2E7LE

Structure of a high-affinity mutant of the 2c tcr in complex with ld/ql9
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
175
Chain Sequence
GPHSMRYFETAVSRRGLGEPRYISVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Cytotoxic Tcell receptor
total genus 51
structure length 175
sequence length 175
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2e7lE00
1RK1A 4LCYA 3VRIA 3P9MA 1FFOA 3BVNA 5FA3A 1TVBA 2E7LE 3GMLA 3ARGA 1T1ZA 3QFJA 4O2CA 1JUFA 1KTLA 1UQSA 5EO0A 3PWUA 5HGDA 3RTQA 3W39A 3UTSA 1AO7A 1FFPA 1Z5LA 4PP8C 3MGTA 1XR9A 3RWDA 4JRYA 4LCWA 1X7QA 2VLJA 3LKNA 5D7IA 3VXPA 5C0CA 3GSOA 2VLRA 4NQCA 3ERYA 3GMMA 2XFXA 1FZMA 3QDMA 5C0DA 1OGAA 4U1LA 4FFEX 3OXRA 1HHIA 1PQZA 2PO6A 3RWIA 4PRAA 3LN4A 3LKOA 5L2KA 1WBXA 2AV1A 1UXWA 3BH9A 1L8JA 3MRDA 3MRRA 3H7BA 4ZUTA 4QRUA 5IEHA 3BO8A 1FO0H 3GSVA 3W0WA 3MRHA 3KYNA 2Q7YA 1ZHNA 4HKJA 1OSZA 3MYJA 3TN0A 3SPVA 3T1FA 4GUPA 3JTSA 3GSNH 3ECBA 1CG9A 3MROA 1W0WA 3H9SA 3DX6A 1YPZA 1T0MA 1T7VA 3FQUA 1YN7A 4U6YA 5C0BA 1SYVA 3WLBA 3ARBA 1RK0A 1E27A 5FDWA 3MRBA 4QRSA 4JFQA 3HG1A 4K7FA 5C0JA 1ZT4A 4MJ6A 4V3EB 4Y4HA 3VFUA 3VFVA 5HHQA 4L8CA 2VE6A 3X11A 1VGKA 3TIDA 4PRBA 4G42A 3KPSA 4U1IA 3MA7A 2HN7A 3L3IA 3MRIA 1A1NA 4PJFA 3VFSA 3VXSA 2AK4A 5B39A 3WS3A 5C0FA 4PJ9A 2BVPA 3VFRA 2PYEA 3O4LA 5MEPA 2D31A 3FONA 4JFDA 2P5WA 3TBWA 1MWAH 3SDAA 3GIVA 3X14A 1A1OA 3VRJA 2AV7A 1T0NA 5IEKA 1WBYA 3ILQC 3MRJA 1QVOA 1AKJA 3LKSA 1CE6A 1ZVSA 2GUOA 3QI9A 5EU3A 3MRNA 3DMMA 3D3VA 1JHTA 5HHMA 2CIIA 1BQHA 3LN5A 3UBXA 3PWVA 4JFFA 4WU5A 1ZSDA 4PJIA 3PWLA 4WW2C 3TBTA 1N2RA 3WL9A 1RJZA 2AXGA 2AKRA 2A83A 5BRZA 4WDIA 1QO3A 1LP9A 4NO2A 1I7TA 3RUGA 5BXFA 1Q94A 4PV9A 2FYYA 4MS8A 5AD0A 3MRFA 3PABA 1M05A 1KPUA 4EUPA 3BP4A 2MHAA 4ZUSA 5D7LA 1S7QA 2H6PA 1I7UA 3PQYA 5IB1A 2VLKA 3RL1A 3D18A 2J8UA 1VACA 1KJVA 2CLZA 2CLVA 5J6GA 3E6FA 1DE4A 4NNYA 4U1HA 3RWFA 3P4NA 3WUWA 3QUYA 4NQVA 1LD9A 1IM3A 1S9XA 5EU6A 4Z78A 3O8XA 3I6LD 1FZKA 3CC5A 2FZ3A 3KPMA 3GMRA 3M1BA 1NEZA 3UPRA 4PJCA 2OL3H 1R3HA 3PWNA 4WU7A 3HCVA 1A1MA 3CVHA 3AREA 3TJHA 4X6FA 1GZQA 1HSBA 3QUKA 3RGVC 2XPGA 1S7SA 1QEWA 3KPPA 3MV8A 3TBSA 1W0VA 3FOMA 4Y4FA 5D7JC 5DEGA 3SDDA 1T1WA 3C9NA 4CVXA 1EXUA 3GMPA 5EU5A 3TPUE 2X4PA 3GMOA 1ZAGA 4U1NA 5D2NA 3QQ4A 3O3EA 3GSRA 3GJFA 3CH1A 5D5MA 1MI5A 5E8OA 2DYPA 3GSWA 5INDA 1T80A 4MNQA 3KPQA 4PREA 5L2JA 1RJYA 3TO2A 4PGCA 4L8DA 1HHGA 1HHJA 4QRTA 3MRMA 4PGEA 4ZUUA 3FT3A 1MHEA 5IB4A 4HV8A 2GTWA 4D0CA 3PWJA 4NSKA 4XXCA 1BD2A 1S7RA 4NT6A 5C0EA 4ZFZA 3BWAA 3TA3A 3HLAA 5SWSA 3QQ3A 1S7UA 4ELMA 1HYRC 3L3DA 4JQVA 5ISZA 3AM8A 3MRCA 4WJ5A 3RWJA 1DUZA 2X4RA 4X6EA 3P4MA 3VFMA 1BZ9A 1XR8A 1ZT1A 4PRHA 5EU4A 4QOKA 5IVXA 3LV3A 5J1AA 4CVZA 3FT4A 4NO5A 5C9JA 3BH8A 4S0UC 4EN3C 4PJEA 1W72A 1I1FA 2CLRA 5C0AA 3BGMA 3VWKA 2NX5A 5BJTA 4F7EA 1IM9A 3GMQA 3E2HA 3P73A 2CIKA 4MJ5A 4G59A 3V5KA 4U1KA 3KLAA 4E0RA 4GKNA 3VXMA 1BIIA 3VXNA 1HOCA 2V2WA 4MVBA 1K8DA 4PJAA 3MRKA 3SKMA 2X4UA 3CPLA 4N5EA 1CD1A 5F1NA 4E5XA 3O3DA 4HWZA 2BVQA 3VH8A 3FFCA 4NO3A 3OX8A 3P77A 3FQNA 2NW3A 1S9YA 1KBGH 1HHHA 4PJGA 2BNRA 4PRIA 4QRQA 1I4FA 5FKPA 1S8DA 3GSQA 5JHDA 5MEQA 3H9HA 3HE7A 3HAEA 4WUUA 5D2LA 2BNQA 4U1SA 3MREA 3BUYA 1ZT7A 5MERA 4Y4KA 1JF1A 4MJIA 3QUXA 4WO4A 3SKOA 3FQTA 4IRSA 3GSUA 3B6SA 3MRPA 5E00A 3REWA 3IT8D 3L9RA 4IHOA 2YEZA 3I6GA 1MHCA 1S7VA 3DX8A 3O3BA 3VFOA 3C8KA 2UWEA 1INQA 1P1ZA 3VFWA 2YPKA 3TVMA 3WS6A 5ACZA 3BZFA 3JVGA 4G8GA 4N0UA 5E6IC 5J6HA 3TBYA 3CZFA 5SWZA 4JFPA 3PWPA 3CDGA 2JCCA 3L3KA 4EI5A 4NQEA 1T1XA 3O3AA 4L9LC 4PJDA 2BCKA 1N5AA 4LHUA 3IXAA 5MENA 1LEGA 2HLAA 4Y16A 3P9LA 4F7PA 3VXOA 3V5HA 1HHKA 4PG9A 4PR5A 5E8PA 1T20A 3GSXA 5FA4A 4QRPA 2BSSA 4O2FA 2GITA 1T22A 4L3CA 1I7RA 1EEYA 3LKPA 3SCMA 5C0IA 2ESVA 4NQXA 5E9DA 5HHOA 1LQVA 1QSFA 2C7UA 3X12A 5HGBA 1N3NA 2FO4A 3MRLA 1SYSA 3HPJA 4L29A 4PJ8A 4UQ2A 2HJKA 1NANH 1AGBA 3OV6A 4I48A 3RWCA 5F7DA 3UTTA 1VADA 3O9WA 5EO1A 3ROLA 4U1JA 4X6CA 1I1YA 5B38A 3ARFA 4G9DA 5IB3A 3JTCA 3DTXA 3DBXA 3TIEA 4K71B 1EEZA 5DDHA 3VCLA 4WWKC 1YN6A 2P5EA 4PG2A 3KPNA 2V2XA 4MXQA 2X4TA 5C08A 1S7WA 3SDCA 1QR1A 1K5NA 3VWJA 4N0CA 3L3JA 3MGOA 3LKQA 3ILPA 5D9SA 1JFMA 1G6RH 2WY3A 3SJVA 1A6ZA 1JGEA 4FTVA 3VXUA 3G08A 4PGBA 5MEOA 1B0GA 3BP7A 3FRUA 1OF2A 3VFNA 4QRRA 4JFOA 3AU1A 1ZS8A 2GAZA 2X4SA 4PRNA 4V3DB 1T21A 1AGDA 3VJ6A 3HE6A 4L3EA 3RWHA 1GZPA 4G43A 4Z76A 4Z77A 4PRDA 3L3HA 3TO4A 3MR9A 3ARDA 1DDHA 5DEFA 5IB5A 1KJ3H 3NFNA 2X70A 2GTZA 5ENWA 5BS0A 2X4QA 1XZ0A 4PV8A 5IM7A 4F7CA 4PRPA 2VLLA 3U0PA 1E28A 4U1MA 3VFTA 3RWEA 3FQWA 1TMCA 4I4WA 3UTQA 3MRQA 3QZWA 4L8SC 1KJMA 1LEKA 1I1AA 1QLFA 3GMNA 3BXNA 3MV7A 4LCCC 3RZCA 1N59A 5GSRA 1XH3A 2ZOLA 3D25A 3ES6A 1YDPA 2F54A 4HUVA 4MQ7A 2H26A 4G8IA 3B3IA 3E6HA 1UXSA 4HUUA 3BZEA 4MX7A 4G9FA 2OI9A 3ROOA 1KPVA 4APQA 3RL2A 3KYOA 1A9BA 1AGEA 1ED3A 2FWOA 3QEQA 1U58A 1HSAA 2F53A 3QFDA 4JRXA 4MNGA 4ZAKA 1FFNA 3D39A 2GT9A 4L4TA 4O2EA 2YPLA 3V5DA 5HYJA 4UQ3A 1LK2A 1AGFA 2X4OA 5HGHA 5IROA 1B0RA 3KWWA 3QULA 4LNRA 1ZHKA 4ZUWA 4PJXA 3FOLA 3BW9A 3TBVA 1T7YA 2ZOKA 3D2UA 3KPLA 5GSVA 3MV9A 5EUOA 3LKRA 1A9EA 2VAAA 1B3JA 1ZHBA 1T7XA 4U6XA 4F7MA 3FQRA 1T7WA 5E8NA 5C07A 3CCHA 3QDJA 5SWQA 5F1IA 5HHNA 4NHUE 4F7TA 2RFXA 1TVHA 2HJLA 1LDPH 1WBZA 5HGAA 2ZSWA 5INCA 1T7ZA 1FZJA 1QQDA 1S7XA 3TZVC 3M17A 1JPGA 3MRGA 4JFEA 1KPRA 4IIQC 4NQDA 1S9WA 4IRJA 3FTGA 5C0GA 1JGDA 3TF7A 1T1YA 1FZOA 4X6DA 4D0BA 1JPFA 5F9JA 4HS3A 4PJ5A 3I6KA 3RWGA 3OXSA 3P4OA 2BSTA 4GKSA 2FIKA 5C09A 2X4NA 1EFXA 1AGCA 1ZHLA 2F74A 4PDCE 3VXRA 5HHPA 3HUJA 4HUWA 4D0DA 3QDGA 3KXFA 3S6CA 3KPOA 4N0FA 4HUXA 3X13A 3VFPA 4CW1A 4HX1A 4PJHA 1QRNA 4Y2DA 1C16A 1KJ2H 3E3QA 2AXFA 4PJ7A 1KCGC 1DUYA 3DXAA 3TFKA 5EFIA 3BHBA 4PJBA 3T8XA 1NAMH 3BEVA 3FQXA 5IB2A 3FT2A 1M6OA 1ONQA 1P4LA 2BSRA 1FG2A 4NO0A 4JQXA 5EOTA 1P7QA 2ZSVA 3JTTA 4NNXA 2CKBH 3KPRA 4ZUVA 1JE6A 4L8BA 3BEWA 4ONOA 2GJ6A 1G7PA 3DX7A 2BVOA 4L4VA 4PGDA 2VABA 4N8VA 1QSEA 3QUZA 5H94A 1G7QA 3L3GA 3SDXA 1OGTA 1S7TA
chains in the Genus database with same CATH superfamily
1RK1A 4LCYA 3VRIA 3P9MA 1FFOA 3BVNA 5FA3A 1TVBA 2E7LE 3GMLA 3ARGA 1T1ZA 3QFJA 4O2CA 1JUFA 1KTLA 1UQSA 5EO0A 3PWUA 5HGDA 3RTQA 3W39A 3UTSA 1AO7A 1FFPA 1Z5LA 4PP8C 3MGTA 1XR9A 3RWDA 4JRYA 4LCWA 1X7QA 2VLJA 3LKNA 5D7IA 3VXPA 5C0CA 3GSOA 2VLRA 4NQCA 3ERYA 3GMMA 2XFXA 1FZMA 3QDMA 5C0DA 1OGAA 4U1LA 4FFEX 3OXRA 1HHIA 1PQZA 2PO6A 3RWIA 4PRAA 3LN4A 3LKOA 5L2KA 1WBXA 2AV1A 1UXWA 3BH9A 1L8JA 3MRDA 3MRRA 3H7BA 4ZUTA 4QRUA 5IEHA 3BO8A 1FO0H 3GSVA 3W0WA 3MRHA 3KYNA 2Q7YA 1ZHNA 4HKJA 1OSZA 3MYJA 3TN0A 3SPVA 3T1FA 4GUPA 3JTSA 3GSNH 3ECBA 1CG9A 3MROA 1W0WA 3H9SA 3DX6A 1YPZA 1T0MA 1T7VA 3FQUA 1YN7A 4U6YA 5C0BA 1SYVA 3WLBA 3ARBA 1RK0A 1E27A 5FDWA 3MRBA 4QRSA 4JFQA 3HG1A 4K7FA 5C0JA 1ZT4A 4MJ6A 4V3EB 4Y4HA 3VFUA 3VFVA 5HHQA 4L8CA 2VE6A 3X11A 1VGKA 3TIDA 4PRBA 4G42A 3KPSA 4U1IA 3MA7A 2HN7A 3L3IA 3MRIA 1A1NA 4PJFA 3VFSA 3VXSA 2AK4A 5B39A 3WS3A 5C0FA 4PJ9A 2BVPA 3VFRA 2PYEA 3O4LA 5MEPA 2D31A 3FONA 4JFDA 2P5WA 3TBWA 1MWAH 3SDAA 3GIVA 3X14A 1A1OA 4JO8A 3VRJA 2AV7A 1T0NA 5IEKA 1WBYA 3ILQC 3MRJA 1QVOA 1AKJA 3LKSA 1CE6A 1ZVSA 2GUOA 3QI9A 5EU3A 3MRNA 3DMMA 3D3VA 1JHTA 5HHMA 2CIIA 1BQHA 3LN5A 3UBXA 3PWVA 4JFFA 4WU5A 1ZSDA 4PJIA 3PWLA 4WW2C 3TBTA 1N2RA 3WL9A 1RJZA 2AXGA 2AKRA 2A83A 5BRZA 4WDIA 1QO3A 1LP9A 4NO2A 1I7TA 3RUGA 5BXFA 1Q94A 4PV9A 2FYYA 4MS8A 5AD0A 3MRFA 3PABA 1M05A 1KPUA 4EUPA 3BP4A 2MHAA 4ZUSA 5D7LA 1S7QA 2H6PA 1I7UA 3PQYA 5IB1A 2VLKA 3RL1A 3D18A 2J8UA 1VACA 1KJVA 2CLZA 2CLVA 5J6GA 3E6FA 1DE4A 4NNYA 4U1HA 3RWFA 3P4NA 3WUWA 3QUYA 4NQVA 1LD9A 1IM3A 1S9XA 5EU6A 4Z78A 3O8XA 3I6LD 1FZKA 3CC5A 2FZ3A 3KPMA 3GMRA 3M1BA 1NEZA 3UPRA 4PJCA 2OL3H 1R3HA 3PWNA 4WU7A 3HCVA 1A1MA 3CVHA 3AREA 3TJHA 4X6FA 1GZQA 1HSBA 3QUKA 3RGVC 2XPGA 1S7SA 1QEWA 3KPPA 3MV8A 3TBSA 1W0VA 3FOMA 4Y4FA 5D7JC 5DEGA 3SDDA 1T1WA 3C9NA 4CVXA 1EXUA 3GMPA 5EU5A 3TPUE 2X4PA 3GMOA 1ZAGA 4U1NA 5D2NA 3QQ4A 3O3EA 3GSRA 3GJFA 3CH1A 5D5MA 1MI5A 5E8OA 2DYPA 3GSWA 5INDA 1T80A 4MNQA 3KPQA 4PREA 5L2JA 1RJYA 3TO2A 4PGCA 4L8DA 1HHGA 1HHJA 4QRTA 3MRMA 4PGEA 4ZUUA 3FT3A 1MHEA 5IB4A 4HV8A 2GTWA 4D0CA 3PWJA 4NSKA 4XXCA 2O5NA 1BD2A 1S7RA 4NT6A 5C0EA 4ZFZA 3BWAA 3TA3A 3HLAA 5SWSA 3QQ3A 1S7UA 4ELMA 1HYRC 3L3DA 4JQVA 5ISZA 3AM8A 3MRCA 4WJ5A 3RWJA 1DUZA 2X4RA 4X6EA 3P4MA 3VFMA 1BZ9A 1XR8A 2IA1A 1ZT1A 4PRHA 5EU4A 4QOKA 5IVXA 3LV3A 5J1AA 4CVZA 3FT4A 4NO5A 5C9JA 3BH8A 4S0UC 4EN3C 4PJEA 1W72A 1I1FA 2CLRA 5C0AA 3BGMA 3VWKA 2NX5A 5BJTA 4F7EA 1IM9A 3GMQA 3E2HA 3P73A 2CIKA 4MJ5A 4G59A 3V5KA 4U1KA 3KLAA 4E0RA 4GKNA 3VXMA 1BIIA 3VXNA 1HOCA 2V2WA 4MVBA 1K8DA 4PJAA 3MRKA 3SKMA 2X4UA 3CPLA 4N5EA 1CD1A 5F1NA 4E5XA 3O3DA 4HWZA 2BVQA 3VH8A 3FFCA 4NO3A 3OX8A 3P77A 3FQNA 2NW3A 1S9YA 1KBGH 1HHHA 4PJGA 2BNRA 4PRIA 4QRQA 1I4FA 5FKPA 1S8DA 3GSQA 5JHDA 5MEQA 3H9HA 3HE7A 3HAEA 4WUUA 5D2LA 2BNQA 4U1SA 3MREA 3BUYA 1ZT7A 5MERA 4Y4KA 1JF1A 4MJIA 3QUXA 4WO4A 3SKOA 3FQTA 4IRSA 3GSUA 3B6SA 3MRPA 5E00A 3REWA 3IT8D 3L9RA 4IHOA 2YEZA 3I6GA 1MHCA 1S7VA 3DX8A 3O3BA 3VFOA 3C8KA 2UWEA 1INQA 1P1ZA 3VFWA 2YPKA 3TVMA 3WS6A 5ACZA 3BZFA 3JVGA 4G8GA 4N0UA 5E6IC 5J6HA 3TBYA 3CZFA 5SWZA 4JFPA 3PWPA 3CDGA 2JCCA 3L3KA 4EI5A 4NQEA 1T1XA 3O3AA 4L9LC 4PJDA 2BCKA 1N5AA 4LHUA 3IXAA 5MENA 1LEGA 2HLAA 4Y16A 3P9LA 4F7PA 3VXOA 3V5HA 1HHKA 4PG9A 4PR5A 5E8PA 1T20A 3GSXA 5FA4A 4QRPA 2BSSA 4O2FA 2GITA 1T22A 4L3CA 1I7RA 1EEYA 3LKPA 3SCMA 5C0IA 4BKWA 2ESVA 4NQXA 5E9DA 5HHOA 1LQVA 1QSFA 2C7UA 3X12A 5HGBA 1N3NA 2FO4A 3MRLA 1SYSA 3HPJA 4L29A 4PJ8A 4UQ2A 2HJKA 1NANH 1AGBA 3OV6A 4I48A 3RWCA 5F7DA 3UTTA 1VADA 3O9WA 5EO1A 3ROLA 4U1JA 4X6CA 1I1YA 5B38A 3ARFA 4G9DA 5IB3A 3JTCA 3DTXA 3DBXA 3TIEA 4K71B 1EEZA 5DDHA 3VCLA 4WWKC 1YN6A 2P5EA 4PG2A 3KPNA 2V2XA 4MXQA 2X4TA 5C08A 1S7WA 3SDCA 1QR1A 1K5NA 3VWJA 4N0CA 3L3JA 3MGOA 3LKQA 3ILPA 5D9SA 1JFMA 1G6RH 2WY3A 3SJVA 1A6ZA 1JGEA 4FTVA 3VXUA 3G08A 4PGBA 5MEOA 1B0GA 3BP7A 3FRUA 1OF2A 3VFNA 4QRRA 4JFOA 3AU1A 1ZS8A 2GAZA 2X4SA 4PRNA 3I0TA 4V3DB 1T21A 1AGDA 3VJ6A 3HE6A 4L3EA 3RWHA 1GZPA 4G43A 4Z76A 4Z77A 4PRDA 3L3HA 3TO4A 3MR9A 3ARDA 1DDHA 5DEFA 5IB5A 1KJ3H 3NFNA 2X70A 2GTZA 5ENWA 5BS0A 2X4QA 1XZ0A 4PV8A 5IM7A 4F7CA 4PRPA 2VLLA 3U0PA 1E28A 4U1MA 3VFTA 3RWEA 3FQWA 1TMCA 2NYKA 4I4WA 3UTQA 3MRQA 3QZWA 4L8SC 1KJMA 1LEKA 1I1AA 1QLFA 3GMNA 3BXNA 3MV7A 4LCCC 3RZCA 1N59A 5GSRA 1XH3A 2ZOLA 3D25A 3ES6A 1YDPA 2F54A 4HUVA 4MQ7A 2H26A 4G8IA 3B3IA 3E6HA 1UXSA 4HUUA 3BZEA 4MX7A 4G9FA 2OI9A 3ROOA 1KPVA 4APQA 4G59C 3RL2A 3KYOA 1A9BA 1AGEA 1ED3A 2FWOA 3QEQA 1U58A 1HSAA 2F53A 3QFDA 4JRXA 4MNGA 4ZAKA 1FFNA 3D39A 2GT9A 4L4TA 4O2EA 2YPLA 3V5DA 5HYJA 4UQ3A 1LK2A 1AGFA 2X4OA 5HGHA 5IROA 1B0RA 3KWWA 3QULA 4LNRA 1ZHKA 4ZUWA 4PJXA 3FOLA 3BW9A 3TBVA 1T7YA 2ZOKA 3D2UA 3KPLA 5GSVA 3MV9A 5EUOA 3LKRA 1A9EA 2VAAA 1B3JA 1ZHBA 1T7XA 4U6XA 4F7MA 3FQRA 1T7WA 5E8NA 5C07A 3CCHA 3QDJA 5SWQA 5F1IA 5HHNA 4NHUE 4F7TA 2RFXA 1TVHA 2HJLA 1LDPH 1WBZA 5HGAA 2ZSWA 5INCA 1T7ZA 1FZJA 1QQDA 1S7XA 3TZVC 3M17A 1JPGA 3MRGA 4JFEA 1KPRA 4IIQC 4NQDA 1S9WA 4IRJA 3FTGA 5C0GA 1JGDA 3TF7A 1T1YA 1FZOA 4X6DA 4D0BA 1JPFA 5F9JA 4HS3A 4PJ5A 3I6KA 3RWGA 3OXSA 3P4OA 2BSTA 4GKSA 2FIKA 5C09A 2X4NA 1EFXA 1AGCA 1ZHLA 2F74A 4PDCE 3VXRA 5HHPA 3HUJA 4HUWA 4D0DA 3QDGA 3KXFA 3S6CA 3KPOA 4N0FA 4HUXA 3X13A 3VFPA 4CW1A 4HX1A 4PJHA 1QRNA 4Y2DA 1C16A 1KJ2H 3E3QA 2AXFA 4PJ7A 1KCGC 1DUYA 3DXAA 3TFKA 5EFIA 3BHBA 4PJBA 3T8XA 1NAMH 3BEVA 3FQXA 5IB2A 3FT2A 1M6OA 1ONQA 1P4LA 2BSRA 1FG2A 4NO0A 4JQXA 5EOTA 1P7QA 2ZSVA 3JTTA 4NNXA 2CKBH 3KPRA 4ZUVA 1JE6A 4L8BA 3BEWA 4ONOA 3DX7A 2GJ6A 1G7PA 2BVOA 4L4VA 4PGDA 2VABA 4N8VA 1QSEA 3QUZA 5H94A 1G7QA 3L3GA 3SDXA 1OGTA 1S7TA
chains in the Genus database with same CATH topology
1RK1A 4LCYA 3VRIA 3P9MA 1FFOA 3BVNA 5FA3A 1TVBA 2E7LE 3GMLA 3ARGA 1T1ZA 3QFJA 4O2CA 1JUFA 1KTLA 1UQSA 5EO0A 3PWUA 5HGDA 3RTQA 3W39A 3UTSA 1AO7A 1FFPA 1Z5LA 4PP8C 3MGTA 1XR9A 3RWDA 4JRYA 4LCWA 1X7QA 2VLJA 3LKNA 5D7IA 3VXPA 5C0CA 3GSOA 2VLRA 4NQCA 3ERYA 3GMMA 2XFXA 1FZMA 3QDMA 5C0DA 1OGAA 4U1LA 4FFEX 3OXRA 1HHIA 1PQZA 2PO6A 3RWIA 4PRAA 3LN4A 3LKOA 5L2KA 1WBXA 2AV1A 1UXWA 3BH9A 1L8JA 3MRDA 3MRRA 3H7BA 4ZUTA 4QRUA 5IEHA 3BO8A 1FO0H 3GSVA 3W0WA 3MRHA 3KYNA 2Q7YA 1ZHNA 4HKJA 1OSZA 3MYJA 3TN0A 3SPVA 3T1FA 4GUPA 3JTSA 3GSNH 3ECBA 1CG9A 3MROA 1W0WA 3H9SA 3DX6A 1YPZA 1T0MA 1T7VA 3FQUA 1YN7A 4U6YA 5C0BA 1SYVA 3WLBA 3ARBA 1RK0A 1E27A 5FDWA 3MRBA 4QRSA 4JFQA 3HG1A 4K7FA 5C0JA 1ZT4A 4MJ6A 4V3EB 4Y4HA 3VFUA 3VFVA 5HHQA 4L8CA 2VE6A 3X11A 1VGKA 3TIDA 4PRBA 4G42A 3KPSA 4U1IA 3MA7A 2HN7A 3L3IA 3MRIA 1A1NA 4PJFA 3VFSA 3VXSA 2AK4A 5B39A 3WS3A 5C0FA 4PJ9A 2BVPA 3VFRA 2PYEA 3O4LA 5MEPA 2D31A 3FONA 4JFDA 2P5WA 3TBWA 1MWAH 3SDAA 3GIVA 3X14A 1A1OA 3VRJA 2AV7A 1T0NA 5IEKA 1WBYA 3ILQC 3MRJA 1QVOA 1AKJA 3LKSA 1CE6A 1ZVSA 2GUOA 3QI9A 5EU3A 3MRNA 3DMMA 3D3VA 1JHTA 5HHMA 2CIIA 1BQHA 3LN5A 3UBXA 3PWVA 4JFFA 4WU5A 1ZSDA 4PJIA 3PWLA 4WW2C 3TBTA 1N2RA 3WL9A 1RJZA 2AXGA 2AKRA 2A83A 5BRZA 4WDIA 1QO3A 1LP9A 4NO2A 1I7TA 3RUGA 5BXFA 1Q94A 4PV9A 2FYYA 4MS8A 5AD0A 3MRFA 3PABA 1M05A 1KPUA 4EUPA 3BP4A 2MHAA 4ZUSA 5D7LA 1S7QA 2H6PA 1I7UA 3PQYA 5IB1A 2VLKA 3RL1A 3D18A 2J8UA 1VACA 1KJVA 2CLZA 2CLVA 5J6GA 3E6FA 1DE4A 4NNYA 4U1HA 3RWFA 3P4NA 3WUWA 3QUYA 4NQVA 1LD9A 1IM3A 1S9XA 5EU6A 4Z78A 3O8XA 3I6LD 1FZKA 3CC5A 2FZ3A 3KPMA 3GMRA 3M1BA 1NEZA 3UPRA 4PJCA 2OL3H 1R3HA 3PWNA 4WU7A 3HCVA 1A1MA 3CVHA 3AREA 3TJHA 4X6FA 1GZQA 1HSBA 3QUKA 3RGVC 2XPGA 1S7SA 1QEWA 3KPPA 3MV8A 3TBSA 1W0VA 3FOMA 4Y4FA 5D7JC 5DEGA 3SDDA 1T1WA 3C9NA 4CVXA 1EXUA 3GMPA 5EU5A 3TPUE 2X4PA 3GMOA 1ZAGA 4U1NA 5D2NA 3QQ4A 3O3EA 3GSRA 3GJFA 3CH1A 5D5MA 1MI5A 5E8OA 2DYPA 3GSWA 5INDA 1T80A 4MNQA 3KPQA 4PREA 5L2JA 1RJYA 3TO2A 4PGCA 4L8DA 1HHGA 1HHJA 4QRTA 3MRMA 4PGEA 4ZUUA 3FT3A 1MHEA 5IB4A 4HV8A 2GTWA 4D0CA 3PWJA 4NSKA 4XXCA 1BD2A 1S7RA 4NT6A 5C0EA 4ZFZA 3BWAA 3TA3A 3HLAA 5SWSA 3QQ3A 1S7UA 4ELMA 1HYRC 3L3DA 4JQVA 5ISZA 3AM8A 3MRCA 4WJ5A 3RWJA 1DUZA 2X4RA 4X6EA 3P4MA 3VFMA 1BZ9A 1XR8A 1ZT1A 4PRHA 5EU4A 4QOKA 5IVXA 3LV3A 5J1AA 4CVZA 3FT4A 4NO5A 5C9JA 3BH8A 4S0UC 4EN3C 4PJEA 1W72A 1I1FA 2CLRA 5C0AA 3BGMA 3VWKA 2NX5A 5BJTA 4F7EA 1IM9A 3GMQA 3E2HA 3P73A 2CIKA 4MJ5A 4G59A 3V5KA 4U1KA 3KLAA 4E0RA 4GKNA 3VXMA 1BIIA 3VXNA 1HOCA 2V2WA 4MVBA 1K8DA 4PJAA 3MRKA 3SKMA 2X4UA 3CPLA 4N5EA 1CD1A 5F1NA 4E5XA 3O3DA 4HWZA 2BVQA 3VH8A 3FFCA 4NO3A 3OX8A 3P77A 3FQNA 2NW3A 1S9YA 1KBGH 1HHHA 4PJGA 2BNRA 4PRIA 4QRQA 1I4FA 5FKPA 1S8DA 3GSQA 5JHDA 5MEQA 3H9HA 3HE7A 3HAEA 4WUUA 5D2LA 2BNQA 4U1SA 3MREA 3BUYA 1ZT7A 5MERA 4Y4KA 1JF1A 4MJIA 3QUXA 4WO4A 3SKOA 3FQTA 4IRSA 3GSUA 3B6SA 3MRPA 5E00A 3REWA 3IT8D 3L9RA 4IHOA 2YEZA 3I6GA 1MHCA 1S7VA 3DX8A 3O3BA 3VFOA 3C8KA 2UWEA 1INQA 1P1ZA 3VFWA 2YPKA 3TVMA 3WS6A 5ACZA 3BZFA 3JVGA 4G8GA 4N0UA 5E6IC 5J6HA 3TBYA 3CZFA 5SWZA 4JFPA 3PWPA 3CDGA 2JCCA 3L3KA 4EI5A 4NQEA 1T1XA 3O3AA 4L9LC 4PJDA 2BCKA 1N5AA 4LHUA 3IXAA 5MENA 1LEGA 2HLAA 4Y16A 3P9LA 4F7PA 3VXOA 3V5HA 1HHKA 4PG9A 4PR5A 5E8PA 1T20A 3GSXA 5FA4A 4QRPA 2BSSA 4O2FA 2GITA 1T22A 4L3CA 1I7RA 1EEYA 3LKPA 3SCMA 5C0IA 2ESVA 4NQXA 5E9DA 5HHOA 1LQVA 1QSFA 2C7UA 3X12A 5HGBA 1N3NA 2FO4A 3MRLA 1SYSA 3HPJA 4L29A 4PJ8A 4UQ2A 2HJKA 1NANH 1AGBA 3OV6A 4I48A 3RWCA 5F7DA 3UTTA 1VADA 3O9WA 5EO1A 3ROLA 4U1JA 4X6CA 1I1YA 5B38A 3ARFA 4G9DA 5IB3A 3JTCA 3DTXA 3DBXA 3TIEA 4K71B 1EEZA 5DDHA 3VCLA 4WWKC 1YN6A 2P5EA 4PG2A 3KPNA 2V2XA 4MXQA 2X4TA 5C08A 1S7WA 3SDCA 1QR1A 1K5NA 3VWJA 4N0CA 3L3JA 3MGOA 3LKQA 3ILPA 5D9SA 1JFMA 1G6RH 2WY3A 3SJVA 1A6ZA 1JGEA 4FTVA 3VXUA 3G08A 4PGBA 5MEOA 1B0GA 3BP7A 3FRUA 1OF2A 3VFNA 4QRRA 4JFOA 3AU1A 1ZS8A 2GAZA 2X4SA 4PRNA 4V3DB 1T21A 1AGDA 3VJ6A 3HE6A 4L3EA 3RWHA 1GZPA 4G43A 4Z76A 4Z77A 4PRDA 3L3HA 3TO4A 3MR9A 3ARDA 1DDHA 5DEFA 5IB5A 1KJ3H 3NFNA 2X70A 2GTZA 5ENWA 5BS0A 2X4QA 1XZ0A 4PV8A 5IM7A 4F7CA 4PRPA 2VLLA 3U0PA 1E28A 4U1MA 3VFTA 3RWEA 3FQWA 1TMCA 4I4WA 3UTQA 3MRQA 3QZWA 4L8SC 1KJMA 1LEKA 1I1AA 1QLFA 3GMNA 3BXNA 3MV7A 4LCCC 3RZCA 1N59A 5GSRA 1XH3A 2ZOLA 3D25A 3ES6A 1YDPA 2F54A 4HUVA 4MQ7A 2H26A 4G8IA 3B3IA 3E6HA 1UXSA 4HUUA 3BZEA 4MX7A 4G9FA 2OI9A 3ROOA 1KPVA 4APQA 3RL2A 3KYOA 1A9BA 1AGEA 1ED3A 2FWOA 3QEQA 1U58A 1HSAA 2F53A 3QFDA 4JRXA 4MNGA 4ZAKA 1FFNA 3D39A 2GT9A 4L4TA 4O2EA 2YPLA 3V5DA 5HYJA 4UQ3A 1LK2A 1AGFA 2X4OA 5HGHA 5IROA 1B0RA 3KWWA 3QULA 4LNRA 1ZHKA 4ZUWA 4PJXA 3FOLA 3BW9A 3TBVA 1T7YA 2ZOKA 3D2UA 3KPLA 5GSVA 3MV9A 5EUOA 3LKRA 1A9EA 2VAAA 1B3JA 1ZHBA 1T7XA 4U6XA 4F7MA 3FQRA 1T7WA 5E8NA 5C07A 3CCHA 3QDJA 5SWQA 5F1IA 5HHNA 4NHUE 4F7TA 2RFXA 1TVHA 2HJLA 1LDPH 1WBZA 5HGAA 2ZSWA 5INCA 1T7ZA 1FZJA 1QQDA 1S7XA 3TZVC 3M17A 1JPGA 3MRGA 4JFEA 1KPRA 4IIQC 4NQDA 1S9WA 4IRJA 3FTGA 5C0GA 1JGDA 3TF7A 1T1YA 1FZOA 4X6DA 4D0BA 1JPFA 5F9JA 4HS3A 4PJ5A 3I6KA 3RWGA 3OXSA 3P4OA 2BSTA 4GKSA 2FIKA 5C09A 2X4NA 1EFXA 1AGCA 1ZHLA 2F74A 4PDCE 3VXRA 5HHPA 3HUJA 4HUWA 4D0DA 3QDGA 3KXFA 3S6CA 3KPOA 4N0FA 4HUXA 3X13A 3VFPA 4CW1A 4HX1A 4PJHA 1QRNA 4Y2DA 1C16A 1KJ2H 3E3QA 2AXFA 4PJ7A 1KCGC 1DUYA 3DXAA 3TFKA 5EFIA 3BHBA 4PJBA 3T8XA 1NAMH 3BEVA 3FQXA 5IB2A 3FT2A 1M6OA 1ONQA 1P4LA 2BSRA 1FG2A 4NO0A 4JQXA 5EOTA 1P7QA 2ZSVA 3JTTA 4NNXA 2CKBH 3KPRA 4ZUVA 1JE6A 4L8BA 3BEWA 4ONOA 2GJ6A 1G7PA 3DX7A 2BVOA 4L4VA 4PGDA 2VABA 4N8VA 1QSEA 3QUZA 5H94A 1G7QA 3L3GA 3SDXA 1OGTA 1S7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RK1 A;  4LCY A;  3VRI A;  3P9M A;  1FFO A;  3BVN A;  5FA3 A;  1TVB A;  2E7L E;  3GML A;  3ARG A;  1T1Z A;  3QFJ A;  4O2C A;  1JUF A;  1KTL A;  1UQS A;  5EO0 A;  3PWU A;  5HGD A;  3RTQ A;  3W39 A;  3UTS A;  1AO7 A;  1FFP A;  1Z5L A;  4PP8 C;  3MGT A;  1XR9 A;  3RWD A;  4JRY A;  4LCW A;  1X7Q A;  2VLJ A;  3LKN A;  5D7I A;  3VXP A;  5C0C A;  3GSO A;  2VLR A;  4NQC A;  3ERY A;  3GMM A;  2XFX A;  1FZM A;  3QDM A;  5C0D A;  1OGA A;  4U1L A;  4FFE X;  3OXR A;  1HHI A;  1PQZ A;  2PO6 A;  3RWI A;  4PRA A;  3LN4 A;  3LKO A;  5L2K A;  1WBX A;  2AV1 A;  1UXW A;  3BH9 A;  1L8J A;  3MRD A;  3MRR A;  3H7B A;  4ZUT A;  4QRU A;  5IEH A;  3BO8 A;  1FO0 H;  3GSV A;  3W0W A;  3MRH A;  3KYN A;  2Q7Y A;  1ZHN A;  4HKJ A;  1OSZ A;  3MYJ A;  3TN0 A;  3SPV A;  3T1F A;  4GUP A;  3JTS A;  3GSN H;  3ECB A;  1CG9 A;  3MRO A;  1W0W A;  3H9S A;  3DX6 A;  1YPZ A;  1T0M A;  1T7V A;  3FQU A;  1YN7 A;  4U6Y A;  5C0B A;  1SYV A;  3WLB A;  3ARB A;  1RK0 A;  1E27 A;  5FDW A;  3MRB A;  4QRS A;  4JFQ A;  3HG1 A;  4K7F A;  5C0J A;  1ZT4 A;  4MJ6 A;  4V3E B;  4Y4H A;  3VFU A;  3VFV A;  5HHQ A;  4L8C A;  2VE6 A;  3X11 A;  1VGK A;  3TID A;  4PRB A;  4G42 A;  3KPS A;  4U1I A;  3MA7 A;  2HN7 A;  3L3I A;  3MRI A;  1A1N A;  4PJF A;  3VFS A;  3VXS A;  2AK4 A;  5B39 A;  3WS3 A;  5C0F A;  4PJ9 A;  2BVP A;  3VFR A;  2PYE A;  3O4L A;  5MEP A;  2D31 A;  3FON A;  4JFD A;  2P5W A;  3TBW A;  1MWA H;  3SDA A;  3GIV A;  3X14 A;  1A1O A;  3VRJ A;  2AV7 A;  1T0N A;  5IEK A;  1WBY A;  3ILQ C;  3MRJ A;  1QVO A;  1AKJ A;  3LKS A;  1CE6 A;  1ZVS A;  2GUO A;  3QI9 A;  5EU3 A;  3MRN A;  3DMM A;  3D3V A;  1JHT A;  5HHM A;  2CII A;  1BQH A;  3LN5 A;  3UBX A;  3PWV A;  4JFF A;  4WU5 A;  1ZSD A;  4PJI A;  3PWL A;  4WW2 C;  3TBT A;  1N2R A;  3WL9 A;  1RJZ A;  2AXG A;  2AKR A;  2A83 A;  5BRZ A;  4WDI A;  1QO3 A;  1LP9 A;  4NO2 A;  1I7T A;  3RUG A;  5BXF A;  1Q94 A;  4PV9 A;  2FYY A;  4MS8 A;  5AD0 A;  3MRF A;  3PAB A;  1M05 A;  1KPU A;  4EUP A;  3BP4 A;  2MHA A;  4ZUS A;  5D7L A;  1S7Q A;  2H6P A;  1I7U A;  3PQY A;  5IB1 A;  2VLK A;  3RL1 A;  3D18 A;  2J8U A;  1VAC A;  1KJV A;  2CLZ A;  2CLV A;  5J6G A;  3E6F A;  1DE4 A;  4NNY A;  4U1H A;  3RWF A;  3P4N A;  3WUW A;  3QUY A;  4NQV A;  1LD9 A;  1IM3 A;  1S9X A;  5EU6 A;  4Z78 A;  3O8X A;  3I6L D;  1FZK A;  3CC5 A;  2FZ3 A;  3KPM A;  3GMR A;  3M1B A;  1NEZ A;  3UPR A;  4PJC A;  2OL3 H;  1R3H A;  3PWN A;  4WU7 A;  3HCV A;  1A1M A;  3CVH A;  3ARE A;  3TJH A;  4X6F A;  1GZQ A;  1HSB A;  3QUK A;  3RGV C;  2XPG A;  1S7S A;  1QEW A;  3KPP A;  3MV8 A;  3TBS A;  1W0V A;  3FOM A;  4Y4F A;  5D7J C;  5DEG A;  3SDD A;  1T1W A;  3C9N A;  4CVX A;  1EXU A;  3GMP A;  5EU5 A;  3TPU E;  2X4P A;  3GMO A;  1ZAG A;  4U1N A;  5D2N A;  3QQ4 A;  3O3E A;  3GSR A;  3GJF A;  3CH1 A;  5D5M A;  1MI5 A;  5E8O A;  2DYP A;  3GSW A;  5IND A;  1T80 A;  4MNQ A;  3KPQ A;  4PRE A;  5L2J A;  1RJY A;  3TO2 A;  4PGC A;  4L8D A;  1HHG A;  1HHJ A;  4QRT A;  3MRM A;  4PGE A;  4ZUU A;  3FT3 A;  1MHE A;  5IB4 A;  4HV8 A;  2GTW A;  4D0C A;  3PWJ A;  4NSK A;  4XXC A;  1BD2 A;  1S7R A;  4NT6 A;  5C0E A;  4ZFZ A;  3BWA A;  3TA3 A;  3HLA A;  5SWS A;  3QQ3 A;  1S7U A;  4ELM A;  1HYR C;  3L3D A;  4JQV A;  5ISZ A;  3AM8 A;  3MRC A;  4WJ5 A;  3RWJ A;  1DUZ A;  2X4R A;  4X6E A;  3P4M A;  3VFM A;  1BZ9 A;  1XR8 A;  1ZT1 A;  4PRH A;  5EU4 A;  4QOK A;  5IVX A;  3LV3 A;  5J1A A;  4CVZ A;  3FT4 A;  4NO5 A;  5C9J A;  3BH8 A;  4S0U C;  4EN3 C;  4PJE A;  1W72 A;  1I1F A;  2CLR A;  5C0A A;  3BGM A;  3VWK A;  2NX5 A;  5BJT A;  4F7E A;  1IM9 A;  3GMQ A;  3E2H A;  3P73 A;  2CIK A;  4MJ5 A;  4G59 A;  3V5K A;  4U1K A;  3KLA A;  4E0R A;  4GKN A;  3VXM A;  1BII A;  3VXN A;  1HOC A;  2V2W A;  4MVB A;  1K8D A;  4PJA A;  3MRK A;  3SKM A;  2X4U A;  3CPL A;  4N5E A;  1CD1 A;  5F1N A;  4E5X A;  3O3D A;  4HWZ A;  2BVQ A;  3VH8 A;  3FFC A;  4NO3 A;  3OX8 A;  3P77 A;  3FQN A;  2NW3 A;  1S9Y A;  1KBG H;  1HHH A;  4PJG A;  2BNR A;  4PRI A;  4QRQ A;  1I4F A;  5FKP A;  1S8D A;  3GSQ A;  5JHD A;  5MEQ A;  3H9H A;  3HE7 A;  3HAE A;  4WUU A;  5D2L A;  2BNQ A;  4U1S A;  3MRE A;  3BUY A;  1ZT7 A;  5MER A;  4Y4K A;  1JF1 A;  4MJI A;  3QUX A;  4WO4 A;  3SKO A;  3FQT A;  4IRS A;  3GSU A;  3B6S A;  3MRP A;  5E00 A;  3REW A;  3IT8 D;  3L9R A;  4IHO A;  2YEZ A;  3I6G A;  1MHC A;  1S7V A;  3DX8 A;  3O3B A;  3VFO A;  3C8K A;  2UWE A;  1INQ A;  1P1Z A;  3VFW A;  2YPK A;  3TVM A;  3WS6 A;  5ACZ A;  3BZF A;  3JVG A;  4G8G A;  4N0U A;  5E6I C;  5J6H A;  3TBY A;  3CZF A;  5SWZ A;  4JFP A;  3PWP A;  3CDG A;  2JCC A;  3L3K A;  4EI5 A;  4NQE A;  1T1X A;  3O3A A;  4L9L C;  4PJD A;  2BCK A;  1N5A A;  4LHU A;  3IXA A;  5MEN A;  1LEG A;  2HLA A;  4Y16 A;  3P9L A;  4F7P A;  3VXO A;  3V5H A;  1HHK A;  4PG9 A;  4PR5 A;  5E8P A;  1T20 A;  3GSX A;  5FA4 A;  4QRP A;  2BSS A;  4O2F A;  2GIT A;  1T22 A;  4L3C A;  1I7R A;  1EEY A;  3LKP A;  3SCM A;  5C0I A;  2ESV A;  4NQX A;  5E9D A;  5HHO A;  1LQV A;  1QSF A;  2C7U A;  3X12 A;  5HGB A;  1N3N A;  2FO4 A;  3MRL A;  1SYS A;  3HPJ A;  4L29 A;  4PJ8 A;  4UQ2 A;  2HJK A;  1NAN H;  1AGB A;  3OV6 A;  4I48 A;  3RWC A;  5F7D A;  3UTT A;  1VAD A;  3O9W A;  5EO1 A;  3ROL A;  4U1J A;  4X6C A;  1I1Y A;  5B38 A;  3ARF A;  4G9D A;  5IB3 A;  3JTC A;  3DTX A;  3DBX A;  3TIE A;  4K71 B;  1EEZ A;  5DDH A;  3VCL A;  4WWK C;  1YN6 A;  2P5E A;  4PG2 A;  3KPN A;  2V2X A;  4MXQ A;  2X4T A;  5C08 A;  1S7W A;  3SDC A;  1QR1 A;  1K5N A;  3VWJ A;  4N0C A;  3L3J A;  3MGO A;  3LKQ A;  3ILP A;  5D9S A;  1JFM A;  1G6R H;  2WY3 A;  3SJV A;  1A6Z A;  1JGE A;  4FTV A;  3VXU A;  3G08 A;  4PGB A;  5MEO A;  1B0G A;  3BP7 A;  3FRU A;  1OF2 A;  3VFN A;  4QRR A;  4JFO A;  3AU1 A;  1ZS8 A;  2GAZ A;  2X4S A;  4PRN A;  4V3D B;  1T21 A;  1AGD A;  3VJ6 A;  3HE6 A;  4L3E A;  3RWH A;  1GZP A;  4G43 A;  4Z76 A;  4Z77 A;  4PRD A;  3L3H A;  3TO4 A;  3MR9 A;  3ARD A;  1DDH A;  5DEF A;  5IB5 A;  1KJ3 H;  3NFN A;  2X70 A;  2GTZ A;  5ENW A;  5BS0 A;  2X4Q A;  1XZ0 A;  4PV8 A;  5IM7 A;  4F7C A;  4PRP A;  2VLL A;  3U0P A;  1E28 A;  4U1M A;  3VFT A;  3RWE A;  3FQW A;  1TMC A;  4I4W A;  3UTQ A;  3MRQ A;  3QZW A;  4L8S C;  1KJM A;  1LEK A;  1I1A A;  1QLF A;  3GMN A;  3BXN A;  3MV7 A;  4LCC C;  3RZC A;  1N59 A;  5GSR A;  1XH3 A;  2ZOL A;  3D25 A;  3ES6 A;  1YDP A;  2F54 A;  4HUV A;  4MQ7 A;  2H26 A;  4G8I A;  3B3I A;  3E6H A;  1UXS A;  4HUU A;  3BZE A;  4MX7 A;  4G9F A;  2OI9 A;  3ROO A;  1KPV A;  4APQ A;  3RL2 A;  3KYO A;  1A9B A;  1AGE A;  1ED3 A;  2FWO A;  3QEQ A;  1U58 A;  1HSA A;  2F53 A;  3QFD A;  4JRX A;  4MNG A;  4ZAK A;  1FFN A;  3D39 A;  2GT9 A;  4L4T A;  4O2E A;  2YPL A;  3V5D A;  5HYJ A;  4UQ3 A;  1LK2 A;  1AGF A;  2X4O A;  5HGH A;  5IRO A;  1B0R A;  3KWW A;  3QUL A;  4LNR A;  1ZHK A;  4ZUW A;  4PJX A;  3FOL A;  3BW9 A;  3TBV A;  1T7Y A;  2ZOK A;  3D2U A;  3KPL A;  5GSV A;  3MV9 A;  5EUO A;  3LKR A;  1A9E A;  2VAA A;  1B3J A;  1ZHB A;  1T7X A;  4U6X A;  4F7M A;  3FQR A;  1T7W A;  5E8N A;  5C07 A;  3CCH A;  3QDJ A;  5SWQ A;  5F1I A;  5HHN A;  4NHU E;  4F7T A;  2RFX A;  1TVH A;  2HJL A;  1LDP H;  1WBZ A;  5HGA A;  2ZSW A;  5INC A;  1T7Z A;  1FZJ A;  1QQD A;  1S7X A;  3TZV C;  3M17 A;  1JPG A;  3MRG A;  4JFE A;  1KPR A;  4IIQ C;  4NQD A;  1S9W A;  4IRJ A;  3FTG A;  5C0G A;  1JGD A;  3TF7 A;  1T1Y A;  1FZO A;  4X6D A;  4D0B A;  1JPF A;  5F9J A;  4HS3 A;  4PJ5 A;  3I6K A;  3RWG A;  3OXS A;  3P4O A;  2BST A;  4GKS A;  2FIK A;  5C09 A;  2X4N A;  1EFX A;  1AGC A;  1ZHL A;  2F74 A;  4PDC E;  3VXR A;  5HHP A;  3HUJ A;  4HUW A;  4D0D A;  3QDG A;  3KXF A;  3S6C A;  3KPO A;  4N0F A;  4HUX A;  3X13 A;  3VFP A;  4CW1 A;  4HX1 A;  4PJH A;  1QRN A;  4Y2D A;  1C16 A;  1KJ2 H;  3E3Q A;  2AXF A;  4PJ7 A;  1KCG C;  1DUY A;  3DXA A;  3TFK A;  5EFI A;  3BHB A;  4PJB A;  3T8X A;  1NAM H;  3BEV A;  3FQX A;  5IB2 A;  3FT2 A;  1M6O A;  1ONQ A;  1P4L A;  2BSR A;  1FG2 A;  4NO0 A;  4JQX A;  5EOT A;  1P7Q A;  2ZSV A;  3JTT A;  4NNX A;  2CKB H;  3KPR A;  4ZUV A;  1JE6 A;  4L8B A;  3BEW A;  4ONO A;  2GJ6 A;  1G7P A;  3DX7 A;  2BVO A;  4L4V A;  4PGD A;  2VAB A;  4N8V A;  1QSE A;  3QUZ A;  5H94 A;  1G7Q A;  3L3G A;  3SDX A;  1OGT A;  1S7T A; 
#chains in the Genus database with same CATH topology
 1RK1 A;  4LCY A;  3VRI A;  3P9M A;  1FFO A;  3BVN A;  5FA3 A;  1TVB A;  2E7L E;  3GML A;  3ARG A;  1T1Z A;  3QFJ A;  4O2C A;  1JUF A;  1KTL A;  1UQS A;  5EO0 A;  3PWU A;  5HGD A;  3RTQ A;  3W39 A;  3UTS A;  1AO7 A;  1FFP A;  1Z5L A;  4PP8 C;  3MGT A;  1XR9 A;  3RWD A;  4JRY A;  4LCW A;  1X7Q A;  2VLJ A;  3LKN A;  5D7I A;  3VXP A;  5C0C A;  3GSO A;  2VLR A;  4NQC A;  3ERY A;  3GMM A;  2XFX A;  1FZM A;  3QDM A;  5C0D A;  1OGA A;  4U1L A;  4FFE X;  3OXR A;  1HHI A;  1PQZ A;  2PO6 A;  3RWI A;  4PRA A;  3LN4 A;  3LKO A;  5L2K A;  1WBX A;  2AV1 A;  1UXW A;  3BH9 A;  1L8J A;  3MRD A;  3MRR A;  3H7B A;  4ZUT A;  4QRU A;  5IEH A;  3BO8 A;  1FO0 H;  3GSV A;  3W0W A;  3MRH A;  3KYN A;  2Q7Y A;  1ZHN A;  4HKJ A;  1OSZ A;  3MYJ A;  3TN0 A;  3SPV A;  3T1F A;  4GUP A;  3JTS A;  3GSN H;  3ECB A;  1CG9 A;  3MRO A;  1W0W A;  3H9S A;  3DX6 A;  1YPZ A;  1T0M A;  1T7V A;  3FQU A;  1YN7 A;  4U6Y A;  5C0B A;  1SYV A;  3WLB A;  3ARB A;  1RK0 A;  1E27 A;  5FDW A;  3MRB A;  4QRS A;  4JFQ A;  3HG1 A;  4K7F A;  5C0J A;  1ZT4 A;  4MJ6 A;  4V3E B;  4Y4H A;  3VFU A;  3VFV A;  5HHQ A;  4L8C A;  2VE6 A;  3X11 A;  1VGK A;  3TID A;  4PRB A;  4G42 A;  3KPS A;  4U1I A;  3MA7 A;  2HN7 A;  3L3I A;  3MRI A;  1A1N A;  4PJF A;  3VFS A;  3VXS A;  2AK4 A;  5B39 A;  3WS3 A;  5C0F A;  4PJ9 A;  2BVP A;  3VFR A;  2PYE A;  3O4L A;  5MEP A;  2D31 A;  3FON A;  4JFD A;  2P5W A;  3TBW A;  1MWA H;  3SDA A;  3GIV A;  3X14 A;  1A1O A;  4JO8 A;  3VRJ A;  2AV7 A;  1T0N A;  5IEK A;  1WBY A;  3ILQ C;  3MRJ A;  1QVO A;  1AKJ A;  3LKS A;  1CE6 A;  1ZVS A;  2GUO A;  3QI9 A;  5EU3 A;  3MRN A;  3DMM A;  3D3V A;  1JHT A;  5HHM A;  2CII A;  1BQH A;  3LN5 A;  3UBX A;  3PWV A;  4JFF A;  4WU5 A;  1ZSD A;  4PJI A;  3PWL A;  4WW2 C;  3TBT A;  1N2R A;  3WL9 A;  1RJZ A;  2AXG A;  2AKR A;  2A83 A;  5BRZ A;  4WDI A;  1QO3 A;  1LP9 A;  4NO2 A;  1I7T A;  3RUG A;  5BXF A;  1Q94 A;  4PV9 A;  2FYY A;  4MS8 A;  5AD0 A;  3MRF A;  3PAB A;  1M05 A;  1KPU A;  4EUP A;  3BP4 A;  2MHA A;  4ZUS A;  5D7L A;  1S7Q A;  2H6P A;  1I7U A;  3PQY A;  5IB1 A;  2VLK A;  3RL1 A;  3D18 A;  2J8U A;  1VAC A;  1KJV A;  2CLZ A;  2CLV A;  5J6G A;  3E6F A;  1DE4 A;  4NNY A;  4U1H A;  3RWF A;  3P4N A;  3WUW A;  3QUY A;  4NQV A;  1LD9 A;  1IM3 A;  1S9X A;  5EU6 A;  4Z78 A;  3O8X A;  3I6L D;  1FZK A;  3CC5 A;  2FZ3 A;  3KPM A;  3GMR A;  3M1B A;  1NEZ A;  3UPR A;  4PJC A;  2OL3 H;  1R3H A;  3PWN A;  4WU7 A;  3HCV A;  1A1M A;  3CVH A;  3ARE A;  3TJH A;  4X6F A;  1GZQ A;  1HSB A;  3QUK A;  3RGV C;  2XPG A;  1S7S A;  1QEW A;  3KPP A;  3MV8 A;  3TBS A;  1W0V A;  3FOM A;  4Y4F A;  5D7J C;  5DEG A;  3SDD A;  1T1W A;  3C9N A;  4CVX A;  1EXU A;  3GMP A;  5EU5 A;  3TPU E;  2X4P A;  3GMO A;  1ZAG A;  4U1N A;  5D2N A;  3QQ4 A;  3O3E A;  3GSR A;  3GJF A;  3CH1 A;  5D5M A;  1MI5 A;  5E8O A;  2DYP A;  3GSW A;  5IND A;  1T80 A;  4MNQ A;  3KPQ A;  4PRE A;  5L2J A;  1RJY A;  3TO2 A;  4PGC A;  4L8D A;  1HHG A;  1HHJ A;  4QRT A;  3MRM A;  4PGE A;  4ZUU A;  3FT3 A;  1MHE A;  5IB4 A;  4HV8 A;  2GTW A;  4D0C A;  3PWJ A;  4NSK A;  4XXC A;  2O5N A;  1BD2 A;  1S7R A;  4NT6 A;  5C0E A;  4ZFZ A;  3BWA A;  3TA3 A;  3HLA A;  5SWS A;  3QQ3 A;  1S7U A;  4ELM A;  1HYR C;  3L3D A;  4JQV A;  5ISZ A;  3AM8 A;  3MRC A;  4WJ5 A;  3RWJ A;  1DUZ A;  2X4R A;  4X6E A;  3P4M A;  3VFM A;  1BZ9 A;  1XR8 A;  2IA1 A;  1ZT1 A;  4PRH A;  5EU4 A;  4QOK A;  5IVX A;  3LV3 A;  5J1A A;  4CVZ A;  3FT4 A;  4NO5 A;  5C9J A;  3BH8 A;  4S0U C;  4EN3 C;  4PJE A;  1W72 A;  1I1F A;  2CLR A;  5C0A A;  3BGM A;  3VWK A;  2NX5 A;  5BJT A;  4F7E A;  1IM9 A;  3GMQ A;  3E2H A;  3P73 A;  2CIK A;  4MJ5 A;  4G59 A;  3V5K A;  4U1K A;  3KLA A;  4E0R A;  4GKN A;  3VXM A;  1BII A;  3VXN A;  1HOC A;  2V2W A;  4MVB A;  1K8D A;  4PJA A;  3MRK A;  3SKM A;  2X4U A;  3CPL A;  4N5E A;  1CD1 A;  5F1N A;  4E5X A;  3O3D A;  4HWZ A;  2BVQ A;  3VH8 A;  3FFC A;  4NO3 A;  3OX8 A;  3P77 A;  3FQN A;  2NW3 A;  1S9Y A;  1KBG H;  1HHH A;  4PJG A;  2BNR A;  4PRI A;  4QRQ A;  1I4F A;  5FKP A;  1S8D A;  3GSQ A;  5JHD A;  5MEQ A;  3H9H A;  3HE7 A;  3HAE A;  4WUU A;  5D2L A;  2BNQ A;  4U1S A;  3MRE A;  3BUY A;  1ZT7 A;  5MER A;  4Y4K A;  1JF1 A;  4MJI A;  3QUX A;  4WO4 A;  3SKO A;  3FQT A;  4IRS A;  3GSU A;  3B6S A;  3MRP A;  5E00 A;  3REW A;  3IT8 D;  3L9R A;  4IHO A;  2YEZ A;  3I6G A;  1MHC A;  1S7V A;  3DX8 A;  3O3B A;  3VFO A;  3C8K A;  2UWE A;  1INQ A;  1P1Z A;  3VFW A;  2YPK A;  3TVM A;  3WS6 A;  5ACZ A;  3BZF A;  3JVG A;  4G8G A;  4N0U A;  5E6I C;  5J6H A;  3TBY A;  3CZF A;  5SWZ A;  4JFP A;  3PWP A;  3CDG A;  2JCC A;  3L3K A;  4EI5 A;  4NQE A;  1T1X A;  3O3A A;  4L9L C;  4PJD A;  2BCK A;  1N5A A;  4LHU A;  3IXA A;  5MEN A;  1LEG A;  2HLA A;  4Y16 A;  3P9L A;  4F7P A;  3VXO A;  3V5H A;  1HHK A;  4PG9 A;  4PR5 A;  5E8P A;  1T20 A;  3GSX A;  5FA4 A;  4QRP A;  2BSS A;  4O2F A;  2GIT A;  1T22 A;  4L3C A;  1I7R A;  1EEY A;  3LKP A;  3SCM A;  5C0I A;  4BKW A;  2ESV A;  4NQX A;  5E9D A;  5HHO A;  1LQV A;  1QSF A;  2C7U A;  3X12 A;  5HGB A;  1N3N A;  2FO4 A;  3MRL A;  1SYS A;  3HPJ A;  4L29 A;  4PJ8 A;  4UQ2 A;  2HJK A;  1NAN H;  1AGB A;  3OV6 A;  4I48 A;  3RWC A;  5F7D A;  3UTT A;  1VAD A;  3O9W A;  5EO1 A;  3ROL A;  4U1J A;  4X6C A;  1I1Y A;  5B38 A;  3ARF A;  4G9D A;  5IB3 A;  3JTC A;  3DTX A;  3DBX A;  3TIE A;  4K71 B;  1EEZ A;  5DDH A;  3VCL A;  4WWK C;  1YN6 A;  2P5E A;  4PG2 A;  3KPN A;  2V2X A;  4MXQ A;  2X4T A;  5C08 A;  1S7W A;  3SDC A;  1QR1 A;  1K5N A;  3VWJ A;  4N0C A;  3L3J A;  3MGO A;  3LKQ A;  3ILP A;  5D9S A;  1JFM A;  1G6R H;  2WY3 A;  3SJV A;  1A6Z A;  1JGE A;  4FTV A;  3VXU A;  3G08 A;  4PGB A;  5MEO A;  1B0G A;  3BP7 A;  3FRU A;  1OF2 A;  3VFN A;  4QRR A;  4JFO A;  3AU1 A;  1ZS8 A;  2GAZ A;  2X4S A;  4PRN A;  3I0T A;  4V3D B;  1T21 A;  1AGD A;  3VJ6 A;  3HE6 A;  4L3E A;  3RWH A;  1GZP A;  4G43 A;  4Z76 A;  4Z77 A;  4PRD A;  3L3H A;  3TO4 A;  3MR9 A;  3ARD A;  1DDH A;  5DEF A;  5IB5 A;  1KJ3 H;  3NFN A;  2X70 A;  2GTZ A;  5ENW A;  5BS0 A;  2X4Q A;  1XZ0 A;  4PV8 A;  5IM7 A;  4F7C A;  4PRP A;  2VLL A;  3U0P A;  1E28 A;  4U1M A;  3VFT A;  3RWE A;  3FQW A;  1TMC A;  2NYK A;  4I4W A;  3UTQ A;  3MRQ A;  3QZW A;  4L8S C;  1KJM A;  1LEK A;  1I1A A;  1QLF A;  3GMN A;  3BXN A;  3MV7 A;  4LCC C;  3RZC A;  1N59 A;  5GSR A;  1XH3 A;  2ZOL A;  3D25 A;  3ES6 A;  1YDP A;  2F54 A;  4HUV A;  4MQ7 A;  2H26 A;  4G8I A;  3B3I A;  3E6H A;  1UXS A;  4HUU A;  3BZE A;  4MX7 A;  4G9F A;  2OI9 A;  3ROO A;  1KPV A;  4APQ A;  4G59 C;  3RL2 A;  3KYO A;  1A9B A;  1AGE A;  1ED3 A;  2FWO A;  3QEQ A;  1U58 A;  1HSA A;  2F53 A;  3QFD A;  4JRX A;  4MNG A;  4ZAK A;  1FFN A;  3D39 A;  2GT9 A;  4L4T A;  4O2E A;  2YPL A;  3V5D A;  5HYJ A;  4UQ3 A;  1LK2 A;  1AGF A;  2X4O A;  5HGH A;  5IRO A;  1B0R A;  3KWW A;  3QUL A;  4LNR A;  1ZHK A;  4ZUW A;  4PJX A;  3FOL A;  3BW9 A;  3TBV A;  1T7Y A;  2ZOK A;  3D2U A;  3KPL A;  5GSV A;  3MV9 A;  5EUO A;  3LKR A;  1A9E A;  2VAA A;  1B3J A;  1ZHB A;  1T7X A;  4U6X A;  4F7M A;  3FQR A;  1T7W A;  5E8N A;  5C07 A;  3CCH A;  3QDJ A;  5SWQ A;  5F1I A;  5HHN A;  4NHU E;  4F7T A;  2RFX A;  1TVH A;  2HJL A;  1LDP H;  1WBZ A;  5HGA A;  2ZSW A;  5INC A;  1T7Z A;  1FZJ A;  1QQD A;  1S7X A;  3TZV C;  3M17 A;  1JPG A;  3MRG A;  4JFE A;  1KPR A;  4IIQ C;  4NQD A;  1S9W A;  4IRJ A;  3FTG A;  5C0G A;  1JGD A;  3TF7 A;  1T1Y A;  1FZO A;  4X6D A;  4D0B A;  1JPF A;  5F9J A;  4HS3 A;  4PJ5 A;  3I6K A;  3RWG A;  3OXS A;  3P4O A;  2BST A;  4GKS A;  2FIK A;  5C09 A;  2X4N A;  1EFX A;  1AGC A;  1ZHL A;  2F74 A;  4PDC E;  3VXR A;  5HHP A;  3HUJ A;  4HUW A;  4D0D A;  3QDG A;  3KXF A;  3S6C A;  3KPO A;  4N0F A;  4HUX A;  3X13 A;  3VFP A;  4CW1 A;  4HX1 A;  4PJH A;  1QRN A;  4Y2D A;  1C16 A;  1KJ2 H;  3E3Q A;  2AXF A;  4PJ7 A;  1KCG C;  1DUY A;  3DXA A;  3TFK A;  5EFI A;  3BHB A;  4PJB A;  3T8X A;  1NAM H;  3BEV A;  3FQX A;  5IB2 A;  3FT2 A;  1M6O A;  1ONQ A;  1P4L A;  2BSR A;  1FG2 A;  4NO0 A;  4JQX A;  5EOT A;  1P7Q A;  2ZSV A;  3JTT A;  4NNX A;  2CKB H;  3KPR A;  4ZUV A;  1JE6 A;  4L8B A;  3BEW A;  4ONO A;  3DX7 A;  2GJ6 A;  1G7P A;  2BVO A;  4L4V A;  4PGD A;  2VAB A;  4N8V A;  1QSE A;  3QUZ A;  5H94 A;  1G7Q A;  3L3G A;  3SDX A;  1OGT A;  1S7T A; 
#chains in the Genus database with same CATH homology
 1RK1 A;  4LCY A;  3VRI A;  3P9M A;  1FFO A;  3BVN A;  5FA3 A;  1TVB A;  2E7L E;  3GML A;  3ARG A;  1T1Z A;  3QFJ A;  4O2C A;  1JUF A;  1KTL A;  1UQS A;  5EO0 A;  3PWU A;  5HGD A;  3RTQ A;  3W39 A;  3UTS A;  1AO7 A;  1FFP A;  1Z5L A;  4PP8 C;  3MGT A;  1XR9 A;  3RWD A;  4JRY A;  4LCW A;  1X7Q A;  2VLJ A;  3LKN A;  5D7I A;  3VXP A;  5C0C A;  3GSO A;  2VLR A;  4NQC A;  3ERY A;  3GMM A;  2XFX A;  1FZM A;  3QDM A;  5C0D A;  1OGA A;  4U1L A;  4FFE X;  3OXR A;  1HHI A;  1PQZ A;  2PO6 A;  3RWI A;  4PRA A;  3LN4 A;  3LKO A;  5L2K A;  1WBX A;  2AV1 A;  1UXW A;  3BH9 A;  1L8J A;  3MRD A;  3MRR A;  3H7B A;  4ZUT A;  4QRU A;  5IEH A;  3BO8 A;  1FO0 H;  3GSV A;  3W0W A;  3MRH A;  3KYN A;  2Q7Y A;  1ZHN A;  4HKJ A;  1OSZ A;  3MYJ A;  3TN0 A;  3SPV A;  3T1F A;  4GUP A;  3JTS A;  3GSN H;  3ECB A;  1CG9 A;  3MRO A;  1W0W A;  3H9S A;  3DX6 A;  1YPZ A;  1T0M A;  1T7V A;  3FQU A;  1YN7 A;  4U6Y A;  5C0B A;  1SYV A;  3WLB A;  3ARB A;  1RK0 A;  1E27 A;  5FDW A;  3MRB A;  4QRS A;  4JFQ A;  3HG1 A;  4K7F A;  5C0J A;  1ZT4 A;  4MJ6 A;  4V3E B;  4Y4H A;  3VFU A;  3VFV A;  5HHQ A;  4L8C A;  2VE6 A;  3X11 A;  1VGK A;  3TID A;  4PRB A;  4G42 A;  3KPS A;  4U1I A;  3MA7 A;  2HN7 A;  3L3I A;  3MRI A;  1A1N A;  4PJF A;  3VFS A;  3VXS A;  2AK4 A;  5B39 A;  3WS3 A;  5C0F A;  4PJ9 A;  2BVP A;  3VFR A;  2PYE A;  3O4L A;  5MEP A;  2D31 A;  3FON A;  4JFD A;  2P5W A;  3TBW A;  1MWA H;  3SDA A;  3GIV A;  3X14 A;  1A1O A;  3VRJ A;  2AV7 A;  1T0N A;  5IEK A;  1WBY A;  3ILQ C;  3MRJ A;  1QVO A;  1AKJ A;  3LKS A;  1CE6 A;  1ZVS A;  2GUO A;  3QI9 A;  5EU3 A;  3MRN A;  3DMM A;  3D3V A;  1JHT A;  5HHM A;  2CII A;  1BQH A;  3LN5 A;  3UBX A;  3PWV A;  4JFF A;  4WU5 A;  1ZSD A;  4PJI A;  3PWL A;  4WW2 C;  3TBT A;  1N2R A;  3WL9 A;  1RJZ A;  2AXG A;  2AKR A;  2A83 A;  5BRZ A;  4WDI A;  1QO3 A;  1LP9 A;  4NO2 A;  1I7T A;  3RUG A;  5BXF A;  1Q94 A;  4PV9 A;  2FYY A;  4MS8 A;  5AD0 A;  3MRF A;  3PAB A;  1M05 A;  1KPU A;  4EUP A;  3BP4 A;  2MHA A;  4ZUS A;  5D7L A;  1S7Q A;  2H6P A;  1I7U A;  3PQY A;  5IB1 A;  2VLK A;  3RL1 A;  3D18 A;  2J8U A;  1VAC A;  1KJV A;  2CLZ A;  2CLV A;  5J6G A;  3E6F A;  1DE4 A;  4NNY A;  4U1H A;  3RWF A;  3P4N A;  3WUW A;  3QUY A;  4NQV A;  1LD9 A;  1IM3 A;  1S9X A;  5EU6 A;  4Z78 A;  3O8X A;  3I6L D;  1FZK A;  3CC5 A;  2FZ3 A;  3KPM A;  3GMR A;  3M1B A;  1NEZ A;  3UPR A;  4PJC A;  2OL3 H;  1R3H A;  3PWN A;  4WU7 A;  3HCV A;  1A1M A;  3CVH A;  3ARE A;  3TJH A;  4X6F A;  1GZQ A;  1HSB A;  3QUK A;  3RGV C;  2XPG A;  1S7S A;  1QEW A;  3KPP A;  3MV8 A;  3TBS A;  1W0V A;  3FOM A;  4Y4F A;  5D7J C;  5DEG A;  3SDD A;  1T1W A;  3C9N A;  4CVX A;  1EXU A;  3GMP A;  5EU5 A;  3TPU E;  2X4P A;  3GMO A;  1ZAG A;  4U1N A;  5D2N A;  3QQ4 A;  3O3E A;  3GSR A;  3GJF A;  3CH1 A;  5D5M A;  1MI5 A;  5E8O A;  2DYP A;  3GSW A;  5IND A;  1T80 A;  4MNQ A;  3KPQ A;  4PRE A;  5L2J A;  1RJY A;  3TO2 A;  4PGC A;  4L8D A;  1HHG A;  1HHJ A;  4QRT A;  3MRM A;  4PGE A;  4ZUU A;  3FT3 A;  1MHE A;  5IB4 A;  4HV8 A;  2GTW A;  4D0C A;  3PWJ A;  4NSK A;  4XXC A;  1BD2 A;  1S7R A;  4NT6 A;  5C0E A;  4ZFZ A;  3BWA A;  3TA3 A;  3HLA A;  5SWS A;  3QQ3 A;  1S7U A;  4ELM A;  1HYR C;  3L3D A;  4JQV A;  5ISZ A;  3AM8 A;  3MRC A;  4WJ5 A;  3RWJ A;  1DUZ A;  2X4R A;  4X6E A;  3P4M A;  3VFM A;  1BZ9 A;  1XR8 A;  1ZT1 A;  4PRH A;  5EU4 A;  4QOK A;  5IVX A;  3LV3 A;  5J1A A;  4CVZ A;  3FT4 A;  4NO5 A;  5C9J A;  3BH8 A;  4S0U C;  4EN3 C;  4PJE A;  1W72 A;  1I1F A;  2CLR A;  5C0A A;  3BGM A;  3VWK A;  2NX5 A;  5BJT A;  4F7E A;  1IM9 A;  3GMQ A;  3E2H A;  3P73 A;  2CIK A;  4MJ5 A;  4G59 A;  3V5K A;  4U1K A;  3KLA A;  4E0R A;  4GKN A;  3VXM A;  1BII A;  3VXN A;  1HOC A;  2V2W A;  4MVB A;  1K8D A;  4PJA A;  3MRK A;  3SKM A;  2X4U A;  3CPL A;  4N5E A;  1CD1 A;  5F1N A;  4E5X A;  3O3D A;  4HWZ A;  2BVQ A;  3VH8 A;  3FFC A;  4NO3 A;  3OX8 A;  3P77 A;  3FQN A;  2NW3 A;  1S9Y A;  1KBG H;  1HHH A;  4PJG A;  2BNR A;  4PRI A;  4QRQ A;  1I4F A;  5FKP A;  1S8D A;  3GSQ A;  5JHD A;  5MEQ A;  3H9H A;  3HE7 A;  3HAE A;  4WUU A;  5D2L A;  2BNQ A;  4U1S A;  3MRE A;  3BUY A;  1ZT7 A;  5MER A;  4Y4K A;  1JF1 A;  4MJI A;  3QUX A;  4WO4 A;  3SKO A;  3FQT A;  4IRS A;  3GSU A;  3B6S A;  3MRP A;  5E00 A;  3REW A;  3IT8 D;  3L9R A;  4IHO A;  2YEZ A;  3I6G A;  1MHC A;  1S7V A;  3DX8 A;  3O3B A;  3VFO A;  3C8K A;  2UWE A;  1INQ A;  1P1Z A;  3VFW A;  2YPK A;  3TVM A;  3WS6 A;  5ACZ A;  3BZF A;  3JVG A;  4G8G A;  4N0U A;  5E6I C;  5J6H A;  3TBY A;  3CZF A;  5SWZ A;  4JFP A;  3PWP A;  3CDG A;  2JCC A;  3L3K A;  4EI5 A;  4NQE A;  1T1X A;  3O3A A;  4L9L C;  4PJD A;  2BCK A;  1N5A A;  4LHU A;  3IXA A;  5MEN A;  1LEG A;  2HLA A;  4Y16 A;  3P9L A;  4F7P A;  3VXO A;  3V5H A;  1HHK A;  4PG9 A;  4PR5 A;  5E8P A;  1T20 A;  3GSX A;  5FA4 A;  4QRP A;  2BSS A;  4O2F A;  2GIT A;  1T22 A;  4L3C A;  1I7R A;  1EEY A;  3LKP A;  3SCM A;  5C0I A;  2ESV A;  4NQX A;  5E9D A;  5HHO A;  1LQV A;  1QSF A;  2C7U A;  3X12 A;  5HGB A;  1N3N A;  2FO4 A;  3MRL A;  1SYS A;  3HPJ A;  4L29 A;  4PJ8 A;  4UQ2 A;  2HJK A;  1NAN H;  1AGB A;  3OV6 A;  4I48 A;  3RWC A;  5F7D A;  3UTT A;  1VAD A;  3O9W A;  5EO1 A;  3ROL A;  4U1J A;  4X6C A;  1I1Y A;  5B38 A;  3ARF A;  4G9D A;  5IB3 A;  3JTC A;  3DTX A;  3DBX A;  3TIE A;  4K71 B;  1EEZ A;  5DDH A;  3VCL A;  4WWK C;  1YN6 A;  2P5E A;  4PG2 A;  3KPN A;  2V2X A;  4MXQ A;  2X4T A;  5C08 A;  1S7W A;  3SDC A;  1QR1 A;  1K5N A;  3VWJ A;  4N0C A;  3L3J A;  3MGO A;  3LKQ A;  3ILP A;  5D9S A;  1JFM A;  1G6R H;  2WY3 A;  3SJV A;  1A6Z A;  1JGE A;  4FTV A;  3VXU A;  3G08 A;  4PGB A;  5MEO A;  1B0G A;  3BP7 A;  3FRU A;  1OF2 A;  3VFN A;  4QRR A;  4JFO A;  3AU1 A;  1ZS8 A;  2GAZ A;  2X4S A;  4PRN A;  4V3D B;  1T21 A;  1AGD A;  3VJ6 A;  3HE6 A;  4L3E A;  3RWH A;  1GZP A;  4G43 A;  4Z76 A;  4Z77 A;  4PRD A;  3L3H A;  3TO4 A;  3MR9 A;  3ARD A;  1DDH A;  5DEF A;  5IB5 A;  1KJ3 H;  3NFN A;  2X70 A;  2GTZ A;  5ENW A;  5BS0 A;  2X4Q A;  1XZ0 A;  4PV8 A;  5IM7 A;  4F7C A;  4PRP A;  2VLL A;  3U0P A;  1E28 A;  4U1M A;  3VFT A;  3RWE A;  3FQW A;  1TMC A;  4I4W A;  3UTQ A;  3MRQ A;  3QZW A;  4L8S C;  1KJM A;  1LEK A;  1I1A A;  1QLF A;  3GMN A;  3BXN A;  3MV7 A;  4LCC C;  3RZC A;  1N59 A;  5GSR A;  1XH3 A;  2ZOL A;  3D25 A;  3ES6 A;  1YDP A;  2F54 A;  4HUV A;  4MQ7 A;  2H26 A;  4G8I A;  3B3I A;  3E6H A;  1UXS A;  4HUU A;  3BZE A;  4MX7 A;  4G9F A;  2OI9 A;  3ROO A;  1KPV A;  4APQ A;  3RL2 A;  3KYO A;  1A9B A;  1AGE A;  1ED3 A;  2FWO A;  3QEQ A;  1U58 A;  1HSA A;  2F53 A;  3QFD A;  4JRX A;  4MNG A;  4ZAK A;  1FFN A;  3D39 A;  2GT9 A;  4L4T A;  4O2E A;  2YPL A;  3V5D A;  5HYJ A;  4UQ3 A;  1LK2 A;  1AGF A;  2X4O A;  5HGH A;  5IRO A;  1B0R A;  3KWW A;  3QUL A;  4LNR A;  1ZHK A;  4ZUW A;  4PJX A;  3FOL A;  3BW9 A;  3TBV A;  1T7Y A;  2ZOK A;  3D2U A;  3KPL A;  5GSV A;  3MV9 A;  5EUO A;  3LKR A;  1A9E A;  2VAA A;  1B3J A;  1ZHB A;  1T7X A;  4U6X A;  4F7M A;  3FQR A;  1T7W A;  5E8N A;  5C07 A;  3CCH A;  3QDJ A;  5SWQ A;  5F1I A;  5HHN A;  4NHU E;  4F7T A;  2RFX A;  1TVH A;  2HJL A;  1LDP H;  1WBZ A;  5HGA A;  2ZSW A;  5INC A;  1T7Z A;  1FZJ A;  1QQD A;  1S7X A;  3TZV C;  3M17 A;  1JPG A;  3MRG A;  4JFE A;  1KPR A;  4IIQ C;  4NQD A;  1S9W A;  4IRJ A;  3FTG A;  5C0G A;  1JGD A;  3TF7 A;  1T1Y A;  1FZO A;  4X6D A;  4D0B A;  1JPF A;  5F9J A;  4HS3 A;  4PJ5 A;  3I6K A;  3RWG A;  3OXS A;  3P4O A;  2BST A;  4GKS A;  2FIK A;  5C09 A;  2X4N A;  1EFX A;  1AGC A;  1ZHL A;  2F74 A;  4PDC E;  3VXR A;  5HHP A;  3HUJ A;  4HUW A;  4D0D A;  3QDG A;  3KXF A;  3S6C A;  3KPO A;  4N0F A;  4HUX A;  3X13 A;  3VFP A;  4CW1 A;  4HX1 A;  4PJH A;  1QRN A;  4Y2D A;  1C16 A;  1KJ2 H;  3E3Q A;  2AXF A;  4PJ7 A;  1KCG C;  1DUY A;  3DXA A;  3TFK A;  5EFI A;  3BHB A;  4PJB A;  3T8X A;  1NAM H;  3BEV A;  3FQX A;  5IB2 A;  3FT2 A;  1M6O A;  1ONQ A;  1P4L A;  2BSR A;  1FG2 A;  4NO0 A;  4JQX A;  5EOT A;  1P7Q A;  2ZSV A;  3JTT A;  4NNX A;  2CKB H;  3KPR A;  4ZUV A;  1JE6 A;  4L8B A;  3BEW A;  4ONO A;  2GJ6 A;  1G7P A;  3DX7 A;  2BVO A;  4L4V A;  4PGD A;  2VAB A;  4N8V A;  1QSE A;  3QUZ A;  5H94 A;  1G7Q A;  3L3G A;  3SDX A;  1OGT A;  1S7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...