1S7WA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7wA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7wA01
3EFFA 1U95B 5DJ8A 2ICEA 4M43L 5TDPA 5E8NB 3PWJA 3TCLA 4X4ZA 2ENSA 3ZL4L 3FN0H 3CIQA 3KPMA 4K7PX 4RX4A 4QHKI 3TV3H 5K9JL 1V8HA 1AI1H 2DQCL 3KXFA 4OD3H 2O5YL 2AEWA 2OTWA 5CEYA 4RISH 5D7LE 5I16B 5IMMA 4PLJC 1FYTD 2DQFA 1RZKH 4JKPH 1MQKL 3U7YH 1FNGB 5C71A 3FZUD 4JY5L 2BSTB 1FN4B 4LDEB 5BS0E 3O45A 1KXQE 1ZLUH 4OLVH 5GRYA 2NY1C 1P9MC 1QRND 4JHZA 4B0MM 5KS9E 2R29H 5J89A 2OMNA 5C0BA 3L7EA 1CFQB 1RJCA 4BM7A 2QQLL 1QQDB 3MV9D 3JWDH 2Y6SC 2VKWA 3QUZB 5H2BB 5FUCC 4Y5YA 3AFLA 5IJKA 4LEXL 4MD4B 3OXSA 3GJEA 4L3ED 1OD9A 3SJVD 3K81A 1IQWH 3BYTA 2VLLA 3FB5B 1A1OA 4HKJB 1KEML 4URTB 4WEMB 1IC5L 3BI9X 5DJXB 1DEEA 4K7FB 2ESVE 4ONGH 5FV1L 3WKML 4OV5B 2UVFA 3WCYA 4NRYA 1UJ3C 3O2DH 1U2HA 4PG2C 1F90H 3V0WH 4QXUL 4IRJD 5LWYH 1JPGB 3T4YB 2MMXA 4NDMB 5T33H 2LQRA 3NA9H 1NCWL 1KSRA 2X2YA 4Z6AT 4YX2L 4HIIA 5AZEL 1A7BA 1IQDA 5C07B 4LSUL 1T1YA 4GG6A 4Q6IB 3TN0C 3QUYA 3ZKMC 2VAAA 4HPYH 4L4TD 3LD8C 4WWKB 4BKLA 1X5GA 1AIFB 1RUQH 2E9IA 1CG9B 1JNHB 2AJ3A 1DLFH 1TIUA 4GKZB 5F9AC 2QJDA 3MRCA 1R3HA 2A0LC 2ZCHH 4IRJA 4MAYC 4LU5H 2XZCL 4ISVB 1UADC 4UAOB 4WI3A 4QRQB 1NUNB 2HJLA 4TNWK 3S35X 5J6HB 1NANH 1INEL 3IAPA 5B21A 3RVVD 3GK8H 3V6OC 43CAA 4J3WA 4OZGB 2EXWC 4XBPA 4EOWL 5IT2L 3DECA 3NZHH 2HFEB 1G7IB 4KJPC 4LMQI 5ITBL 2WW8A 4X6FA 3MMEB 1MF2H 4IRZL 3VWJD 4P4RA 4Q9RH 2ZUTA 1INDH 4OF0A 1VHPA 1A9BA 3ARXA 3QO0A 3GMPA 2JB5H 1DL7H 4OGXH 4NQXB 4QGYA 2IFFH 3H3PH 3P73B 5IMKB 3Q5YA 3NCJL 4NSKA 3TT1L 4BFIA 3IJHA 4BSVA 4F7PB 3KPRB 5FYKE 4X6DE 4WY7L 4PLNC 1TTGA 4UQ3B 2CO6B 1A6ZB 5IBUB 1G7PB 2F53A 2CUHA 2F74B 5C2BL 4W68A 2ORBL 3C2AL 1FFNB 3B5TA 4LSQH 4L3AA 1ONQA 1WGOA 1MI5D 5DLMH 4TUKH 1DBJH 1OQXA 4MNQE 1B0WA 5CUSL 3ZO0A 4U1NA 1L9NA 4HHAA 3MJ8B 3VRIB 2R1WB 4ESKA 3LPGA 4ERSL 2QR0B 3IDNB 3EJZD 5SWSE 4NQVB 1NFIB 2FH6A 2HVKB 3BDYL 2XRAH 1FBIL 3O6LH 3HUJF 2FHBA 2HA1A 2SEBB 2UWEF 3P30L 1FL6A 3WFBH 2DWEA 3VD9A 4JRXA 3GJFB 5CZVL 4WWKA 5B3JF 2A9NH 5JW3H 5HYSG 3MYJB 3RWDB 2ZOKA 1URLA 3BKYL 2VXUH 3QI9D 4NJ9H 2BY1A 4JFFE 4NWUH 5HHMD 5IGXL 2VE6B 3HG1E 4JRXE 4XC3L 4Y19E 2JJSA 2X44D 2NX5E 2P5WD 1H3PH 4K23H 3MTRA 3CXHJ 1KCUH 2P43B 4QNPE 4JVPA 4LHUA 2FECI 1G0XA 1X9QA 2XQBL 1BM3H 3EGSB 3LAFA 3GGWB 1LEKA 1A4JA 4QHNA 5EZLB 4IIQB 4X9GA 3UC0L 3TBYB 1CBVL 4P4KB 3K7UA 2EZ0C 3BKMH 4R0LA 1ZAGA 2J12B 1GZQB 3GSRB 2XN9B 3ARSA 1FNGA 3MLTB 3RZWA 1NCCH 4KDWA 3O6FC 3OF6D 4JFDD 5FGSA 3GFUA 4FFVD 4U1KA 1U8KA 1RUPH 5E8DL 1EFQA 4QHMB 1AGFB 3QEUA 4JQVC 4OLYH 4HFUH 4NJAL 3MRNA 1FIGL 1HHHA 4NWUL 5CSZB 4TTDC 3TBTA 4YHML 4JQIH 2WK2A 5KSUB 4JRYA 3D0LA 1SM3L 4MX7B 4CMMA 2A6DB 4JQXA 3RFZC 4NKDB 4XZUA 2VUYA 4UINL 5C09D 1CK0H 2EDTA 4QRRA 1MFAH 3NACH 4FFZL 5BRZA 3RPIA 5A16A 5EBMA 3G5YA 4HGMA 3BT2L 3FQWB 4KI5C 4PJEB 5HDQH 1S7UA 2BNUB 2B4CH 1BM3L 4NWTL 3GRWL 5JIHA 3RWIA 2JJVA 2YD7A 1CD8A 3EZJB 3SDXB 5IHLB 3ZHLA 1CICB 2EYTB 3NIDE 3ZKMD 5DJZA 3S36X 1H5BB 3EDFA 1FRGH 3MLXH 2VL5A 3VXRE 2DKUA 1U93B 4M4RA 3P9MB 3CVHL 4PTUB 5CUSH 4WW2B 4UIMA 5EU6D 2BSSA 2I9LB 3DVFA 5KVEL 3MLUH 1YEIL 4LSUH 1F02I 4KROB 1KB5B 3DV4A 1S9YA 2R0LH 4H1LH 4O58H 3MRDA 4JPIB 4N5EC 3DUSA 1S7XB 3LHPH 4LIQL 4KDTC 2B5IC 4QXTA 1TQBB 2GTWA 3PF2A 3X14A 1W72B 2LTQC 4JO4H 5EO9A 5EOCJ 1EGJA 5C9JB 4X6FB 2HLAA 3IDIB 1U3HC 3N85H 3TVMB 3C5ZA 1HI6B 3QUKB 1OAZL 3O9WC 1X44A 1FE8L 2A73B 4HC1A 1BZ9A 5CZXC 3SGJC 5B22A 4O02L 3IVKB 3IDUA 5F6HI 2P8PA 2NY1B 3HS0A 2GJZB 1RUML 2F19L 3AM8A 4K94C 2AKRB 2FIKB 5GS3A 4NPYA 1H3TA 4PRPE 2DL2A 5C08E 5EU5B 1QG3A 1KN4H 1OAYH 1P4IL 4IIQC 3X3GL 4PREA 1DSFH 4QOKD 2CIIA 3CFJB 3FO1B 1VEOA 4LAQH 3MODH 1KACB 2OZ4H 3SE9H 3CK0L 3MFFB 4R2GD 1F42A 1I4FB 4NFBA 4Y1AB 1P84J 3VXMD 1DLFL 4PRID 4TVPD 3S98A 1T2QH 2A9MH 1MRFL 4U1NB 5F7FA 1SJXA 1KGCE 4FQ1H 4KK9D 1NCCL 4NRXA 3CFIC 4JLRB 3N1FC 1EERB 5EUOB 4MJIA 3ISWA 1J5OL 4G3YH 2FSEB 3QG7H 3ZTNH 4LLMA 5IUSA 5MERA 2I24N 4DAGL 1A5FH 1H3VA 5DC4B 2W9DH 5FIEA 5D9SB 2A2QT 3IB4A 1WIUA 3STZB 5JQHC 4DZ8A 3TGXA 1A3RL 4KZDL 3FQRB 4D3CH 3VA6A 4LHUB 4Q2ZB 4XBEH 4Y5VB 3ULSB 3UYPA 1PKQE 2Z9TA 2OI9C 4DEPC 1MCJA 4QHKJ 3O4LE 1VADA 3ARZA 4OZIE 3P73A 3VG0L 5I8CB 3JWDL 1BVKB 3I84A 1MJJA 4CN1A 2BHUA 4R4BB 5GGRB 1OP5H 2A38A 5J4MA 2HT4C 1O7SA 5BS0A 3PWVB 3O3UN 3WFEH 5HHPA 1UQSA 3D3VE 4GW4A 1RJZB 5JQ6H 35C8H 2ZSWB 2D9CA 5ITBH 1DVFC 3V7AG 2BVOB 3LSOB 4HD9A 4DQOH 3O3EB 1TJIH 1EHNA 4HLZG 1UWGL 3LIZH 4LPUA 3S96B 1GL4B 5F6IB 3IJYA 1MFBH 2AK1H 3MGTA 2NYYD 3ZHDA 4FQ1L 4HZLA 1ND0B 3D2UB 4QWWD 4X4MA 3PJSB 4ALAH 4U0RC 1RSFA 5CSBA 3QWOA 1CFBA 2F5AL 5C0IA 4OLUH 1ZLUK 4DVRL 5GIRA 3RBGA 4YAQB 4NO3B 1EO5A 3U79A 2ICWJ 1BP3B 4CL7A 2R0ZH 2B8OT 1CCZA 3OKEA 3QIBB 5EC1A 1G7JB 2HFFA 4GMTL 3VXOB 4L8DA 1RZIA 2AK4D 3ILPA 4KU1A 3KPQA 3OQ3B 2YPVH 4ZPTA 4JO1H 4QRPE 1JVKA 1A6AA 1ED3A 4IOSD 1A6UH 4M7JH 5FYKD 3TWCL 3KPLA 4ZXBA 1U8OB 4RAVB 1LGVA 3UX9B 3IFOA 1KB5H 4E42A 5EZOH 4XNYL 5JHLH 2Q20A 4XVJH 1UXWA 4RRPG 3BWAB 1ADQL 4LCIH 4GAJL 3JVGA 1CDYA 2APTA 3FTGB 5JW5B 3BHBB 4ODTL 1R5VA 2GT9A 3NCJH 4A2LA 5I71B 4WDIA 5L9DH 5JLZB 2R56H 3NMEA 3HLAA 2PYEB 1E28B 1KJ3H 4FXKA 3VFRB 5HPOA 3TF7C 4WFEE 3CPLB 3CDCA 5F9JB 3H8NA 1KFAH 1Q38A 1B6DA 2P24A 5C0RH 5I1AA 1T04A 5DFTA 5IT2H 4P57B 4MAYA 3NABH 4XPAL 5C2UB 4QRPB 1LVEA 4PGDA 5DI8A 4GMTH 3KYAA 1Y0LB 4CVXB 3DYOA 4XWOD 1OTSC 2IAMB 1N59B 3DTXA 3HPLA 3PGDB 1U8NA 5J0BA 3PP4L 5EUOA 1YNLH 1MCPH 4NKDA 2X4NB 1RUPL 3BUTA 3DRTA 4NRXB 3EFFB 5TF1L 1P2CA 4HUVA 5FXCH 5FK9A 5HVFB 1YDPB 2IPKA 5IJVB 1RZIB 4L5FL 3V0VA 1IGCH 3PL6D 4NCC1 3SN6N 3U4BH 2YPKB 1XCTB 3JSSA 5I0DA 3ULVD 5EWIH 5DHYA 3IKCA 1NMCC 2NY0D 1P6FA 3EYVA 5T1LB 1PVHA 5DJ6A 1FZMA 5DMIH 2CDGA 4PJAE 3NAAL 2VITA 5EG6C 4N9OB 2YN5A 5KW9H 2EC9U 1BGXL 5TDNA 8FABA 3V4UH 3W0WE 3KPTA 2FATH 4J12A 5JIPA 1FYHB 3SDYH 3QG6B 3CSGA 1S9WA 2QADC 1XGQA 3HRPA 4M5YH 5HHPB 4RCAA 3QBTB 1D3CA 1MFEL 2VLRA 1UWXK 2OP4L 1Y6KR 5D6DC 5JUEL 5JDJA 5D7IF 2ICES 1JYVA 1P69B 3OV6A 4R4BA 4LHUG 4OKVB 3VXRD 1U91A 1NAMB 5D5MF 5JHDA 3GBNL 1MLCB 4R4FH 5EO9B 3U30C 4MNQB 4FFEX 3D5OF 2FCBA 3RVXC 1A4KB 1HZHL 3U7YL 2JF1A 1AR1C 1SYSA 4FMFA 4KK6C 3PGCB 5JA9A 1CDBA 4LCWB 1ZXQA 4HBQA 2GTZA 3GI9L 1U2CA 5MP6L 2Y7QA 3L3OA 2UWEA 2HAZA 3V7AE 1K4CB 4MAYD 5D7IB 1DQML 4GAFB 5BVPH 3N9GH 2FD6L 5GS0D 4RAVA 4HDIA 5E99L 4X0KB 3MLWH 4I8DA 4NKOA 1B6UA 1FNHA 2NY5C 2XY1A 4GUPA 43C9A 4BZYA 4D9RE 5ALCH 4IRSA 2I5YL 3F65A 4M62L 4ZPTB 1ZHBA 2UY6A 1H8SA 1PD6A 4FQJH 4BELD 4P5MB 1Q9KA 3WFBL 1WEJH 3QULA 4EVNB 3TBSA 5IV2B 1CLZL 5C1MB 1SJHA 4AG4L 4NP4L 3RPIB 3IETA 4U3HA 5SWSB 1U36A 1OAQL 5F93C 3TA3B 4KAQH 4OZ4A 3INUL 3DRQA 3M8OL 3QCTH 1MJ7H 1CFNA 3L5WA 2FBJL 3PJSA 2YZ1A 1RMFL 1QLEL 2DQIL 1YQ2A 5J6GA 3ZE0E 1IKFH 3MA9H 1FZKA 4GOSA 4RMRA 1KENL 1S7RB 4U7KA 5D7SL 1T7XA 1P9MA 3TFKD 1DQLL 4HK3N 4E41E 4PRBB 1FVEB 2HWZL 2ITCB 5A2IH 1FZOB 3CH1B 4HW6A 4UINH 3VFGL 4YDIL 3MX0A 3ZDXE 5B8CB 2PO6A 4OD1H 4MXQD 3CPLA 3E3QE 3LKPB 5ACZA 5MEND 2IPUK 3B9KC 5DJ2A 3ULUF 4JFDB 1D5XA 4XCCH 5I8CA 4ETQA 4WENB 1CE1H 3GB7A 5I15H 4RBPK 3MUY1 2CMRH 5IHBA 4R7NA 3BPNC 4AL8H 4LVHC 2VB5A 3WMSA 3X13B 4HWBH 4U1MA 1HKLL 4NKQB 1RVFH 4QRUB 4I0PD 2ZUQC 1ZLVH 4U6YB 1K6QH 3D9AL 1U6AH 1FAKT 1VENA 3EO1A 4LCCC 5I6XC 3D25B 4GAGL 3G6JE 1CT8A 3DSFH 3KJ6L 4RWYH 1OP9A 5TDNB 1HH6A 2PXYB 3VFSA 4PRHE 1CLOH 4IOFC 2R69H 2VITB 2X4UB 5KN5B 1F13A 1Q9LB 4NO0B 1HEZB 3HCVB 2OR8A 2JLLA 5MENE 3QEGL 4LSPH 2QQKH 2WBJB 4OLXL 4V1DD 2Q87A 3GNMH 4MNQD 4AQ1B 2EDLA 1C1EH 3KG5A 2DI7A 5AG9A 5DGQA 43C9B 4QYOA 3DX9A 4H8WH 2GQHA 3W2DH 1L4IA 3U9PL 1JUFB 3ES6A 1JK8B 4Y5VC 1AGEA 1DBKH 1Z9SA 1HH6B 1NFDE 2PXYA 1NJ9A 2KDGA 1WFUA 3OX8B 3QIUC 4ZMAT 3FB7A 2OTUB 4D2NA 1K3IA 4KWUA 4TULH 4YUEH 2VDKL 5IQ7H 4KDVA 1PSKL 2X4OA 4Y0GA 3WYRA 1RJZA 5C0GB 2ZG2A 4U1KB 5IW1A 1MNUL 2NXZD 3HNSH 2XA3A 4G8GD 4OB5H 4S2SA 1FLTX 4Y4KA 4WHDA 1JF5A 4F7TA 4OLUL 4UIKH 1U8PB 2A6KA 2EICA 1VGEL 1A6TA 4K9EL 1W0WA 3UAJD 2X9XA 1JNLL 2DLFL 4XVJL 3IFLL 1LWRA 4F7CA 4OKVA 3TA3C 1NDMA 1HCFX 4L1HA 1WFNA 3KPSA 4FZ8L 2GT9B 2NMSA 5GGRY 2QHRH 3DUSB 1JV5B 4OLZH 1GPOH 3BHBA 5HSFA 1INQB 2EXYC 5IVXE 5IFJA 3FQUA 1MJUL 4OF8A 4EDXB 5IWLA 1UXSB 3GSWB 2R1YB 4ACPA 3IFNH 4QWWC 5FYJE 3T4AB 4JM2B 3HNVH 2AP2A 1QBBA 4QOKB 3L3JA 1CFNB 1K8DB 3RAJL 3G5VA 2ZSVA 3R0NA 5DEFA 1F8TL 1LD9A 3GIVB 3FQTA 2BVTA 1C7TA 4MVBD 2XRAL 1NCNA 4DFHA 4L3CA 3QQ4A 4RMTA 4X7SH 4BFEA 5MHSD 2CKBL 2IF7A 4CUCA 5B4MD 3W5NA 4HV8A 1MIMH 3KPQB 3V6FA 1F4AA 2OSLB 5TF0A 3ARQA 4P0DA 4PRBA 2OR7A 1WBZA 1JMZA 2HMIC 3UPCA 1MCHA 5FK9B 5IJVA 5CFHA 4YWGH 3TZVA 2SEBA 3GEWB 3D18B 2UZIH 1NGYB 1TMCB 4GG8B 3O81A 12E8H 5HYEA 35C8L 1XIWA 2WINA 3O9WA 3ARWA 1BFVL 4FHBD 2F19H 5FCUH 1RZKC 5F7EL 1QNZL 3GMNA 1E4KA 5A3ID 4Q6IC 5KSBF 5IBTH 2DF3A 2PXYD 3CDFA 4J4PC 4GBXC 4XAKE 2WIIA 5F97E 2GY5A 2O5YH 3UCRA 1OAQH 4GG6F 1EHXA 3LRHA 1HCVA 3RKPA 5KW9L 2QKIB 4P46D 5SWQA 5ESVB 1T66D 2RAMA 1JTPA 3X14B 3QCUH 1FHGA 2VABA 5KTEH 3WJLC 4X4XA 3JBG7 5TPWL 1MF2L 4IRZH 5I1DB 2HTKD 2IAMC 5D72H 3BRFA 3QFJD 3PABA 3ABZA 2YA1A 2VDRH 5HDLA 2R1YA 4RFOL 3CMOH 2J8UF 4PTTA 1A1NA 4XNMB 4D8PB 5BVJA 5KSBB 2X5PA 3OAUL 4Z7QF 4ZUSB 3B3IB 3T0VA 3AXLB 2MQ0A 2I9LA 4X9HA 4KTYA 3ZDZE 4XP9H 2VDOH 4OCMC 3BO8A 3L9RB 2FRGP 4IMKA 4XX1G 1IC5H 3P4NA 5HHXL 3EO9H 4YE4H 4WHCA 1J0IA 1EO8L 3O2VH 5B3NA 4O2FB 4JQXC 3RHWK 4MCYA 1EFXA 3C8KB 2XFXA 1I8LA 3CLFH 1F4WL 5IROA 3BKJH 4YGVB 4W81A 5AWNH 1N6VA 3VMOA 4BQ8A 2YBRA 1H5BC 3OAUH 2GSIA 4LEOA 2JB6A 4MJ5A 1I3RA 4CADA 5KVFH 4LLUA 4QRSA 5FGBC 4YHIA 1W0YT 5CKGA 3H7BB 1XFPA 5C3LD 2JTDA 1QA9A 3V95A 3PV6A 2BNRD 4XPTH 3TCXA 1TXKA 1OW0C 4NJAH 3MRPB 4OIBA 2X10A 7FABH 5ESAA 4HWBL 1VERA 3PWNB 2RGSA 1FJ1A 3Q0HA 3QIUA 5D2LA 1H3PL 4JGJA 4L9LB 5EUKB 5H35B 3SCMA 4NN5C 3JWNC 5F7NC 3T65B 5GRVK 3VRLF 4QEGA 2AK4E 2YPLB 3ZE1E 3IVKA 2VO5A 4OIAA 1T20A 4RFNC 3D1MC 4ZD3H 2X1OA 3AS0A 3MJ7B 4JE4B 4PJDF 2R69L 4EJ1C 4MJIE 4L4JA 2D0GA 2R9HD 3AB0B 2DQUH 4U0QB 4XP5L 5F21B 2R8SH 4Z5RB 1V7ML 1ORQA 5MEOA 1F4WH 3LCYA 1KN2L 2C4FU 3AXLA 2R56L 3MLSH 4WTWA 2PTTA 3GSQA 3B9VA 4LLWA 2FEDC 3IDJA 1KCVH 2C1OB 3GSUA 3NCYS 4M61A 5AG8A 4BZ1L 1TETL 1JN6B 2YC1A 3D3VD 4ERSH 2AEPL 1IARB 5DFVC 4HLJA 4UIMB 1MHHB 4JHAL 1P4LB 3QDME 4S1RH 3V5KB 3QDJB 5CP7B 1HOCB 3LMJH 5TH2A 2OYPA 4G7VH 1I85A 4LIQH 5K9KA 5EBWB 1V7MH 3OJ2C 3JVGC 1IEBB 1X5XA 5TE6H 1MFAL 3IFNL 5EZIL 3EAKA 2OQJB 1QFWI 4KV5E 1G7JA 3U9UB 4P5TD 4PV9A 1CQKA 3RTQD 3OHXA 4XHJD 3MRPA 1FAIL 3MZGB 4OAWA 2NY7H 2GAZB 4RDQF 4YFLI 1GIGH 2RFXB 3IFLH 3VFTA 5IHZA 3ZZ1A 4G8IA 2PW1B 3C2SA 4K3GA 2ADJB 2X40A 2XQYG 4JB9H 4JG0L 4PFEA 3TPUA 1GGIL 5ANME 4LOUD 4U6HB 1UA6H 3VXSB 2F54E 2IFFL 1XH3A 1F97A 1F2XK 4C55A 4X6DA 4QXWA 2YD2A 4M93B 2DRUA 2VDML 1PKQA 1Z5LA 3WNNA 1EGJH 4Q6IA 4JFXB 4GXVL 1MCSA 3AROA 2WINB 2YXFA 1C16A 1IAMA 1LEGA 1CS6A 5KVMC 1OL0A 1KJMA 4JEGB 5HI4D 4IRSB 4N90D 1ZK9A 2HLAB 2ZUYA 3AS3A 2PW2B 5D7LB 1XT5A 5EO1A 3IYLW 1WBZB 2ADFL 3HAEA 2BFVL 2LABA 5EU4A 3QUZC 2IBZX 3JTCA 4R0LB 3WJLA 2YA0A 4R26L 5TJWK 3T8XA 3BP4B 3UTSA 3ZKNC 1G9MC 5DR5L 4X8JA 4KVNH 3VFOB 4ONHB 4FQLL 3FB6B 5JHLL 4Z0XB 3MBXL 4PJFB 3P9MA 3PXHA 3ZTJH 3DETC 2DTSA 2D03L 1F11B 1UWGH 3LIZL 3FRPG 2YD1A 3S3SA 5SWQB 4AENA 3IDJB 1NGZA 4U1IB 4HUXA 4P4KD 5LQBL 3BOVA 1H8NA 3ULVL 5GGVH 3RP1A 2ERJB 4HJ0C 5J8OA 1CICC 3T08A 4OFYD 5ICYA 4ZOBA 3LEXB 2IANB 2CQVA 1WC7A 2UWEE 2E27L 2D0HA 2D7PA 4L8BB 3UO1H 5L6YH 3RY6C 4N5EA 4G80B 4UIKL 1KCRL 3L6FA 1KUMA 4ELKB 2FECL 2I27N 2Z35A 1FJ1B 2F54A 5FGBA 1AGCB 2M8XA 3MJ7A 2GUOA 3U7WL 1YEFL 1DBAH 3GJFK 4DGVL 2ZCLL 1VKXA 5IW3A 1CG9A 1JNHA 6FABH 2NZIA 1MAKA 3LN9A 1NAKH 5C0FB 5CEXB 3MUJA 4LBEB 4M4PA 3RWGB 2B5IB 4FFZH 4O51B 4XTRD 3FO2B 5KG9A 4G3YL 3O6FD 3BX7C 1NCDL 1LP9F 3BP7B 4NQED 4HKBA 2NZ9C 4O9HL 3RRQA 1AH1A 1U8KB 2KQMA 3FONA 2DM2A 1MPAH 3HMWL 4KZEH 2HT3C 5JPNA 2BVEA 3ECBA 1T2QL 1OPGH 3GSNA 1XF2B 5LCVL 1BOGA 3DO7B 4N8VB 4I48A 4CGTA 3HE7A 3RA7H 3H0TB 2VDLL 3DGGB 3RTQB 3ZDYE 1WZLA 1G6VK 4E0RA 4P2QD 1YN6A 5FKPA 5HDOA 2A73A 2V7HA 1NQBA 4KMLB 4YBLB 5DRXA 1GOFA 4UDUA 4PUBL 3UTSD 4HLZH 1XGTB 3CCHB 3DI3B 2QSCH 4XPHL 4YGAB 3VD4A 1AQDA 4LSQL 3QI9C 2CLRB 1D5BA 3B3IA 4HBCL 1N2RB 1KC5L 1I8KB 4ODTH 3LY6A 4XP4H 4IRSD 5D6CB 3MFGB 5E7FA 4Y4HC 4YZFE 2YMXH 3N85L 4FQXA 1RULL 2HLFD 4DGYL 4BZ1H 5E8DH 1HIMH 3GB7B 1H0DB 3VI4F 3SE9L 3QQ3B 5DK0A 2E6JA 3ZE2F 1S7RA 3VE0B 3MXVH 3V7MA 4XX1E 1SMAA 2JJTA 1X5AA 2K1MA 3O3BA 4RGMB 2DMCA 2C3VB 4POUB 5B39A 3LV3B 4ZXBB 3OZ9H 5GRWA 4ZS6D 4V1DA 2Y6SD 3QUMB 2VZVA 3MLRH 3BGMB 3MRRB 2EIDA 3U6RB 1BD2E 2HFGL 5C0AA 5TQ2H 4I3RH 4XXCC 1RZ8A 4G6JH 3OL2A 2G5BA 5JIKA 4PG9A 4RIRB 4DKFL 5IOPA 2EDEA 5FGCB 1P7KA 1XH3B 2J4WH 4XVUC 2BJMH 4HGKC 4S0UC 3NCCB 4I4WA 2EYSB 1RJLA 3U0PA 4PRIB 1DVFB 5IP4A 5DJ0A 4PJDA 1GGCL 1KC5H 4GRWF 3WBDA 3V5HA 3BUYA 3QZWB 3DXAD 4LARL 4CMHC 1Q1JL 1UKTA 4TYUA 3EOYG 4MMXC 2NQCA 3D39B 4KXZH 3EYUL 1A4JB 4Z7VA 4ZO8A 1L7IL 4Y8DC 2XXCB 4HPOH 2KZ1B 4EI5C 4G5ZH 1KENH 4FQ2H 2AABH 2GSGA 3SPVB 4I0CC 5DK2B 4DGVH 1WCQA 4F7CB 3EYSL 5CMAA 2RB8A 1ZT1A 4MVBC 5C8JA 3VD7A 1GC1H 2ZWLT 2L7JA 4G8EA 3R1GH 1CXHA 4HXAH 4LCUB 3T4AA 4AJ0A 1UXSA 15C8L 3BW9A 3GSWA 3MV8D 3QDGE 4XP9L 4QCIB 4PD4J 3MYZA 5I16A 4XVSH 3IXAB 1HXYB 3CUPA 4O2CB 5DRZB 2X4TB 1IC4H 3P40A 3ARTA 3QFDB 4JJ5B 5EPMA 4U1HA 1OP3K 2R23A 4KK5C 1P7QA 4ODWB 3TA3A 1X5FA 4RNRA 3M17B 1RI8A 1U8HA 4M48L 3SE4C 1DQJB 5D2NA 1FL5A 5CJ8A 2IALB 2F5BH 1L0QA 1BBDL 1OLZA 4OQTH 5IB4B 1W8OA 3I02B 1CQYA 2B20A 4RISL 2E7BA 2WLZA 3N1QC 3DV6B 3AB0C 4OSUL 3D69A 3P0VH 1A8JH 1AY1L 5D1QC 4K7PL 4YE4L 3W11D 5E8PA 4P46C 5HVHC 3QXVA 1YEGL 2D7QA 4KI5F 3WNOA 4PJXA 1AO7A 3SQOL 4Y4KD 1A3RH 4KZDH 2ZJSL 4RFNB 4ZS7L 1KG0A 2CIIB 1T6WA 4N9GA 4EUPB 4F7EB 3N1MC 3OJDB 3HNTL 4FZEH 1DBJL 1BREA 4JFPA 1QLRA 4L8SA 4LPXA 1C5DA 3DMMA 4NQVA 5ILTH 3TIEB 4OBSA 4MA8H 4BFGA 3VXRB 4NO0A 3KNBA 1N6QL 1TJHH 1WTGT 1RV6X 1VFBA 5HGHA 4PYHA 4JVWA 1EXUA 4H26A 3UDWA 3QB7C 1AE6H 3BH9A 5IF0A 5DA4A 2B1HH 4UV7H 3VWKD 4FFVC 3QFJA 3EO1B 3MO1A 3RDTA 1KJ2H 5DZNA 1HILB 4OIIL 2EE3A 3QO0B 4Y2DD 4BSJA 4ZFZA 4I18B 2X6MA 1QYGL 3U83A 2YEZA 3G04B 3QA3A 4J4PA 1CD9B 4LKCB 4LSDA 2W0FB 3OKMB 3BKYH 2PCPB 43CAB 4AENB 1YY8B 5DD3L 5ETUA 3I75A 1LK2B 1IGCL 2DQDL 1FVDA 5E4IA 2HTLC 5IBLC 4PR5A 1NGXA 5I74B 3CXDH 4CMHB 3R06B 3LS4H 2AV1A 4G7YL 3SKOB 5JW5A 2W1NA 3CH1A 4UI2A 1EAPA 5A3IC 5K9JH 2PKDA 1NDGA 5GRVL 1A6AB 3T2NH 2YMXL 3GKZA 4KKNA 1QRKA 4IHOB 3HE6D 3ARUA 1EEZA 1G7LB 4CBPA 2GEEA 2Z4QA 3BUYB 2BOBB 4XNYH 1C16B 2YK1H 1Z6JT 1OGAD 4CW1A 5JORB 4FQ2L 4XNXL 4NM4H 3HMXA 4P3DB 3WXWH 4K3JH 2PETA 3EKCA 5EWIL 1QFWH 1VEMA 1GAFL 1ES0B 3MACL 3LH2L 4LLDA 5T33L 5DZLA 5IOPB 4JFEB 1MIEH 3LQAH 2R2HA 1PAMA 2DMKA 1T1WB 1IGJA 4S1SH 4OFDA 4D9QD 4K7FA 3E6FA 3F7YB 2D7MA 2XG4A 1UACH 1TVBA 2V5RA 3QCVH 4NQDE 3RVUC 3HAEG 3TPUB 2ITDB 3MV7D 1MFNA 4XXDB 3P11L 4ZTPL 1SEBA 4PRDB 4LCWA 3DVNA 2AV1B 2Q76A 3K2MC 4N8PA 3CSBA 4G42B 1D6EA 1JHLH 2IQ9H 2AJXH 4KDTA 1IT9H 4NZTL 2CLRA 3C87A 3SGDH 1GOGA 3FN3A 3P77B 4MHHG 3RY4A 2NY5L 1JRHI 1WVZA 2G5RA 2YC1B 3CC5A 5MHSE 3EW3B 1MCDA 3GSUB 4U0RB 2V7HB 1EMTH 1A7RH 1W72L 3Q6FA 3G5ZA 1LNUA 4PJ9D 3KYMB 3U4EA 1HOCA 4JO2L 5FYJL 3QSKB 1A0QH 4Q0XH 1AQDB 3HI6L 2V17L 1CIDA 1M7IB 4DKEH 4WHYG 4MB4A 4KUZL 1IC7L 5B38G 2WMPA 5E08L 4FQIL 2VZSA 4P59H 2BNRA 3ARBD 4NT6B 3FMGL 1FFPB 1MLBA 3UEZA 1XIWC 4JFQA 2W9DL 1O0VA 5FDWA 3RTQA 3LPWA 5J12C 4HKBB 5DRNB 2YWZA 3F7PC 4Z7WF 1ZV5A 4Y2DB 1VACA 5GGUA 3WJJA 5DQJB 4FNLL 3UZVB 2EEDA 3SKJH 2YD8A 4JFOB 4KK8D 4HUVB 1T0NB 2AGJH 4PREB 5D7KE 3VRLE 3WIIH 5E8PB 1KTLA 1T7WA 3FMGH 4LGSB 5DUBA 3TPKA 1G1CA 1DANU 3E8UL 2Z35B 2EO1A 3K8KA 3S96A 5E95B 1IQWL 4GSDL 4LLUB 1PDKA 5M95B 4GRMA 4EN3A 3JWOL 3SDDC 5IB4A 5ESQA 1XGPB 5EC2B 1FLRH 3MRHA 4P49A 2NY6D 1A7QL 1TVHA 5FYJH 5JOFA 1BAFL 1ZE3C 4NHCH 3AREC 5F89A 3GMMA 5DHXB 1FNFA 3VXUB 3HE6B 1FGNH 1AXIB 2VXSH 4WCYL 4YHIB 1OAUL 5IB5B 4NT6A 1B3JA 1NEZB 2W60A 3MV7A 3QUXD 4JFFA 4XH2A 3P4OB 3MBEB 1VADB 2ED9A 5ICXA 2FEEL 2FO1A 2NX5B 2HRLA 3NZ8B 1XF3B 1WCBA 2IFGA 2W07A 3C6LB 3WLBB 4KMTL 5TDOA 1K9TA 4KI5E 2IGFH 4NYLA 3SGDI 1DBMH 1LO0H 5HGAB 4HIEA 4KHTL 4X7DC 1RIHH 1V05A 3P4MB 3HAEH 2VC2H 4MNGB 2LTQB 1CGSH 3BKCL 4X7SL 2EIZA 4MXWH 4NZDA 1JPSL 4JHBA 5JXAH 2HKFH 3VGAC 3HLAB 1IZJA 4R96A 4U2ZA 5DT1L 1LQSR 1CLZH 1AGDB 1T22A 4PJ9A 2IC2A 4CVZA 4OCWH 1LNUB 4NQEB 5CJXC 4UV4H 1V7NL 4L4VE 3RWFA 3PQYD 2C3GA 3FZUC 2QQNL 4NO2A 3QHTC 1KPUA 4U33A 5DJ2B 3NFSH 4NC1C 2ZUSA 4G43A 5JZ7C 3RWHA 1MUJB 1G7IA 4FTVD 5I1GL 4I77H 1T1WA 1FZJA 1MI5B 4NNYB 5B39G 2XTLA 1PJ9A 1T21A 3LMJL 5DRWA 1A7QH 3OPZL 5E5MA 4IBLT 3QQNA 1G7MB 4G42A 3L3DB 3MLXL 4ZFOL 1BD2D 3FT3A 3RI5F 4GXUN 3UP1A 3O8XA 1P4BH 1BJ8A 3VG0H 1KTDA 4W4NA 4AT6B 1MCNA 4AMKH 4F37K 1CVRA 2Q8BH 4KJWD 1MCCA 3ARBC 4O2EA 4MA3B 5E6YA 4RAUB 1KCSH 5KS9A 3FN9A 2IGFL 5HI5C 5KZCB 4Y4FD 2Y23A 5E2VH 4YPJA 4NZUH 4POZC 5C86A 5T1MB 5C07A 4V3EB 4OUOA 3MCG1 4HJGB 2NY2C 5IHZB 1G7LA 3GBLA 1MJUH 1U92A 5L0QB 5C0DA 2FBOJ 2MHAB 1JNNH 2DWDB 4P3DA 2Q7YB 5I18L 4QRTB 1INEH 1A3LH 1MCIA 4YDJB 3UTZB 1JGLH 3VH8A 3FO0L 1AQKL 1YPZA 2VXTL 4POZD 1LHZA 2QV2A 4LKCA 1SQ2N 5IFJB 3TJHA 4MD0B 2IJ0C 3ZT7A 4HMDA 1T22B 4CVZB 4LVOC 3WLWC 4G8FB 1KT2B 4WO4A 4Z7VE 3HC3H 3TWCH 4OZHF 5D1QB 1U58A 3SDDB 1IBGH 3T77A 5FCSH 2MFNA 5HVHB 4ZO7A 1KJVA 1QO3A 2ZCKL 4X5WB 4YHYC 4KVCH 2XV6B 5FV2A 1RZKL 4JKPL 5GRXG 5D9SA 3C2AH 2DQFB 2XN9D 2YR3A 1FLRL 3P9LA 2ICCA 5KOMC 3STZA 4X9FA 3H42H 3HE7B 4XGZA 3TJHD 1BFTA 1UVQA 2VR4A 4K23L 5HYJD 3G5YB 3V8CA 2J88H 3CMGA 3DXAB 3NFPB 2H1PH 3GMMB 4P2OC 3DWTA 1ZLSL 3UTTD 3DYPA 4X6CE 2VLKB 3OB0H 1XGPA 5EC2A 2W0KA 4HPYL 1MCRA 5GJTL 5DJCB 4X9BA 1PLGL 3ELAT 4O58L 2A6JB 4WI9A 3F7YA 5D72L 1CVSC 2C7UA 4F8TA 2NY3D 25C8H 4RFEB 1KTLB 4U1SB 5LVEA 2R2HB 3P30H 3KPNB 1IAOB 1Q0XH 4LAJH 2VDNL 3J7HA 5L9DL 4UT7H 2BC4B 4WW1B 3C5ZB 1A22B 5GRJH 3L6FB 1IM3A 3V8OA 4J1UB 1D6VH 1G9NH 2Z31A 1I3RB 1YN7A 2AXFA 4YNYB 3HC0A 4QTIH 1ZHNA 3WD5L 4N8CL 1UACL 2IBZY 2GTWB 4HHAB 1K8IA 5D2NC 2LU7A 5F6HJ 4FQXD 4OI8A 2Z4QB 5D4QA 1EFXB 5D2LF 5GS2D 4OZFA 4PTTB 2R8SL 2FX9L 1KJ2B 1KN4L 4ZTOH 5C9JA 1KV3A 2FEDD 1YQVL 4PRHA 2AJZB 2DLGA 2P42B 5TE6L 3ULUE 2BCKA 1NCBH 2A9NL 1FDLH 2HH0L 3TO4A 3L95A 1F3JA 1E4XL 2MPAL 5INDA 5K9OB 1A7PL 4TUJB 5C70A 1HXYA 5DRZA 5CJXA 4PJBB 5C09A 5IIEA 3P2TA 4X9IA 4ZQKA 3G9AB 5SWZA 2Z92B 1TVBB 4Z7UB 1A9EB 4Y5YC 2YZ8A 4XP4L 2HVJB 2Q7YA 1ZLWH 5JA8B 3VI3F 1QPPA 4XP1H 3BZFA 1NCDH 2B0SH 3ZTNL 1FZOA 2EYTA 5IVNA 4HS6A 2NLJB 4JRYE 4XMKL 4YO0B 3VXNA 3IETB 2A6DA 5EA0H 2J2ZA 5DEGB 4LVOB 4PY7A 4U7MA 2BXYA 4P2RB 3C08H 2RJMA 4NM4L 3WXWL 4HWNA 4HJJL 1QVOB 1A21A 4LCCB 4YHMH 2BDNH 4ZS7H 5FYLH 3BQUB 3GZKA 4HWBA 4PJFE 1T83C 4P5MA 1PQZB 1HHJB 1X5ZA 5HGDA 2W0LA 2DLHA 5I8EB 4Z7NF 4YHYB 1C5BL 1JNJA 2I60L 2CXKA 1DR9A 5E2UH 3SBWC 2F5AH 3QUMA 3VXQA 3K8LA 5E8OA 4K94H 1RHHB 3F7RA 1UG9A 3WHXA 5CJOH 3EJJX 3WL9A 1TENA 1HZHH 1U3ZA 4HT1H 1U3HA 5EOTA 3IAGC 4GRWH 3RUGA 1E4WL 5MI0B 3W9EA 2VQ1B 4NCC2 1XAUA 4F8QA 4Y4HA 3FQUB 5JO5B 2AJXL 3O4OC 4G9FE 4FP8L 2Y1VA 1MHCA 3N9GL 5EORH 2OXGA 2XQBH 4Y16B 4LPCA 3U36B 3FT2A 3MMEA 4PRHD 3FFCD 1GIGL 3QPQC 1YN6B 5FKPB 4LSTL 4Q0XL 1T66C 1ZHLB 2R2EB 4P9HL 1NBYB 3AMKA 4KJPD 5AEAA 5FYLL 2HTKC 2IAMD 1HNGA 3UJIH 4K7PY 5I66A 4RMUA 4N8VA 4I9WE 4NQDA 5T3ZH 4W4OC 1UWXH 5C08B 5BZWA 4ISVA 4YHZH 2DL9A 3K4DA 3HE6A 2UYLA 3QPQD 1MHCB 1JWUB 2DLTA 1IC4L 3ECBB 3FAWA 4F7EA 3TNMA 1JUFA 1KPRA 3ES6B 3O6FB 1RAMA 3D2UD 5EFIB 2P48B 4L8SB 3K2UL 5JXAL 4Z7VF 5T3XH 4P46B 5IG7B 1CZ8H 4X5LA 3MJ9H 3JTSA 2HRPL 3BEWB 5ADOL 1WJ3A 3RY6A 2ZPKL 4G6JL 4YDVA 3HZMA 2IALA 3BVNB 3IXTA 4C54A 4HJ0D 5IEKA 4Y2DA 5ICZB 5JQ6L 4UUJA 1OLLA 4LQ1A 5HD8C 3IDMA 4XPBH 3HKFA 1YECH 5IVXB 4NZUL 4RIRA 3S3JA 1QZ1A 4PYGA 5DTFB 1QSZA 5E00B 5H94A 3ARBB 4HXBH 4N0UA 4HUNB 5ADOH 5KSAA 3BGMA 3ZKXB 2X89D 3TIDB 4U1MB 4HF5H 1YNLL 1U58B 2X9YA 3DROA 5I1AB 4DOHE 2R23B 4PJ8D 1ZLVK 3W39A 4U6YA 1N5YH 3GM8A 4OCLC 4CVXA 1G7PA 4V2CB 5FYKH 3TO4C 5DD1L 1A9EA 3E3QA 1GZPA 4Q9RL 25C8L 1QEWB 1AHWA 3KS0H 2OK0L 1UFUA 1HSBA 5KOVC 4KMQA 4X6CA 3EFDH 2BMKB 1NUFA 5D1QA 1D5BB 2YD5A 4XNQB 1BWMA 4WDIB 1M05B 3EJYD 3HZVA 4BUGA 1U93A 4NFCA 1EEYB 1FFOB 4QLRA 3MCLH 3U0PB 4QKXB 2EDRA 3D39A 2XWTB 4GAJH 3G5XB 3HRZB 2MJWA 3MXWH 3U4AA 4TPRL 1QSEA 5H94B 2IEPA 5E2WL 3WUWG 4HXBL 4X99A 3CSYA 3U0WH 3FRUB 4LKXB 2AW2A 2H3NA 1MREL 1R3HB 3VGFA 1IQDB 2FDBP 4R4FL 3GMOB 2ZUQB 1CD1A 4ODXA 1JGVH 1AXSB 1I75A 3L5XH 3VGEA 2XWBB 3BPCB 4JR9H 5HJ3A 5D2NE 1ZHKA 4KKCD 4M6AA 5JORA 3DPBA 1R5WA 2R1XB 3CFCH 5DD1H 1XCQB 4KTDH 4R97B 4XP6H 3GSOA 5EIIA 4ZYKA 4R2GB 3VW3H 2ZCHL 1K4CA 5FYJD 4NQCE 3WKNA 1YEEL 3GHEL 3VXMB 4CNIA 5FA4B 3SY0B 3VXNB 1G9EA 3VWJA 5DHVA 1HQ4A 4XC1L 3TN0A 3VH8G 1UM4L 4RZCB 5I1CL 4LAQL 4ZUWA 4HS3A 5DA0B 1M05A 4S1SL 3WDHA 2VAJA 3TBVB 4JR9L 3ZTJG 5HI4C 4G80A 4M62H 3ZE1F 4LLQA 3C9NA 5D7JD 3UBXG 3DURB 1CICD 2W0FA 1G6RH 1NMBH 1WFOA 2YA2A 4PBXA 2EKJA 1UH4A 5D6CA 4HGWB 3QISA 3RNQB 4IMLA 2DBJA 1UWEL 3NIGF 2ZNXA 5MENA 4GBXD 5DUMH 3AAZB 5EUOE 1U8MA 4G6ML 1YEJH 1I9JH 5IFAL 4TSBL 4DW2L 2ZP0T 2CMRL 3BRGC 3KLSA 3H9SD 4MNGA 2YD4A 4ZSOA 3CFCL 3QDAA 1MCQA 1X5HA 3MREB 1QNZH 3QNXB 4X8JB 1CTNA 5TE7L 2AK1L 2HKHL 5FA4A 1KIPA 4EN3D 3DGGA 1NPUA 4DN3L 2ICWA 4I48B 4PP1D 5ANMB 5L88H 1ZT4B 5TDPB 2N7BA 4L9LA 4O5LL 4ZAKA 2QQNH 5JW4N 3VDCA 4XCEA 4F3FA 4M6OH 2ID5A 3VFMB 1NL0L 1ITCA 5EUOF 4S1RL 1ORSB 2AI0L 1UYWH 3B5HA 1A14H 4NKMB 3ARVA 1Q9OA 1CD0A 2DYPD 4PJAA 3SE4A 2YBRB 4NUJB 1IL1B 3C09C 4TTDD 5E1AB 4MDJB 3N1GC 2BVQA 2ZG3A 2R1WA 2FX7L 5DMIL 5GJSL 1T7YA 1EVUA 1FL5B 2FX8H 4NO5B 4G6FB 4MDIB 2ZNWA 3QDMB 2ADJA 4UOJA 1OTTD 4EXPX 3TVMA 2P24B 3FFCE 3MOAL 1OT2A 1BBJB 5I1IL 3OR7B 1J7VR 4OZFG 2NZ9D 5IESL 2DYPA 4YIQA 4IJ3B 1ZMYA 1F4HA 4ZNEA 1F4YL 1OCWL 1FCGA 3MJ9L 4KK6D 4F2MB 3FOMB 4ONHA 1UKSA 4MCYB 4XMLL 2ESVA 1E6OH 3EYFB 1WZ1L 1ZGLM 1FCCA 1KB5A 2W9EH 3DV4B 2CK2A 5I30L 4DKFH 5E70A 3JTTB 5I75B 4JFDA 4M3JA 4R3SB 2X05A 3H9SE 5ISZA 4L4VB 3REVA 3N50A 3GMPB 1MCWW 1U8OA 3MGAA 3LKRA 2LAAA 4MD0A 1X5KA 1SEBB 3TT3H 4XP5H 1EEUA 2W91A 1CE6A 1QFHA 3JUZA 4YUEL 2FEEI 3E1F1 2F58H 2HWZH 3P4MA 1FPTL 4FQPA 3SDAA 2LVCA 5HYJA 3HHRB 4F9PA 5TDOB 3O0RL 5EO0B 5GJSH 5EU4B 3C5ZD 4GKOA 4PGJA 5E2TL 2Z93A 2DQGL 2OL3L 4HX1A 1OM3L 1HHKA 1HXMB 4D9RD 5IW6B 5KVDL 3KJ4C 2YXMA 1AE6L 3U0TA 1KJMB 1F58H 1I1AA 3MNWB 3MRKA 5GRUH 1BJMA 2PR4L 4MX7A 4ELMB 1O7VA 4MA1B 1AKJA 3IFPB 3I6LD 3ULVH 1QBLL 3SKJL 4NN7C 3IF1A 4FQHA 4U6XB 2AXJA 3IAQA 1IAIL 2AJSH 3BE1H 4JPWH 4ZDHB 2XWTA 3H9SB 3ARGA 5H37G 3RGVC 3S5LA 3MGOB 4X98A 4OM0L 5FECA 4FQCH 5FKAA 4GMSL 4Q9CA 1NAML 1B0RB 1YEFH 2AERT 1CYGA 1OAKL 3JV4B 4OZIA 1R3IH 1T03H 3LSOA 1KJ2L 1B4JH 2GTZB 1G9MH 1MHHA 1YY9C 2CKBB 1FRGL 5FO9A 1YEEH 2GSIB 4LEOB 3ROLA 4AIZA 4DKDC 1HSBB 2MCG1 1FFRA 4FQIH 4P59L 5IEHB 1L8JA 1PG7L 1DN2A 1NDGB 1Z3GL 2X41A 4ZODA 5HYQB 4H0GA 5E2TH 3G5VB 5I73B 4YK4B 3GSRA 3MLTA 3QAZB 4IJ3C 4BQBA 2XA8L 4EBQL 1F3JB 4DAGH 5LKNA 3W39B 4D0CA 3PIQA 5I8OL 3FOLB 4ZUVB 5LXGL 1S7VB 5BRZE 1JWSB 3L9RA 2ESVD 4Y5VA 1CBVH 2D7OA 1T0MB 4IM8A 4P48A 3WFZA 4QHNB 1WSST 1KJ2A 4X5XB 5JUEH 1C08B 3QDGB 1I9IH 1L9MA 1GVIA 4XNMA 5KSBA 5GRZA 3ROOA 2A74A 2Y06H 5AYUH 4EUPH 2C9AA 4M1DH 4NGHL 3DHMA 4JFPB 4K3DH 1CGXA 3DURA 3HG1B 4DVRH 3DMMD 4OCRL 3P4OA 2K7PA 3MLYL 5CLWA 2AXGB 4CJ0A 1EJ6A 1AR2A 1N4XL 4NN6B 2OX5A 2JIXD 1NC4B 4OQ1A 5DMGD 4QYOB 5IW1B 5DD6B 1Q9WB 1GSMA 5L7XL 4UT9H 1A64A 2W92A 4N68A 3RDTD 1UM6L 3B6SA 2VQUA 1A6UL 4M7JL 3VXMA 4CNIB 2EH7H 4PJGE 4S0SD 4NZRL 3DVIA 4BH8A 2DWEB 4Y16D 3IDYB 4XRCB 1N0XL 3S35H 3TJHC 5CCKL 3FKUS 5I8KH 3TVMC 4K9EC 1RQ5A 4LSPL 3VW3L 4WTZG 4U1JA 4X6CF 5HY9B 4MYWB 5GGQH 4S1QH 3ZHKA 4HV8B 4MQXC 1RUKL 2G75A 5ITFB 1EEZB 3EOTL 1VFMA 3D85B 1REIA 3THMH 3HPJB 1W0VB 3NCYP 4XT1C 12E8L 3X13A 4YFLF 4LRNH 3FJTA 3KYKH 3G9VA 4X8XA 4ZO6A 4U1HB 3HMXL 5JZ7D 2CLZB 2BY2A 1PZ5A 4U1LB 3O2DL 3NOIA 2XT1B 3U82B 5GGQL 3QPXL 3HFML 3MRLB 5J57B 4KV5F 4WGVB 4X6CB 5ENWA 1DE4A 2PCPA 3T2OA 5AAMA 4NSKB 4OLWL 5GZND 1K8IB 3P77A 2ZOLB 4XWGL 4I3SH 1Q72H 4U2YA 3EUUA 1B0RA 4XPAH 5I1IH 3QH3B 4Z95L 2V2XB 1WAAA 4KY1H 4AEFA 3ME0A 4LCWD 2I25N 1EH9A 2OK0H 3OR6B 4ODUA 2NTFB 2V5MA 4S2SB 3KWWB 2OL3B 2XICA 1FVEA 1DN0B 3I9GL 1I1AC 4ONOA 3WNMA 4NZTH 3D0LB 4ZPVB 4KJWC 2DM7A 3GBML 4XNZB 1ZLSH 4PJ8B 1JGDA 2K7QA 4GQ9H 2H6PA 1UB6A 5GIRB 1MI5E 3WXVH 3FB7B 3WD5H 3EOAB 2NXYB 2YD6A 4N0YL 4LF3B 3EO9L 1Q9OB 2VXQH 4PJAB 3SKMB 3QCVL 4FTVE 2RFXA 3VFTB 4DCQA 4Y5XC 2BSRA 4XCYA 4UNTA 2VR9A 1DL7L 3IDXL 4PRAA 4BQ6A 2ED8A 3I9GH 4GAYA 5GGUB 2EKSA 2Y72A 1D5MB 4DGIH 1N3NB 2YD9A 4BK5A 4QHMA 4JM2A 1Q94A 3B5GA 1KPUB 3QHFH 5SWSD 1F3RB 4MA7H 2DQIH 1JV5A 4LNVA 4OCYL 2GITA 4JPKH 1E6JL 2APWA 1UH3A 3O6LL 1FBIH 1MWAA 2ADGA 3WLWD 1XGTA 3CCHA 1KEGL 2Z0BA 4FMKA 3H9ZA 1U91B 1HINL 1TLKA 4AEIH 3DI2B 1RFDH 3I2CH 2XY2A 4KKAC 3VXUE 1UWEH 2QLVB 4OZIF 1TCRA 3H9HB 3G5ZB 4PJ5A 4OCXL 1NBZB 4O9HH 3SCMC 4YXHL 3RZCC 2ZCKH 5ICXB 1AJ7H 4XCNA 4ENED 4LLQB 1YPZB 5HHVL 3LEVH 2QBWA 4Y16C 3V6BR 2KUTA 3F62A 3BH8A 3H3BC 5TPWH 4ZFGL 3LB6D 5TE7H 1BQSA 1SY6L 5EDXA 2VRAA 4GW1A 4KQ4L 3BKJL 1LO3H 5A43C 1T20B 3ZSTA 4HK3J 1U95A 4IOIB 2R0WL 1X6NA 1GGCH 3RHWF 4E0RB 1XCTA 3O41B 3OAZH 1WZ1H 3DO3A 3QUMH 1RY7B 4D0BB 3E6FB 3QNYA 3JZ7A 2YHGA 4L8SC 1NCAH 3BN9D 5KSAD 1UYWL 5T1DH 1BVLB 5FKAB 4ELMA 1PG7X 4PGCA 1ROWA 2UY7A 3C08L 4AH2B 5LGHH 4R7DA 1QP1A 4WI4A 2YSSA 3IKCB 1SMOA 3LKOA 1EHLH 4OKDA 3SGKC 1UGNA 4JDTH 4Z0BL 4YHKH 1WC7B 4M7KL 3FO2A 4OCNC 1XZ0A 1OF2B 1PQZA 4N1EA 4YQXH 3HE7C 5CIPB 3HI1B 2DLIA 1QRNE 2VLRE 1Y0LA 2HT2D 4OJFH 1MJ7L 1M4KA 5DJAB 3I50L 4G43B 2FATL 2ATPB 1KIRB 3NPSC 4Y88A 2VC2L 4HX1B 5EOQL 1S7VA 5DFVD 5EU6E 1CI5A 5F7MC 2D31A 3IDGB 5C0BD 3RWCB 1R3KB 5I9QC 1N5AB 1P84K 4PJHF 1X4YA 5E8EA 4KRPD 2EH7L 1WFTA 4JANB 3TYFB 3T09A 4P2QA 1CDGA 1MCOH 2J8HA 4U1GC 3HZYA 1SYSB 1TFHA 5HTSA 1YMME 3DJ9A 2DYPB 4MGXA 4Z7OF 5ID0B 3M45A 1PY4A 1FV1A 5C0EA 4TUJA 5IWLC 4XVTH 2WQRA 1A7OH 5DK2A 5ESVA 3LRSA 1E4XI 4YHOL 3LS5H 2Q7NA 4LU5L 4GFTB 1BIHA 1CDIA 3KDMA 3WE6A 1C1EL 4P2RD 1WF5A 3DROB 4YC2C 2I60H 4NFDA 3U46A 3ILPB 1KELH 3SO3C 2XNAB 3UYRH 3RIFK 3BDXA 3QUYD 1EBAA 2Y36H 1AIFA 1NEZG 1B0GA 4ZAKD 4I5BB 1HDMA 2B4CL 2HJLB 1MFDH 5J13B 3MRJA 5DTFA 5KVGH 2ARWA 4MXVF 3VXSA 2ADIA 1Z2KA 5ACMA 4XPBL 1XIWB 3DRQB 1QFUL 4PGBA 3U4BL 5FGRA 2UZYB 5DD6A 1ITBB 3Q6GH 3LPFA 4OBRA 5IB3B 3B9KD 2NW3A 1KG0B 1QBLH 4JFDE 4WEBL 2BY0A 4WEUD 2DQHH 3TFKA 1K5NA 2V5TA 4H8WL 2G5BB 5C0AD 3HI5L 3S5LG 1OAZH 2WZPD 4OM1H 3WHE1 2J8UB 3OAYH 1YEDA 4F58H 4O51A 1AD9B 1VDGA 3WN5A 1WICA 1MY5A 3HB3D 4MXQA 4OUUB 1KCRH 3FO9A 3GJEB 1UH2A 5D5MB 5E24E 1YEHH 2ZSWA 3QNXA 3MRBA 1KPRB 3F12A 4AQOA 3OAZK 4D3CL 2XN9A 3O6KH 4LRIA 2OXHA 4XNQA 5A2FA 4YDKH 4WHTB 1U8JA 4M48H 2AJVH 4FFYL 5FHAL 3EFDL 1XGYH 5F3HA 5DK0B 5EIVA 5INCA 1M7IA 5HHMA 4OF3A 4UB0H 3BESR 1UB5B 1LEIA 3S88H 2ERJC 2CGRL 2P5WA 1QSFB 3QA3B 1BFOA 5LAXB 4D9LH 4F7MB 4HEPG 1CGUA 1ZGLA 2VLRB 3BPLC 4LHUD 2CKBA 5LCVH 4WFFD 3NCMA 5BO1H 3VGGA 1FL3A 3WS3B 4JO4L 4PJCE 3TT1H 5DMYA 3QIWC 5CEZD 4R2GC 2JJUA 5JOFB 1MFCH 1TTFA 4OZHA 4Q9BA 4N0UB 4H20H 1JZ3A 3S88L 3MV8A 5I19L 1CWVA 1NUDA 5CJQH 4OUUA 4EI5D 2HT4D 1FYTB 3GSVB 5HHVH 4R4NC 1JGEA 1MHEB 3RI5K 1BIIA 3RVXD 1HH9A 3V5HB 1E4JA 4PJDB 3V0VB 1FC1A 4G7VL 4W4OA 4RZCA 4FQQA 2QHRL 4GS7C 3S4SA 3TVMD 3ZKQD 4MS8C 4LLVB 3BQUD 1M71B 4F37F 1OP5K 5J7CC 2FZ3B 1ES0A 2HRPH 2QL1A 1CLCA 3FHAA 4PS4L 2ZZUT 1KBGH 2DQEH 3E6HB 3ARGB 3QUML 4OF5A 1JE6A 1OW0A 2E27H 3TO4D 4OZGF 1AQKH 2OZ4L 5I9QB 2QADD 2O26U 4QTHA 1RZJH 1J8HB 3DX8A 4DWHA 1RZ8B 1ZOXA 1OTTC 1AXSA 3IJSA 1ZVSA 5DEGA 4WTZA 3LHPL 3HRZA 4DKAA 1NLDL 4HMEA 2PW1A 1U8NB 5DMGC 3UDWC 2GAZA 4N0FB 1L7TH 1NCWH 4NPYB 3HC3L 2XWJA 1U6AL 3KPSD 5C08A 4L8BA 3QFDA 4CAGA 1HHKB 5EH1A 2HVJA 3RDTC 1GGBL 4LK4A 2X4TA 4WFGD 3N06B 5I1CH 2Y36L 4L4TB 3MLVL 2YN3A 5IFAH 4K7PH 1J05A 1FG9C 3E2HC 5FUZH 3B9KB 5HYJB 2Q6WA 2BERA 2HYMA 2X7LA 2DBLH 5JXEC 3ARFC 2ARJA 3UPAA 4L9DA 4XC3H 3GDBA 4YIQB 1KLGA 2Q3AA 5F88B 3UTTB 3VWKA 1A9BB 1YPZE 3PE9A 1N6UA 3PWUA 3HC4L 1D5XB 2OMBA 3SPVA 1J12A 2PTVA 3VFNB 3BPNB 3X3GH 3VFPB 3HNVL 5F3BB 4MNHA 4OI7A 4MQSB 3KR3H 1S7TB 4NQCB 1QEWA 1HQ4B 4PLJD 3ZDYF 4WI8A 5CEZL 3THML 5IR1B 1EXUB 4H26B 3BP4A 3DARA 4CDHA 4KGJA 1TZGH 5D1XA 3PP3H 1LO2L 3TZVD 2G2RB 3UJJL 4MB3A 3UYOD 1KXVC 3MXWL 1CFVH 4JO3H 1ZA3A 4NBZB 5DQ9A 5BQ7B 4NM8H 4KK8C 5D70H 5GISL 1NUGA 3MNVB 3GHEH 2APBA 4YAQA 3O9WD 1KCUL 4NQTA 3NTCH 4X7CC 3D85D 4MVBA 1JGLL 4QTHB 4L8DB 2R9HC 4PBWD 1C12B 5JDSA 1XZ0B 3BQUA 3IT8D 4MLIA 3ETBF 2Q8AL 5CWSB 2PYEE 3ARDA 3LKSA 1KCLA 1G7QB 4UDTB 1JPGA 3WUZA 4KTEH 2W0PA 5L2KE 4ONFH 4OFKA 3L7FA 4X7FC 3NFNA 3S37L 4ZSOB 3T0EE 3C6SA 1VKXB 2CH8A 1HQRB 1HHGA 2XI9A 4JFOA 2WV3A 5BW7A 4K2UL 2WWMC 1CL7L 3IS1X 5ISZE 4JCLA 4XC1H 3CGTA 3UYRL 1WZMA 1N8ZB 3NIFF 2OQJA 5IQ9B 4O4YL 5IMLA 4H1LG 1I1YA 1E6JH 4Z7WA 4P9MH 4KUCD 4OTXH 3LKQA 3GSNH 5MEPB 4QHLA 1K8DA 3VU2A 1BVKA 1VFAA 3OKOB 9CGTA 2ZG1A 2EYRB 4O2FA 3TO4B 3RU8H 2QADB 1RD6A 3CMOL 4OT1H 2LV4A 3U48A 4M8QB 1JCKA 3VMPA 2NYYC 2YUVA 3TBWA 3VXSE 2MKWA 4ZD3L 3QI9B 3VD5A 2AEQL 1BQHB 1QFPA 2IWGA 1D9KD 3PWPD 3QG6A 3C5SB 1F58L 5HHOA 3P11H 2W9LA 4YHNB 5A2LH 2BZDA 2Q3ZA 2PYED 3UPRB 1IM9D 1WV7T 4OLXH 5ELIA 3IRPX 2IPUG 4WNQA 2VDNH 1IFHH 2Y06L 5GXBB 2F15A 3RGHA 4XI5C 5F1IA 4ODSH 2NW3B 3VXQB 1IAOA 2YWYA 2Y5TB 4P5TA 4PRDA 5GS0L 2J8UA 4XXDA 3SE8L 3RWDA 4NKIL 1H8OA 3EOAA 2NY6B 3T3PE 5I1EH 1T1XB 4HIHA 1NJ9B 1FG2A 4JZOA 2Z8VC 1IEHA 1VA9A 5CIPH 2LFGA 3HR5A 1DCLA 4WJ5A 1JWUA 2UV3A 4DN4H 3QDHA 4J3OC 5B39B 3C6LD 5F1OB 2XKNB 5KSBE 3TZVB 2N56A 5FUOH 3QEHB 3QXUA 2HLFC 3QJFA 4XNUH 1GHFL 3MRFA 3CUPB 4O2CA 3AUVA 2G60H 1IAII 4GMSH 3B4NA 4G5ZL 4X7TB 1HEZA 1BEYH 3HCVA 3RIFF 2JELH 2WUBH 4WUKL 3REWB 4HUXB 1ODAA 3IDYC 4PJBA 5C09B 1JL8A 5D7JB 4XMPL 2L0DA 5T3ZL 5FHAH 1D5ZA 3IJHB 4F80A 5IM7A 1GZQA 1AO7E 4TUOB 3KPPB 4E5XB 1EGJL 1GXEA 4PB0L 1YNKH 2N1KA 3AY4C 3LKPA 1OSPL 3Q5TA 2WIMA 5ACZB 3X3FH 4ZUSA 2BY3A 4P2QB 4N8CH 2AEPH 3EDKA 2FO4B 3CK0H 5EZLA 1S9YB 4FXLA 4G9DA 3I50H 3EYFA 4UOW1 1A14L 5KSAB 2BX5A 3PQYE 2JK5B 4UILH 1A7OL 4F33A 5I76A 2BDNL 5I1DA 3LN4A 5DDHA 1INDL 4JZJC 3DVGA 3NIFE 4L4TA 5DVKA 3PWPA 2AV7B 4UTAL 4KQ3L 5EU6B 1UZ8A 5L88L 3CVHA 2CSPA 4GKZA 1MJ8L 4F7TB 2V2TA 2WP3O 3TN0D 3HN3A 5KJRH 3O8XC 1S5IL 4N5ED 4NHUA 3FONB 3TF7A 5JOPD 3GMQA 1QBMH 4LOUC 5JHDD 2YPLA 2G60L 3QP3A 2C3HA 4HSQA 1J1XL 3EIFA 2QSTA 1QRNA 5CP3H 4C83B 5F7HA 4J3TA 3S97C 1S9KC 3FN0L 3QUYC 3MRMA 1Q9WA 4OQTL 2X09A 4HKXB 4J7RA 4GQ9L 4KRPB 3STBA 4WU5A 1LDPH 4APQD 1YYLH 4B7LA 2CR3A 3A67H 4WFFE 2VLLB 3QDMD 2E8YA 2AXGA 2VISB 4LRNL 2EDOA 3C5ZC 4LL9A 2NY1D 1UQSB 4GW4B 5D96B 4GUPB 1S9VB 5B38B 3C5SA 4MWFA 5I1LB 1NC4A 1U3JA 2H2PC 1I8KA 3L5IA 5AWNL 3MREA 3VXPA 3RWFB 3MJ9A 8CGTA 2E9BA 5BVPL 2CIKB 3WIHA 2HJFA 1U8HB 1NGZB 4OCSL 3EDEA 4WUUA 4OLWH 1A2YA 4Q6YA 5SX4I 1FFNA 5CLTA 4V3DB 5DRXB 2BRRH 1TJGH 4PJFA 1BOYA 3UMTA 4Q97A 2GITB 3QUZA 5H2BA 1A02N 3UTOA 3GGWA 4KZEL 5IGXH 4Y89A 4NYLB 4NBYB 3RNQA 3WV0A 5I17A 2RHEA 5LQBH 1ZEAL 4JDZA 2B1AL 2CJUH 4HUUB 4LCUA 1TDQA 3TCLB 1OAUH 4WO4B 5IMLB 2NPLX 3F8UB 3WIHL 4EIGB 1YMHB 3C5JA 5D6DA 4H20L 1R3LA 5F96L 1FGVH 2C1PB 1UCBL 4HC1L 3LKQB 4XVUD 2EDJA 4G9FB 1T3FB 4HCRL 3RVWC 4JRXB 4PJGB 2ZUXA 1QLEH 5EIQA 1TQCB 4ONGL 4J8RA 4U3CA 2VZ3A 1I9RH 2OJEA 2ITDA 3LDBC 1ADQH 1D5MA 4N5UA 1B88A 5K33A 1CGSL 4OZIB 4NM8L 2QR0A 3IDNA 4U6XA 5DGRA 5DUBB 4PJ7A 5B3JE 3GKWH 4KFZC 4QRTA 5DS8B 3GSOB 4HAFA 2F5BL 4HIXL 3BRDA 4A2MA 1ZHKB 4Y4FB 4P2RE 4NN7B 3ARFB 4EOWH 5FFLA 4TQEH 4JY4A 2HG5B 3PWPE 4PY8I 1HWGB 1HXMA 4EVNA 3OMZA 4WV1C 5LGHL 4LKXA 1BAFH 4NHCL 2HP4A 1BLNB 1RVFL 4IRSC 1MI5A 1Q9LA 1DQQB 4J3XA 3I2CL 2DAVA 2R0KH 1QO3B 1IGMH 1CIUA 3EO0A 3CVHB 5CBEB 1UEYA 1A3QA 4KHXL 3D25A 2Z93B 2P7TB 4DUWA 1NGWB 2QHLA 4GW5B 2Z8WC 4MD5A 1UCBH 4HC1H 1OGAE 3MV11 5E5RB 1AFVH 3WFDH 4NWTH 3OKLA 5T3XD 5GSRA 3VMNA 5I76B 5D1ZB 5DVLA 4GRWB 5EBGA 1KPVA 4RQQB 1YECL 4YEFA 1H0DA 5T1KD 4P3CL 1W0VA 4FXGA 5F7UA 2ESVB 4PD4K 1Y6MR 3W0WD 4LFHD 3PDOA 4Z76B 1M7DB 2B7DT 2YPVL 1AHWB 1NAKL 1XGUA 3Q3GA 1N5AA 4A6YA 1TNNA 2BSSB 5GS1C 2YEZB 5MI0C 4PTUA 4WRLA 5F9WC 2Y25A 2OTPA 1QSEE 4EQ3A 5INDB 5AD0A 1V5JA 2W60B 4R90L 4XH2B 5HGGS 3ARGD 1KTRL 5FYKU 1CXIA 2OCFD 4Z78A 4LSSL 1NGQH 4OZFB 4M43H 4HEME 4DZBA 2BNQA 1A0QL 3OPZH 3QEQE 1P7QD 1W2KT 3GSXA 4WUUE 3SGKA 2NNAA 4BK4A 3AGVA 3QXAA 5JMOC 1S9WB 1FORH 4KQ4H 4PJEA 4GG6E 5JR1L 4MDJA 3EDDA 5F7DA 2D7NA 1IL1A 1QFWM 1NCBL 4JFEA 3QWOB 2AXFB 4YNYA 5E6IC 5BZDA 4YBQC 4TSCL 5CSGA 1V3KA 2NR6C 4KKCC 4AZ8A 4OD2A 3VWJC 4GLRH 3HZMB 5T5FL 1I1RA 2BNQE 5DS8A 3CFEB 2J6EA 1YEGH 3W82A 4LSTH 1T1XA 4WO4D 1RIVL 4OZGE 4UILL 4PJ9C 3B83A 3FT4B 4A6YH 3HFMH 3CJJA 3MCKB 2XTJC 4S0TD 5C0IB 4WV1B 2YOCA 3O41A 2P8LB 3VXUD 1S5HB 4K8RD 3L3JB 4P2YA 2MCPH 5IFHL 3L5XL 4E41B 4PB9H 2AQ2A 4XMKH 1J0KA 3NZHL 4OGAD 5I71C 1FN4A 3AAZA 3WS6C 4JY5H 4KPHH 2V9TA 4WFHD 5FEBA 4KXZI 1M6OA 5J1AA 3TT3L 4M6ML 4N0CD 6FABL 5MEPA 5HYQA 5E03A 3CLFL 4CRPA 4M7ZB 1WISA 4KI1A 4WI2A 4PJCF 3TYGH 1MJJB 4M8QA 3G08B 4MS8D 2COQA 4U1IA 3RL1B 5IQ9A 4DGYH 4D0CB 1TPXC 1C5CH 4LP5A 1IILE 3H7LA 3QFJB 4LMQE 2OR9H 5GS1B 4HUWB 4CN6A 4MHHI 1LO2H 2RCSH 3C8HA 3HE6C 4ZFFB 2ARJQ 3MV8E 4QF1A 1U92B 5IESH 3X12B 3SDCA 3VFUA 4E9LA 5ESQB 1G6RL 1NMBL 3Q6GL 5FOBA 1WQVT 2WM0A 3SCMB 5D71L 2FR4A 3MFFA 4XPGL 3UTSB 4ZTOL 1VFOA 4UTAH 3FFDA 1D6EB 1DFBL 5KS9B 1DDHA 1JFQH 1AGEB 2CLVB 3KXFD 3RZCA 1WLHA 1W8NA 3NPZB 1RU9H 3ARPA 1SJVA 4LCWE 1TZIA 2DJSA 3BZDA 1YEHL 2NXYD 4PJXB 1QRNB 4MJID 2VQTA 1T5WA 3O2DA 4YK4C 4YEEA 4OGYH 1G6RA 1PYWA 3WNPA 4LNRA 2E7LA 1I8MB 1G7HA 2FYYB 3EHBD 2NW2B 2DQHL 3OR6A 4ODUB 5DQDH 4NO3A 1S8DA 5ILTL 5C0CE 1A1MA 2MWCA 5AD0B 4MJ6A 2OS7A 4HS6B 5KSAC 5FB8A 3O4LD 2NY3C 1P7QB 3P4NB 4S10A 3BMVA 5DEZA 1DBKL 1EZVX 4ODVL 5CKAA 1QSVA 2RCSL 4HFUL 2D2OA 4NZJA 4OTXL 4M5YL 5T5NF 4YPGA 3UTQA 4J3SA 5DRWB 4AEIL 4GKSA 2R0KL 1MVUA 3D39E 5GGTH 3FOMA 3U2SB 4GS7B 4NP4H 5GRJL 4PJIA 4M1DL 4NGHH 5CZXD 1YNKL 1DVFD 5GS1A 2Q86B 4XAWL 4X4ME 1A7RL 5DURB 3VFVA 5CBEA 3V4PL 3MOAH 1R3JA 3RWEA 4C4KT 2OI9A 3RDTB 4A6YB 2X7LB 3BPOC 1QFOA 2OM5A 2VIRA 3O3AB 3UC0H 3VXME 3FTGA 3H3KA 5C0AE 2R15A 4MLSA 5DJDB 4LP4A 1JHKL 3IDXH 1TVHB 2GFBB 3DUUA 4Y1AD 3MZTA 2DQJL 4JM4H 5BJTB 1R3KA 3ZYIA 1ORQB 4P23B 5HPMA 1OP3H 1DVFA 1IAKB 3RJQB 4JHWH 1YN7B 2PO6C 2VWEE 1YUHA 1ED3B 4GG8A 3DHJA 2GY7B 5I15L 3LZFH 1DBBH 4TN9A 3VJ6A 1Z0NA 5LGKA 4P2QE 3RIAK 5DVMA 2NY4B 3G6JF 2BFVH 4OZFH 1BLNA 1Q9KB 3RUGE 5L8LB 1RJYA 3OKEB 3QIBA 4Y1AA 4KKBD 1P4IH 3O2WH 4JDTL 1YC8A 3DV6A 1OGAA 5DC0A 1F4XL 4JG1H 4EUPA 1P53A 1AGBA 1RUAL 4IOFD 1Q1JH 3O4OB 4PJ5D 4ZSOE 4PJFF 3K46A 3CFJA 2NR6D 4XCEB 1YMMD 4OZHB 3SCMD 4O02H 1T1ZA 2E9WA 4M8VA 1F5WA 4NQEE 5F9OL 4JHAH 2GUOB 3UPRA 3BDYH 5GRUL 4LGRB 5EN2B 2E6QA 4ODHH 3QXTA 5JNYA 4MXVE 4YFEA 1HSAA 5BMFH 4LQFL 4QHUA 3GNML 1A6WH 3G08A 3WS6A 5BJTA 1K4DA 2XACC 3LEXA 4JZNB 2RQ8A 1R24B 1GGBH 3L3GB 3TO2B 2BP3A 5A1AA 1R3LB 2BVUA 5KAQF 3U7AA 1V3MA 3V9FA 2WLYA 1OAXL 1TZHB 1IKNA 1E28A 3MO1B 1NC2B 4LRIC 1S7QB 1BF8A 2EXWD 4YR6B 3V0WL 2PXYC 2PO6B 3U30B 3ILQC 5DT1H 1LEKB 2V7NA 3V79C 1YEKH 2WSKA 4OD3L 5BCAA 4R9HA 3T2NL 2H8PA 4AG4H 3R0MA 2DQTH 1CU4H 1CF8H 5E8NA 5CJBA 3S6CA 3GJFA 3WXVL 3KJ4B 4WW2A 5D2LE 3WO3B 2CO7B 1CE1L 4H1LB 4N1CA 4F15C 5FM5O 4KMTH 2IH3B 1SJEA 5SX5K 5DJ6B 5D7JC 5FB8B 2VE6A 1I8IB 3CFKB 4PV8A 3QWRD 1PY9A 5BW7C 5D71H 3QIWA 4P2CG 1I3UA 3TH4T 3LKSB 5BZDB 2NY6C 3TBSB 1CK0L 4G8GE 3BPOB 5DVOA 4G6FD 3VXOA 5F7DB 5CZVH 1WAAF 4ODSL 1QYGH 3IF1B 2FD6H 4FQHB 5FO7B 4BQ9A 4FQLH 4HK0A 2A6IB 3F7VA 4PP2A 4CVWA 4V2BA 4XI5D 2X1QA 2EDFA 1EUUA 3KWWA 5FUZL 1JPFA 4PJIF 3KAAA 4PJ8C 1JP5A 1DDHB 3RZCB 2FHFA 3V6ZB 2JB5L 3IJYB 4PJBF 1S78D 1ZLWK 5EZJB 2F54D 2VOTA 5GSVA 3GBMH 4Z7UA 4GKNB 1JNNL 4OV6F 4QCIA 4G9DB 1GJIA 5AZEH 1X7QA 3D39D 4BSVB 1EEYA 3BIKA 4F7PA 1J5OH 5I19H 1YEIH 4BFIB 4R97C 2EDDA 3VXTB 1DE4B 5IFHH 1FNSL 3G04A 4PJDE 4JRXD 1N2RA 2D3VA 3Q5OA 2R4RH 1QLFA 1I8LC 2BMKA 4JFFD 2VSCA 3RWCA 4R6UA 3U7WH 2F53B 5HVWA 1NSNH 4PJIB 4ZUTA 4FQXB 3STLA 1K3ZA 1UC6A 2HKFL 2M26A 3PDOB 4Z76A 4ORGA 5L8KB 3I75B 4XBGB 5F70A 4EDXA 2DTML 3HPJA 4DJMA 4OB5L 1I1CA 2QQLH 1N7ML 3MRFB 4UZGA 3X11A 3TPUE 3MODL 4PBVC 4HCRH 2YS4A 4FRWA 2CLZA 3VDBA 1FIEA 1ERNA 2R0LL 3BIBX 3KYKL 4I77L 1H15B 4TRPL 1BOGB 4JREC 3DO7A 1SYVB 4QRRE 1MY7A 5DJZB 3L1OL 3VXPB 4U3XA 1NANI 2O5XH 5I6XB 1LE5A 3QDMA 2VNCA 4QT5B 4MDIA 4EDWH 3NPSB 2CK0L 4LNRB 2B39A 1CR9H 3RVUD 4B53A 2YPKA 4XPFH 5ICZA 2DQEL 2Q8BL 3GMLA 4NNPH 3E3QC 3MYJA 4OM1L 5HHNB 4PV8B 3KPOA 4JGUA 5CINH 2NY7L 2PO6D 1RIHL 5ACLA 1ACYH 4OCYH 5T1KB 4NN5B 2GJJA 3UZEA 2AJ3B 1P1ZB 5EU3B 3W81A 4ODWA 3OXRA 1JGEB 4PJ7B 3S34H 1RZGB 3H9YA 5IJKC 4D0BA 1Z9LA 1LP9A 4TUKL 3O2WL 1T2XA 1XGYL 3QUZD 1BFSA 1BHGA 5DJCA 3BE1L 3KR3L 3OGCB 3IXAA 2ZPKH 3BWUC 2QTEA 5GGSA 4MAYB 5DJYA 3BFOA 3H9HA 5CGYD 5T3ZE 2VDPH 5IHUL 4UAOC 3SQOH 3WKMH 1SYVA 5D93C 2DBLL 1UZ8B 3CFBB 1F11A 4JB9L 2X4QA 4MXWL 4P4KA 3PHQA 4DKEL 2E7CA 5K59E 2W38A 2HJFB 3Q3GB 1EEQA 1G84A 2W65A 3MRDB 5TQ2L 4QRUA 1RUAH 4QHUB 3FT2B 1T4KB 3IGAB 1QHPA 5H37H 4X4YB 4NRZB 5HHQA 3N0PB 4NQCD 4K55A 3JUYA 1KFAL 1YA5A 3GIZL 3WFEL 5L0QC 1P7HL 4WHTA 3V4PH 5LXGH 5E2VL 5KTEL 1MAML 2AXHA 2E7MA 5DJ0B 1PX4A 4P9HH 2BNQD 5SWZD 4PRIA 1LDSA 4LFHG 4FG6C 5E2WH 4XTRC 3OAYK 1OTUC 2XZCH 3S5LB 5B8CA 4H88L 2V2WA 3OGCA 1NMAH 4C59B 5C08D 1T7VA 4KRNA 5GSVB 3DIFA 1PBYA 3O11B 4PRAB 3WFHA 1S7UB 1JFMA 3QEQB 5H8DA 5EIIB 5BV7H 4Z7UF 2EH8L 5ID1B 4XNZC 4U6HA 1J0JA 3JV6A 4LLYB 4DQOL 3B2UC 1RK1B 1I1FA 5BXFB 5HGDB 5LG1A 1L0XA 4NOFA 5L7XH 3BZFB 3SJVE 3SDXE 4ELKA 2NCMA 3C6LC 3LD8B 4PP2B 4CADB 2WWKO 4HIHB 3QRFM 3HS0B 1MCEA 2ATKA 3KYOB 1UM4H 3CSYB 2ZOLA 1YY9D 3Q48A 3P3YA 3ULVE 3R8QA 2BOBA 2BRRL 5GZOD 5D7IE 4OCRH 4O4YH 3V4UL 2JK5A 5DD5L 3QIWB 1R5IA 2Y5TA 4P5TB 5BS0D 1BJ1J 2FGWH 5KVDH 1ZTXH 1E0OB 3GM0A 4NO2B 4RRPA 4XVTL 1CFTA 4M6MH 2GCYA 1SY6H 1GYAA 4N0CA 4PLKC 2PYFB 5HI3C 1FYTE 3GHBH 4I13B 4WEBH 2R29L 4EI5B 2EC8A 4NRZA 5FM4A 5ETUB 2C1OA 5HYJE 3MRLA 3RVTC 3KYNB 5FUCE 3D85A 5GQBA 4X6BB 4JDVB 2I07B 3EGSA 5L2JB 4F2MA 4ZUTB 2X4SB 4PJ9B 5KVGL 1CL7I 1P4LA 3V5KA 1AHWC 4M9OA 1U8LB 3PWUB 1FIGH 2HN7A 3EYOA 4P99A 2AJZA 4PJ5E 2A6KB 4MJIB 3ALXA 4U6VH 2AK4A 2JCCF 3N1PC 3EO0B 1J0YA 2D7TH 3GI9H 2DIBA 5IK3B 3C8DA 3OKDA 2GJ6E 2V9QA 3ZL4H 4UT7L 1NKOA 1I7RA 1CL7H 3VGDA 5I1LA 4XRCA 3MUGA 1WCBB 2BSED 1Z5LB 4XCCL 4MA8L 1FP5A 5F8RC 3GMNB 2NXZB 3FQWA 3EBAA 2OBGA 2I5YH 4APQC 2EEAA 3CU1A 4J6RL 5IVXA 1RZGA 2V6HA 2UUDK 3VXUA 1M71A 2YUXA 1J8HE 3HR5B 4PGCB 4AH2A 4X6EB 1NCUA 1DQDL 3PGFH 3ZDXF 4L1DA 2JCCB 5I1JL 2C7UB 2EEBA 4EUPG 3WSQH 4XHJC 3CDGA 4Z18A 3DXAA 3NFPA 4EEEA 3QIUB 5D2LB 1OGAB 4QRSB 4WY7H 2BVOA 4QRPD 1D6VL 1AGFA 1KCVL 3MR9A 4K3DL 4Y7MA 4DTGL 4EXKA 1NGPL 4MAUL 4PJGA 4X80L 1QKZL 1NAMH 2AI0H 1LD9B 2WY3A 2VWEC 2ADFH 3QHZL 2WUCH 4FFWC 5FCUL 3T0AA 5IMOB 1SVCP 2EE6A 5IQ7L 4M7LL 1OAYL 1CGVA 3FFCA 3SBWA 3TH3T 4DUVA 3CZJA 3PGDA 4AIOA 3FB5A 3EOBB 4LASH 2NX5D 2P5WE 3FOLA 1T5XB 2A0LD 1EX0A 3HR6A 4NQDB 2PF6A 1INQA 2YRZA 3J8F7 3ZKSD 1LEIB 1A1NB 4D8PA 5BVJB 4G6KL 3ALPA 1EV2E 4JN1L 4Z7WB 4Y4HD 4K9EH 1OSZB 3CXHK 3SDYL 3VFWB 2Y07H 4CU6A 3FQXB 4Z77B 2O61A 2E7HA 3RTQC 3VFNA 3WIFB 4MQ7B 1RZ7H 2V17H 1WWWX 4PIRF 3P0YH 2P8LA 4L4VD 2CDEB 3I6GB 4Y16A 1KLFA 5DD0L 2Q76B 3VGAB 1QSFA 2VZUA 4JREB 4NBXB 1WBYA 1BECA 5KJRL 1YMMB 4K8RH 4GAGH 3DSFL 4RWYL 2FJHB 5GS0H 5T1MA 4XAWH 3JV0A 5KANI 1AXTL 5F71A 4S1DD 3IFPA 1V3LA 5D5ME 1HYRC 1P1ZA 4FZ8H 2VLJA 2VN4A 3KXFE 1F3DH 2DD8H 4PGBB 5T3XL 2BXZA 1RFDL 2VR5A 2HT3D 1IKNC 3V6OA 3CNKA 3DNKA 1OWWA 4KROD 1LEGB 1OSPH 3UAJC 1XMWA 4M6OL 1JF6A 1M1SA 4W6WB 5E9DE 2X89A 4YO0A 1W72H 2VH5L 1FZJB 4NNYA 2XFXB 1AP2A 1CXKA 4PY7B 4KY1L 4Y4FC 2FZ3A 3LRGA 4X83A 3HTLX 3OZ9L 3L3DA 3S34L 2FX9H 5LWYL 5CP7A 2G2RA 4MCZA 5CGTA 3R06A 4U7SA 4M1GH 2F74A 1HDMB 2X4SA 3LQZB 1Z3GH 1DEEB 2ED7A 2V9RA 1NFDB 3AM8C 1MUJA 3GRWA 1BMGA 1LK2A 1AC6A 2EIZB 1KCKA 4OSUH 1SBSL 4PJEF 1IM9B 5FOBB 1LO4L 2J5LC 2PTTB 4LLWB 5IHUH 3PWVA 1XF4B 4MA1C 4KJQD 5K9OA 4C56A 1AGDA 1GZPB 1A6PA 4LHQB 5I0ZA 1JYWA 1NGXB 3QIUD 4LVNC 2CRYA 4ONFL 5F7YC 3UZQA 1OHQA 3H6JA 1EHLL 3WIHH 4YDIH 2BSTA 2OJZH 3VFWA 5E56A 3TO2A 5F72S 3OKNB 1YYLL 4WW2F 1RK0A 1ZS8A 2AS5M 5A40E 5CJOL 4DK3A 1Q72L 3MRHB 4YPGB 3ARBA 3JWOH 3KNBB 3MR9B 4L4TE 4MMZC 2HG5A 1KULA 1ZTXL 2E7LC 4OLYL 3L5WB 3PP3K 5EBMB 4F9PC 3QQ9D 2C5DC 4YXLH 1I1FB 5HI5D 5IF0B 3FFCB 4UUJB 4MJ6B 5SWSA 3TC9A 1NC4D 3OJDA 5IVXF 1SBBA 2CK0H 3IJSB 4K2UH 1S7SB 3UTTE 4ALAL 4LDLB 1A3LL 3LN5B 1OARL 4NZRH 4WUUD 1WIOA 1C5DB 3O11A 4L3EA 1MHPH 5FYLE 1AJ7L 3ARDB 4BA8A 4WW2C 3MJ8A 3EDJA 3CFKA 5E94B 4K3JL 3CZFB 1T80A 3MUGB 1TZIB 3GIVA 4MXQC 4OZHE 3C8KA 2XOTA 5IB3A 4FQQB 1JHTB 1CLYH 3BH8B 2BRQA 1IEAA 5E6IA 3L3KA 3BEWA 1YMHA 3C5JB 2ZUVA 3PP4H 5GS0C 2X42A 4H88H 3QNZB 5C09E 3BO8B 4IIQA 2H32B 1NFKA 4HCRA 4LSVH 4Y2OA 3OKKA 3OXSB 3QXWA 4ZOEA 3FO0H 4M93C 2WBJD 4NQSA 1FFPA 1MLBB 1X5LA 1FO0L 5ICYB 3ULUL 4XPTL 1BFOB 3AS1A 4NUGH