA 5E8OA 1T1YA 1GZQA 2X4TA 4L29A 2CLRA 4JRXA 5EO1A 4F7EA 1HSBA 1A9EA 1Z5LA 2BNQA 3FRUA 4V3DB 3VFNA 1B0RA 1HHJA 3MRKA 3TIDA 3KPMA 1QVOA 3QEQA 1LD9A 1PQZA 3JVGA 4PJ8A 4PJDA 3RL2A 5C0IA 1ZSDA 3CH1A 2X70A 3SJVA 3VFOA 3V5KA 3BVNA 3MRGA 2BNRA 1GZPA 1L8JA 1MWAH 2XFXA 3S6CA 3JTSA 2YPKA 3V5HA 1FFNA 3KYNA 3VFPA 3H7BA 3ILPA 1M05A 4HUWA 1G7PA 2GAZA 4WO4A 3UTSA 1EEZA 1LDPH 1T7XA 2AV7A 4PGCA 5INDA 1QEWA 2F53A 3LN4A 1SYVA 4L8CA 5HGBA 1VACA 3MRLA 3KPNA 3FOMA 4N5EA 1KJVA 4NNYA 4HUUA 5C0CA 4PV8A 1TVBA 3LV3A 1T21A 2WY3A 3GMOA 4PJ9A 1BIIA 4ZUWA 2NX5A 5C0GA 2VLKA 3L3GA 4QRTA 1T1WA 1U58A 1NAMH 3MRQA 3MV9A 3MRJA 3HCVA 4V3EB 5E8NA 1KPUA 1HSAA 3HG1A 1IM3A 4Y4FA 5FA3A 2V2XA 5FA4A 1G7QA 5ISZA 5EU3A 4JFFA 3OXRA 5DEGA 5J1AA 3ROLA 2VAAA 3CZFA 3TBWA 5C9JA 3CPLA 2BSTA 3O3BA 4N8VA 1ZT7A 1S7UA 4HUXA 3SCMA 4EN3C 4Z77A 1FZJA 5H94A 3L3DA 1N59A 5HHOA 4MS8A 2UWEA 3BEWA 4NQCA 2VLJA 2BVQA 2OL3H 2X4UA 1YN6A 1A1MA 1S7VA 1T1ZA 3DX6A 1ZS8A 1XZ0A 1SYSA 1ZHNA 3CVHA 4IHOA 3E6HA 4L8DA 4PG9A 3X14A 3KLAA 3KPLA 3DX7A 2HJKA 1AGEA 5F9JA 3AU1A 4HX1A 2FO4A 4PRNA 1QQDA 5F1NA 1G6RH 1UXSA 3SKMA 5J6GA 5D7IA 3VFWA 4PJFA 1T7YA 4JQXA 2V2WA 4PRHA 2X4PA 3GSWA 1EEYA 1OSZA 3LKNA 5F1IA 3CCHA 2J8UA 2P5EA 4NHUE 3VWJA 3RL1A 3BO8A 3RZCA 3RWGA 4NNXA 1K8DA 3MRRA 3GMMA 2AK4A 2X4QA 1ZAGA 2GTWA 2H6PA 1I7TA 3KWWA 4XXCA 4QRRA 2JCCA 3ECBA 5D7JC 4PV9A 1ED3A 1T22A 3RWEA 4O2EA 2FZ3A 3VXRA 1MI5A 2HN7A 4WU5A 4Z76A 2BCKA 1JGEA 3BP7A 2C7UA 3MV8A 5FKPA 4WW2C 4U6XA 4HKJA 4G9FA 3WLBA 4CVXA 2X4NA 3VFMA 2YPLA 5SWSA 2DYPA 3HLAA 1A9BA 4PJGA 5HGHA 3W39A 3ARFA 4IIQC 1JHTA 3BP4A 3W0WA 3C8KA 2RFXA 5HGAA 1JE6A 3SPVA 4QRPA 1BD2A 1XR9A 1EFXA 4NO2A 2H26A 3X12A 3M17A 1UQSA 3MREA 4JFEA 4X6EA 3HE7A 3O3DA 4K7FA 1HYRC 1DUYA 1IM9A 1KJMA 1UXWA 2AXGA 4WJ5A 5ENWA 5IB1A 5J6HA 2E7LE 5IROA 2HLAA 1VADA 3D2UA 4IRJA 3VWKA 3TF7A 1B3JA 4FFEX 3TBTA 3BEVA 1I1FA 5B39A 4PRBA 1K5NA 1S7XA 4MVBA 4FTVA 5DDHA 2HJLA 1LEGA 4PJBA 1T0MA 1AGBA 4PJCA 4PJAA 4Y16A 1LEKA 4NT6A 3TPUE 4X6CA 3TO4A 4G9DA 1HOCA 3HAEA 1T1XA 4PJ5A 3IXAA 4L8SC 5D2NA 1C16A 2BVOA 4U1HA 4U1MA 4PGBA 4ZAKA 5HHMA 3GMPA 4ZUTA 3GSQA 2VLRA 1YPZA 2X4RA 3O4LA 3FQXA 4LHUA 4LNRA 3M1BA 1S7RA 3RWDA 3L3HA 3LKPA 3PWNA 5D5MA 1W0WA 2GJ6A 3T1FA 3REWA 3QFJA 1FZOA 3RWJA 5C0JA 1AO7A 3G08A 3L3IA 2P5WA 1RK0A 3QULA 4S0UC 1OGAA 3BUYA 3RTQA 1ZHKA 1S8DA 3D25A 1YN7A 3IT8D 1AGDA 1S7QA 1E28A 3QUXA 1DUZA 3P4OA 3B3IA 4HWZA 3TBVA 5E00A 3SDDA 4L3EA 4MNQA 3DXAA 4U1JA 4U1SA 4L3CA 5C0DA 3SKOA 1ZHBA 3TIEA 1DDHA 3BWAA 3BZFA 2BSRA 3I6GA 3KPPA 4U1KA 3ROOA 3RGVC 5BJTA 4L8BA 5L2KA 5GSRA 5EFIA 1DE4A 4E5XA 4APQA 3VXUA 1FZKA 4N0UA 1WBXA 3QUYA 5MEPA
chains in the Genus database with same CATH superfamily
1QRNA 2PYEA 4MNGA 3CDGA 1T20A 3P9LA 4PGDA 3O8XA 1WBZA 3QFDA 3L9RA 5BRZA 3MR9A 5SWZA 4JO8A 3GMQA 3AM8A 3GSRA 3BGMA 4PRAA 3O3AA 3MRCA 1FZMA 1I7RA 4QRSA 1I4FA 3VXNA 2ESVA 1AGFA 4Z78A 5EOTA 4I48A 3MRBA 4NO5A 3TVMA 1S9YA 3SDAA 3H9HA 3RWCA 4HUVA 4N0CA 4NSKA 4ONOA 5FDWA 1FFPA 3QUKA 3LKOA 4NO3A 2AXFA 1HHGA 1S7WA 3O9WA 4PJEA 1HHHA 3LN5A 4D0BA 3BZEA 3OV6A 3PWLA 3FT4A 4WWKC 3MRDA 3P9MA 4EUPA 4ZUSA 3VCLA 3MGOA 2XPGA 4PJ7A 3TJHA 4QRUA 3P4MA 2NYKA 3GIVA 3PWVA 4O2FA 4UQ2A 3UBXA 3VH8A 4F7PA 5IB5A 1YDPA 3CC5A 3MROA 4MQ7A 3TFKA 3JTTA 3VFUA 2D31A 2GUOA 2X4SA 4Y2DA 4NQDA 5C0BA 2FYYA 3O3EA 1I7UA 2MHAA 4NO0A 3GSNH 2Q7YA 3UTTA 4NQVA 4L4TA 2VABA 2ZSVA 4G59A 4U6YA 2CLZA 1VGKA 5IB4A 4G42A 3SDXA 4X6DA 4PJIA 4JQVA 4LCWA 4Y4HA 1JFMA 5D2LA 3MGTA 4JFQA 5C07A 3KPSA 4HV8A 3QQ3A 1B0GA 5HYJA 2CKBH 3VXSA 3VFTA 3X11A 4MX7A 3MRNA 4D0CA 3ARGA 4QOKA 1AGCA 3FT3A 3FTGA 1N3NA 3D3VA 4WDIA 3DX8A 5F7DA 3GMNA 1QSEA 1HHIA 4NQEA 3UPRA 1I1AA 4PRDA 1KBGH 3QUZA 1NANH 3TO2A 5HGDA 2CIIA 5JHDA 3LKRA 4PG2A 1W72A 3GMRA 5MEOA 3X13A 3L3JA 3P73A 4L9LC 1CE6A 5INCA 1S9WA 5C09A 1E27A 1T80A 3PQYA 4F7CA 3FQNA 3TN0A 3RUGA 3MRPA 3E2HA 2CLVA 4ZUVA 4L4VA 2GT9A 4PJXA 1WBYA 2FWOA 3B6SA 4GKNA 3VXMA 4I4WA 3PABA 3TBSA 5C0EA 5GSVA 1QO3A 1NEZA 5L2JA 1BQHA 3AREA 3QDGA 3C9NA 1QSFA 3KXFA 3I6KA 3LKQA 1P7QA 3L3KA 3QQ4A 2A83A 4JRYA 2VE6A 3E6FA 3V5DA 5E9DA 3FFCA 4PP8C 1P1ZA 4ZFZA 5C08A 3KPOA 1JPFA 4G8GA 3WL9A 4F7MA 1RK1A 4Y4KA 2F74A 1T7WA 4PRPA 3TZVC 1CG9A 2AV1A 4WUUA 4GUPA 1ZT1A 3RWFA 3ARDA 3MV7A 1RJZA 2ZOLA 5MERA 3VFSA 1QR1A 2AKRA 1AKJA 4UQ3A 2ZOKA 3FQTA 3QDMA 1HHKA 2GITA 1S9XA 4JFPA 1T7ZA 5IVXA 3MA7A 4CW1A 2OI9A 2ZSWA 4K71B 5C0AA 1ZVSA 1ZT4A 3MRHA 5IM7A 4PDCE 3U0PA 3GSXA 3KPRA 5HHNA 4D0DA 1A6ZA 4PJHA 1R3HA 1RJYA 1T0NA 1N5AA 3D39A 1JGDA 4JFOA 4PRIA 3QZWA 4PR5A 5DEFA 3P4NA 3FQUA 3KYOA 4MXQA 4IRSA 3TA3A 1OGTA 1TVHA 1ZHLA 3VJ6A 3VRIA 4F7TA 3T8XA 1FFOA 3UTQA 3GMLA 3HPJA 3JTCA 5SWQA 3KPQA 4MJIA 3HUJA 5ACZA 4QRQA 3FOLA 1A1OA 4G43A 3OX8A 2FIKA 4JFDA 3LKSA 3BXNA 5B38A 3FT2A 4X6FA 3RWIA 5MENA 3GJFA 1I1YA 3WS6A 3NFNA 4O2CA 4EI5A 1CD1A 1KJ2H 1QLFA 2BSSA 3I0TA 1KPVA 1P4LA 4MJ6A 5D9SA 3SDCA 5BXFA 3MRFA 2PO6A 5AD0A 3DTXA 3GSVA 4LCYA 3ES6A 4G8IA 1KPRA 3FQRA 5EU6A 3VXPA 3MRIA 3P77A 1OF2A 5HHQA 4HS3A 5C0FA 1KTLA 1MHEA 1A1NA 4NQXA 5EO0A 3QI9A 2X4OA 3BH8A 4N0FA 5IEHA 3DBXA 1KJ3H 2CIKA 4LCCC 3I6LD 2BVPA 3E3QA 3BW9A 5E8PA 4ZUUA 3TBYA 3VXOA 1S7SA 3MRMA 5IB2A 4GKSA 3FONA 1XR8A 3FQWA 1LP9A 1FG2A 1ONQA 2YEZA 3QDJA 1KCGC 5IB3A 1LK2A 1JUFA 3ARBA 4ELMA 5IEKA 3PWPA 3PWUA 3PWJA 1BZ9A 3GSOA 3H9SA 1LQVA 3GSUA 3ERYA 5EUOA 1JPGA 4E0RA 5MEQA 5EU4A 4U1IA 1INQA 1XH3A 2F54A 1Q94A 3VFVA 5EU5A 1FO0H 1JF1A 2VLLA 3BH9A 3HE6A 5D7LA 4PREA 5E6IC 3MYJA 1T7VA 3BHBA 4MJ5A 3D18A 4U1NA 4PGEA 3ILQC 1M6OA 5BS0A 4WU7A 3OXSA 3WS3A 1N2RA 1MHCA 1W0VA 3DMMA 1S7TA 4U1LA 3WUWA 4CVZA 3RWHA 1TMCA 5HHPA 3VRJA 1X7QA 2GTZA 3VFRA 2NW3A 1EXUA 5E8OA 1T1YA 1GZQA 2X4TA 4L29A 2CLRA 4JRXA 5EO1A 4F7EA 1HSBA 1A9EA 1Z5LA 2BNQA 3FRUA 4V3DB 3VFNA 1B0RA 1HHJA 3MRKA 3TIDA 3KPMA 1QVOA 3QEQA 1LD9A 1PQZA 3JVGA 4PJ8A 4PJDA 3RL2A 5C0IA 1ZSDA 3CH1A 2X70A 3SJVA 3VFOA 3V5KA 3BVNA 3MRGA 2BNRA 1GZPA 1L8JA 1MWAH 2XFXA 3S6CA 3JTSA 2YPKA 3V5HA 1FFNA 3KYNA 3VFPA 3H7BA 3ILPA 1M05A 4HUWA 1G7PA 2GAZA 4WO4A 3UTSA 1EEZA 1LDPH 1T7XA 2AV7A 4PGCA 5INDA 1QEWA 2F53A 3LN4A 1SYVA 4L8CA 5HGBA 1VACA 3MRLA 3KPNA 3FOMA 4N5EA 1KJVA 4NNYA 4HUUA 5C0CA 4PV8A 1TVBA 3LV3A 1T21A 2WY3A 3GMOA 4PJ9A 1BIIA 4ZUWA 2NX5A 5C0GA 2VLKA 3L3GA 4QRTA 1T1WA 1U58A 1NAMH 3MRQA 3MV9A 3MRJA 3HCVA 4V3EB 5E8NA 1KPUA 1HSAA 3HG1A 1IM3A 4Y4FA 5FA3A 2V2XA 5FA4A 1G7QA 2IA1A 5ISZA 5EU3A 4JFFA 3OXRA 5DEGA 5J1AA 3ROLA 2VAAA 3CZFA 3TBWA 5C9JA 3CPLA 2BSTA 3O3BA 4G59C 4N8VA 1ZT7A 1S7UA 4HUXA 3SCMA 4EN3C 4Z77A 1FZJA 5H94A 3L3DA 1N59A 5HHOA 4MS8A 2UWEA 3BEWA 4NQCA 2VLJA 2BVQA 2OL3H 2X4UA 1YN6A 1A1MA 1S7VA 1T1ZA 3DX6A 1ZS8A 1XZ0A 1SYSA 1ZHNA 3CVHA 4IHOA 3E6HA 4L8DA 4PG9A 3X14A 3KLAA 3KPLA 3DX7A 2HJKA 1AGEA 5F9JA 3AU1A 4HX1A 2FO4A 4PRNA 1QQDA 5F1NA 1G6RH 1UXSA 3SKMA 5J6GA 5D7IA 3VFWA 4PJFA 1T7YA 4JQXA 2V2WA 4PRHA 2X4PA 3GSWA 1EEYA 1OSZA 3LKNA 5F1IA 3CCHA 2J8UA 2P5EA 4NHUE 3VWJA 3RL1A 3BO8A 3RZCA 3RWGA 4NNXA 1K8DA 3MRRA 3GMMA 2AK4A 2X4QA 1ZAGA 2GTWA 2H6PA 1I7TA 3KWWA 4XXCA 4QRRA 2JCCA 3ECBA 5D7JC 4PV9A 1ED3A 1T22A 3RWEA 4O2EA 2FZ3A 3VXRA 1MI5A 2HN7A 4WU5A 4Z76A 2BCKA 1JGEA 3BP7A 2C7UA 3MV8A 5FKPA 4WW2C 4U6XA 4HKJA 4G9FA 3WLBA 4CVXA 2X4NA 3VFMA 2YPLA 5SWSA 2DYPA 3HLAA 1A9BA 4PJGA 5HGHA 3W39A 3ARFA 4IIQC 1JHTA 3BP4A 3W0WA 3C8KA 2RFXA 5HGAA 1JE6A 3SPVA 4QRPA 1BD2A 1XR9A 1EFXA 4NO2A 2H26A 3X12A 3M17A 1UQSA 3MREA 4JFEA 4X6EA 3HE7A 3O3DA 4K7FA 1HYRC 1DUYA 1IM9A 1KJMA 1UXWA 2AXGA 4WJ5A 5ENWA 5IB1A 5J6HA 2E7LE 5IROA 2HLAA 1VADA 3D2UA 4IRJA 3VWKA 3TF7A 1B3JA 4FFEX 3TBTA 3BEVA 1I1FA 5B39A 4PRBA 1K5NA 1S7XA 4MVBA 4FTVA 5DDHA 2HJLA 4BKWA 1LEGA 4PJBA 1T0MA 1AGBA 4PJCA 4PJAA 4Y16A 1LEKA 4NT6A 3TPUE 4X6CA 3TO4A 4G9DA 1HOCA 3HAEA 1T1XA 4PJ5A 3IXAA 4L8SC 5D2NA 1C16A 2BVOA 4U1HA 4U1MA 4PGBA 4ZAKA 5HHMA 3GMPA 4ZUTA 3GSQA 2VLRA 1YPZA 2X4RA 2O5NA 3O4LA 3FQXA 4LHUA 4LNRA 3M1BA 1S7RA 3RWDA 3L3HA 3LKPA 3PWNA 5D5MA 1W0WA 2GJ6A 3T1FA 3REWA 3QFJA 1FZOA 3RWJA 5C0JA 1AO7A 3G08A 3L3IA 2P5WA 1RK0A 3QULA 4S0UC 1OGAA 3BUYA 3RTQA 1ZHKA 1S8DA 3D25A 1YN7A 3IT8D 1AGDA 1S7QA 1E28A 3QUXA 1DUZA 3P4OA 3B3IA 4HWZA 3TBVA 5E00A 3SDDA 4L3EA 4MNQA 3DXAA 4U1JA 4U1SA 4L3CA 5C0DA 3SKOA 1ZHBA 3TIEA 1DDHA 3BWAA 3BZFA 2BSRA 3I6GA 3KPPA 4U1KA 3ROOA 3RGVC 5BJTA 4L8BA 5L2KA 5GSRA 5EFIA 1DE4A 4E5XA 4APQA 3VXUA 1FZKA 4N0UA 1WBXA 3QUYA 5MEPA
chains in the Genus database with same CATH topology
1QRNA 2PYEA 4MNGA 3CDGA 1T20A 3P9LA 4PGDA 3O8XA 1WBZA 3QFDA 3L9RA 5BRZA 3MR9A 5SWZA 3GMQA 3AM8A 3GSRA 3BGMA 4PRAA 3O3AA 3MRCA 1FZMA 1I7RA 4QRSA 1I4FA 3VXNA 2ESVA 1AGFA 4Z78A 5EOTA 4I48A 3MRBA 4NO5A 3TVMA 1S9YA 3SDAA 3H9HA 3RWCA 4HUVA 4N0CA 4NSKA 4ONOA 5FDWA 1FFPA 3QUKA 3LKOA 4NO3A 2AXFA 1HHGA 1S7WA 3O9WA 4PJEA 1HHHA 3LN5A 4D0BA 3BZEA 3OV6A 3PWLA 3FT4A 4WWKC 3MRDA 3P9MA 4EUPA 4ZUSA 3VCLA 3MGOA 2XPGA 4PJ7A 3TJHA 4QRUA 3P4MA 3GIVA 3PWVA 4O2FA 4UQ2A 3UBXA 3VH8A 4F7PA 5IB5A 1YDPA 3CC5A 3MROA 4MQ7A 3TFKA 3JTTA 3VFUA 2D31A 2GUOA 2X4SA 4Y2DA 4NQDA 5C0BA 2FYYA 3O3EA 1I7UA 2MHAA 4NO0A 3GSNH 2Q7YA 3UTTA 4NQVA 4L4TA 2VABA 2ZSVA 4G59A 4U6YA 2CLZA 1VGKA 5IB4A 4G42A 3SDXA 4X6DA 4PJIA 4JQVA 4LCWA 4Y4HA 1JFMA 5D2LA 3MGTA 4JFQA 5C07A 3KPSA 4HV8A 3QQ3A 1B0GA 5HYJA 2CKBH 3VXSA 3VFTA 3X11A 4MX7A 3MRNA 4D0CA 3ARGA 4QOKA 1AGCA 3FT3A 3FTGA 1N3NA 3D3VA 4WDIA 3DX8A 5F7DA 3GMNA 1QSEA 1HHIA 4NQEA 3UPRA 1I1AA 4PRDA 1KBGH 3QUZA 1NANH 3TO2A 5HGDA 2CIIA 5JHDA 3LKRA 4PG2A 1W72A 3GMRA 5MEOA 3X13A 3L3JA 3P73A 4L9LC 1CE6A 5INCA 1S9WA 5C09A 1E27A 1T80A 3PQYA 4F7CA 3FQNA 3TN0A 3RUGA 3MRPA 3E2HA 2CLVA 4ZUVA 4L4VA 2GT9A 4PJXA 1WBYA 2FWOA 3B6SA 4GKNA 3VXMA 4I4WA 3PABA 3TBSA 5C0EA 5GSVA 1QO3A 1NEZA 5L2JA 1BQHA 3AREA 3QDGA 3C9NA 1QSFA 3KXFA 3I6KA 3LKQA 1P7QA 3L3KA 3QQ4A 2A83A 4JRYA 2VE6A 3E6FA 3V5DA 5E9DA 3FFCA 4PP8C 1P1ZA 4ZFZA 5C08A 3KPOA 1JPFA 4G8GA 3WL9A 4F7MA 1RK1A 4Y4KA 2F74A 1T7WA 4PRPA 3TZVC 1CG9A 2AV1A 4WUUA 4GUPA 1ZT1A 3RWFA 3ARDA 3MV7A 1RJZA 2ZOLA 5MERA 3VFSA 1QR1A 2AKRA 1AKJA 4UQ3A 2ZOKA 3FQTA 3QDMA 1HHKA 2GITA 1S9XA 4JFPA 1T7ZA 5IVXA 3MA7A 4CW1A 2OI9A 2ZSWA 4K71B 5C0AA 1ZVSA 1ZT4A 3MRHA 5IM7A 4PDCE 3U0PA 3GSXA 3KPRA 5HHNA 4D0DA 1A6ZA 4PJHA 1R3HA 1RJYA 1T0NA 1N5AA 3D39A 1JGDA 4JFOA 4PRIA 3QZWA 4PR5A 5DEFA 3P4NA 3FQUA 3KYOA 4MXQA 4IRSA 3TA3A 1OGTA 1TVHA 1ZHLA 3VJ6A 3VRIA 4F7TA 3T8XA 1FFOA 3UTQA 3GMLA 3HPJA 3JTCA 5SWQA 3KPQA 4MJIA 3HUJA 5ACZA 4QRQA 3FOLA 1A1OA 4G43A 3OX8A 2FIKA 4JFDA 3LKSA 3BXNA 5B38A 3FT2A 4X6FA 3RWIA 5MENA 3GJFA 1I1YA 3WS6A 3NFNA 4O2CA 4EI5A 1CD1A 1KJ2H 1QLFA 2BSSA 4MJ6A 1KPVA 1P4LA 5D9SA 3SDCA 5BXFA 3MRFA 2PO6A 5AD0A 3DTXA 3GSVA 4LCYA 3ES6A 4G8IA 1KPRA 3FQRA 5EU6A 3VXPA 3MRIA 3P77A 1OF2A 5HHQA 4HS3A 5C0FA 1KTLA 1MHEA 1A1NA 4NQXA 5EO0A 3QI9A 2X4OA 3BH8A 4N0FA 5IEHA 3DBXA 1KJ3H 2CIKA 4LCCC 3I6LD 2BVPA 3E3QA 3BW9A 5E8PA 4ZUUA 3TBYA 3VXOA 1S7SA 3MRMA 5IB2A 4GKSA 3FONA 1XR8A 3FQWA 1LP9A 1FG2A 1ONQA 2YEZA 3QDJA 1KCGC 5IB3A 1LK2A 1JUFA 3ARBA 4ELMA 5IEKA 3PWPA 3PWUA 3PWJA 1BZ9A 3GSOA 3H9SA 1LQVA 3GSUA 3ERYA 5EUOA 1JPGA 4E0RA 5MEQA 5EU4A 4U1IA 1INQA 1XH3A 2F54A 1Q94A 3VFVA 5EU5A 1FO0H 1JF1A 2VLLA 3BH9A 3HE6A 5D7LA 4PREA 5E6IC 3MYJA 1T7VA 3BHBA 4MJ5A 3D18A 4U1NA 4PGEA 3ILQC 1M6OA 5BS0A 4WU7A 3OXSA 3WS3A 1N2RA 1MHCA 1W0VA 3DMMA 1S7TA 4U1LA 3WUWA 4CVZA 3RWHA 1TMCA 5HHPA 3VRJA 1X7QA 2GTZA 3VFRA 2NW3A 1EXUA 5E8OA 1T1YA 1GZQA 2X4TA 4L29A 2CLRA 4JRXA 5EO1A 4F7EA 1HSBA 1A9EA 1Z5LA 2BNQA 3FRUA 4V3DB 3VFNA 1B0RA 1HHJA 3MRKA 3TIDA 3KPMA 1QVOA 3QEQA 1LD9A 1PQZA 3JVGA 4PJ8A 4PJDA 3RL2A 5C0IA 1ZSDA 3CH1A 2X70A 3SJVA 3VFOA 3V5KA 3BVNA 3MRGA 2BNRA 1GZPA 1L8JA 1MWAH 2XFXA 3S6CA 3JTSA 2YPKA 3V5HA 1FFNA 3KYNA 3VFPA 3H7BA 3ILPA 1M05A 4HUWA 1G7PA 2GAZA 4WO4A 3UTSA 1EEZA 1LDPH 1T7XA 2AV7A 4PGCA 5INDA 1QEWA 2F53A 3LN4A 1SYVA 4L8CA 5HGBA 1VACA 3MRLA 3KPNA 3FOMA 4N5EA 1KJVA 4NNYA 4HUUA 5C0CA 4PV8A 1TVBA 3LV3A 1T21A 2WY3A 3GMOA 4PJ9A 1BIIA 4ZUWA 2NX5A 5C0GA 2VLKA 3L3GA 4QRTA 1T1WA 1U58A 1NAMH 3MRQA 3MV9A 3MRJA 3HCVA 4V3EB 5E8NA 1KPUA 1HSAA 3HG1A 1IM3A 4Y4FA 5FA3A 2V2XA 5FA4A 1G7QA 5ISZA 5EU3A 4JFFA 3OXRA 5DEGA 5J1AA 3ROLA 2VAAA 3CZFA 3TBWA 5C9JA 3CPLA 2BSTA 3O3BA 4N8VA 1ZT7A 1S7UA 4HUXA 3SCMA 4EN3C 4Z77A 1FZJA 5H94A 3L3DA 1N59A 5HHOA 4MS8A 2UWEA 3BEWA 4NQCA 2VLJA 2BVQA 2OL3H 2X4UA 1YN6A 1A1MA 1S7VA 1T1ZA 3DX6A 1ZS8A 1XZ0A 1SYSA 1ZHNA 3CVHA 4IHOA 3E6HA 4L8DA 4PG9A 3X14A 3KLAA 3KPLA 3DX7A 2HJKA 1AGEA 5F9JA 3AU1A 4HX1A 2FO4A 4PRNA 1QQDA 5F1NA 1G6RH 1UXSA 3SKMA 5J6GA 5D7IA 3VFWA 4PJFA 1T7YA 4JQXA 2V2WA 4PRHA 2X4PA 3GSWA 1EEYA 1OSZA 3LKNA 5F1IA 3CCHA 2J8UA 2P5EA 4NHUE 3VWJA 3RL1A 3BO8A 3RZCA 3RWGA 4NNXA 1K8DA 3MRRA 3GMMA 2AK4A 2X4QA 1ZAGA 2GTWA 2H6PA 1I7TA 3KWWA 4XXCA 4QRRA 2JCCA 3ECBA 5D7JC 4PV9A 1ED3A 1T22A 3RWEA 4O2EA 2FZ3A 3VXRA 1MI5A 2HN7A 4WU5A 4Z76A 2BCKA 1JGEA 3BP7A 2C7UA 3MV8A 5FKPA 4WW2C 4U6XA 4HKJA 4G9FA 3WLBA 4CVXA 2X4NA 3VFMA 2YPLA 5SWSA 2DYPA 3HLAA 1A9BA 4PJGA 5HGHA 3W39A 3ARFA 4IIQC 1JHTA 3BP4A 3W0WA 3C8KA 2RFXA 5HGAA 1JE6A 3SPVA 4QRPA 1BD2A 1XR9A 1EFXA 4NO2A 2H26A 3X12A 3M17A 1UQSA 3MREA 4JFEA 4X6EA 3HE7A 3O3DA 4K7FA 1HYRC 1DUYA 1IM9A 1KJMA 1UXWA 2AXGA 4WJ5A 5ENWA 5IB1A 5J6HA 2E7LE 5IROA 2HLAA 1VADA 3D2UA 4IRJA 3VWKA 3TF7A 1B3JA 4FFEX 3TBTA 3BEVA 1I1FA 5B39A 4PRBA 1K5NA 1S7XA 4MVBA 4FTVA 5DDHA 2HJLA 1LEGA 4PJBA 1T0MA 1AGBA 4PJCA 4PJAA 4Y16A 1LEKA 4NT6A 3TPUE 4X6CA 3TO4A 4G9DA 1HOCA 3HAEA 1T1XA 4PJ5A 3IXAA 4L8SC 5D2NA 1C16A 2BVOA 4U1HA 4U1MA 4PGBA 4ZAKA 5HHMA 3GMPA 4ZUTA 3GSQA 2VLRA 1YPZA 2X4RA 3O4LA 3FQXA 4LHUA 4LNRA 3M1BA 1S7RA 3RWDA 3L3HA 3LKPA 3PWNA 5D5MA 1W0WA 2GJ6A 3T1FA 3REWA 3QFJA 1FZOA 3RWJA 5C0JA 1AO7A 3G08A 3L3IA 2P5WA 1RK0A 3QULA 4S0UC 1OGAA 3BUYA 3RTQA 1ZHKA 1S8DA 3D25A 1YN7A 3IT8D 1AGDA 1S7QA 1E28A 3QUXA 1DUZA 3P4OA 3B3IA 4HWZA 3TBVA 5E00A 3SDDA 4L3EA 4MNQA 3DXAA 4U1JA 4U1SA 4L3CA 5C0DA 3SKOA 1ZHBA 3TIEA 1DDHA 3BWAA 3BZFA 2BSRA 3I6GA 3KPPA 4U1KA 3ROOA 3RGVC 5BJTA 4L8BA 5L2KA 5GSRA 5EFIA 1DE4A 4E5XA 4APQA 3VXUA 1FZKA 4N0UA 1WBXA 3QUYA 5MEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRN A;  2PYE A;  4MNG A;  3CDG A;  1T20 A;  3P9L A;  4PGD A;  3O8X A;  1WBZ A;  3QFD A;  3L9R A;  5BRZ A;  3MR9 A;  5SWZ A;  3GMQ A;  3AM8 A;  3GSR A;  3BGM A;  4PRA A;  3O3A A;  3MRC A;  1FZM A;  1I7R A;  4QRS A;  1I4F A;  3VXN A;  2ESV A;  1AGF A;  4Z78 A;  5EOT A;  4I48 A;  3MRB A;  4NO5 A;  3TVM A;  1S9Y A;  3SDA A;  3H9H A;  3RWC A;  4HUV A;  4N0C A;  4NSK A;  4ONO A;  5FDW A;  1FFP A;  3QUK A;  3LKO A;  4NO3 A;  2AXF A;  1HHG A;  1S7W A;  3O9W A;  4PJE A;  1HHH A;  3LN5 A;  4D0B A;  3BZE A;  3OV6 A;  3PWL A;  3FT4 A;  4WWK C;  3MRD A;  3P9M A;  4EUP A;  4ZUS A;  3VCL A;  3MGO A;  2XPG A;  4PJ7 A;  3TJH A;  4QRU A;  3P4M A;  3GIV A;  3PWV A;  4O2F A;  4UQ2 A;  3UBX A;  3VH8 A;  4F7P A;  5IB5 A;  1YDP A;  3CC5 A;  3MRO A;  4MQ7 A;  3TFK A;  3JTT A;  3VFU A;  2D31 A;  2GUO A;  2X4S A;  4Y2D A;  4NQD A;  5C0B A;  2FYY A;  3O3E A;  1I7U A;  2MHA A;  4NO0 A;  3GSN H;  2Q7Y A;  3UTT A;  4NQV A;  4L4T A;  2VAB A;  2ZSV A;  4G59 A;  4U6Y A;  2CLZ A;  1VGK A;  5IB4 A;  4G42 A;  3SDX A;  4X6D A;  4PJI A;  4JQV A;  4LCW A;  4Y4H A;  1JFM A;  5D2L A;  3MGT A;  4JFQ A;  5C07 A;  3KPS A;  4HV8 A;  3QQ3 A;  1B0G A;  5HYJ A;  2CKB H;  3VXS A;  3VFT A;  3X11 A;  4MX7 A;  3MRN A;  4D0C A;  3ARG A;  4QOK A;  1AGC A;  3FT3 A;  3FTG A;  1N3N A;  3D3V A;  4WDI A;  3DX8 A;  5F7D A;  3GMN A;  1QSE A;  1HHI A;  4NQE A;  3UPR A;  1I1A A;  4PRD A;  1KBG H;  3QUZ A;  1NAN H;  3TO2 A;  5HGD A;  2CII A;  5JHD A;  3LKR A;  4PG2 A;  1W72 A;  3GMR A;  5MEO A;  3X13 A;  3L3J A;  3P73 A;  4L9L C;  1CE6 A;  5INC A;  1S9W A;  5C09 A;  1E27 A;  1T80 A;  3PQY A;  4F7C A;  3FQN A;  3TN0 A;  3RUG A;  3MRP A;  3E2H A;  2CLV A;  4ZUV A;  4L4V A;  2GT9 A;  4PJX A;  1WBY A;  2FWO A;  3B6S A;  4GKN A;  3VXM A;  4I4W A;  3PAB A;  3TBS A;  5C0E A;  5GSV A;  1QO3 A;  1NEZ A;  5L2J A;  1BQH A;  3ARE A;  3QDG A;  3C9N A;  1QSF A;  3KXF A;  3I6K A;  3LKQ A;  1P7Q A;  3L3K A;  3QQ4 A;  2A83 A;  4JRY A;  2VE6 A;  3E6F A;  3V5D A;  5E9D A;  3FFC A;  4PP8 C;  1P1Z A;  4ZFZ A;  5C08 A;  3KPO A;  1JPF A;  4G8G A;  3WL9 A;  4F7M A;  1RK1 A;  4Y4K A;  2F74 A;  1T7W A;  4PRP A;  3TZV C;  1CG9 A;  2AV1 A;  4WUU A;  4GUP A;  1ZT1 A;  3RWF A;  3ARD A;  3MV7 A;  1RJZ A;  2ZOL A;  5MER A;  3VFS A;  1QR1 A;  2AKR A;  1AKJ A;  4UQ3 A;  2ZOK A;  3FQT A;  3QDM A;  1HHK A;  2GIT A;  1S9X A;  4JFP A;  1T7Z A;  5IVX A;  3MA7 A;  4CW1 A;  2OI9 A;  2ZSW A;  4K71 B;  5C0A A;  1ZVS A;  1ZT4 A;  3MRH A;  5IM7 A;  4PDC E;  3U0P A;  3GSX A;  3KPR A;  5HHN A;  4D0D A;  1A6Z A;  4PJH A;  1R3H A;  1RJY A;  1T0N A;  1N5A A;  3D39 A;  1JGD A;  4JFO A;  4PRI A;  3QZW A;  4PR5 A;  5DEF A;  3P4N A;  3FQU A;  3KYO A;  4MXQ A;  4IRS A;  3TA3 A;  1OGT A;  1TVH A;  1ZHL A;  3VJ6 A;  3VRI A;  4F7T A;  3T8X A;  1FFO A;  3UTQ A;  3GML A;  3HPJ A;  3JTC A;  5SWQ A;  3KPQ A;  4MJI A;  3HUJ A;  5ACZ A;  4QRQ A;  3FOL A;  1A1O A;  4G43 A;  3OX8 A;  2FIK A;  4JFD A;  3LKS A;  3BXN A;  5B38 A;  3FT2 A;  4X6F A;  3RWI A;  5MEN A;  3GJF A;  1I1Y A;  3WS6 A;  3NFN A;  4O2C A;  4EI5 A;  1CD1 A;  1KJ2 H;  1QLF A;  2BSS A;  4MJ6 A;  1KPV A;  1P4L A;  5D9S A;  3SDC A;  5BXF A;  3MRF A;  2PO6 A;  5AD0 A;  3DTX A;  3GSV A;  4LCY A;  3ES6 A;  4G8I A;  1KPR A;  3FQR A;  5EU6 A;  3VXP A;  3MRI A;  3P77 A;  1OF2 A;  5HHQ A;  4HS3 A;  5C0F A;  1KTL A;  1MHE A;  1A1N A;  4NQX A;  5EO0 A;  3QI9 A;  2X4O A;  3BH8 A;  4N0F A;  5IEH A;  3DBX A;  1KJ3 H;  2CIK A;  4LCC C;  3I6L D;  2BVP A;  3E3Q A;  3BW9 A;  5E8P A;  4ZUU A;  3TBY A;  3VXO A;  1S7S A;  3MRM A;  5IB2 A;  4GKS A;  3FON A;  1XR8 A;  3FQW A;  1LP9 A;  1FG2 A;  1ONQ A;  2YEZ A;  3QDJ A;  1KCG C;  5IB3 A;  1LK2 A;  1JUF A;  3ARB A;  4ELM A;  5IEK A;  3PWP A;  3PWU A;  3PWJ A;  1BZ9 A;  3GSO A;  3H9S A;  1LQV A;  3GSU A;  3ERY A;  5EUO A;  1JPG A;  4E0R A;  5MEQ A;  5EU4 A;  4U1I A;  1INQ A;  1XH3 A;  2F54 A;  1Q94 A;  3VFV A;  5EU5 A;  1FO0 H;  1JF1 A;  2VLL A;  3BH9 A;  3HE6 A;  5D7L A;  4PRE A;  5E6I C;  3MYJ A;  1T7V A;  3BHB A;  4MJ5 A;  3D18 A;  4U1N A;  4PGE A;  3ILQ C;  1M6O A;  5BS0 A;  4WU7 A;  3OXS A;  3WS3 A;  1N2R A;  1MHC A;  1W0V A;  3DMM A;  1S7T A;  4U1L A;  3WUW A;  4CVZ A;  3RWH A;  1TMC A;  5HHP A;  3VRJ A;  1X7Q A;  2GTZ A;  3VFR A;  2NW3 A;  1EXU A;  5E8O A;  1T1Y A;  1GZQ A;  2X4T A;  4L29 A;  2CLR A;  4JRX A;  5EO1 A;  4F7E A;  1HSB A;  1A9E A;  1Z5L A;  2BNQ A;  3FRU A;  4V3D B;  3VFN A;  1B0R A;  1HHJ A;  3MRK A;  3TID A;  3KPM A;  1QVO A;  3QEQ A;  1LD9 A;  1PQZ A;  3JVG A;  4PJ8 A;  4PJD A;  3RL2 A;  5C0I A;  1ZSD A;  3CH1 A;  2X70 A;  3SJV A;  3VFO A;  3V5K A;  3BVN A;  3MRG A;  2BNR A;  1GZP A;  1L8J A;  1MWA H;  2XFX A;  3S6C A;  3JTS A;  2YPK A;  3V5H A;  1FFN A;  3KYN A;  3VFP A;  3H7B A;  3ILP A;  1M05 A;  4HUW A;  1G7P A;  2GAZ A;  4WO4 A;  3UTS A;  1EEZ A;  1LDP H;  1T7X A;  2AV7 A;  4PGC A;  5IND A;  1QEW A;  2F53 A;  3LN4 A;  1SYV A;  4L8C A;  5HGB A;  1VAC A;  3MRL A;  3KPN A;  3FOM A;  4N5E A;  1KJV A;  4NNY A;  4HUU A;  5C0C A;  4PV8 A;  1TVB A;  3LV3 A;  1T21 A;  2WY3 A;  3GMO A;  4PJ9 A;  1BII A;  4ZUW A;  2NX5 A;  5C0G A;  2VLK A;  3L3G A;  4QRT A;  1T1W A;  1U58 A;  1NAM H;  3MRQ A;  3MV9 A;  3MRJ A;  3HCV A;  4V3E B;  5E8N A;  1KPU A;  1HSA A;  3HG1 A;  1IM3 A;  4Y4F A;  5FA3 A;  2V2X A;  5FA4 A;  1G7Q A;  5ISZ A;  5EU3 A;  4JFF A;  3OXR A;  5DEG A;  5J1A A;  3ROL A;  2VAA A;  3CZF A;  3TBW A;  5C9J A;  3CPL A;  2BST A;  3O3B A;  4N8V A;  1ZT7 A;  1S7U A;  4HUX A;  3SCM A;  4EN3 C;  4Z77 A;  1FZJ A;  5H94 A;  3L3D A;  1N59 A;  5HHO A;  4MS8 A;  2UWE A;  3BEW A;  4NQC A;  2VLJ A;  2BVQ A;  2OL3 H;  2X4U A;  1YN6 A;  1A1M A;  1S7V A;  1T1Z A;  3DX6 A;  1ZS8 A;  1XZ0 A;  1SYS A;  1ZHN A;  3CVH A;  4IHO A;  3E6H A;  4L8D A;  4PG9 A;  3X14 A;  3KLA A;  3KPL A;  3DX7 A;  2HJK A;  1AGE A;  5F9J A;  3AU1 A;  4HX1 A;  2FO4 A;  4PRN A;  1QQD A;  5F1N A;  1G6R H;  1UXS A;  3SKM A;  5J6G A;  5D7I A;  3VFW A;  4PJF A;  1T7Y A;  4JQX A;  2V2W A;  4PRH A;  2X4P A;  3GSW A;  1EEY A;  1OSZ A;  3LKN A;  5F1I A;  3CCH A;  2J8U A;  2P5E A;  4NHU E;  3VWJ A;  3RL1 A;  3BO8 A;  3RZC A;  3RWG A;  4NNX A;  1K8D A;  3MRR A;  3GMM A;  2AK4 A;  2X4Q A;  1ZAG A;  2GTW A;  2H6P A;  1I7T A;  3KWW A;  4XXC A;  4QRR A;  2JCC A;  3ECB A;  5D7J C;  4PV9 A;  1ED3 A;  1T22 A;  3RWE A;  4O2E A;  2FZ3 A;  3VXR A;  1MI5 A;  2HN7 A;  4WU5 A;  4Z76 A;  2BCK A;  1JGE A;  3BP7 A;  2C7U A;  3MV8 A;  5FKP A;  4WW2 C;  4U6X A;  4HKJ A;  4G9F A;  3WLB A;  4CVX A;  2X4N A;  3VFM A;  2YPL A;  5SWS A;  2DYP A;  3HLA A;  1A9B A;  4PJG A;  5HGH A;  3W39 A;  3ARF A;  4IIQ C;  1JHT A;  3BP4 A;  3W0W A;  3C8K A;  2RFX A;  5HGA A;  1JE6 A;  3SPV A;  4QRP A;  1BD2 A;  1XR9 A;  1EFX A;  4NO2 A;  2H26 A;  3X12 A;  3M17 A;  1UQS A;  3MRE A;  4JFE A;  4X6E A;  3HE7 A;  3O3D A;  4K7F A;  1HYR C;  1DUY A;  1IM9 A;  1KJM A;  1UXW A;  2AXG A;  4WJ5 A;  5ENW A;  5IB1 A;  5J6H A;  2E7L E;  5IRO A;  2HLA A;  1VAD A;  3D2U A;  4IRJ A;  3VWK A;  3TF7 A;  1B3J A;  4FFE X;  3TBT A;  3BEV A;  1I1F A;  5B39 A;  4PRB A;  1K5N A;  1S7X A;  4MVB A;  4FTV A;  5DDH A;  2HJL A;  1LEG A;  4PJB A;  1T0M A;  1AGB A;  4PJC A;  4PJA A;  4Y16 A;  1LEK A;  4NT6 A;  3TPU E;  4X6C A;  3TO4 A;  4G9D A;  1HOC A;  3HAE A;  1T1X A;  4PJ5 A;  3IXA A;  4L8S C;  5D2N A;  1C16 A;  2BVO A;  4U1H A;  4U1M A;  4PGB A;  4ZAK A;  5HHM A;  3GMP A;  4ZUT A;  3GSQ A;  2VLR A;  1YPZ A;  2X4R A;  3O4L A;  3FQX A;  4LHU A;  4LNR A;  3M1B A;  1S7R A;  3RWD A;  3L3H A;  3LKP A;  3PWN A;  5D5M A;  1W0W A;  2GJ6 A;  3T1F A;  3REW A;  3QFJ A;  1FZO A;  3RWJ A;  5C0J A;  1AO7 A;  3G08 A;  3L3I A;  2P5W A;  1RK0 A;  3QUL A;  4S0U C;  1OGA A;  3BUY A;  3RTQ A;  1ZHK A;  1S8D A;  3D25 A;  1YN7 A;  3IT8 D;  1AGD A;  1S7Q A;  1E28 A;  3QUX A;  1DUZ A;  3P4O A;  3B3I A;  4HWZ A;  3TBV A;  5E00 A;  3SDD A;  4L3E A;  4MNQ A;  3DXA A;  4U1J A;  4U1S A;  4L3C A;  5C0D A;  3SKO A;  1ZHB A;  3TIE A;  1DDH A;  3BWA A;  3BZF A;  2BSR A;  3I6G A;  3KPP A;  4U1K A;  3ROO A;  3RGV C;  5BJT A;  4L8B A;  5L2K A;  5GSR A;  5EFI A;  1DE4 A;  4E5X A;  4APQ A;  3VXU A;  1FZK A;  4N0U A;  1WBX A;  3QUY A;  5MEP A; 
#chains in the Genus database with same CATH topology
 1QRN A;  2PYE A;  4MNG A;  3CDG A;  1T20 A;  3P9L A;  4PGD A;  3O8X A;  1WBZ A;  3QFD A;  3L9R A;  5BRZ A;  3MR9 A;  5SWZ A;  4JO8 A;  3GMQ A;  3AM8 A;  3GSR A;  3BGM A;  4PRA A;  3O3A A;  3MRC A;  1FZM A;  1I7R A;  4QRS A;  1I4F A;  3VXN A;  2ESV A;  1AGF A;  4Z78 A;  5EOT A;  4I48 A;  3MRB A;  4NO5 A;  3TVM A;  1S9Y A;  3SDA A;  3H9H A;  3RWC A;  4HUV A;  4N0C A;  4NSK A;  4ONO A;  5FDW A;  1FFP A;  3QUK A;  3LKO A;  4NO3 A;  2AXF A;  1HHG A;  1S7W A;  3O9W A;  4PJE A;  1HHH A;  3LN5 A;  4D0B A;  3BZE A;  3OV6 A;  3PWL A;  3FT4 A;  4WWK C;  3MRD A;  3P9M A;  4EUP A;  4ZUS A;  3VCL A;  3MGO A;  2XPG A;  4PJ7 A;  3TJH A;  4QRU A;  3P4M A;  2NYK A;  3GIV A;  3PWV A;  4O2F A;  4UQ2 A;  3UBX A;  3VH8 A;  4F7P A;  5IB5 A;  1YDP A;  3CC5 A;  3MRO A;  4MQ7 A;  3TFK A;  3JTT A;  3VFU A;  2D31 A;  2GUO A;  2X4S A;  4Y2D A;  4NQD A;  5C0B A;  2FYY A;  3O3E A;  1I7U A;  2MHA A;  4NO0 A;  3GSN H;  2Q7Y A;  3UTT A;  4NQV A;  4L4T A;  2VAB A;  2ZSV A;  4G59 A;  4U6Y A;  2CLZ A;  1VGK A;  5IB4 A;  4G42 A;  3SDX A;  4X6D A;  4PJI A;  4JQV A;  4LCW A;  4Y4H A;  1JFM A;  5D2L A;  3MGT A;  4JFQ A;  5C07 A;  3KPS A;  4HV8 A;  3QQ3 A;  1B0G A;  5HYJ A;  2CKB H;  3VXS A;  3VFT A;  3X11 A;  4MX7 A;  3MRN A;  4D0C A;  3ARG A;  4QOK A;  1AGC A;  3FT3 A;  3FTG A;  1N3N A;  3D3V A;  4WDI A;  3DX8 A;  5F7D A;  3GMN A;  1QSE A;  1HHI A;  4NQE A;  3UPR A;  1I1A A;  4PRD A;  1KBG H;  3QUZ A;  1NAN H;  3TO2 A;  5HGD A;  2CII A;  5JHD A;  3LKR A;  4PG2 A;  1W72 A;  3GMR A;  5MEO A;  3X13 A;  3L3J A;  3P73 A;  4L9L C;  1CE6 A;  5INC A;  1S9W A;  5C09 A;  1E27 A;  1T80 A;  3PQY A;  4F7C A;  3FQN A;  3TN0 A;  3RUG A;  3MRP A;  3E2H A;  2CLV A;  4ZUV A;  4L4V A;  2GT9 A;  4PJX A;  1WBY A;  2FWO A;  3B6S A;  4GKN A;  3VXM A;  4I4W A;  3PAB A;  3TBS A;  5C0E A;  5GSV A;  1QO3 A;  1NEZ A;  5L2J A;  1BQH A;  3ARE A;  3QDG A;  3C9N A;  1QSF A;  3KXF A;  3I6K A;  3LKQ A;  1P7Q A;  3L3K A;  3QQ4 A;  2A83 A;  4JRY A;  2VE6 A;  3E6F A;  3V5D A;  5E9D A;  3FFC A;  4PP8 C;  1P1Z A;  4ZFZ A;  5C08 A;  3KPO A;  1JPF A;  4G8G A;  3WL9 A;  4F7M A;  1RK1 A;  4Y4K A;  2F74 A;  1T7W A;  4PRP A;  3TZV C;  1CG9 A;  2AV1 A;  4WUU A;  4GUP A;  1ZT1 A;  3RWF A;  3ARD A;  3MV7 A;  1RJZ A;  2ZOL A;  5MER A;  3VFS A;  1QR1 A;  2AKR A;  1AKJ A;  4UQ3 A;  2ZOK A;  3FQT A;  3QDM A;  1HHK A;  2GIT A;  1S9X A;  4JFP A;  1T7Z A;  5IVX A;  3MA7 A;  4CW1 A;  2OI9 A;  2ZSW A;  4K71 B;  5C0A A;  1ZVS A;  1ZT4 A;  3MRH A;  5IM7 A;  4PDC E;  3U0P A;  3GSX A;  3KPR A;  5HHN A;  4D0D A;  1A6Z A;  4PJH A;  1R3H A;  1RJY A;  1T0N A;  1N5A A;  3D39 A;  1JGD A;  4JFO A;  4PRI A;  3QZW A;  4PR5 A;  5DEF A;  3P4N A;  3FQU A;  3KYO A;  4MXQ A;  4IRS A;  3TA3 A;  1OGT A;  1TVH A;  1ZHL A;  3VJ6 A;  3VRI A;  4F7T A;  3T8X A;  1FFO A;  3UTQ A;  3GML A;  3HPJ A;  3JTC A;  5SWQ A;  3KPQ A;  4MJI A;  3HUJ A;  5ACZ A;  4QRQ A;  3FOL A;  1A1O A;  4G43 A;  3OX8 A;  2FIK A;  4JFD A;  3LKS A;  3BXN A;  5B38 A;  3FT2 A;  4X6F A;  3RWI A;  5MEN A;  3GJF A;  1I1Y A;  3WS6 A;  3NFN A;  4O2C A;  4EI5 A;  1CD1 A;  1KJ2 H;  1QLF A;  2BSS A;  3I0T A;  1KPV A;  1P4L A;  4MJ6 A;  5D9S A;  3SDC A;  5BXF A;  3MRF A;  2PO6 A;  5AD0 A;  3DTX A;  3GSV A;  4LCY A;  3ES6 A;  4G8I A;  1KPR A;  3FQR A;  5EU6 A;  3VXP A;  3MRI A;  3P77 A;  1OF2 A;  5HHQ A;  4HS3 A;  5C0F A;  1KTL A;  1MHE A;  1A1N A;  4NQX A;  5EO0 A;  3QI9 A;  2X4O A;  3BH8 A;  4N0F A;  5IEH A;  3DBX A;  1KJ3 H;  2CIK A;  4LCC C;  3I6L D;  2BVP A;  3E3Q A;  3BW9 A;  5E8P A;  4ZUU A;  3TBY A;  3VXO A;  1S7S A;  3MRM A;  5IB2 A;  4GKS A;  3FON A;  1XR8 A;  3FQW A;  1LP9 A;  1FG2 A;  1ONQ A;  2YEZ A;  3QDJ A;  1KCG C;  5IB3 A;  1LK2 A;  1JUF A;  3ARB A;  4ELM A;  5IEK A;  3PWP A;  3PWU A;  3PWJ A;  1BZ9 A;  3GSO A;  3H9S A;  1LQV A;  3GSU A;  3ERY A;  5EUO A;  1JPG A;  4E0R A;  5MEQ A;  5EU4 A;  4U1I A;  1INQ A;  1XH3 A;  2F54 A;  1Q94 A;  3VFV A;  5EU5 A;  1FO0 H;  1JF1 A;  2VLL A;  3BH9 A;  3HE6 A;  5D7L A;  4PRE A;  5E6I C;  3MYJ A;  1T7V A;  3BHB A;  4MJ5 A;  3D18 A;  4U1N A;  4PGE A;  3ILQ C;  1M6O A;  5BS0 A;  4WU7 A;  3OXS A;  3WS3 A;  1N2R A;  1MHC A;  1W0V A;  3DMM A;  1S7T A;  4U1L A;  3WUW A;  4CVZ A;  3RWH A;  1TMC A;  5HHP A;  3VRJ A;  1X7Q A;  2GTZ A;  3VFR A;  2NW3 A;  1EXU A;  5E8O A;  1T1Y A;  1GZQ A;  2X4T A;  4L29 A;  2CLR A;  4JRX A;  5EO1 A;  4F7E A;  1HSB A;  1A9E A;  1Z5L A;  2BNQ A;  3FRU A;  4V3D B;  3VFN A;  1B0R A;  1HHJ A;  3MRK A;  3TID A;  3KPM A;  1QVO A;  3QEQ A;  1LD9 A;  1PQZ A;  3JVG A;  4PJ8 A;  4PJD A;  3RL2 A;  5C0I A;  1ZSD A;  3CH1 A;  2X70 A;  3SJV A;  3VFO A;  3V5K A;  3BVN A;  3MRG A;  2BNR A;  1GZP A;  1L8J A;  1MWA H;  2XFX A;  3S6C A;  3JTS A;  2YPK A;  3V5H A;  1FFN A;  3KYN A;  3VFP A;  3H7B A;  3ILP A;  1M05 A;  4HUW A;  1G7P A;  2GAZ A;  4WO4 A;  3UTS A;  1EEZ A;  1LDP H;  1T7X A;  2AV7 A;  4PGC A;  5IND A;  1QEW A;  2F53 A;  3LN4 A;  1SYV A;  4L8C A;  5HGB A;  1VAC A;  3MRL A;  3KPN A;  3FOM A;  4N5E A;  1KJV A;  4NNY A;  4HUU A;  5C0C A;  4PV8 A;  1TVB A;  3LV3 A;  1T21 A;  2WY3 A;  3GMO A;  4PJ9 A;  1BII A;  4ZUW A;  2NX5 A;  5C0G A;  2VLK A;  3L3G A;  4QRT A;  1T1W A;  1U58 A;  1NAM H;  3MRQ A;  3MV9 A;  3MRJ A;  3HCV A;  4V3E B;  5E8N A;  1KPU A;  1HSA A;  3HG1 A;  1IM3 A;  4Y4F A;  5FA3 A;  2V2X A;  5FA4 A;  1G7Q A;  2IA1 A;  5ISZ A;  5EU3 A;  4JFF A;  3OXR A;  5DEG A;  5J1A A;  3ROL A;  2VAA A;  3CZF A;  3TBW A;  5C9J A;  3CPL A;  2BST A;  3O3B A;  4G59 C;  4N8V A;  1ZT7 A;  1S7U A;  4HUX A;  3SCM A;  4EN3 C;  4Z77 A;  1FZJ A;  5H94 A;  3L3D A;  1N59 A;  5HHO A;  4MS8 A;  2UWE A;  3BEW A;  4NQC A;  2VLJ A;  2BVQ A;  2OL3 H;  2X4U A;  1YN6 A;  1A1M A;  1S7V A;  1T1Z A;  3DX6 A;  1ZS8 A;  1XZ0 A;  1SYS A;  1ZHN A;  3CVH A;  4IHO A;  3E6H A;  4L8D A;  4PG9 A;  3X14 A;  3KLA A;  3KPL A;  3DX7 A;  2HJK A;  1AGE A;  5F9J A;  3AU1 A;  4HX1 A;  2FO4 A;  4PRN A;  1QQD A;  5F1N A;  1G6R H;  1UXS A;  3SKM A;  5J6G A;  5D7I A;  3VFW A;  4PJF A;  1T7Y A;  4JQX A;  2V2W A;  4PRH A;  2X4P A;  3GSW A;  1EEY A;  1OSZ A;  3LKN A;  5F1I A;  3CCH A;  2J8U A;  2P5E A;  4NHU E;  3VWJ A;  3RL1 A;  3BO8 A;  3RZC A;  3RWG A;  4NNX A;  1K8D A;  3MRR A;  3GMM A;  2AK4 A;  2X4Q A;  1ZAG A;  2GTW A;  2H6P A;  1I7T A;  3KWW A;  4XXC A;  4QRR A;  2JCC A;  3ECB A;  5D7J C;  4PV9 A;  1ED3 A;  1T22 A;  3RWE A;  4O2E A;  2FZ3 A;  3VXR A;  1MI5 A;  2HN7 A;  4WU5 A;  4Z76 A;  2BCK A;  1JGE A;  3BP7 A;  2C7U A;  3MV8 A;  5FKP A;  4WW2 C;  4U6X A;  4HKJ A;  4G9F A;  3WLB A;  4CVX A;  2X4N A;  3VFM A;  2YPL A;  5SWS A;  2DYP A;  3HLA A;  1A9B A;  4PJG A;  5HGH A;  3W39 A;  3ARF A;  4IIQ C;  1JHT A;  3BP4 A;  3W0W A;  3C8K A;  2RFX A;  5HGA A;  1JE6 A;  3SPV A;  4QRP A;  1BD2 A;  1XR9 A;  1EFX A;  4NO2 A;  2H26 A;  3X12 A;  3M17 A;  1UQS A;  3MRE A;  4JFE A;  4X6E A;  3HE7 A;  3O3D A;  4K7F A;  1HYR C;  1DUY A;  1IM9 A;  1KJM A;  1UXW A;  2AXG A;  4WJ5 A;  5ENW A;  5IB1 A;  5J6H A;  2E7L E;  5IRO A;  2HLA A;  1VAD A;  3D2U A;  4IRJ A;  3VWK A;  3TF7 A;  1B3J A;  4FFE X;  3TBT A;  3BEV A;  1I1F A;  5B39 A;  4PRB A;  1K5N A;  1S7X A;  4MVB A;  4FTV A;  5DDH A;  2HJL A;  4BKW A;  1LEG A;  4PJB A;  1T0M A;  1AGB A;  4PJC A;  4PJA A;  4Y16 A;  1LEK A;  4NT6 A;  3TPU E;  4X6C A;  3TO4 A;  4G9D A;  1HOC A;  3HAE A;  1T1X A;  4PJ5 A;  3IXA A;  4L8S C;  5D2N A;  1C16 A;  2BVO A;  4U1H A;  4U1M A;  4PGB A;  4ZAK A;  5HHM A;  3GMP A;  4ZUT A;  3GSQ A;  2VLR A;  1YPZ A;  2X4R A;  2O5N A;  3O4L A;  3FQX A;  4LHU A;  4LNR A;  3M1B A;  1S7R A;  3RWD A;  3L3H A;  3LKP A;  3PWN A;  5D5M A;  1W0W A;  2GJ6 A;  3T1F A;  3REW A;  3QFJ A;  1FZO A;  3RWJ A;  5C0J A;  1AO7 A;  3G08 A;  3L3I A;  2P5W A;  1RK0 A;  3QUL A;  4S0U C;  1OGA A;  3BUY A;  3RTQ A;  1ZHK A;  1S8D A;  3D25 A;  1YN7 A;  3IT8 D;  1AGD A;  1S7Q A;  1E28 A;  3QUX A;  1DUZ A;  3P4O A;  3B3I A;  4HWZ A;  3TBV A;  5E00 A;  3SDD A;  4L3E A;  4MNQ A;  3DXA A;  4U1J A;  4U1S A;  4L3C A;  5C0D A;  3SKO A;  1ZHB A;  3TIE A;  1DDH A;  3BWA A;  3BZF A;  2BSR A;  3I6G A;  3KPP A;  4U1K A;  3ROO A;  3RGV C;  5BJT A;  4L8B A;  5L2K A;  5GSR A;  5EFI A;  1DE4 A;  4E5X A;  4APQ A;  3VXU A;  1FZK A;  4N0U A;  1WBX A;  3QUY A;  5MEP A; 
#chains in the Genus database with same CATH homology
 1QRN A;  2PYE A;  4MNG A;  3CDG A;  1T20 A;  3P9L A;  4PGD A;  3O8X A;  1WBZ A;  3QFD A;  3L9R A;  5BRZ A;  3MR9 A;  5SWZ A;  3GMQ A;  3AM8 A;  3GSR A;  3BGM A;  4PRA A;  3O3A A;  3MRC A;  1FZM A;  1I7R A;  4QRS A;  1I4F A;  3VXN A;  2ESV A;  1AGF A;  4Z78 A;  5EOT A;  4I48 A;  3MRB A;  4NO5 A;  3TVM A;  1S9Y A;  3SDA A;  3H9H A;  3RWC A;  4HUV A;  4N0C A;  4NSK A;  4ONO A;  5FDW A;  1FFP A;  3QUK A;  3LKO A;  4NO3 A;  2AXF A;  1HHG A;  1S7W A;  3O9W A;  4PJE A;  1HHH A;  3LN5 A;  4D0B A;  3BZE A;  3OV6 A;  3PWL A;  3FT4 A;  4WWK C;  3MRD A;  3P9M A;  4EUP A;  4ZUS A;  3VCL A;  3MGO A;  2XPG A;  4PJ7 A;  3TJH A;  4QRU A;  3P4M A;  3GIV A;  3PWV A;  4O2F A;  4UQ2 A;  3UBX A;  3VH8 A;  4F7P A;  5IB5 A;  1YDP A;  3CC5 A;  3MRO A;  4MQ7 A;  3TFK A;  3JTT A;  3VFU A;  2D31 A;  2GUO A;  2X4S A;  4Y2D A;  4NQD A;  5C0B A;  2FYY A;  3O3E A;  1I7U A;  2MHA A;  4NO0 A;  3GSN H;  2Q7Y A;  3UTT A;  4NQV A;  4L4T A;  2VAB A;  2ZSV A;  4G59 A;  4U6Y A;  2CLZ A;  1VGK A;  5IB4 A;  4G42 A;  3SDX A;  4X6D A;  4PJI A;  4JQV A;  4LCW A;  4Y4H A;  1JFM A;  5D2L A;  3MGT A;  4JFQ A;  5C07 A;  3KPS A;  4HV8 A;  3QQ3 A;  1B0G A;  5HYJ A;  2CKB H;  3VXS A;  3VFT A;  3X11 A;  4MX7 A;  3MRN A;  4D0C A;  3ARG A;  4QOK A;  1AGC A;  3FT3 A;  3FTG A;  1N3N A;  3D3V A;  4WDI A;  3DX8 A;  5F7D A;  3GMN A;  1QSE A;  1HHI A;  4NQE A;  3UPR A;  1I1A A;  4PRD A;  1KBG H;  3QUZ A;  1NAN H;  3TO2 A;  5HGD A;  2CII A;  5JHD A;  3LKR A;  4PG2 A;  1W72 A;  3GMR A;  5MEO A;  3X13 A;  3L3J A;  3P73 A;  4L9L C;  1CE6 A;  5INC A;  1S9W A;  5C09 A;  1E27 A;  1T80 A;  3PQY A;  4F7C A;  3FQN A;  3TN0 A;  3RUG A;  3MRP A;  3E2H A;  2CLV A;  4ZUV A;  4L4V A;  2GT9 A;  4PJX A;  1WBY A;  2FWO A;  3B6S A;  4GKN A;  3VXM A;  4I4W A;  3PAB A;  3TBS A;  5C0E A;  5GSV A;  1QO3 A;  1NEZ A;  5L2J A;  1BQH A;  3ARE A;  3QDG A;  3C9N A;  1QSF A;  3KXF A;  3I6K A;  3LKQ A;  1P7Q A;  3L3K A;  3QQ4 A;  2A83 A;  4JRY A;  2VE6 A;  3E6F A;  3V5D A;  5E9D A;  3FFC A;  4PP8 C;  1P1Z A;  4ZFZ A;  5C08 A;  3KPO A;  1JPF A;  4G8G A;  3WL9 A;  4F7M A;  1RK1 A;  4Y4K A;  2F74 A;  1T7W A;  4PRP A;  3TZV C;  1CG9 A;  2AV1 A;  4WUU A;  4GUP A;  1ZT1 A;  3RWF A;  3ARD A;  3MV7 A;  1RJZ A;  2ZOL A;  5MER A;  3VFS A;  1QR1 A;  2AKR A;  1AKJ A;  4UQ3 A;  2ZOK A;  3FQT A;  3QDM A;  1HHK A;  2GIT A;  1S9X A;  4JFP A;  1T7Z A;  5IVX A;  3MA7 A;  4CW1 A;  2OI9 A;  2ZSW A;  4K71 B;  5C0A A;  1ZVS A;  1ZT4 A;  3MRH A;  5IM7 A;  4PDC E;  3U0P A;  3GSX A;  3KPR A;  5HHN A;  4D0D A;  1A6Z A;  4PJH A;  1R3H A;  1RJY A;  1T0N A;  1N5A A;  3D39 A;  1JGD A;  4JFO A;  4PRI A;  3QZW A;  4PR5 A;  5DEF A;  3P4N A;  3FQU A;  3KYO A;  4MXQ A;  4IRS A;  3TA3 A;  1OGT A;  1TVH A;  1ZHL A;  3VJ6 A;  3VRI A;  4F7T A;  3T8X A;  1FFO A;  3UTQ A;  3GML A;  3HPJ A;  3JTC A;  5SWQ A;  3KPQ A;  4MJI A;  3HUJ A;  5ACZ A;  4QRQ A;  3FOL A;  1A1O A;  4G43 A;  3OX8 A;  2FIK A;  4JFD A;  3LKS A;  3BXN A;  5B38 A;  3FT2 A;  4X6F A;  3RWI A;  5MEN A;  3GJF A;  1I1Y A;  3WS6 A;  3NFN A;  4O2C A;  4EI5 A;  1CD1 A;  1KJ2 H;  1QLF A;  2BSS A;  4MJ6 A;  1KPV A;  1P4L A;  5D9S A;  3SDC A;  5BXF A;  3MRF A;  2PO6 A;  5AD0 A;  3DTX A;  3GSV A;  4LCY A;  3ES6 A;  4G8I A;  1KPR A;  3FQR A;  5EU6 A;  3VXP A;  3MRI A;  3P77 A;  1OF2 A;  5HHQ A;  4HS3 A;  5C0F A;  1KTL A;  1MHE A;  1A1N A;  4NQX A;  5EO0 A;  3QI9 A;  2X4O A;  3BH8 A;  4N0F A;  5IEH A;  3DBX A;  1KJ3 H;  2CIK A;  4LCC C;  3I6L D;  2BVP A;  3E3Q A;  3BW9 A;  5E8P A;  4ZUU A;  3TBY A;  3VXO A;  1S7S A;  3MRM A;  5IB2 A;  4GKS A;  3FON A;  1XR8 A;  3FQW A;  1LP9 A;  1FG2 A;  1ONQ A;  2YEZ A;  3QDJ A;  1KCG C;  5IB3 A;  1LK2 A;  1JUF A;  3ARB A;  4ELM A;  5IEK A;  3PWP A;  3PWU A;  3PWJ A;  1BZ9 A;  3GSO A;  3H9S A;  1LQV A;  3GSU A;  3ERY A;  5EUO A;  1JPG A;  4E0R A;  5MEQ A;  5EU4 A;  4U1I A;  1INQ A;  1XH3 A;  2F54 A;  1Q94 A;  3VFV A;  5EU5 A;  1FO0 H;  1JF1 A;  2VLL A;  3BH9 A;  3HE6 A;  5D7L A;  4PRE A;  5E6I C;  3MYJ A;  1T7V A;  3BHB A;  4MJ5 A;  3D18 A;  4U1N A;  4PGE A;  3ILQ C;  1M6O A;  5BS0 A;  4WU7 A;  3OXS A;  3WS3 A;  1N2R A;  1MHC A;  1W0V A;  3DMM A;  1S7T A;  4U1L A;  3WUW A;  4CVZ A;  3RWH A;  1TMC A;  5HHP A;  3VRJ A;  1X7Q A;  2GTZ A;  3VFR A;  2NW3 A;  1EXU A;  5E8O A;  1T1Y A;  1GZQ A;  2X4T A;  4L29 A;  2CLR A;  4JRX A;  5EO1 A;  4F7E A;  1HSB A;  1A9E A;  1Z5L A;  2BNQ A;  3FRU A;  4V3D B;  3VFN A;  1B0R A;  1HHJ A;  3MRK A;  3TID A;  3KPM A;  1QVO A;  3QEQ A;  1LD9 A;  1PQZ A;  3JVG A;  4PJ8 A;  4PJD A;  3RL2 A;  5C0I A;  1ZSD A;  3CH1 A;  2X70 A;  3SJV A;  3VFO A;  3V5K A;  3BVN A;  3MRG A;  2BNR A;  1GZP A;  1L8J A;  1MWA H;  2XFX A;  3S6C A;  3JTS A;  2YPK A;  3V5H A;  1FFN A;  3KYN A;  3VFP A;  3H7B A;  3ILP A;  1M05 A;  4HUW A;  1G7P A;  2GAZ A;  4WO4 A;  3UTS A;  1EEZ A;  1LDP H;  1T7X A;  2AV7 A;  4PGC A;  5IND A;  1QEW A;  2F53 A;  3LN4 A;  1SYV A;  4L8C A;  5HGB A;  1VAC A;  3MRL A;  3KPN A;  3FOM A;  4N5E A;  1KJV A;  4NNY A;  4HUU A;  5C0C A;  4PV8 A;  1TVB A;  3LV3 A;  1T21 A;  2WY3 A;  3GMO A;  4PJ9 A;  1BII A;  4ZUW A;  2NX5 A;  5C0G A;  2VLK A;  3L3G A;  4QRT A;  1T1W A;  1U58 A;  1NAM H;  3MRQ A;  3MV9 A;  3MRJ A;  3HCV A;  4V3E B;  5E8N A;  1KPU A;  1HSA A;  3HG1 A;  1IM3 A;  4Y4F A;  5FA3 A;  2V2X A;  5FA4 A;  1G7Q A;  5ISZ A;  5EU3 A;  4JFF A;  3OXR A;  5DEG A;  5J1A A;  3ROL A;  2VAA A;  3CZF A;  3TBW A;  5C9J A;  3CPL A;  2BST A;  3O3B A;  4N8V A;  1ZT7 A;  1S7U A;  4HUX A;  3SCM A;  4EN3 C;  4Z77 A;  1FZJ A;  5H94 A;  3L3D A;  1N59 A;  5HHO A;  4MS8 A;  2UWE A;  3BEW A;  4NQC A;  2VLJ A;  2BVQ A;  2OL3 H;  2X4U A;  1YN6 A;  1A1M A;  1S7V A;  1T1Z A;  3DX6 A;  1ZS8 A;  1XZ0 A;  1SYS A;  1ZHN A;  3CVH A;  4IHO A;  3E6H A;  4L8D A;  4PG9 A;  3X14 A;  3KLA A;  3KPL A;  3DX7 A;  2HJK A;  1AGE A;  5F9J A;  3AU1 A;  4HX1 A;  2FO4 A;  4PRN A;  1QQD A;  5F1N A;  1G6R H;  1UXS A;  3SKM A;  5J6G A;  5D7I A;  3VFW A;  4PJF A;  1T7Y A;  4JQX A;  2V2W A;  4PRH A;  2X4P A;  3GSW A;  1EEY A;  1OSZ A;  3LKN A;  5F1I A;  3CCH A;  2J8U A;  2P5E A;  4NHU E;  3VWJ A;  3RL1 A;  3BO8 A;  3RZC A;  3RWG A;  4NNX A;  1K8D A;  3MRR A;  3GMM A;  2AK4 A;  2X4Q A;  1ZAG A;  2GTW A;  2H6P A;  1I7T A;  3KWW A;  4XXC A;  4QRR A;  2JCC A;  3ECB A;  5D7J C;  4PV9 A;  1ED3 A;  1T22 A;  3RWE A;  4O2E A;  2FZ3 A;  3VXR A;  1MI5 A;  2HN7 A;  4WU5 A;  4Z76 A;  2BCK A;  1JGE A;  3BP7 A;  2C7U A;  3MV8 A;  5FKP A;  4WW2 C;  4U6X A;  4HKJ A;  4G9F A;  3WLB A;  4CVX A;  2X4N A;  3VFM A;  2YPL A;  5SWS A;  2DYP A;  3HLA A;  1A9B A;  4PJG A;  5HGH A;  3W39 A;  3ARF A;  4IIQ C;  1JHT A;  3BP4 A;  3W0W A;  3C8K A;  2RFX A;  5HGA A;  1JE6 A;  3SPV A;  4QRP A;  1BD2 A;  1XR9 A;  1EFX A;  4NO2 A;  2H26 A;  3X12 A;  3M17 A;  1UQS A;  3MRE A;  4JFE A;  4X6E A;  3HE7 A;  3O3D A;  4K7F A;  1HYR C;  1DUY A;  1IM9 A;  1KJM A;  1UXW A;  2AXG A;  4WJ5 A;  5ENW A;  5IB1 A;  5J6H A;  2E7L E;  5IRO A;  2HLA A;  1VAD A;  3D2U A;  4IRJ A;  3VWK A;  3TF7 A;  1B3J A;  4FFE X;  3TBT A;  3BEV A;  1I1F A;  5B39 A;  4PRB A;  1K5N A;  1S7X A;  4MVB A;  4FTV A;  5DDH A;  2HJL A;  1LEG A;  4PJB A;  1T0M A;  1AGB A;  4PJC A;  4PJA A;  4Y16 A;  1LEK A;  4NT6 A;  3TPU E;  4X6C A;  3TO4 A;  4G9D A;  1HOC A;  3HAE A;  1T1X A;  4PJ5 A;  3IXA A;  4L8S C;  5D2N A;  1C16 A;  2BVO A;  4U1H A;  4U1M A;  4PGB A;  4ZAK A;  5HHM A;  3GMP A;  4ZUT A;  3GSQ A;  2VLR A;  1YPZ A;  2X4R A;  3O4L A;  3FQX A;  4LHU A;  4LNR A;  3M1B A;  1S7R A;  3RWD A;  3L3H A;  3LKP A;  3PWN A;  5D5M A;  1W0W A;  2GJ6 A;  3T1F A;  3REW A;  3QFJ A;  1FZO A;  3RWJ A;  5C0J A;  1AO7 A;  3G08 A;  3L3I A;  2P5W A;  1RK0 A;  3QUL A;  4S0U C;  1OGA A;  3BUY A;  3RTQ A;  1ZHK A;  1S8D A;  3D25 A;  1YN7 A;  3IT8 D;  1AGD A;  1S7Q A;  1E28 A;  3QUX A;  1DUZ A;  3P4O A;  3B3I A;  4HWZ A;  3TBV A;  5E00 A;  3SDD A;  4L3E A;  4MNQ A;  3DXA A;  4U1J A;  4U1S A;  4L3C A;  5C0D A;  3SKO A;  1ZHB A;  3TIE A;  1DDH A;  3BWA A;  3BZF A;  2BSR A;  3I6G A;  3KPP A;  4U1K A;  3ROO A;  3RGV C;  5BJT A;  4L8B A;  5L2K A;  5GSR A;  5EFI A;  1DE4 A;  4E5X A;  4APQ A;  3VXU A;  1FZK A;  4N0U A;  1WBX A;  3QUY A;  5MEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...