2E7LE

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
GPHSMRYFETAVSRRGLGEPRYISVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 51
structure length 175
sequence length 175
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2e7lE00
3ARFA 4MX7A 4ELMA 3RWHA 1TVBA 4EUPA 4PG2A 2VLKA 3TIEA 3GMQA 3GMOA 4PJGA 4Y2DA 4HUXA 4NQVA 4JQXA 1ZSDA 3HAEA 1S7XA 1S9XA 3HE6A 5IB1A 4PREA 1B0GA 3FQXA 4L8SC 4G59A 4N0UA 5EU6A 1Q94A 3C9NA 3PWLA 4CVZA 1INQA 2E7LE 1CE6A 3ROLA 3LKQA 1YN7A 4HX1A 2C7UA 4I48A 3QDJA 3VFSA 3VXRA 3UBXA 3MV9A 3O3EA 5IB4A 1QQDA 1DUZA 3OV6A 3SDCA 1S9WA 2FO4A 3MRBA 5HHOA 3ROOA 3RTQA 4JFPA 3MRLA 1EXUA 5HGDA 5SWZA 3KPOA 3BUYA 3O4LA 1BQHA 4UQ3A 4WJ5A 4WU5A 5L2JA 3MRGA 3V5DA 1I1FA 4PJAA 5L2KA 3HLAA 3E2HA 1BZ9A 3BZEA 3GSQA 3TBYA 5BRZA 3HCVA 1ZHBA 3E6HA 4U1JA 1K8DA 2ZOKA 1HHKA 3KYNA 5HGAA 2X4OA 2Q7YA 1ED3A 1ZAGA 3MRMA 1N59A 4Y4FA 4L8CA 3CVHA 3VWKA 1OSZA 4Y4HA 4MJ6A 5IB5A 5GSVA 1UXSA 3WUWA 1JGDA 5E8OA 2GUOA 4CW1A 3VWJA 1S7RA 1CG9A 1C16A 3NFNA 3RL2A 4MJIA 5E8NA 4JFEA 3M17A 3TBTA 2JCCA 3TZVC 4HUUA 2GT9A 3GMNA 3KWWA 5C0BA 3QDGA 3U0PA 1XZ0A 4O2EA 3FQNA 3LN4A 3RWJA 1QRNA 2X4RA 3KLAA 3QUXA 4WW2C 4U1MA 4HS3A 4JFQA 1ZT7A 2D31A 5C0CA 5C0IA 2HJLA 3V5KA 1E28A 4PV8A 5E9DA 2F54A 3BW9A 1BD2A 3M1BA 3PWPA 1ZS8A 3QFDA 3HG1A 1JHTA 3MA7A 3OXRA 3TVMA 3FT3A 3GSUA 4WU7A 4F7PA 3KXFA 3TO2A 1UQSA 3VFVA 2CIIA 3MRKA 5DDHA 2BVOA 4L3CA 5D5MA 4N0FA 4NO2A 5MERA 3CH1A 3O8XA 4LCCC 4NT6A 4NO3A 3T1FA 1NANH 2ZOLA 3RWEA 3BXNA 3P4NA 3P73A 4NQXA 3QDMA 4PRDA 4LCYA 3KPRA 3TPUE 1A1OA 2X4TA 3MR9A 3P9LA 4PRIA 3VXNA 1P4LA 3KPSA 5EU3A 5J1AA 2P5EA 1T1XA 3BH8A 4MS8A 3B3IA 3ES6A 5FKPA 4PJ9A 3V5HA 3H9HA 5MEPA 3P4MA 5F9JA 2YPLA 3IXAA 3L3JA 4PRHA 2HLAA 3QULA 4HKJA 4PRAA 2BNQA 1S9YA 2CIKA 3GMMA 3T8XA 3FQUA 4Y4KA 1VGKA 1B3JA 3QQ3A 3D18A 5EU4A 2HN7A 4X6CA 2NW3A 2BNRA 5JHDA 1NEZA 5HGBA 3BVNA 4PGBA 4PRPA 4F7MA 1AGEA 3MROA 2YEZA 1FZMA 2AXFA 1L8JA 4NQCA 5HHQA 1S7VA 1LP9A 2XFXA 4NSKA 1LD9A 3QEQA 4U1LA 4MQ7A 4LNRA 1G6RH 1HHHA 2CLZA 1KBGH 3MRPA 4PJ5A 3KYOA 4PRNA 5EO1A 1KPVA 5D2NA 2GTWA 5FDWA 3LV3A 5IEKA 2V2XA 1QEWA 4PJEA 2GJ6A 3BHBA 3WLBA 4FTVA 3GSOA 5MENA 3BGMA 4PV9A 4WDIA 4Z76A 3JTCA 4O2FA 4U1IA 3GSXA 3X13A 3JVGA 5F7DA 3MRJA 1FFPA 1JF1A 4PG9A 3FFCA 2P5WA 4Z77A 5C09A 4L29A 1T7XA 3DX7A 1KTLA 3SDDA 3SKOA 3X12A 4X6DA 1T0MA 1EEYA 3REWA 3VFOA 5C0DA 4MVBA 3KPNA 4PJIA 3TBWA 1IM3A 2FWOA 5SWSA 3RWGA 2X4NA 1N3NA 4S0UC 5SWQA 5F1NA 3ARGA 5C0EA 3QQ4A 3IT8D 4CVXA 1S7QA 1X7QA 3W0WA 1P7QA 2YPKA 5C0AA 4ZUVA 3PQYA 1T0NA 4F7EA 3CDGA 5B39A 1WBYA 1AGBA 1W72A 3QFJA 4WO4A 1JUFA 4IHOA 1VADA 4HWZA 5F1IA 3MREA 1MHEA 1NAMH 1T7YA 3GMLA 3VRJA 3D3VA 4K71B 3RWIA 3RWDA 5IEHA 1AKJA 3VRIA 3RGVC 1JGEA 1ZVSA 3KPQA 4U1NA 4V3DB 3P4OA 5IVXA 1HHGA 1WBZA 2AV1A 3FTGA 5DEFA 4PJXA 1LEKA 5EFIA 4G9DA 4JFDA 1A9EA 1I7TA 1S7UA 4ONOA 2A83A 1A9BA 4L8BA 3MRNA 2HJKA 5FA4A 3MRFA 4JFOA 5C0JA 4N0CA 1QLFA 3VXOA 3O3AA 5E8PA 4L3EA 3X14A 2CKBH 3MV7A 3UTSA 2X70A 4QRRA 3CC5A 3AU1A 1A1MA 4NO0A 3D2UA 4K7FA 3TIDA 4JRXA 3MRCA 4QRSA 4APQA 4EN3C 1LK2A 3DBXA 5ENWA 3HPJA 3DX6A 4PJ8A 3CCHA 4QRPA 1QSFA 1OGTA 1RJZA 1ZHLA 3RWFA 1KJVA 3P77A 5EO0A 3MV8A 3AREA 4HUVA 2H26A 4ZFZA 3OXSA 3FT4A 3OX8A 3FRUA 4QRUA 4PJHA 1KPUA 1OF2A 3BWAA 1I4FA 1N5AA 1CD1A 1S7WA 1R3HA 2H6PA 5HGHA 1QO3A 2BVQA 3C8KA 3HUJA 3SJVA 3ECBA 1LQVA 3UTTA 3AM8A 3TBSA 3L3KA 1LDPH 3MRDA 3VXUA 4D0BA 5IB3A 3QI9A 3PWVA 1JE6A 1I1YA 2VE6A 3BP4A 1XR9A 4N8VA 1PQZA 3SPVA 5HHPA 4WUUA 5IB2A 5ACZA 4GKNA 5HYJA 5ISZA 1T22A 3O3BA 1K5NA 1EFXA 2ZSWA 3L3IA 3RUGA 3VH8A 2BSSA 3MRHA 4X6FA 1YN6A 5C07A 1KJ2H 4G42A 2BSTA 2X4SA 3SCMA 2AKRA 3LKOA 2X4PA 4U1KA 1T1YA 3BZFA 3E6FA 3VFMA 1I7UA 1A6ZA 4PJFA 2VLLA 4F7CA 1P1ZA 3TO4A 4U1SA 5D7JC 1AO7A 1AGFA 4QRQA 5E6IC 3FQRA 4D0CA 2CLVA 3VXPA 1S7SA 2OI9A 5E00A 5MEQA 3UPRA 5IM7A 5DEGA 4E5XA 2F53A 3BEVA 2CLRA 1BIIA 1A1NA 2ZSVA 4PP8C 3TJHA 3KPPA 3TBVA 3DX8A 4PJCA 1WBXA 2DYPA 4U1HA 5MEOA 1G7PA 1LEGA 3PABA 1HOCA 3FQTA 3L9RA 1FZOA 3L3DA 4PDCE 1I7RA 2X4UA 4Z78A 1SYSA 3I6KA 3MRQA 3MYJA 1T1ZA 4PJDA 3KPLA 5EU5A 3CPLA 2GITA 4D0DA 2UWEA 3WS6A 3FQWA 5BS0A 3GSVA 1SYVA 1KJ3H 1T7ZA 2VABA 3G08A 3ILQC 3LKSA 3WL9A 3CZFA 2NX5A 3JTSA 4F7TA 4QRTA 3I6LD 4O2CA 1ZT1A 4X6EA 1YDPA 3O9WA 3JTTA 4ZUWA 3O3DA 1FG2A 4G8GA 3ERYA 3W39A 2BSRA 3GMPA 3LN5A 2BVPA 4U6XA 3WS3A 3QUKA 1GZPA 2GTZA 4MNGA 1MHCA 4PJBA 4L9LC 3PWUA 3BP7A 4GUPA 4PGDA 2X4QA 3MRRA 2PYEA 3ARBA 5D7IA 1HHIA 2AXGA 4I4WA 4N5EA 2FIKA 3RWCA 5GSRA 4L8DA 4U6YA 1T7VA 3B6SA 5J6HA 4LHUA 3D39A 4WWKC 1QSEA 4JFFA 4PRBA 4PGEA 3GIVA 1XH3A 4EI5A 1FFOA 5IROA 5INCA 1HSAA 5HHNA 3SDXA 3DTXA 1U58A 2MHAA 3FOMA 3GJFA 3KPMA 3PWNA 5J6GA 2ESVA 4E0RA 3E3QA 4HUWA 4NQDA 5FA3A 3GSWA 4ZUSA 1OGAA 1RK0A 2FYYA 3GSRA 3QUYA 3ILPA 3MRIA 4G9FA 3MGTA 4IIQC 1T7WA 4IRSA 3LKNA 4NNYA 5D2LA 1W0VA 4NO5A 3VFRA 2XPGA 3RL1A 1E27A 4NHUE 3BH9A 1DE4A 1FZKA 4HV8A 3DXAA 3D25A 2VLRA 5C0FA 5C08A 3BO8A 4ZUUA 1JPFA 4ZUTA 4UQ2A 2GAZA 3SDAA 3TN0A 4XXCA 2OL3H 1T80A 4QOKA 1JPGA 4NNXA 1ONQA 1MWAH 5AD0A 2FZ3A 3TFKA 3SKMA 1S7TA 5EOTA 1T1WA 3PWJA 3QUZA 4Y16A 2BCKA 1MI5A 3VJ6A 3VFNA 1T21A 4PR5A 2PO6A 3VXMA 1EEZA 2AK4A 5D9SA 2VLJA 3TA3A 2J8UA 2AV7A 3GSNH 5HHMA 1S8DA 3L3HA 3FONA 3DMMA 1TMCA 3VFPA 1KJMA 1ZT4A 1DUYA 1GZQA 4LCWA 1W0WA 3VFWA 1N2RA 5B38A 5BJTA 1KCGC 4GKSA 3VCLA 1HSBA 4JRYA 1VACA 1HYRC 3VFUA 4NQEA 4PGCA 1B0RA 1UXWA 1IM9A 1ZHNA 3HE7A 3MGOA 3S6CA 3RZCA 1QR1A 1RJYA 4L4VA 1ZHKA 1TVHA 3LKRA 1KPRA 1QVOA 3BEWA 4MNQA 1XR8A 1YPZA 5H94A 3UTQA 1AGDA 5EUOA 1AGCA 4JQVA 4MXQA 1FO0H 1G7QA 3FT2A 4G43A 1M6OA 4G8IA 1FFNA 3FOLA 4L4TA 2V2WA 5BXFA 3ARDA 4V3EB 2F74A 4PJ7A 1DDHA 3QZWA 3I6GA 5C9JA 4MJ5A 4IRJA 2WY3A 3TF7A 3VFTA 3GMRA 3VXSA 3X11A 4ZAKA 1HHJA 1Z5LA 2RFXA 3LKPA 3P9MA 5D7LA 1M05A 5INDA 1JFMA 2VAAA 3H7BA 1FZJA 1I1AA 3L3GA 1T20A 5C0GA 3H9SA 1RK1A 4FFEX
chains in the Genus database with same CATH superfamily
3ARFA 4MX7A 4ELMA 3RWHA 1TVBA 4EUPA 4PG2A 2VLKA 3TIEA 3GMQA 3GMOA 4PJGA 4Y2DA 4HUXA 4NQVA 4G59C 4JQXA 1ZSDA 3HAEA 1S7XA 1S9XA 3HE6A 5IB1A 4PREA 1B0GA 3FQXA 4L8SC 4G59A 4N0UA 5EU6A 1Q94A 3C9NA 3PWLA 4CVZA 1INQA 2E7LE 1CE6A 3ROLA 3LKQA 1YN7A 4HX1A 2C7UA 4I48A 3QDJA 3VFSA 3VXRA 3UBXA 3MV9A 3O3EA 5IB4A 1QQDA 1DUZA 3OV6A 3SDCA 1S9WA 2FO4A 3MRBA 5HHOA 3ROOA 3RTQA 4JFPA 3MRLA 1EXUA 5HGDA 5SWZA 3KPOA 3BUYA 3O4LA 1BQHA 4UQ3A 4WJ5A 4WU5A 5L2JA 3MRGA 3V5DA 1I1FA 4PJAA 5L2KA 3HLAA 3E2HA 1BZ9A 3BZEA 3GSQA 3TBYA 5BRZA 3HCVA 1ZHBA 3E6HA 4U1JA 1K8DA 2ZOKA 1HHKA 3KYNA 5HGAA 2X4OA 2Q7YA 1ED3A 1ZAGA 3MRMA 1N59A 4Y4FA 4L8CA 3CVHA 3VWKA 1OSZA 4Y4HA 4MJ6A 5IB5A 5GSVA 1UXSA 3WUWA 1JGDA 5E8OA 2GUOA 4CW1A 3VWJA 1S7RA 1CG9A 1C16A 3NFNA 3RL2A 4MJIA 5E8NA 4JFEA 3M17A 3TBTA 2JCCA 3TZVC 4HUUA 2GT9A 3GMNA 3KWWA 5C0BA 3QDGA 3U0PA 1XZ0A 4O2EA 3FQNA 3LN4A 3RWJA 1QRNA 2X4RA 3KLAA 3QUXA 4WW2C 4U1MA 4HS3A 4JFQA 1ZT7A 2D31A 5C0CA 5C0IA 2HJLA 3V5KA 1E28A 4PV8A 5E9DA 2F54A 3BW9A 1BD2A 3M1BA 3PWPA 1ZS8A 3QFDA 3HG1A 1JHTA 3MA7A 3OXRA 3TVMA 3FT3A 3GSUA 4WU7A 4F7PA 3KXFA 3TO2A 1UQSA 3VFVA 2CIIA 3MRKA 5DDHA 2BVOA 4L3CA 5D5MA 4N0FA 4NO2A 5MERA 2O5NA 3CH1A 3O8XA 4LCCC 4NT6A 4NO3A 3T1FA 1NANH 2ZOLA 3RWEA 3BXNA 3P4NA 3P73A 4NQXA 3QDMA 4PRDA 4LCYA 3KPRA 3TPUE 1A1OA 2X4TA 3MR9A 3P9LA 4PRIA 3VXNA 1P4LA 3KPSA 5EU3A 5J1AA 2P5EA 1T1XA 3BH8A 4MS8A 3B3IA 3ES6A 5FKPA 4PJ9A 3V5HA 3H9HA 5MEPA 3P4MA 5F9JA 2YPLA 3IXAA 3L3JA 4PRHA 2HLAA 3QULA 4HKJA 4PRAA 2BNQA 1S9YA 2CIKA 3GMMA 3T8XA 3FQUA 4Y4KA 1VGKA 1B3JA 3QQ3A 3D18A 5EU4A 2HN7A 4X6CA 2NW3A 2BNRA 5JHDA 1NEZA 5HGBA 3BVNA 4PGBA 4PRPA 4F7MA 1AGEA 3MROA 2YEZA 1FZMA 2AXFA 1L8JA 4NQCA 5HHQA 1S7VA 1LP9A 2XFXA 4NSKA 1LD9A 3QEQA 4U1LA 4MQ7A 4LNRA 1G6RH 1HHHA 2CLZA 1KBGH 3MRPA 4PJ5A 3KYOA 4PRNA 5EO1A 1KPVA 5D2NA 2GTWA 5FDWA 3LV3A 5IEKA 2V2XA 4JO8A 1QEWA 4PJEA 2GJ6A 3BHBA 3WLBA 4FTVA 3GSOA 5MENA 3BGMA 4PV9A 4WDIA 4Z76A 3JTCA 4O2FA 4U1IA 3GSXA 3X13A 3JVGA 5F7DA 3MRJA 1FFPA 1JF1A 4PG9A 3FFCA 2P5WA 4Z77A 5C09A 4L29A 1T7XA 3DX7A 1KTLA 3SDDA 3SKOA 3X12A 4X6DA 1T0MA 1EEYA 3REWA 3VFOA 5C0DA 4MVBA 3KPNA 4PJIA 3TBWA 1IM3A 2FWOA 5SWSA 3RWGA 2X4NA 1N3NA 4S0UC 5SWQA 5F1NA 3ARGA 5C0EA 3QQ4A 3IT8D 4CVXA 1S7QA 1X7QA 3W0WA 1P7QA 2YPKA 5C0AA 4ZUVA 3PQYA 1T0NA 4F7EA 3CDGA 5B39A 1WBYA 1AGBA 1W72A 3QFJA 4WO4A 1JUFA 4IHOA 1VADA 4HWZA 5F1IA 3MREA 1MHEA 1NAMH 1T7YA 3GMLA 3VRJA 3D3VA 4K71B 3RWIA 3RWDA 5IEHA 1AKJA 3VRIA 3RGVC 1JGEA 1ZVSA 3KPQA 4U1NA 4V3DB 3P4OA 5IVXA 1HHGA 1WBZA 2AV1A 3FTGA 5DEFA 4PJXA 1LEKA 5EFIA 4G9DA 4JFDA 1A9EA 1I7TA 1S7UA 4ONOA 2A83A 1A9BA 4L8BA 3MRNA 2HJKA 5FA4A 3MRFA 4JFOA 5C0JA 4N0CA 1QLFA 3VXOA 3O3AA 5E8PA 4L3EA 3X14A 2CKBH 3MV7A 3UTSA 2X70A 4QRRA 3CC5A 3AU1A 1A1MA 4NO0A 3D2UA 4K7FA 3TIDA 4JRXA 3MRCA 4QRSA 4APQA 4EN3C 1LK2A 3DBXA 5ENWA 3HPJA 3DX6A 4PJ8A 3CCHA 4QRPA 1QSFA 1OGTA 1RJZA 1ZHLA 3RWFA 1KJVA 3P77A 5EO0A 3MV8A 3AREA 4HUVA 2H26A 4ZFZA 3OXSA 3FT4A 3OX8A 3FRUA 4QRUA 4PJHA 1KPUA 1OF2A 3BWAA 1I4FA 1N5AA 1CD1A 1S7WA 1R3HA 2H6PA 5HGHA 1QO3A 2BVQA 3C8KA 3HUJA 3SJVA 3ECBA 1LQVA 3UTTA 3AM8A 3TBSA 3L3KA 1LDPH 3MRDA 3VXUA 4D0BA 5IB3A 3QI9A 3PWVA 1JE6A 1I1YA 2VE6A 3BP4A 1XR9A 4N8VA 1PQZA 3SPVA 5HHPA 4WUUA 5IB2A 5ACZA 4GKNA 5HYJA 5ISZA 1T22A 3O3BA 1K5NA 1EFXA 2ZSWA 3L3IA 3RUGA 3VH8A 2BSSA 3MRHA 4X6FA 1YN6A 5C07A 1KJ2H 4G42A 2BSTA 2X4SA 3SCMA 2AKRA 3LKOA 2X4PA 4U1KA 1T1YA 3BZFA 3E6FA 3VFMA 1I7UA 1A6ZA 4PJFA 2VLLA 4F7CA 1P1ZA 3TO4A 4U1SA 5D7JC 1AO7A 1AGFA 4QRQA 5E6IC 3FQRA 4D0CA 2CLVA 3VXPA 1S7SA 2OI9A 5E00A 5MEQA 3UPRA 5IM7A 5DEGA 4E5XA 2F53A 3BEVA 2CLRA 1BIIA 1A1NA 2ZSVA 4PP8C 3TJHA 3KPPA 3TBVA 3DX8A 4PJCA 1WBXA 2DYPA 4U1HA 5MEOA 1G7PA 1LEGA 3PABA 1HOCA 3FQTA 3L9RA 1FZOA 3L3DA 4PDCE 1I7RA 2X4UA 4Z78A 1SYSA 3I6KA 3MRQA 3MYJA 1T1ZA 4PJDA 3KPLA 5EU5A 3CPLA 2GITA 4D0DA 2UWEA 3WS6A 3FQWA 5BS0A 3GSVA 1SYVA 1KJ3H 3I0TA 1T7ZA 2VABA 3G08A 3ILQC 3LKSA 3WL9A 3CZFA 2NX5A 3JTSA 4F7TA 4QRTA 3I6LD 4O2CA 1ZT1A 4X6EA 1YDPA 3O9WA 3JTTA 4ZUWA 3O3DA 1FG2A 4G8GA 3ERYA 3W39A 2BSRA 3GMPA 3LN5A 2BVPA 4U6XA 3WS3A 3QUKA 1GZPA 2GTZA 4MNGA 1MHCA 4PJBA 4L9LC 3PWUA 3BP7A 4GUPA 4PGDA 2X4QA 3MRRA 2PYEA 3ARBA 5D7IA 1HHIA 2AXGA 4I4WA 4N5EA 2FIKA 3RWCA 5GSRA 4L8DA 4U6YA 1T7VA 3B6SA 5J6HA 4LHUA 3D39A 4WWKC 1QSEA 4JFFA 4PRBA 4PGEA 3GIVA 1XH3A 4EI5A 1FFOA 5IROA 5INCA 1HSAA 5HHNA 3SDXA 3DTXA 1U58A 2MHAA 3FOMA 3GJFA 3KPMA 3PWNA 5J6GA 2ESVA 4E0RA 3E3QA 4HUWA 4NQDA 5FA3A 3GSWA 4ZUSA 1OGAA 1RK0A 2FYYA 3GSRA 3QUYA 3ILPA 3MRIA 4G9FA 3MGTA 4IIQC 1T7WA 4IRSA 3LKNA 4NNYA 5D2LA 1W0VA 4NO5A 3VFRA 2XPGA 3RL1A 1E27A 4NHUE 3BH9A 1DE4A 1FZKA 4HV8A 3DXAA 3D25A 2VLRA 5C0FA 5C08A 3BO8A 4ZUUA 1JPFA 4ZUTA 4UQ2A 2GAZA 3SDAA 3TN0A 4XXCA 2OL3H 1T80A 4QOKA 1JPGA 4NNXA 1ONQA 1MWAH 5AD0A 2FZ3A 3TFKA 3SKMA 1S7TA 5EOTA 1T1WA 3PWJA 3QUZA 4Y16A 2BCKA 1MI5A 3VJ6A 3VFNA 1T21A 4PR5A 2PO6A 3VXMA 1EEZA 2AK4A 5D9SA 2VLJA 3TA3A 2J8UA 2AV7A 3GSNH 5HHMA 1S8DA 3L3HA 3FONA 3DMMA 1TMCA 3VFPA 1KJMA 1ZT4A 1DUYA 1GZQA 4LCWA 1W0WA 3VFWA 1N2RA 5B38A 5BJTA 1KCGC 4GKSA 3VCLA 1HSBA 4JRYA 1VACA 1HYRC 3VFUA 4NQEA 4PGCA 1B0RA 1UXWA 1IM9A 1ZHNA 3HE7A 3MGOA 3S6CA 2NYKA 3RZCA 1RJYA 1QR1A 4L4VA 1ZHKA 1TVHA 3LKRA 1KPRA 1QVOA 3BEWA 4MNQA 1XR8A 1YPZA 5H94A 3UTQA 1AGDA 5EUOA 1AGCA 4JQVA 4MXQA 1FO0H 1G7QA 3FT2A 4G43A 1M6OA 4G8IA 1FFNA 3FOLA 4L4TA 2V2WA 5BXFA 3ARDA 4V3EB 2F74A 4PJ7A 1DDHA 2IA1A 3QZWA 3I6GA 5C9JA 4MJ5A 4IRJA 2WY3A 3TF7A 3VFTA 4BKWA 3GMRA 3VXSA 3X11A 4ZAKA 1HHJA 1Z5LA 2RFXA 3LKPA 3P9MA 5D7LA 1M05A 5INDA 1JFMA 2VAAA 3H7BA 1FZJA 1I1AA 3L3GA 1T20A 5C0GA 3H9SA 1RK1A 4FFEX
chains in the Genus database with same CATH topology
3ARFA 4MX7A 4ELMA 3RWHA 1TVBA 4EUPA 4PG2A 2VLKA 3TIEA 3GMQA 3GMOA 4PJGA 4Y2DA 4HUXA 4NQVA 4JQXA 1ZSDA 3HAEA 1S7XA 1S9XA 3HE6A 5IB1A 4PREA 1B0GA 3FQXA 4L8SC 4G59A 4N0UA 5EU6A 1Q94A 3C9NA 3PWLA 4CVZA 1INQA 2E7LE 1CE6A 3ROLA 3LKQA 1YN7A 4HX1A 2C7UA 4I48A 3QDJA 3VFSA 3VXRA 3UBXA 3MV9A 3O3EA 5IB4A 1QQDA 1DUZA 3OV6A 3SDCA 1S9WA 2FO4A 3MRBA 5HHOA 3ROOA 3RTQA 4JFPA 3MRLA 1EXUA 5HGDA 5SWZA 3KPOA 3BUYA 3O4LA 1BQHA 4UQ3A 4WJ5A 4WU5A 5L2JA 3MRGA 3V5DA 1I1FA 4PJAA 5L2KA 3HLAA 3E2HA 1BZ9A 3BZEA 3GSQA 3TBYA 5BRZA 3HCVA 1ZHBA 3E6HA 4U1JA 1K8DA 2ZOKA 1HHKA 3KYNA 5HGAA 2X4OA 2Q7YA 1ED3A 1ZAGA 3MRMA 1N59A 4Y4FA 4L8CA 3CVHA 3VWKA 1OSZA 4Y4HA 4MJ6A 5IB5A 5GSVA 1UXSA 3WUWA 1JGDA 5E8OA 2GUOA 4CW1A 3VWJA 1S7RA 1CG9A 1C16A 3NFNA 3RL2A 4MJIA 5E8NA 4JFEA 3M17A 3TBTA 2JCCA 3TZVC 4HUUA 2GT9A 3GMNA 3KWWA 5C0BA 3QDGA 3U0PA 1XZ0A 4O2EA 3FQNA 3LN4A 3RWJA 1QRNA 2X4RA 3KLAA 3QUXA 4WW2C 4U1MA 4HS3A 4JFQA 1ZT7A 2D31A 5C0CA 5C0IA 2HJLA 3V5KA 1E28A 4PV8A 5E9DA 2F54A 3BW9A 1BD2A 3M1BA 3PWPA 1ZS8A 3QFDA 3HG1A 1JHTA 3MA7A 3OXRA 3TVMA 3FT3A 3GSUA 4WU7A 4F7PA 3KXFA 3TO2A 1UQSA 3VFVA 2CIIA 3MRKA 5DDHA 2BVOA 4L3CA 5D5MA 4N0FA 4NO2A 5MERA 3CH1A 3O8XA 4LCCC 4NT6A 4NO3A 3T1FA 1NANH 2ZOLA 3RWEA 3BXNA 3P4NA 3P73A 4NQXA 3QDMA 4PRDA 4LCYA 3KPRA 3TPUE 1A1OA 2X4TA 3MR9A 3P9LA 4PRIA 3VXNA 1P4LA 3KPSA 5EU3A 5J1AA 2P5EA 1T1XA 3BH8A 4MS8A 3B3IA 3ES6A 5FKPA 4PJ9A 3V5HA 3H9HA 5MEPA 3P4MA 5F9JA 2YPLA 3IXAA 3L3JA 4PRHA 2HLAA 3QULA 4HKJA 4PRAA 2BNQA 1S9YA 2CIKA 3GMMA 3T8XA 3FQUA 4Y4KA 1VGKA 1B3JA 3QQ3A 3D18A 5EU4A 2HN7A 4X6CA 2NW3A 2BNRA 5JHDA 1NEZA 5HGBA 3BVNA 4PGBA 4PRPA 4F7MA 1AGEA 3MROA 2YEZA 1FZMA 2AXFA 1L8JA 4NQCA 5HHQA 1S7VA 1LP9A 2XFXA 4NSKA 1LD9A 3QEQA 4U1LA 4MQ7A 4LNRA 1G6RH 1HHHA 2CLZA 1KBGH 3MRPA 4PJ5A 3KYOA 4PRNA 5EO1A 1KPVA 5D2NA 2GTWA 5FDWA 3LV3A 5IEKA 2V2XA 1QEWA 4PJEA 2GJ6A 3BHBA 3WLBA 4FTVA 3GSOA 5MENA 3BGMA 4PV9A 4WDIA 4Z76A 3JTCA 4O2FA 4U1IA 3GSXA 3X13A 3JVGA 5F7DA 3MRJA 1FFPA 1JF1A 4PG9A 3FFCA 2P5WA 4Z77A 5C09A 4L29A 1T7XA 3DX7A 1KTLA 3SDDA 3SKOA 3X12A 4X6DA 1T0MA 1EEYA 3REWA 3VFOA 5C0DA 4MVBA 3KPNA 4PJIA 3TBWA 1IM3A 2FWOA 5SWSA 3RWGA 2X4NA 1N3NA 4S0UC 5SWQA 5F1NA 3ARGA 5C0EA 3QQ4A 3IT8D 4CVXA 1S7QA 1X7QA 3W0WA 1P7QA 2YPKA 5C0AA 4ZUVA 3PQYA 1T0NA 4F7EA 3CDGA 5B39A 1WBYA 1AGBA 1W72A 3QFJA 4WO4A 1JUFA 4IHOA 1VADA 4HWZA 5F1IA 3MREA 1MHEA 1NAMH 1T7YA 3GMLA 3VRJA 3D3VA 4K71B 3RWIA 3RWDA 5IEHA 1AKJA 3VRIA 3RGVC 1JGEA 1ZVSA 3KPQA 4U1NA 4V3DB 3P4OA 5IVXA 1HHGA 1WBZA 2AV1A 3FTGA 5DEFA 4PJXA 1LEKA 5EFIA 4G9DA 4JFDA 1A9EA 1I7TA 1S7UA 4ONOA 2A83A 1A9BA 4L8BA 3MRNA 2HJKA 5FA4A 3MRFA 4JFOA 5C0JA 4N0CA 1QLFA 3VXOA 3O3AA 5E8PA 4L3EA 3X14A 2CKBH 3MV7A 3UTSA 2X70A 4QRRA 3CC5A 3AU1A 1A1MA 4NO0A 3D2UA 4K7FA 3TIDA 4JRXA 3MRCA 4QRSA 4APQA 4EN3C 1LK2A 3DBXA 5ENWA 3HPJA 3DX6A 4PJ8A 3CCHA 4QRPA 1QSFA 1OGTA 1RJZA 1ZHLA 3RWFA 1KJVA 3P77A 5EO0A 3MV8A 3AREA 4HUVA 2H26A 4ZFZA 3OXSA 3FT4A 3OX8A 3FRUA 4QRUA 4PJHA 1KPUA 1OF2A 3BWAA 1I4FA 1N5AA 1CD1A 1S7WA 1R3HA 2H6PA 5HGHA 1QO3A 2BVQA 3C8KA 3HUJA 3SJVA 3ECBA 1LQVA 3UTTA 3AM8A 3TBSA 3L3KA 1LDPH 3MRDA 3VXUA 4D0BA 5IB3A 3QI9A 3PWVA 1JE6A 1I1YA 2VE6A 3BP4A 1XR9A 4N8VA 1PQZA 3SPVA 5HHPA 4WUUA 5IB2A 5ACZA 4GKNA 5HYJA 5ISZA 1T22A 3O3BA 1K5NA 1EFXA 2ZSWA 3L3IA 3RUGA 3VH8A 2BSSA 3MRHA 4X6FA 1YN6A 5C07A 1KJ2H 4G42A 2BSTA 2X4SA 3SCMA 2AKRA 3LKOA 2X4PA 4U1KA 1T1YA 3BZFA 3E6FA 3VFMA 1I7UA 1A6ZA 4PJFA 2VLLA 4F7CA 1P1ZA 3TO4A 4U1SA 5D7JC 1AO7A 1AGFA 4QRQA 5E6IC 3FQRA 4D0CA 2CLVA 3VXPA 1S7SA 2OI9A 5E00A 5MEQA 3UPRA 5IM7A 5DEGA 4E5XA 2F53A 3BEVA 2CLRA 1BIIA 1A1NA 2ZSVA 4PP8C 3TJHA 3KPPA 3TBVA 3DX8A 4PJCA 1WBXA 2DYPA 4U1HA 5MEOA 1G7PA 1LEGA 3PABA 1HOCA 3FQTA 3L9RA 1FZOA 3L3DA 4PDCE 1I7RA 2X4UA 4Z78A 1SYSA 3I6KA 3MRQA 3MYJA 1T1ZA 4PJDA 3KPLA 5EU5A 3CPLA 2GITA 4D0DA 2UWEA 3WS6A 3FQWA 5BS0A 3GSVA 1SYVA 1KJ3H 1T7ZA 2VABA 3G08A 3ILQC 3LKSA 3WL9A 3CZFA 2NX5A 3JTSA 4F7TA 4QRTA 3I6LD 4O2CA 1ZT1A 4X6EA 1YDPA 3O9WA 3JTTA 4ZUWA 3O3DA 1FG2A 4G8GA 3ERYA 3W39A 2BSRA 3GMPA 3LN5A 2BVPA 4U6XA 3WS3A 3QUKA 1GZPA 2GTZA 4MNGA 1MHCA 4PJBA 4L9LC 3PWUA 3BP7A 4GUPA 4PGDA 2X4QA 3MRRA 2PYEA 3ARBA 5D7IA 1HHIA 2AXGA 4I4WA 4N5EA 2FIKA 3RWCA 5GSRA 4L8DA 4U6YA 1T7VA 3B6SA 5J6HA 4LHUA 3D39A 4WWKC 1QSEA 4JFFA 4PRBA 4PGEA 3GIVA 1XH3A 4EI5A 1FFOA 5IROA 5INCA 1HSAA 5HHNA 3SDXA 3DTXA 1U58A 2MHAA 3FOMA 3GJFA 3KPMA 3PWNA 5J6GA 2ESVA 4E0RA 3E3QA 4HUWA 4NQDA 5FA3A 3GSWA 4ZUSA 1OGAA 1RK0A 2FYYA 3GSRA 3QUYA 3ILPA 3MRIA 4G9FA 3MGTA 4IIQC 1T7WA 4IRSA 3LKNA 4NNYA 5D2LA 1W0VA 4NO5A 3VFRA 2XPGA 3RL1A 1E27A 4NHUE 3BH9A 1DE4A 1FZKA 4HV8A 3DXAA 3D25A 2VLRA 5C0FA 5C08A 3BO8A 4ZUUA 1JPFA 4ZUTA 4UQ2A 2GAZA 3SDAA 3TN0A 4XXCA 2OL3H 1T80A 4QOKA 1JPGA 4NNXA 1ONQA 1MWAH 5AD0A 2FZ3A 3TFKA 3SKMA 1S7TA 5EOTA 1T1WA 3PWJA 3QUZA 4Y16A 2BCKA 1MI5A 3VJ6A 3VFNA 1T21A 4PR5A 2PO6A 3VXMA 1EEZA 2AK4A 5D9SA 2VLJA 3TA3A 2J8UA 2AV7A 3GSNH 5HHMA 1S8DA 3L3HA 3FONA 3DMMA 1TMCA 3VFPA 1KJMA 1ZT4A 1DUYA 1GZQA 4LCWA 1W0WA 3VFWA 1N2RA 5B38A 5BJTA 1KCGC 4GKSA 3VCLA 1HSBA 4JRYA 1VACA 1HYRC 3VFUA 4NQEA 4PGCA 1B0RA 1UXWA 1IM9A 1ZHNA 3HE7A 3MGOA 3S6CA 3RZCA 1QR1A 1RJYA 4L4VA 1ZHKA 1TVHA 3LKRA 1KPRA 1QVOA 3BEWA 4MNQA 1XR8A 1YPZA 5H94A 3UTQA 1AGDA 5EUOA 1AGCA 4JQVA 4MXQA 1FO0H 1G7QA 3FT2A 4G43A 1M6OA 4G8IA 1FFNA 3FOLA 4L4TA 2V2WA 5BXFA 3ARDA 4V3EB 2F74A 4PJ7A 1DDHA 3QZWA 3I6GA 5C9JA 4MJ5A 4IRJA 2WY3A 3TF7A 3VFTA 3GMRA 3VXSA 3X11A 4ZAKA 1HHJA 1Z5LA 2RFXA 3LKPA 3P9MA 5D7LA 1M05A 5INDA 1JFMA 2VAAA 3H7BA 1FZJA 1I1AA 3L3GA 1T20A 5C0GA 3H9SA 1RK1A 4FFEX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ARF A;  4MX7 A;  4ELM A;  3RWH A;  1TVB A;  4EUP A;  4PG2 A;  2VLK A;  3TIE A;  3GMQ A;  3GMO A;  4PJG A;  4Y2D A;  4HUX A;  4NQV A;  4JQX A;  1ZSD A;  3HAE A;  1S7X A;  1S9X A;  3HE6 A;  5IB1 A;  4PRE A;  1B0G A;  3FQX A;  4L8S C;  4G59 A;  4N0U A;  5EU6 A;  1Q94 A;  3C9N A;  3PWL A;  4CVZ A;  1INQ A;  2E7L E;  1CE6 A;  3ROL A;  3LKQ A;  1YN7 A;  4HX1 A;  2C7U A;  4I48 A;  3QDJ A;  3VFS A;  3VXR A;  3UBX A;  3MV9 A;  3O3E A;  5IB4 A;  1QQD A;  1DUZ A;  3OV6 A;  3SDC A;  1S9W A;  2FO4 A;  3MRB A;  5HHO A;  3ROO A;  3RTQ A;  4JFP A;  3MRL A;  1EXU A;  5HGD A;  5SWZ A;  3KPO A;  3BUY A;  3O4L A;  1BQH A;  4UQ3 A;  4WJ5 A;  4WU5 A;  5L2J A;  3MRG A;  3V5D A;  1I1F A;  4PJA A;  5L2K A;  3HLA A;  3E2H A;  1BZ9 A;  3BZE A;  3GSQ A;  3TBY A;  5BRZ A;  3HCV A;  1ZHB A;  3E6H A;  4U1J A;  1K8D A;  2ZOK A;  1HHK A;  3KYN A;  5HGA A;  2X4O A;  2Q7Y A;  1ED3 A;  1ZAG A;  3MRM A;  1N59 A;  4Y4F A;  4L8C A;  3CVH A;  3VWK A;  1OSZ A;  4Y4H A;  4MJ6 A;  5IB5 A;  5GSV A;  1UXS A;  3WUW A;  1JGD A;  5E8O A;  2GUO A;  4CW1 A;  3VWJ A;  1S7R A;  1CG9 A;  1C16 A;  3NFN A;  3RL2 A;  4MJI A;  5E8N A;  4JFE A;  3M17 A;  3TBT A;  2JCC A;  3TZV C;  4HUU A;  2GT9 A;  3GMN A;  3KWW A;  5C0B A;  3QDG A;  3U0P A;  1XZ0 A;  4O2E A;  3FQN A;  3LN4 A;  3RWJ A;  1QRN A;  2X4R A;  3KLA A;  3QUX A;  4WW2 C;  4U1M A;  4HS3 A;  4JFQ A;  1ZT7 A;  2D31 A;  5C0C A;  5C0I A;  2HJL A;  3V5K A;  1E28 A;  4PV8 A;  5E9D A;  2F54 A;  3BW9 A;  1BD2 A;  3M1B A;  3PWP A;  1ZS8 A;  3QFD A;  3HG1 A;  1JHT A;  3MA7 A;  3OXR A;  3TVM A;  3FT3 A;  3GSU A;  4WU7 A;  4F7P A;  3KXF A;  3TO2 A;  1UQS A;  3VFV A;  2CII A;  3MRK A;  5DDH A;  2BVO A;  4L3C A;  5D5M A;  4N0F A;  4NO2 A;  5MER A;  3CH1 A;  3O8X A;  4LCC C;  4NT6 A;  4NO3 A;  3T1F A;  1NAN H;  2ZOL A;  3RWE A;  3BXN A;  3P4N A;  3P73 A;  4NQX A;  3QDM A;  4PRD A;  4LCY A;  3KPR A;  3TPU E;  1A1O A;  2X4T A;  3MR9 A;  3P9L A;  4PRI A;  3VXN A;  1P4L A;  3KPS A;  5EU3 A;  5J1A A;  2P5E A;  1T1X A;  3BH8 A;  4MS8 A;  3B3I A;  3ES6 A;  5FKP A;  4PJ9 A;  3V5H A;  3H9H A;  5MEP A;  3P4M A;  5F9J A;  2YPL A;  3IXA A;  3L3J A;  4PRH A;  2HLA A;  3QUL A;  4HKJ A;  4PRA A;  2BNQ A;  1S9Y A;  2CIK A;  3GMM A;  3T8X A;  3FQU A;  4Y4K A;  1VGK A;  1B3J A;  3QQ3 A;  3D18 A;  5EU4 A;  2HN7 A;  4X6C A;  2NW3 A;  2BNR A;  5JHD A;  1NEZ A;  5HGB A;  3BVN A;  4PGB A;  4PRP A;  4F7M A;  1AGE A;  3MRO A;  2YEZ A;  1FZM A;  2AXF A;  1L8J A;  4NQC A;  5HHQ A;  1S7V A;  1LP9 A;  2XFX A;  4NSK A;  1LD9 A;  3QEQ A;  4U1L A;  4MQ7 A;  4LNR A;  1G6R H;  1HHH A;  2CLZ A;  1KBG H;  3MRP A;  4PJ5 A;  3KYO A;  4PRN A;  5EO1 A;  1KPV A;  5D2N A;  2GTW A;  5FDW A;  3LV3 A;  5IEK A;  2V2X A;  1QEW A;  4PJE A;  2GJ6 A;  3BHB A;  3WLB A;  4FTV A;  3GSO A;  5MEN A;  3BGM A;  4PV9 A;  4WDI A;  4Z76 A;  3JTC A;  4O2F A;  4U1I A;  3GSX A;  3X13 A;  3JVG A;  5F7D A;  3MRJ A;  1FFP A;  1JF1 A;  4PG9 A;  3FFC A;  2P5W A;  4Z77 A;  5C09 A;  4L29 A;  1T7X A;  3DX7 A;  1KTL A;  3SDD A;  3SKO A;  3X12 A;  4X6D A;  1T0M A;  1EEY A;  3REW A;  3VFO A;  5C0D A;  4MVB A;  3KPN A;  4PJI A;  3TBW A;  1IM3 A;  2FWO A;  5SWS A;  3RWG A;  2X4N A;  1N3N A;  4S0U C;  5SWQ A;  5F1N A;  3ARG A;  5C0E A;  3QQ4 A;  3IT8 D;  4CVX A;  1S7Q A;  1X7Q A;  3W0W A;  1P7Q A;  2YPK A;  5C0A A;  4ZUV A;  3PQY A;  1T0N A;  4F7E A;  3CDG A;  5B39 A;  1WBY A;  1AGB A;  1W72 A;  3QFJ A;  4WO4 A;  1JUF A;  4IHO A;  1VAD A;  4HWZ A;  5F1I A;  3MRE A;  1MHE A;  1NAM H;  1T7Y A;  3GML A;  3VRJ A;  3D3V A;  4K71 B;  3RWI A;  3RWD A;  5IEH A;  1AKJ A;  3VRI A;  3RGV C;  1JGE A;  1ZVS A;  3KPQ A;  4U1N A;  4V3D B;  3P4O A;  5IVX A;  1HHG A;  1WBZ A;  2AV1 A;  3FTG A;  5DEF A;  4PJX A;  1LEK A;  5EFI A;  4G9D A;  4JFD A;  1A9E A;  1I7T A;  1S7U A;  4ONO A;  2A83 A;  1A9B A;  4L8B A;  3MRN A;  2HJK A;  5FA4 A;  3MRF A;  4JFO A;  5C0J A;  4N0C A;  1QLF A;  3VXO A;  3O3A A;  5E8P A;  4L3E A;  3X14 A;  2CKB H;  3MV7 A;  3UTS A;  2X70 A;  4QRR A;  3CC5 A;  3AU1 A;  1A1M A;  4NO0 A;  3D2U A;  4K7F A;  3TID A;  4JRX A;  3MRC A;  4QRS A;  4APQ A;  4EN3 C;  1LK2 A;  3DBX A;  5ENW A;  3HPJ A;  3DX6 A;  4PJ8 A;  3CCH A;  4QRP A;  1QSF A;  1OGT A;  1RJZ A;  1ZHL A;  3RWF A;  1KJV A;  3P77 A;  5EO0 A;  3MV8 A;  3ARE A;  4HUV A;  2H26 A;  4ZFZ A;  3OXS A;  3FT4 A;  3OX8 A;  3FRU A;  4QRU A;  4PJH A;  1KPU A;  1OF2 A;  3BWA A;  1I4F A;  1N5A A;  1CD1 A;  1S7W A;  1R3H A;  2H6P A;  5HGH A;  1QO3 A;  2BVQ A;  3C8K A;  3HUJ A;  3SJV A;  3ECB A;  1LQV A;  3UTT A;  3AM8 A;  3TBS A;  3L3K A;  1LDP H;  3MRD A;  3VXU A;  4D0B A;  5IB3 A;  3QI9 A;  3PWV A;  1JE6 A;  1I1Y A;  2VE6 A;  3BP4 A;  1XR9 A;  4N8V A;  1PQZ A;  3SPV A;  5HHP A;  4WUU A;  5IB2 A;  5ACZ A;  4GKN A;  5HYJ A;  5ISZ A;  1T22 A;  3O3B A;  1K5N A;  1EFX A;  2ZSW A;  3L3I A;  3RUG A;  3VH8 A;  2BSS A;  3MRH A;  4X6F A;  1YN6 A;  5C07 A;  1KJ2 H;  4G42 A;  2BST A;  2X4S A;  3SCM A;  2AKR A;  3LKO A;  2X4P A;  4U1K A;  1T1Y A;  3BZF A;  3E6F A;  3VFM A;  1I7U A;  1A6Z A;  4PJF A;  2VLL A;  4F7C A;  1P1Z A;  3TO4 A;  4U1S A;  5D7J C;  1AO7 A;  1AGF A;  4QRQ A;  5E6I C;  3FQR A;  4D0C A;  2CLV A;  3VXP A;  1S7S A;  2OI9 A;  5E00 A;  5MEQ A;  3UPR A;  5IM7 A;  5DEG A;  4E5X A;  2F53 A;  3BEV A;  2CLR A;  1BII A;  1A1N A;  2ZSV A;  4PP8 C;  3TJH A;  3KPP A;  3TBV A;  3DX8 A;  4PJC A;  1WBX A;  2DYP A;  4U1H A;  5MEO A;  1G7P A;  1LEG A;  3PAB A;  1HOC A;  3FQT A;  3L9R A;  1FZO A;  3L3D A;  4PDC E;  1I7R A;  2X4U A;  4Z78 A;  1SYS A;  3I6K A;  3MRQ A;  3MYJ A;  1T1Z A;  4PJD A;  3KPL A;  5EU5 A;  3CPL A;  2GIT A;  4D0D A;  2UWE A;  3WS6 A;  3FQW A;  5BS0 A;  3GSV A;  1SYV A;  1KJ3 H;  1T7Z A;  2VAB A;  3G08 A;  3ILQ C;  3LKS A;  3WL9 A;  3CZF A;  2NX5 A;  3JTS A;  4F7T A;  4QRT A;  3I6L D;  4O2C A;  1ZT1 A;  4X6E A;  1YDP A;  3O9W A;  3JTT A;  4ZUW A;  3O3D A;  1FG2 A;  4G8G A;  3ERY A;  3W39 A;  2BSR A;  3GMP A;  3LN5 A;  2BVP A;  4U6X A;  3WS3 A;  3QUK A;  1GZP A;  2GTZ A;  4MNG A;  1MHC A;  4PJB A;  4L9L C;  3PWU A;  3BP7 A;  4GUP A;  4PGD A;  2X4Q A;  3MRR A;  2PYE A;  3ARB A;  5D7I A;  1HHI A;  2AXG A;  4I4W A;  4N5E A;  2FIK A;  3RWC A;  5GSR A;  4L8D A;  4U6Y A;  1T7V A;  3B6S A;  5J6H A;  4LHU A;  3D39 A;  4WWK C;  1QSE A;  4JFF A;  4PRB A;  4PGE A;  3GIV A;  1XH3 A;  4EI5 A;  1FFO A;  5IRO A;  5INC A;  1HSA A;  5HHN A;  3SDX A;  3DTX A;  1U58 A;  2MHA A;  3FOM A;  3GJF A;  3KPM A;  3PWN A;  5J6G A;  2ESV A;  4E0R A;  3E3Q A;  4HUW A;  4NQD A;  5FA3 A;  3GSW A;  4ZUS A;  1OGA A;  1RK0 A;  2FYY A;  3GSR A;  3QUY A;  3ILP A;  3MRI A;  4G9F A;  3MGT A;  4IIQ C;  1T7W A;  4IRS A;  3LKN A;  4NNY A;  5D2L A;  1W0V A;  4NO5 A;  3VFR A;  2XPG A;  3RL1 A;  1E27 A;  4NHU E;  3BH9 A;  1DE4 A;  1FZK A;  4HV8 A;  3DXA A;  3D25 A;  2VLR A;  5C0F A;  5C08 A;  3BO8 A;  4ZUU A;  1JPF A;  4ZUT A;  4UQ2 A;  2GAZ A;  3SDA A;  3TN0 A;  4XXC A;  2OL3 H;  1T80 A;  4QOK A;  1JPG A;  4NNX A;  1ONQ A;  1MWA H;  5AD0 A;  2FZ3 A;  3TFK A;  3SKM A;  1S7T A;  5EOT A;  1T1W A;  3PWJ A;  3QUZ A;  4Y16 A;  2BCK A;  1MI5 A;  3VJ6 A;  3VFN A;  1T21 A;  4PR5 A;  2PO6 A;  3VXM A;  1EEZ A;  2AK4 A;  5D9S A;  2VLJ A;  3TA3 A;  2J8U A;  2AV7 A;  3GSN H;  5HHM A;  1S8D A;  3L3H A;  3FON A;  3DMM A;  1TMC A;  3VFP A;  1KJM A;  1ZT4 A;  1DUY A;  1GZQ A;  4LCW A;  1W0W A;  3VFW A;  1N2R A;  5B38 A;  5BJT A;  1KCG C;  4GKS A;  3VCL A;  1HSB A;  4JRY A;  1VAC A;  1HYR C;  3VFU A;  4NQE A;  4PGC A;  1B0R A;  1UXW A;  1IM9 A;  1ZHN A;  3HE7 A;  3MGO A;  3S6C A;  3RZC A;  1QR1 A;  1RJY A;  4L4V A;  1ZHK A;  1TVH A;  3LKR A;  1KPR A;  1QVO A;  3BEW A;  4MNQ A;  1XR8 A;  1YPZ A;  5H94 A;  3UTQ A;  1AGD A;  5EUO A;  1AGC A;  4JQV A;  4MXQ A;  1FO0 H;  1G7Q A;  3FT2 A;  4G43 A;  1M6O A;  4G8I A;  1FFN A;  3FOL A;  4L4T A;  2V2W A;  5BXF A;  3ARD A;  4V3E B;  2F74 A;  4PJ7 A;  1DDH A;  3QZW A;  3I6G A;  5C9J A;  4MJ5 A;  4IRJ A;  2WY3 A;  3TF7 A;  3VFT A;  3GMR A;  3VXS A;  3X11 A;  4ZAK A;  1HHJ A;  1Z5L A;  2RFX A;  3LKP A;  3P9M A;  5D7L A;  1M05 A;  5IND A;  1JFM A;  2VAA A;  3H7B A;  1FZJ A;  1I1A A;  3L3G A;  1T20 A;  5C0G A;  3H9S A;  1RK1 A;  4FFE X; 
#chains in the Genus database with same CATH topology
 3ARF A;  4MX7 A;  4ELM A;  3RWH A;  1TVB A;  4EUP A;  4PG2 A;  2VLK A;  3TIE A;  3GMQ A;  3GMO A;  4PJG A;  4Y2D A;  4HUX A;  4NQV A;  4G59 C;  4JQX A;  1ZSD A;  3HAE A;  1S7X A;  1S9X A;  3HE6 A;  5IB1 A;  4PRE A;  1B0G A;  3FQX A;  4L8S C;  4G59 A;  4N0U A;  5EU6 A;  1Q94 A;  3C9N A;  3PWL A;  4CVZ A;  1INQ A;  2E7L E;  1CE6 A;  3ROL A;  3LKQ A;  1YN7 A;  4HX1 A;  2C7U A;  4I48 A;  3QDJ A;  3VFS A;  3VXR A;  3UBX A;  3MV9 A;  3O3E A;  5IB4 A;  1QQD A;  1DUZ A;  3OV6 A;  3SDC A;  1S9W A;  2FO4 A;  3MRB A;  5HHO A;  3ROO A;  3RTQ A;  4JFP A;  3MRL A;  1EXU A;  5HGD A;  5SWZ A;  3KPO A;  3BUY A;  3O4L A;  1BQH A;  4UQ3 A;  4WJ5 A;  4WU5 A;  5L2J A;  3MRG A;  3V5D A;  1I1F A;  4PJA A;  5L2K A;  3HLA A;  3E2H A;  1BZ9 A;  3BZE A;  3GSQ A;  3TBY A;  5BRZ A;  3HCV A;  1ZHB A;  3E6H A;  4U1J A;  1K8D A;  2ZOK A;  1HHK A;  3KYN A;  5HGA A;  2X4O A;  2Q7Y A;  1ED3 A;  1ZAG A;  3MRM A;  1N59 A;  4Y4F A;  4L8C A;  3CVH A;  3VWK A;  1OSZ A;  4Y4H A;  4MJ6 A;  5IB5 A;  5GSV A;  1UXS A;  3WUW A;  1JGD A;  5E8O A;  2GUO A;  4CW1 A;  3VWJ A;  1S7R A;  1CG9 A;  1C16 A;  3NFN A;  3RL2 A;  4MJI A;  5E8N A;  4JFE A;  3M17 A;  3TBT A;  2JCC A;  3TZV C;  4HUU A;  2GT9 A;  3GMN A;  3KWW A;  5C0B A;  3QDG A;  3U0P A;  1XZ0 A;  4O2E A;  3FQN A;  3LN4 A;  3RWJ A;  1QRN A;  2X4R A;  3KLA A;  3QUX A;  4WW2 C;  4U1M A;  4HS3 A;  4JFQ A;  1ZT7 A;  2D31 A;  5C0C A;  5C0I A;  2HJL A;  3V5K A;  1E28 A;  4PV8 A;  5E9D A;  2F54 A;  3BW9 A;  1BD2 A;  3M1B A;  3PWP A;  1ZS8 A;  3QFD A;  3HG1 A;  1JHT A;  3MA7 A;  3OXR A;  3TVM A;  3FT3 A;  3GSU A;  4WU7 A;  4F7P A;  3KXF A;  3TO2 A;  1UQS A;  3VFV A;  2CII A;  3MRK A;  5DDH A;  2BVO A;  4L3C A;  5D5M A;  4N0F A;  4NO2 A;  5MER A;  2O5N A;  3CH1 A;  3O8X A;  4LCC C;  4NT6 A;  4NO3 A;  3T1F A;  1NAN H;  2ZOL A;  3RWE A;  3BXN A;  3P4N A;  3P73 A;  4NQX A;  3QDM A;  4PRD A;  4LCY A;  3KPR A;  3TPU E;  1A1O A;  2X4T A;  3MR9 A;  3P9L A;  4PRI A;  3VXN A;  1P4L A;  3KPS A;  5EU3 A;  5J1A A;  2P5E A;  1T1X A;  3BH8 A;  4MS8 A;  3B3I A;  3ES6 A;  5FKP A;  4PJ9 A;  3V5H A;  3H9H A;  5MEP A;  3P4M A;  5F9J A;  2YPL A;  3IXA A;  3L3J A;  4PRH A;  2HLA A;  3QUL A;  4HKJ A;  4PRA A;  2BNQ A;  1S9Y A;  2CIK A;  3GMM A;  3T8X A;  3FQU A;  4Y4K A;  1VGK A;  1B3J A;  3QQ3 A;  3D18 A;  5EU4 A;  2HN7 A;  4X6C A;  2NW3 A;  2BNR A;  5JHD A;  1NEZ A;  5HGB A;  3BVN A;  4PGB A;  4PRP A;  4F7M A;  1AGE A;  3MRO A;  2YEZ A;  1FZM A;  2AXF A;  1L8J A;  4NQC A;  5HHQ A;  1S7V A;  1LP9 A;  2XFX A;  4NSK A;  1LD9 A;  3QEQ A;  4U1L A;  4MQ7 A;  4LNR A;  1G6R H;  1HHH A;  2CLZ A;  1KBG H;  3MRP A;  4PJ5 A;  3KYO A;  4PRN A;  5EO1 A;  1KPV A;  5D2N A;  2GTW A;  5FDW A;  3LV3 A;  5IEK A;  2V2X A;  4JO8 A;  1QEW A;  4PJE A;  2GJ6 A;  3BHB A;  3WLB A;  4FTV A;  3GSO A;  5MEN A;  3BGM A;  4PV9 A;  4WDI A;  4Z76 A;  3JTC A;  4O2F A;  4U1I A;  3GSX A;  3X13 A;  3JVG A;  5F7D A;  3MRJ A;  1FFP A;  1JF1 A;  4PG9 A;  3FFC A;  2P5W A;  4Z77 A;  5C09 A;  4L29 A;  1T7X A;  3DX7 A;  1KTL A;  3SDD A;  3SKO A;  3X12 A;  4X6D A;  1T0M A;  1EEY A;  3REW A;  3VFO A;  5C0D A;  4MVB A;  3KPN A;  4PJI A;  3TBW A;  1IM3 A;  2FWO A;  5SWS A;  3RWG A;  2X4N A;  1N3N A;  4S0U C;  5SWQ A;  5F1N A;  3ARG A;  5C0E A;  3QQ4 A;  3IT8 D;  4CVX A;  1S7Q A;  1X7Q A;  3W0W A;  1P7Q A;  2YPK A;  5C0A A;  4ZUV A;  3PQY A;  1T0N A;  4F7E A;  3CDG A;  5B39 A;  1WBY A;  1AGB A;  1W72 A;  3QFJ A;  4WO4 A;  1JUF A;  4IHO A;  1VAD A;  4HWZ A;  5F1I A;  3MRE A;  1MHE A;  1NAM H;  1T7Y A;  3GML A;  3VRJ A;  3D3V A;  4K71 B;  3RWI A;  3RWD A;  5IEH A;  1AKJ A;  3VRI A;  3RGV C;  1JGE A;  1ZVS A;  3KPQ A;  4U1N A;  4V3D B;  3P4O A;  5IVX A;  1HHG A;  1WBZ A;  2AV1 A;  3FTG A;  5DEF A;  4PJX A;  1LEK A;  5EFI A;  4G9D A;  4JFD A;  1A9E A;  1I7T A;  1S7U A;  4ONO A;  2A83 A;  1A9B A;  4L8B A;  3MRN A;  2HJK A;  5FA4 A;  3MRF A;  4JFO A;  5C0J A;  4N0C A;  1QLF A;  3VXO A;  3O3A A;  5E8P A;  4L3E A;  3X14 A;  2CKB H;  3MV7 A;  3UTS A;  2X70 A;  4QRR A;  3CC5 A;  3AU1 A;  1A1M A;  4NO0 A;  3D2U A;  4K7F A;  3TID A;  4JRX A;  3MRC A;  4QRS A;  4APQ A;  4EN3 C;  1LK2 A;  3DBX A;  5ENW A;  3HPJ A;  3DX6 A;  4PJ8 A;  3CCH A;  4QRP A;  1QSF A;  1OGT A;  1RJZ A;  1ZHL A;  3RWF A;  1KJV A;  3P77 A;  5EO0 A;  3MV8 A;  3ARE A;  4HUV A;  2H26 A;  4ZFZ A;  3OXS A;  3FT4 A;  3OX8 A;  3FRU A;  4QRU A;  4PJH A;  1KPU A;  1OF2 A;  3BWA A;  1I4F A;  1N5A A;  1CD1 A;  1S7W A;  1R3H A;  2H6P A;  5HGH A;  1QO3 A;  2BVQ A;  3C8K A;  3HUJ A;  3SJV A;  3ECB A;  1LQV A;  3UTT A;  3AM8 A;  3TBS A;  3L3K A;  1LDP H;  3MRD A;  3VXU A;  4D0B A;  5IB3 A;  3QI9 A;  3PWV A;  1JE6 A;  1I1Y A;  2VE6 A;  3BP4 A;  1XR9 A;  4N8V A;  1PQZ A;  3SPV A;  5HHP A;  4WUU A;  5IB2 A;  5ACZ A;  4GKN A;  5HYJ A;  5ISZ A;  1T22 A;  3O3B A;  1K5N A;  1EFX A;  2ZSW A;  3L3I A;  3RUG A;  3VH8 A;  2BSS A;  3MRH A;  4X6F A;  1YN6 A;  5C07 A;  1KJ2 H;  4G42 A;  2BST A;  2X4S A;  3SCM A;  2AKR A;  3LKO A;  2X4P A;  4U1K A;  1T1Y A;  3BZF A;  3E6F A;  3VFM A;  1I7U A;  1A6Z A;  4PJF A;  2VLL A;  4F7C A;  1P1Z A;  3TO4 A;  4U1S A;  5D7J C;  1AO7 A;  1AGF A;  4QRQ A;  5E6I C;  3FQR A;  4D0C A;  2CLV A;  3VXP A;  1S7S A;  2OI9 A;  5E00 A;  5MEQ A;  3UPR A;  5IM7 A;  5DEG A;  4E5X A;  2F53 A;  3BEV A;  2CLR A;  1BII A;  1A1N A;  2ZSV A;  4PP8 C;  3TJH A;  3KPP A;  3TBV A;  3DX8 A;  4PJC A;  1WBX A;  2DYP A;  4U1H A;  5MEO A;  1G7P A;  1LEG A;  3PAB A;  1HOC A;  3FQT A;  3L9R A;  1FZO A;  3L3D A;  4PDC E;  1I7R A;  2X4U A;  4Z78 A;  1SYS A;  3I6K A;  3MRQ A;  3MYJ A;  1T1Z A;  4PJD A;  3KPL A;  5EU5 A;  3CPL A;  2GIT A;  4D0D A;  2UWE A;  3WS6 A;  3FQW A;  5BS0 A;  3GSV A;  1SYV A;  1KJ3 H;  3I0T A;  1T7Z A;  2VAB A;  3G08 A;  3ILQ C;  3LKS A;  3WL9 A;  3CZF A;  2NX5 A;  3JTS A;  4F7T A;  4QRT A;  3I6L D;  4O2C A;  1ZT1 A;  4X6E A;  1YDP A;  3O9W A;  3JTT A;  4ZUW A;  3O3D A;  1FG2 A;  4G8G A;  3ERY A;  3W39 A;  2BSR A;  3GMP A;  3LN5 A;  2BVP A;  4U6X A;  3WS3 A;  3QUK A;  1GZP A;  2GTZ A;  4MNG A;  1MHC A;  4PJB A;  4L9L C;  3PWU A;  3BP7 A;  4GUP A;  4PGD A;  2X4Q A;  3MRR A;  2PYE A;  3ARB A;  5D7I A;  1HHI A;  2AXG A;  4I4W A;  4N5E A;  2FIK A;  3RWC A;  5GSR A;  4L8D A;  4U6Y A;  1T7V A;  3B6S A;  5J6H A;  4LHU A;  3D39 A;  4WWK C;  1QSE A;  4JFF A;  4PRB A;  4PGE A;  3GIV A;  1XH3 A;  4EI5 A;  1FFO A;  5IRO A;  5INC A;  1HSA A;  5HHN A;  3SDX A;  3DTX A;  1U58 A;  2MHA A;  3FOM A;  3GJF A;  3KPM A;  3PWN A;  5J6G A;  2ESV A;  4E0R A;  3E3Q A;  4HUW A;  4NQD A;  5FA3 A;  3GSW A;  4ZUS A;  1OGA A;  1RK0 A;  2FYY A;  3GSR A;  3QUY A;  3ILP A;  3MRI A;  4G9F A;  3MGT A;  4IIQ C;  1T7W A;  4IRS A;  3LKN A;  4NNY A;  5D2L A;  1W0V A;  4NO5 A;  3VFR A;  2XPG A;  3RL1 A;  1E27 A;  4NHU E;  3BH9 A;  1DE4 A;  1FZK A;  4HV8 A;  3DXA A;  3D25 A;  2VLR A;  5C0F A;  5C08 A;  3BO8 A;  4ZUU A;  1JPF A;  4ZUT A;  4UQ2 A;  2GAZ A;  3SDA A;  3TN0 A;  4XXC A;  2OL3 H;  1T80 A;  4QOK A;  1JPG A;  4NNX A;  1ONQ A;  1MWA H;  5AD0 A;  2FZ3 A;  3TFK A;  3SKM A;  1S7T A;  5EOT A;  1T1W A;  3PWJ A;  3QUZ A;  4Y16 A;  2BCK A;  1MI5 A;  3VJ6 A;  3VFN A;  1T21 A;  4PR5 A;  2PO6 A;  3VXM A;  1EEZ A;  2AK4 A;  5D9S A;  2VLJ A;  3TA3 A;  2J8U A;  2AV7 A;  3GSN H;  5HHM A;  1S8D A;  3L3H A;  3FON A;  3DMM A;  1TMC A;  3VFP A;  1KJM A;  1ZT4 A;  1DUY A;  1GZQ A;  4LCW A;  1W0W A;  3VFW A;  1N2R A;  5B38 A;  5BJT A;  1KCG C;  4GKS A;  3VCL A;  1HSB A;  4JRY A;  1VAC A;  1HYR C;  3VFU A;  4NQE A;  4PGC A;  1B0R A;  1UXW A;  1IM9 A;  1ZHN A;  3HE7 A;  3MGO A;  3S6C A;  2NYK A;  3RZC A;  1RJY A;  1QR1 A;  4L4V A;  1ZHK A;  1TVH A;  3LKR A;  1KPR A;  1QVO A;  3BEW A;  4MNQ A;  1XR8 A;  1YPZ A;  5H94 A;  3UTQ A;  1AGD A;  5EUO A;  1AGC A;  4JQV A;  4MXQ A;  1FO0 H;  1G7Q A;  3FT2 A;  4G43 A;  1M6O A;  4G8I A;  1FFN A;  3FOL A;  4L4T A;  2V2W A;  5BXF A;  3ARD A;  4V3E B;  2F74 A;  4PJ7 A;  1DDH A;  2IA1 A;  3QZW A;  3I6G A;  5C9J A;  4MJ5 A;  4IRJ A;  2WY3 A;  3TF7 A;  3VFT A;  4BKW A;  3GMR A;  3VXS A;  3X11 A;  4ZAK A;  1HHJ A;  1Z5L A;  2RFX A;  3LKP A;  3P9M A;  5D7L A;  1M05 A;  5IND A;  1JFM A;  2VAA A;  3H7B A;  1FZJ A;  1I1A A;  3L3G A;  1T20 A;  5C0G A;  3H9S A;  1RK1 A;  4FFE X; 
#chains in the Genus database with same CATH homology
 3ARF A;  4MX7 A;  4ELM A;  3RWH A;  1TVB A;  4EUP A;  4PG2 A;  2VLK A;  3TIE A;  3GMQ A;  3GMO A;  4PJG A;  4Y2D A;  4HUX A;  4NQV A;  4JQX A;  1ZSD A;  3HAE A;  1S7X A;  1S9X A;  3HE6 A;  5IB1 A;  4PRE A;  1B0G A;  3FQX A;  4L8S C;  4G59 A;  4N0U A;  5EU6 A;  1Q94 A;  3C9N A;  3PWL A;  4CVZ A;  1INQ A;  2E7L E;  1CE6 A;  3ROL A;  3LKQ A;  1YN7 A;  4HX1 A;  2C7U A;  4I48 A;  3QDJ A;  3VFS A;  3VXR A;  3UBX A;  3MV9 A;  3O3E A;  5IB4 A;  1QQD A;  1DUZ A;  3OV6 A;  3SDC A;  1S9W A;  2FO4 A;  3MRB A;  5HHO A;  3ROO A;  3RTQ A;  4JFP A;  3MRL A;  1EXU A;  5HGD A;  5SWZ A;  3KPO A;  3BUY A;  3O4L A;  1BQH A;  4UQ3 A;  4WJ5 A;  4WU5 A;  5L2J A;  3MRG A;  3V5D A;  1I1F A;  4PJA A;  5L2K A;  3HLA A;  3E2H A;  1BZ9 A;  3BZE A;  3GSQ A;  3TBY A;  5BRZ A;  3HCV A;  1ZHB A;  3E6H A;  4U1J A;  1K8D A;  2ZOK A;  1HHK A;  3KYN A;  5HGA A;  2X4O A;  2Q7Y A;  1ED3 A;  1ZAG A;  3MRM A;  1N59 A;  4Y4F A;  4L8C A;  3CVH A;  3VWK A;  1OSZ A;  4Y4H A;  4MJ6 A;  5IB5 A;  5GSV A;  1UXS A;  3WUW A;  1JGD A;  5E8O A;  2GUO A;  4CW1 A;  3VWJ A;  1S7R A;  1CG9 A;  1C16 A;  3NFN A;  3RL2 A;  4MJI A;  5E8N A;  4JFE A;  3M17 A;  3TBT A;  2JCC A;  3TZV C;  4HUU A;  2GT9 A;  3GMN A;  3KWW A;  5C0B A;  3QDG A;  3U0P A;  1XZ0 A;  4O2E A;  3FQN A;  3LN4 A;  3RWJ A;  1QRN A;  2X4R A;  3KLA A;  3QUX A;  4WW2 C;  4U1M A;  4HS3 A;  4JFQ A;  1ZT7 A;  2D31 A;  5C0C A;  5C0I A;  2HJL A;  3V5K A;  1E28 A;  4PV8 A;  5E9D A;  2F54 A;  3BW9 A;  1BD2 A;  3M1B A;  3PWP A;  1ZS8 A;  3QFD A;  3HG1 A;  1JHT A;  3MA7 A;  3OXR A;  3TVM A;  3FT3 A;  3GSU A;  4WU7 A;  4F7P A;  3KXF A;  3TO2 A;  1UQS A;  3VFV A;  2CII A;  3MRK A;  5DDH A;  2BVO A;  4L3C A;  5D5M A;  4N0F A;  4NO2 A;  5MER A;  3CH1 A;  3O8X A;  4LCC C;  4NT6 A;  4NO3 A;  3T1F A;  1NAN H;  2ZOL A;  3RWE A;  3BXN A;  3P4N A;  3P73 A;  4NQX A;  3QDM A;  4PRD A;  4LCY A;  3KPR A;  3TPU E;  1A1O A;  2X4T A;  3MR9 A;  3P9L A;  4PRI A;  3VXN A;  1P4L A;  3KPS A;  5EU3 A;  5J1A A;  2P5E A;  1T1X A;  3BH8 A;  4MS8 A;  3B3I A;  3ES6 A;  5FKP A;  4PJ9 A;  3V5H A;  3H9H A;  5MEP A;  3P4M A;  5F9J A;  2YPL A;  3IXA A;  3L3J A;  4PRH A;  2HLA A;  3QUL A;  4HKJ A;  4PRA A;  2BNQ A;  1S9Y A;  2CIK A;  3GMM A;  3T8X A;  3FQU A;  4Y4K A;  1VGK A;  1B3J A;  3QQ3 A;  3D18 A;  5EU4 A;  2HN7 A;  4X6C A;  2NW3 A;  2BNR A;  5JHD A;  1NEZ A;  5HGB A;  3BVN A;  4PGB A;  4PRP A;  4F7M A;  1AGE A;  3MRO A;  2YEZ A;  1FZM A;  2AXF A;  1L8J A;  4NQC A;  5HHQ A;  1S7V A;  1LP9 A;  2XFX A;  4NSK A;  1LD9 A;  3QEQ A;  4U1L A;  4MQ7 A;  4LNR A;  1G6R H;  1HHH A;  2CLZ A;  1KBG H;  3MRP A;  4PJ5 A;  3KYO A;  4PRN A;  5EO1 A;  1KPV A;  5D2N A;  2GTW A;  5FDW A;  3LV3 A;  5IEK A;  2V2X A;  1QEW A;  4PJE A;  2GJ6 A;  3BHB A;  3WLB A;  4FTV A;  3GSO A;  5MEN A;  3BGM A;  4PV9 A;  4WDI A;  4Z76 A;  3JTC A;  4O2F A;  4U1I A;  3GSX A;  3X13 A;  3JVG A;  5F7D A;  3MRJ A;  1FFP A;  1JF1 A;  4PG9 A;  3FFC A;  2P5W A;  4Z77 A;  5C09 A;  4L29 A;  1T7X A;  3DX7 A;  1KTL A;  3SDD A;  3SKO A;  3X12 A;  4X6D A;  1T0M A;  1EEY A;  3REW A;  3VFO A;  5C0D A;  4MVB A;  3KPN A;  4PJI A;  3TBW A;  1IM3 A;  2FWO A;  5SWS A;  3RWG A;  2X4N A;  1N3N A;  4S0U C;  5SWQ A;  5F1N A;  3ARG A;  5C0E A;  3QQ4 A;  3IT8 D;  4CVX A;  1S7Q A;  1X7Q A;  3W0W A;  1P7Q A;  2YPK A;  5C0A A;  4ZUV A;  3PQY A;  1T0N A;  4F7E A;  3CDG A;  5B39 A;  1WBY A;  1AGB A;  1W72 A;  3QFJ A;  4WO4 A;  1JUF A;  4IHO A;  1VAD A;  4HWZ A;  5F1I A;  3MRE A;  1MHE A;  1NAM H;  1T7Y A;  3GML A;  3VRJ A;  3D3V A;  4K71 B;  3RWI A;  3RWD A;  5IEH A;  1AKJ A;  3VRI A;  3RGV C;  1JGE A;  1ZVS A;  3KPQ A;  4U1N A;  4V3D B;  3P4O A;  5IVX A;  1HHG A;  1WBZ A;  2AV1 A;  3FTG A;  5DEF A;  4PJX A;  1LEK A;  5EFI A;  4G9D A;  4JFD A;  1A9E A;  1I7T A;  1S7U A;  4ONO A;  2A83 A;  1A9B A;  4L8B A;  3MRN A;  2HJK A;  5FA4 A;  3MRF A;  4JFO A;  5C0J A;  4N0C A;  1QLF A;  3VXO A;  3O3A A;  5E8P A;  4L3E A;  3X14 A;  2CKB H;  3MV7 A;  3UTS A;  2X70 A;  4QRR A;  3CC5 A;  3AU1 A;  1A1M A;  4NO0 A;  3D2U A;  4K7F A;  3TID A;  4JRX A;  3MRC A;  4QRS A;  4APQ A;  4EN3 C;  1LK2 A;  3DBX A;  5ENW A;  3HPJ A;  3DX6 A;  4PJ8 A;  3CCH A;  4QRP A;  1QSF A;  1OGT A;  1RJZ A;  1ZHL A;  3RWF A;  1KJV A;  3P77 A;  5EO0 A;  3MV8 A;  3ARE A;  4HUV A;  2H26 A;  4ZFZ A;  3OXS A;  3FT4 A;  3OX8 A;  3FRU A;  4QRU A;  4PJH A;  1KPU A;  1OF2 A;  3BWA A;  1I4F A;  1N5A A;  1CD1 A;  1S7W A;  1R3H A;  2H6P A;  5HGH A;  1QO3 A;  2BVQ A;  3C8K A;  3HUJ A;  3SJV A;  3ECB A;  1LQV A;  3UTT A;  3AM8 A;  3TBS A;  3L3K A;  1LDP H;  3MRD A;  3VXU A;  4D0B A;  5IB3 A;  3QI9 A;  3PWV A;  1JE6 A;  1I1Y A;  2VE6 A;  3BP4 A;  1XR9 A;  4N8V A;  1PQZ A;  3SPV A;  5HHP A;  4WUU A;  5IB2 A;  5ACZ A;  4GKN A;  5HYJ A;  5ISZ A;  1T22 A;  3O3B A;  1K5N A;  1EFX A;  2ZSW A;  3L3I A;  3RUG A;  3VH8 A;  2BSS A;  3MRH A;  4X6F A;  1YN6 A;  5C07 A;  1KJ2 H;  4G42 A;  2BST A;  2X4S A;  3SCM A;  2AKR A;  3LKO A;  2X4P A;  4U1K A;  1T1Y A;  3BZF A;  3E6F A;  3VFM A;  1I7U A;  1A6Z A;  4PJF A;  2VLL A;  4F7C A;  1P1Z A;  3TO4 A;  4U1S A;  5D7J C;  1AO7 A;  1AGF A;  4QRQ A;  5E6I C;  3FQR A;  4D0C A;  2CLV A;  3VXP A;  1S7S A;  2OI9 A;  5E00 A;  5MEQ A;  3UPR A;  5IM7 A;  5DEG A;  4E5X A;  2F53 A;  3BEV A;  2CLR A;  1BII A;  1A1N A;  2ZSV A;  4PP8 C;  3TJH A;  3KPP A;  3TBV A;  3DX8 A;  4PJC A;  1WBX A;  2DYP A;  4U1H A;  5MEO A;  1G7P A;  1LEG A;  3PAB A;  1HOC A;  3FQT A;  3L9R A;  1FZO A;  3L3D A;  4PDC E;  1I7R A;  2X4U A;  4Z78 A;  1SYS A;  3I6K A;  3MRQ A;  3MYJ A;  1T1Z A;  4PJD A;  3KPL A;  5EU5 A;  3CPL A;  2GIT A;  4D0D A;  2UWE A;  3WS6 A;  3FQW A;  5BS0 A;  3GSV A;  1SYV A;  1KJ3 H;  1T7Z A;  2VAB A;  3G08 A;  3ILQ C;  3LKS A;  3WL9 A;  3CZF A;  2NX5 A;  3JTS A;  4F7T A;  4QRT A;  3I6L D;  4O2C A;  1ZT1 A;  4X6E A;  1YDP A;  3O9W A;  3JTT A;  4ZUW A;  3O3D A;  1FG2 A;  4G8G A;  3ERY A;  3W39 A;  2BSR A;  3GMP A;  3LN5 A;  2BVP A;  4U6X A;  3WS3 A;  3QUK A;  1GZP A;  2GTZ A;  4MNG A;  1MHC A;  4PJB A;  4L9L C;  3PWU A;  3BP7 A;  4GUP A;  4PGD A;  2X4Q A;  3MRR A;  2PYE A;  3ARB A;  5D7I A;  1HHI A;  2AXG A;  4I4W A;  4N5E A;  2FIK A;  3RWC A;  5GSR A;  4L8D A;  4U6Y A;  1T7V A;  3B6S A;  5J6H A;  4LHU A;  3D39 A;  4WWK C;  1QSE A;  4JFF A;  4PRB A;  4PGE A;  3GIV A;  1XH3 A;  4EI5 A;  1FFO A;  5IRO A;  5INC A;  1HSA A;  5HHN A;  3SDX A;  3DTX A;  1U58 A;  2MHA A;  3FOM A;  3GJF A;  3KPM A;  3PWN A;  5J6G A;  2ESV A;  4E0R A;  3E3Q A;  4HUW A;  4NQD A;  5FA3 A;  3GSW A;  4ZUS A;  1OGA A;  1RK0 A;  2FYY A;  3GSR A;  3QUY A;  3ILP A;  3MRI A;  4G9F A;  3MGT A;  4IIQ C;  1T7W A;  4IRS A;  3LKN A;  4NNY A;  5D2L A;  1W0V A;  4NO5 A;  3VFR A;  2XPG A;  3RL1 A;  1E27 A;  4NHU E;  3BH9 A;  1DE4 A;  1FZK A;  4HV8 A;  3DXA A;  3D25 A;  2VLR A;  5C0F A;  5C08 A;  3BO8 A;  4ZUU A;  1JPF A;  4ZUT A;  4UQ2 A;  2GAZ A;  3SDA A;  3TN0 A;  4XXC A;  2OL3 H;  1T80 A;  4QOK A;  1JPG A;  4NNX A;  1ONQ A;  1MWA H;  5AD0 A;  2FZ3 A;  3TFK A;  3SKM A;  1S7T A;  5EOT A;  1T1W A;  3PWJ A;  3QUZ A;  4Y16 A;  2BCK A;  1MI5 A;  3VJ6 A;  3VFN A;  1T21 A;  4PR5 A;  2PO6 A;  3VXM A;  1EEZ A;  2AK4 A;  5D9S A;  2VLJ A;  3TA3 A;  2J8U A;  2AV7 A;  3GSN H;  5HHM A;  1S8D A;  3L3H A;  3FON A;  3DMM A;  1TMC A;  3VFP A;  1KJM A;  1ZT4 A;  1DUY A;  1GZQ A;  4LCW A;  1W0W A;  3VFW A;  1N2R A;  5B38 A;  5BJT A;  1KCG C;  4GKS A;  3VCL A;  1HSB A;  4JRY A;  1VAC A;  1HYR C;  3VFU A;  4NQE A;  4PGC A;  1B0R A;  1UXW A;  1IM9 A;  1ZHN A;  3HE7 A;  3MGO A;  3S6C A;  3RZC A;  1QR1 A;  1RJY A;  4L4V A;  1ZHK A;  1TVH A;  3LKR A;  1KPR A;  1QVO A;  3BEW A;  4MNQ A;  1XR8 A;  1YPZ A;  5H94 A;  3UTQ A;  1AGD A;  5EUO A;  1AGC A;  4JQV A;  4MXQ A;  1FO0 H;  1G7Q A;  3FT2 A;  4G43 A;  1M6O A;  4G8I A;  1FFN A;  3FOL A;  4L4T A;  2V2W A;  5BXF A;  3ARD A;  4V3E B;  2F74 A;  4PJ7 A;  1DDH A;  3QZW A;  3I6G A;  5C9J A;  4MJ5 A;  4IRJ A;  2WY3 A;  3TF7 A;  3VFT A;  3GMR A;  3VXS A;  3X11 A;  4ZAK A;  1HHJ A;  1Z5L A;  2RFX A;  3LKP A;  3P9M A;  5D7L A;  1M05 A;  5IND A;  1JFM A;  2VAA A;  3H7B A;  1FZJ A;  1I1A A;  3L3G A;  1T20 A;  5C0G A;  3H9S A;  1RK1 A;  4FFE X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...