1S7WA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
276
structure length
276
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
total genus 65
structure length 276
sequence length 276
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF06623 MHC_I_C MHC_I C-terminus
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7wA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1s7wA01
1CBVL 5F7UA 1T4KB 4JQXA 3RWGA 4Y5XB 4YK4C 4N1CA 2Z92B 2NY3B 4M62H 3GMRA 1JYWA 2XQBH 3C8DA 2VLRE 4OM1L 1BZ7B 1IGTB 1YDPB 1VKXB 3U9UA 2Y06H 2VAAA 5HYFA 2VQ1B 5BV7B 4L3EB 1RV6X 3KLAB 4KVCH 1NBVL 3RVTC 5L9DL 1DTUA 2Y4SA 4GO6B 4AQ1B 4HKJA 5CLWA 5IM7A 4U6YA 2BP3A 1GZPB 2EIZA 2NY6B 4YR6B 5E2WL 3MRJB 4UTBH 4LSPH 4X4XB 4HPOL 4ZAKA 5CJQH 1ZTXL 3MJ6A 3U4EB 2EH8L 4XHJD 4C56E 4HWZA 5DRXB 3DV6A 3JBG7 4IOSD 1ZGLM 2VZ3A 1JF6A 3OF6D 4POZC 2ZUSA 3CSBA 5B4MC 1ZK9A 4YEEA 2RFXA 5IBLD 2FHCA 4PJ8B 3QHZH 3JWDC 4XWOD 2L0DA 4B0MM 4UDTA 2UZIL 2MCPL 1J0KA 2WBJA 4W70A 1TPXC 5DHYA 1U91B 5C0AA 4I0PA 5L0QC 2F8OA 4C58B 1OAQL 3N85L 3LN5B 4X80L 4K7FB 4H5SA 4BZ2H 2V9QA 4I2XE 4HWBL 1RZKH 5JPMB 4AIZA 3MLTA 5IW6A 1DUYB 4LK4A 2GY7B 1UWXH 3G6JA 3VMNA 4ZFZA 5FGCB 4X7FC 2VLKB 3LEXB 5E1AB 4EBQL 1XEDA 4LRNH 4HCRH 4P2RA 4ZPVA 5KSUA 1MWAL 2DQTL 4HIJA 3KPSE 4MX7A 4UBDC 3VXTA 5AZ2L 2F19H 2BHUA 1QSVA 4PRHE 2IFFL 4XI5C 3GSNL 4ZS6C 4ODTH 4KWUA 3PHOB 5BXFA 3DUSA 2ICWJ 3BT2H 5D70H 1NCAH 4YHKH 1U8JA 1NCNA 2XZCH 1A1OB 2KQMA 5EU7C 2YBRA 4WIQA 1BBDH 4HD9A 3VFOB 5BVPL 5A16B 2F54E 4G9FA 4RISH 3RGVB 3VFNA 4EDXA 4ZFFB 4K3GA 4KJWD 2ICEA 4FXGA 1WWAX 2AI0H 3LKQB 1T1WB 5D2LB 3MOAH 3N1PC 4QF1B 3F8UB 3SKNB 4LNVA 4LBEA 2D2OA 4XPHL 5IP4A 2OLDA 1FBIL 4I4WB 4J23A 1NMBH 1U8OA 5IVXB 1KSRA 2YN5A 1GOFA 2KH2B 2WK2A 5M94B 4D0BB 3HI6H 4KKAC 3WFEL 3FHQA 1J1PL 5CKGA 5DVKA 4C55A 1KYOK 4ETQA 2XRAL 3VRIB 2Z8SA 2OMBA 1JNHA 4XNUH 1ZLUH 1FNHA 2IADB 5CILH 1ZGLP 4H88L 3VDCA 1FO0H 3FT4B 1A7QH 4PGCA 1FRGH 1MHCB 5EBLB 4FP8H 3DX6A 1YN6A 4RA3A 5BOZG 4GKSB 4YDJB 5E7FA 1J1XH 2ILLA 4LHUA 5E9DB 4RFEB 3WFHA 3TLRA 5KS9A 3CFKA 3O8XB 5KSBF 3FN0H 3H9SD 5FA3A 1EHLH 3DGGA 4D3CH 1I9IH 2Y36H 3L3HB 3OTTA 3WIIH 4RAVB 1CFNB 4GRLD 2XZZA 4NKOA 1YUHB 2APTA 3U83A 3ARTA 1UJ3A 5FM5M 3V0AC 5FV1L 5IG7A 1BVKB 3DPBA 3VXME 4W6XB 3C6SA 1KCUL 3CC5A 7CGTA 2J8UE 2R56H 5JW4M 3T8XA 5DJ8A 3RPIB 3WIHL 1T4KA 4Y5XA 3MNWB 4K9EC 3UPRB 1EERB 1J9CT 2DICA 2Z92A 1ZLWK 1BZ7A 1IGTA 1T20A 3S36X 5HHMB 4QGTA 1YDPA 2NXZB 1CFSB 1VKXA 1GCFA 4S1RH 2VQ1A 3U79A 4L3EA 3KLAA 4MWFB 5HPMB 2EC8A 2G75A 5HDBF 3CCHB 4AENB 4O02H 4V1DB 1FVCB 3ZE2F 4YR6A 4U6XB 2G60H 1HKLH 4DFHA 2IH1B 4NZUL 3K2MC 1A7RL 1UCBL 4NQUA 1G6VK 2DN7A 4Q6IC 3UTSE 4YE4L 3GIVB 3WHE0 4X9FA 2XICA 3VXSD 1TJHH 5DFVD 5C07E 5DRXA 4JFHD 3TJHA 4AJ0A 3ULVF 3OX8B 3VD4A 4KJQC 2VDKH 1D5IL 5F9DC 5D7IE 5SWQB 1EEYB 4GQPH 1SEQL 5E94B 1DQDH 4PJ8A 1FNSL 4KXZH 5DJ0B 2VQUA 2PR4L 1QPXA 1MCRA 3VFWB 5I6XC 4YHZL 1XZ0B 1U91A 4JG0L 4I18C 1Y6MR 4JDVB 2W9LA 3EYUL 3LN5A 3RTQB 4K7FA 5GGVL 2YUXA 2NX5B 3B5GA 1U3HD 3EJYD 5JPMA 2D03H 1NBVH 3LD8C 1DUYA 2OTUB 4M61B 1NGZB 5E5RB 3I6LE 5FYLD 1WITA 3S3PA 1OT2A 2VLKA 4RGNE 3LEXA 5E8EB 5E1AA 5C09B 4HPOH 1T1XB 4Y4HC 3GSUB 3QZWA 4I13B 4CMHC 2IGFL 4UIMB 1G7HB 3RUGB 3ARDB 3BRDA 4YXLL 3MRNB 2JIXD 4MS8C 3MLPA 4XBEH 4ZUTA 1H5BB 1KJMB 3QUZD 4I3RL 4CN6A 2AAVA 4GXUN 3KPNB 2IJ0C 1BD2D 1QSEB 3FB6B 3G9VA 4K94C 1MVUB 4MA8L 1A1OA 2H32H 3VFOA 4L8CB 1RJZB 3MMEB 5A16A 2MCPH 2UZIH 3RGVA 3V2AR 4ZFFA 3W11C 4GW5B 1Q94B 3KNBB 3DTXA 3LKQA 1T1WA 5D2LA 2OQJB 4QF1A 3SKNA 5KTEL 1PGRB 4I4WA 5IVXA 4NJAL 1OAQH 1F3DH 4D0BA 3RVWC 4F15C 5GGSY 5L88L 3VRIA 2VO5A 5DJDB 4HDIA 1JK8B 2IADA 2MNUA 4PJAE 2XG5A 3UTQB 3TFKD 1U8KB 3MBXL 1NMCB 1ZLVH 4DN3L 3LS5H 2HLFD 3FT4A 1MHCA 5EBLA 4YDJA 1MWAH 3T4YB 2R69H 5C0BD 4DZ8B 4XCNB 2EYTA 2GUOB 2ZUWA 4RFEA 3O8XA 5F6IB 1D6EB 4X9HA 3NA9L 3GSNH 4YNYB 3L3HA 4RAVA 1CFNA 3EO9L 3DBXB 4NZRL 3WXVH 5BVPH 5K9QI 3SOBL 2ZSVB 1JTTA 2JELH 1BVKA 2DI9A 1K4DB 2BNUB 3SE4C 3D3VD 3E2HC 5ANMB 4V3EB 3FAWA 1FBIH 5EULV 3RPIA 4HLJA 5FYKD 5CWSB 3MNWA 2V5MA 3HG1B 2GSGB 4KTEL 4KUZL 1KJ2L 2FJGB 4LDLB 4XVTL 3BN9D 3WFEH 5J13C 2DWDB 1J1PH 1T0MB 2CUHA 3K8MA 5HHMA 1CFSA 5DC9B 5J7CC 3RVXD 4PG2C 5CEZL 4EEEA 5I19L 4MWFA 2DMBA 3A67L 5HPMA 1YEGH 3CCHA 4AENA 4OLZL 5IMOA 1G6RL 4V1DA 5EBGA 1XMWA 3HHRB 4HWBA 2VABA 4IOFC 4HLZG 4U6XA 5I8KH 5L2KB 2IH1A 5I16B 2VUOA 3KR3H 4Y16B 4WI2A 5BRZD 1NKOA 3TO4C 3GIVA 3T2NL 5C0CE 3F6IA 3IJHB 4X7DC 1LO2L 2CIKB 5LBSL 3QCVL 2VDPH 1C12B 4NQEB 5JQHC 1ZKAA 3JV4B 1F00I 3PNWB 1ACZA 3LH2H 1M6OA 5SWQA 1KNOB 5BW7A 1EEYA 4HJGB 4PY8J 4E5XB 5I1HL 5E94A 5I0ZA 4NP4L 1CDCA 5DJ0A 5I8OL 4OZHB 1T66C 3RA7L 3LY6A 1A2YB 1XZ0A 3FFDB 3Q48A 1DE4B 2R2HB 3IT8D 4JDVA 2EZ0C 4IS6A 3VJ6B 3RTQA 4Z7VB 3SJVB 1PKOA 3FO9B 1X44A 2E8ZA 2NX5A 1S9VB 3HKFA 2NR6D 2OTUA 3I75B 4M61A 5E2TL 1NGZA 1O5DT 5ALCL 2LTQC 3R06A 3BOVA 1RFDH 2VLRD 5E8EA 1TENA 4NZUH 3U4BL 5C09A 3B9KC 3GSXB 1NCBL 4QHUB 1AGBB 1VFMA 1T1XA 1KGCE 3GSUA 4JR9L 4NHUB 3LS4L 4UIMA 1G7HA 3RUGA 5CMAB 1OGAA 3ARDA 2CRZA 4WI9A 3MJ7B 3BRGC 1EAPB 4PLJD 2XI9A 1H5BA 2EE3A 2L7JA 3STBA 1KJMA 4CL7A 1SEQH 3KPNA 4Q0XL 1U8NB 3QDGE 1UG9A 1FNSH 2WIIB 3FB6A 4PJ5E 2EDRA 1KN4H 1CXIA 4L8CA 4G6AD 1RJZA 3MMEA 5LAXB 1RI8A 4GW5A 3IU4L 4MAUL 1Q94A 2DIBA 5IBUB 3REVB 4YHZH 4JG0H 5IUSA 1LE5B 43C9B 2OQJA 4PJXB 5HI4D 1UENA 1TZGL 4X5LA 3EYUH 4BZYA 1H0DB 2DQHL 3F12B 4E0RA 5DURB 2OJEB 4OLWL 2ZG2A 3SCMC 5ADOH 1OAXH 2A6KB 5L8LB 1OQXA 2PXYD 1W0YT 3IDIA 1RZJL 3JWOH 4TNWK 2UY6A 4M03A 2XN9D 5TFSH 2Y6SC 5DJDA 4OF5A 4AYFA 1JK8A 3UTQA 4AZ8A 2DI7A 4ODSL 5T3XD 1I7ZA 5E1HB 3ZTJG 1BAFH 3T4YA 2IGFH 4Z7OF 2QSVA 2E7LE 4DZ8A 4XCNA 1KJ3H 2GUOA 3RY4A 1JZ5A 4Q7DA 1D6EA 3DVNB 4KI5C 3HUJB 4KI5E 5E2VL 5I73B 4HS3B 1U2HA 4YNYA 4WO4C 4I3RH 4YDVB 5CS7A 3KPMB 5D6DC 3DBXA 4HS8H 3IXTB 1NC2D 2ZSVA 3ZYZA 3ARRA 1NGYA 4NQCD 4ZFGL 3U2SB 1K4DA 1QQDB 2BNUA 5DI8B 3BYYA 1IC4L 2XY1A 3V4VL 3FQNB 3GIZL 5ANMA 5KTEH 4KRMB 2F5AL 3AGVA 4NJAH 2AEWA 5CWSA 5SX5K 2ZUUA 5I2IB 1GGTA 2GSGA 3PP3H 2A0LC 1HHHB 1X5KA 1YC8A 2FJGA 5ERWB 1T0MA 3BKML 3QG7H 3VDAA 2XV6B 5IB4B 4K55A 4U1LB 1P2CB 3N06B 3C2AL 3V95A 5ISZB 3QNZB 3MA9L 1RMFL 1RK0B 5D5MB 3QUYA 4WWKD 4DN3H 4KK9D 5BO1L 4P5TC 2M2DA 2QKIB 2C26A 3CSPA 5I16A 3FN3A 4Y16A 4TSBL 2H2PD 3C60C 3TT3H 3MCLL 4LQ1A 1HINL 2BVEA 3UDWC 3IJHA 3F7VB 2V9TA 5LQBL 1C12A 1YJDL 4QXTB 3OXSB 3BQUA 3EO9H 4NO0D 1CLZL 4WI4A 3JV4A 2A6JB 3PNWA 4FQ1L 3WN5A 5C7XL 1KNOA 4HJGA 1SHMA 4E5XA 3MLSH 5LWYL 5EUKB 3DV4B 3UC0H 3DMMB 3GMLB 2W9DH 2FEDC 3D39E 4UOJA 4OZHA 2F5BL 1WEJL 1N6VA 3EDKA 3WFDL 1A2YA 4GKNB 4KTYA 5D72H 3ZHDA 4BQ8A 3FFDA 2XG4A 5HGAB 3E0GA 4KUZH 4NN6B 4XVTH 1DE4A 2R2HA 4KRLB 3VXMD 3MJGX 4HQQL 3CU1A 4BA8A 1AR1D 2AEPL 3VJ6A 1OAKL 3SJVA 3VGAC 1OLZA 1RIUH 3FO9A 5EU3B 2C4XA 1H3XA 1S9VA 4AH2B 2ARWA 4PD4K 2IALB 3FRPG 3I75A 5J89A 4J4PD 3FOLB 4WEMB 4LF3B 4L4TE 4OLZH 1G6RH 1X5YA 4Y19E 3S36L 4FQXB 4Z7WE 3HFML 3U7WL 3SKMB 2IBZY 1PKQE 2DF3A 1AGBA 3MV7E 4NHUA 4TVPH 5D1XD 5IBUG 1TMCB 3BPNB 1T89C 4XNYL 3MJ7A 3FRPA 4D9RE 1EAPA 2ZZUT 1QFUL 4HHAB 1MRFH 5SV4A 5I1CL 4DGYL 1NDGB 2WW8A 5FYLL 5CJ5A 2WAHA 4LOUC 1U8NA 1KENL 2WIIA 3K1KC 4NP4H 5AD0B 3JV5A 1FV1B 2EXYC 3QXVA 2XOTA 1ZHNB 5LAXA 3U48A 1DVFC 1PG7H 4WHDA 3D87B 3REVA 5C71A 3IRPX 3LRHA 1OD9A 3LV3B 1LE5A 43C9A 4R7NA 1L6XA 4PJXA 1SY6H 4P59L 3WSQH 1AQKH 1S3KL 4L5FH 3QRFM 2OJEA 1UACL 2FX7H 2A6KA 3V6OA 4Z7UA 4LPXA 4ELME 5CHNB 5ALCH 2XWJB 2BZDA 4HG4K 1GGBL 4LKCB 2D0GA 1BLNB 5F7WC 3CH8A 4HWEL 2YD6A 1SJVA 3ALPA 4DOHB 1QEWB 1HDMB 2H26B 2IAMA 5JTWA 4U05A 3O81A 1B3JA 4JREB 4Q97A 4PREB 3QXWA 1A8JH 2ORBL 3LS4H 43CAB 4ETYA 2HVKA 2VXUL 4F37K 1GZQB 3I50L 1DEEB 1AHWC 4U6HB 1X4XA 1CXKA 3DVNA 3HUJA 4XVSL 4XNQB 2J6EL 5EU6D 3BHBB 3QCTH 1F42A 4YDVA 4ELKB 4K7PX 5LXGH 5GJTL 2EC9T 1IEBA 3QFJA 3KPMA 7FABL 4TRPL 1XH3B 3IXTA 4QHLB 4P2QE 3A0OA 5FM8A 3IU4H 4MAUH 4Y4KB 3U2SA 5DI8A 2BNQB 1AGDB 4PJIE 3QPXL 5IFAL 4C54A 1TZGH 1C5CL 5BCAA 1RPQA 1N6QH 4JFEB 1OPGL 2Z8RA 5I2IA 1NCWL 1BZQK 1HHHA 3QQNA 4OLWH 5ERWA 1D5ZB 5E5UB 4OGAC 3E1F1 3TF7C 1SYVB 2LAAA 5A2LH 5IB4A 3DIFB 4LNRB 3ULUE 1D6VL 3P0YL 3DROB 4U1LA 4KGJA 4TTDD 3ARSA 1P2CA 4UZGA 3C5JB 3V9FA 5ISZA 4IRJC 1RK0A 2PTTB 3O4LE 3KAAA 5D5MA 1FN4B 4NFBA 3P0GB 1U8PB 1Q0YL 4HS6A 4PJ9C 4TUKH 4N5UA 4L4VE 4WUUD 2QKIA 1SEBB 3HE6B 5FYKL 3OAUL 4FZ8H 1EBPA 3I3DA 1TXKA 5DD6B 2ESVB 3H7BB 1WT5C 1G7PB 1T5WB 3E8UL 4UV4H 3F7VA 3OKDB 1DJSA 4LCCC 4QXTA 1BFVH 2V2XA 1HIMH 4PRIB 2QQLL 5IVXF 2EH7L 2VXTL 2XZQH 1FL5B 3N50A 1EHXA 4PRAB 2O5XL 4A6YB 4ENED 4JFFE 1FNAA 2R4RL 4CKVX 4MJIB 2UVEA 4ZFGH 5IKCA 5JXEC 5EUKA 4HMEA 3DV4A 1QFOA 3DMMA 3GMLA 4O58L 3P11H 3A6CL 3WE6B 2QBWA 2ZUTA 2F5AH 5IFHH 1UQSB 5HGAA 3NCMA 1MEXH 3BIAX 4LCWE 2EDEA 4HWUA 4AEFA 4LU5H 1WICA 2P8PB 5TDNB 1C08B 5EU3A 3QEGH 4AH2A 3B43A 3MA9H 4P46C 3BD4A 4NO2B 5J57B 2IALA 1I7TB 2OL3H 3FOLA 5BO1H 4YHIB 4MVBD 1RUML 1F2QA 3QUZB 1TCRB 4FXLA 4LVHC 1UH3A 4FQXA 5J11B 3SKMA 1R3KB 1FNFA 3WJJC 2G5BB 5JQ6L 5F72S 1HINH 2DQJH 2PKDA 1TMCA 1LO4L 5LQBH 1CI5A 3LQZB 4P23B 1P84K 1BF2A 3W2DH 1FZJB 3ZDXE 4HHAA 3W5MA 4Y2DD 5C7XH 1C7TA 1NDGA 5DJ6B 4R7DB 2IQAB 1GHFH 4FFWD 4NWUL 5AD0A 1FV1A 1WWBX 4QCIA 1ZHNA 2F5BH 2NXYD 1E4XL 4MHHG 3WNMA 4OKVB 3PWVB 4G5ZL 1DQQB 3LV3A 4OJFL 5FM5O 1HCVA 4HQQH 4PGBB 3QUKB 1XF2A 5FUZL 5C0BB 3K2UL 2AGJH 4LHJB 2J4WL 3KPLB 5CHNA 2XWJA 4LKCA 3TVMB 1BLNA 5E08L 4TNVF 1QEWA 1HDMA 4HGKC 5C0IA 2H26A 3U7WH 4PRPD 3C5ZC 5HI5D 3E3QC 4G7YL 43CAA 5ESQB 1KXTB 3VGDA 1GZQA 4HFUH 1MI5E 1D9KD 1DEEA 1G9ML 2DMCA 3C6LC 4GJTB 4RZCB 4U6HA 3RI5K 1JRHL 4XNQA 4X4MA 1CQKA 3BHBA 4ONOA 4HK0B 4ELKA 4FQIL 4NGHH 4MNQD 2DLFL 4PGZA 2ZCHL 1XH3A 5T3XL 4QHLA 1F3RB 1Q9LB 4Y4KA 4F7CB 3TESA 3O6KH 1T03L 1G7JB 2BNQA 1AGDA 3GMOA 4W68A 5D71H 5FV2A 2HJKA 3QDGD 4S0TD 4OFPA 4JFEA 1ZVYA 1S3KH 5L6YH 4J3UA 1D5ZA 2Q7YB 2HTLC 4EKXA 3MCG1 4WI6A 3HZVB 4Q74A 3RUGF 1SYVA 3DIFA 1GGBH 4LNRA 5I1DB 3DROA 4L8SB 1I85A 3C5JA 1MCQA 2P5ED 4XX1G 3S35H 4E42B 2PTTA 1FN4A 4HEPG 3F7RA 1Q8MA 2CO7B 1U8PA 1PX4A 2EECA 1SEBA 3HE6A 4HKBB 3U0WH 2VXUH 1S5IL 3OR7B 5DD6A 2ESVA 4WV1B 3NZHL 3H7BA 2R0ZH 1KEML 5JIKA 1JFQL 2IQ9L 4Q6YA 4RRPG 1G7PA 1T5WA 3ZDZF 4XVSH 3AY4A 4M4PA 3OKDA 3HLAA 4M6ML 3ARGC 3OB0H 5GJTH 4GQ9L 4PRIA 1AI1H 2VKWA 1QLEL 1A7PL 1J11A 4JRYD 1FL5A 5DEGB 5EO1B 4PRAA 5LCVL 4A6YA 4LLUB 5MP6L 1MLBB 2LVEA 4MJIA 3STLB 5FGBC 1U8LB 6FABL 4PJBA 4EOWL 1GOHA 5ID1B 5T33L 3I6KB 4BFGA 5IFAH 3WE6A 4RRPA 1YNKL 4QNPE 4RAHA 2NY2C 1C5CH 2WNGA 3IDUA 2VXVL 2VLRB 5FUOH 5C0DB 1UQSA 1NCWH 4DW2L 2C1OB 3LKSA 1U3ZA 1XGTB 2BOCB 1HI6B 3WNLA 2GK0B 5TDNA 3MLWH 1C08A 4K8RH 2JJTC 3VGFA 4NO2A 1NAML 1I7TA 2CLZA 5DSCB 5EIVA 4YHIA 1Q0YH 3PL6A 4PP2A 2V5TA 3QUZA 4N0CC 1TCRA 4RQQA 4WFFD 5DVNA 3OAUH 2A6DB 2VRAA 2UUDK 2ZUXA 1R3KA 3RFZC 2YA2A 4XCFL 3E8UH 2G5BA 1I7RB 2EDYA 2C3GA 3TPKA 5JW5B 3ROLB 2FD6H 2XY2A 1QBLL 1XIWC 2X4TB 3LQZA 4OQTA 4PRDB 4K3JL 1X5AA 1Z9LA 5TE6H 2QQLH 2VXTH 4P23A 5F7YC 2IBZX 4HZLB 1FZJA 4XAKE 2O5XH 1J87A 2R4RH 2RB8A 1RZ8B 2VLME 4R7DA 2IQAA 3MNVB 3LRSB 5TQ2L 1CK0L 2PXYB 3BZFB 2DQFB 4O58H 3A6CH 1TPXB 3HE7D 1LDSA 3PWVA 3ULVC 4JKMA 3O11B 1DQQA 3PQYE 5L0QB 3SHSA 1KF9B 5T5FL 4CJ1A 4PGBA 1JNNH 3QUKA 4RIRB 5TQ0H 1CLOH 4AY0A 2RHEA 5DQDL 1OF2B 3D39D 2IANE 4QGYA 2DAVA 3JVGA 1U95B 4YBQC 3KPLA 1NMAL 3K81A 2VQTA 2WSKA 3MFGB 3TVMA 3BH8B 1RUMH 3UEZA 3OL2A 2VSCA 1NUFA 1DR9A 4QT5B 4PB9H 3KPSB 2W92A 4PLKD 5JQ6H 5DGRA 3G6DL 4J1UB 5ESQA 4PRHB 2IF7A 4LEOB 4ZXBB 2WBKA 3NVQA 4RZCA 4R0LC 4DAGL 4PJCB 3PF2A 3KYKH 3V7AG 5BV7H 1YECH 1KPVB 4M7KL 3TBTB 4DTGL 5CZXC 4Z7VF 2QSQA 3VFMB 4PJGE 5GRUH 1E4XH 4O9HL 1DN0B 4UDUB 4F7CA 3AM8C 2Q6WB 4YJZL 2DD8L 5IB2B 3TYGH 4OJFH 2HYMA 2X10A 2GSIB 2NZIA 4WWKB 1UEMA 2NY4D 4PP1D 5DRWB 5HGDB 3O9WD 5EU5A 1LQVA 2VUYA 5FUZH 1E27B 3MROB 5DHVB 4S1DD 2P42B 3M8OH 3K2UH 2Q7YA 1FLRL 1S9KC 4CDHA 4YHYC 3HZVA 2HMIC 2YKLL 5I1DA 3MACH 4M6OL 3BMVA 3RBGA 1EGJA 1UH2A 2P24A 3DETD 1XF5B 5JXAL 1UC6A 1Z9MA 3VGGA 5HHOD 4D9LL 3QEQD 4PS4L 4D0CB 4RMVA 4NKMB 2PETA 4HKBA 5C9JB 4RMRA 5KSAC 3OR7A 1FAIL 32C2B 3SN6N 4WV1A 1UKTA 3ARWA 4D9QD 2BRRL 3G9AB 2W0KA 2VXQL 1JRHH 4YDLB 4ONFL 4JFQB 2EIDA 4QOKE 4PJXF 2MKLC 4XMKL 4BSWB 4H25B 1RJLB 4LPYA 3IDYB 4OGYL 3VXMB 2DLFH 5DEGA 4M9OA 4GBXC 5EO1A 1REIA 5T3XH 4LLUA 3QQ4B 4UTAL 1MLBA 4LDOB 1JGUL 3STLA 2XA8L 3ZKXB 1U8LA 4HJ0D 3NIFF 1T03H 4GUPA 5B38B 1KTLB 4Z0XB 2CDEB 4MAYD 4M93C 4LSSH 2VLRA 1HOCB 2MPAL 3K7UA 2ID5A 4HJJH 3BXNB 2OP4H 2C1OA 3GNML 1K5NB 2NNAB 1XGTA 3I2CL 4QRTB 1XCQB 2BOCA 5D1XB 1HI6A 2GK0A 3MRKB 2ZOLB 2NTFB 3WS3B 2PYED 1RJYB 3HUJF 3LSOB 3CX5J 5DSCA 5E6ID 1I8LC 5C70A 4RMSA 3SBWC 4N0FB 2A6DA 3UTSB 4Q6IB 1S5IH 2ICWA 1QACA 3NZHH 1OAYH 5C07B 4C56A 1ZV5A 4S11A 1I7RA 5JDJA 5JW5A 4YHOH 2DLEA 3O4LD 3ROLA 4KTDL 5F9JA 1KCRL 2HT3D 2X4TA 4PRDA 2X70B 3IFOB 4GQ9H 5D7IB 4ZFOL 1S7RB 3ARYA 1B2WL 1KTRL 1A7PH 1FFPA 4HZLA 3N0PB 2N4IA 4GSDH 5MP6H 4UV7L 1RZ8A 2WWKO 1B4RA 5GZOD 1K6QL 3LRSA 4FS0A 1CGSL 3PE9A 2PXYA 3BZFA 2DQFA 3T2PA 5T33H 2EE9A 2CUMA 5I6XB 5LGJB 1T1YA 1YNKH 4R4BB 3ISWA 5FCUL 3MLYL 1MCJA 2VXVH 3GI9L 1EMTL 3IFPB 5D5MF 3NFPA 3O11A 4OCXL 3TPUE 4OCWH 4DW2H 1CF8L 3NCCB 1ZLUK 4MJ6B 4I2XA 4I8DA 1ZS8A 2NPLX 1QSFD 2K9UA 1N26A 1OF2A 4XCEA 3DI3B 2QV2A 1T6VN 1U95A 4WTXA 1F6FB 1NAMH 4WTZG 1KIRB 4RGNB 3BH8A 1YMME 3ARFD 4RGOL 4QT5A 4P0DA 1DQLL 3KPSA 4G6JL 4O2FB 4FABL 1K3ZA 4LEXL 5CBEB 4N5ED 3ABZA 4J1UA 4PRHA 4LEOA 4ZXBA 1XF3B 4G3YH 4MDJB 4K3JH 3RWJB 2EDFA 3GK8H 1MCHA 4WTZA 3GMNB 5ITFB 3L1OL 3FQUA 1PBYA 3RGHA 4JM4H 2X2YA 3P40A 2OI9B 3WIFA 2IBBA 2F54A 1KPVA 5TQ2H 3TBTA 1CK0H 2A6IB 3VFMA 4FQPA 2PTVA 3OMZA 1Y18B 1DN0A 3O3UN 5FOBB 5IB2A 1ZHKB 5ALBH 1PFCA 4JQXC 5DWUL 5J8OA 2GSIA 4WWKA 5T5FH 4OD1L 3CXDH 4PJHB 4ZNCD 1BVLB 5HGDA 5CUSH 3ZSTA 4KKNA 4HF5H 5CGYC 1E27A 3MROA 2GTWA 4NN7C 4CVWA 5DQDH 1IQDB 1FGVH 1LK3L 4KZDL 2C4FU 2X1XR 1BPVA 4G6MH 1NGQH 4PJAB 1I75A 1TJGH 4NUJB 1JFMA 1PYWB 1A3RL 1V3LA 3QI9D 4OZIF 5C08E 4X7CC 4D0CA 5IEHB 4NKMA 4MSWB 3G6DH 5C9JA 5IT2H 5B38G 4ZAKC 4ZYKA 2N7AA 32C2A 3UPAA 2UY7A 3GMPB 1DCLA 4DAGH 4JB9H 3UTOA 5C9KA 3MQIA 1L7IH 4JFQA 4M1GL 3NABL 4L4JA 2NLJB 3MUY1 1IFHL 4BSWA 3SE9H 4G8GE 5KN5B 4H25A 4GT7A 1RJLA 4M7KH 4DTGH 2WUBL 2ERJB 2AP2A 3VXMA 3OZ9H 4UU9A 3C8KB 4NN5B 2QR0B 3QQ4A 5F7MC 2J8UA 1CD0A 4HIXL 2XFXB 2DD8H 5B38A 2WBJC 3MBED 12E8H 4EIZC 4MXVF 1KTLA 4Z0XA 1IKFL 3RL1B 2FCBA 2W9EL 1SBBA 1HOCA 3GHBL 5GSVB 4HFWB 1KELL 3ARBD 4KXZI 1K5NA 1F2XK 3C87A 2NNAA 2XTLA 4QRTA 1XCQA 4LGPB 4OCMC 4JZJB 1BOGB 2F74B 5KOMC 3MRKA 5B21A 2ZOLA 2NTFA 2YUWA 3WS3A 5JXAH 3LSOA 1RJYA 2OZ4A 4D9LH 2YA0A 2QQNL 3VXRD 3FL7A 3FHAA 2FO4B 4N0FA 3H42L 2AV7B 3O4OB 3UTSA 4Q6IA 3QIBD 1MCNA 5C0CB 3TO4B 1A7BA 5C07A 1DBAH 5GRZA 3M17B 5EOTB 4EI5C 2BK8A 1J0IA 1QVOA 4FRWA 4YHML 4LARL 4U6TA 4XMKH 5D7IA 3IFOA 4OGYH 4O2EB 4OFYD 5AYQA 4UTAH 1HN1A 5K93A 1W0WB 3EHBC 3MXWL 3MLUH 1L7TL 1EX0A 4X5XB 3V4UL 3O6FB 4I9WD 2GKIA 3UJIL 1MQ8A 3W39A 3ZTNH 4R4BA 3GSVB 4LLQB 1V3MA 2X4NB 5DR5L 1Q9KB 4ERSL 3IFPA 2VZSA 4BSJA 2J5LB 2AV1B 3EO1B 4ODBD 5F71A 2GTZB 4N8VB 5ICZB 3I2CH 5F6HI 4MJ6A 1OT1A 3EDJA 1MCFA 2R2CA 3CSYB 4MCZB 4GMTL 4ZO9A 1JE6A 4HXAH 4GAGH 4F9PC 1KIRA 1G7MB 4TNVK 3RIFK 4F57L 4WRLA 4HH9B 3OKMA 1AO7E 3S7GA 1CD8A 4NJ9H 2WWMC 4O2FA 5CBEA 3OV6A 2P8LB 3KJ6L 1WK0A 5D7LE 5I1JL 4IIQB 4KTDH 4MS8A 3CMOL 1YN7B 4OBRA 4QRPD 3RZCC 3RWJA 3OKNB 4XPFL 4DKDC 1B2WH 3IJSA 4RFNC 2JTDA 5ITFA 5HYEA 3QDGB 3UXFA 1D5MB 4YFEA 4PJ5B 3SKJL 4WEUD 2OI9A 3G04B 2CK0L 5B4MD 1CGSH 2D7NA 2Q8BH 2A6IA 4XNMB 1H3TA 1Y18A 2OS7A 1MAKA 4TQEL 5FCUH 3MLYH 2LQRA 1A3QA 3GI9H 1V8HA 5FOBA 1ZHKA 5F1OB 4KDWA 1CD1B 4OCXH 3EOTL 4Y5XC 3QIUC 4I1NB 2NY3C 1BVLA 5D93B 3SCMB 1IZKA 1FE8L 1R3HB 1G0DA 5DJZB 4MA1B 1IQDA 3G5XB 5ENWB 1OARL 5A43C 2PO6B 2I60H 3KJ4C 4PJAA 1OP3H 1NGPL 5F1IB 1VGEL 4NUJA 5JNYB 1PYWA 1WFOA 1KPUB 4ZUWB 4LSRH 1H3PH 4G6JH 5IEHA 1FH5L 2JB5H 2I27N 2DQIL 4KU1A 4UBDD 2VDOL 4K3EH 5HVWA 3GMPA 5L2JA 4WO4B 3TJHC 4G8FB 2AK4E 4JY6B 3L1OH 2XNAB 3V7MA 4XCCH 1I3GH 2NLJA 2VYRE 1S7TB 5KN5A 5JR1H 1V7ML 1X9QA 4JN1H 3D1MC 2DJUA 3C8KA 2QR0A 1Q0XH 5HJ3B 5D8JH 2CIIB 1LWRA 4MD5B 3E2HA 4UMGA 5FHAL 2XFXA 3E6FB 4NT6B 3U82B 1N4XL 1B88A 1C5DB 3RL1A 3RIAF 2K7QA 3BIKB 1MCIA 4AEIL 1RULL 2HFGL 1I8MB 1WGOA 3UBXI 3LZFL 3JTTB 5GSVA 2DL2A 4HFWA 2I07B 3RX8A 1LK3H 4KZDH 4OLXL 1J5OH 3G5YB 3SO3B 4OKDA 4DN4L 5CZVL 3VG9B 4N0UE 4JZJA 2F74A 4Y4FD 2QQQA 3H3PL 3K1DA 1GXEA 3TCXA 2P4AB 3KYAA 3SQOL 4WY7L 2QADC 4OM0L 2VLKE 5MHSD 5C6TL 1N7MH 5EORL 1ZHLB 2AJUL 4HGWB 1O7VA 2AV7A 5FDWB 3TO4A 1K3IA 5C0CA 3S88H 4NFDA 1I7UB 4GKZB 5CSZB 3HE7B 3P9MB 3ZYJA 1WISA 3M17A 1KB5B 3TWCL 4PP8C 3NABH 5JO5A 2C9AA 1MY7A 2C1PB 4HZAA 4XGZB 1IFHH 3QQ9D 5ACMA 4N8VG 4O2EA 1IBGL 1E4WL 5I0DA 4HIXH 3CVIL 3D39B 3RGVC 4X5XA 3O6FA 1RSFA 4LPUA 1NCUA 3P9WB 4QOKD 4LIQH 4LLQA 2X4NA 4MQ7B 2W9EH 4S0UC 1MIEL 2AJYL 1Q9KA 5HD8C 3RPKA 3C5SA 3K3QA 2C3HA 2DOCA 5KJRL 2AV1A 1UA6L 3EO1A 4EZMA 3UYRL 2GTZA 4N8VA 1II4E 4HBCL 3CSYA 5AUMB 4XXDB 3MJ9L 3VDBA 3KS0J 4L4TB 4KVNL 4GFTB 3L9RB 3VXQB 4RMUA 4Y19B 1G7MA 1ORSA 1KB9K 2BERA 2B5IB 1PKQB 1BIHA 2ADGA 3NFNB 4HH9A 4JPVH 4U1KA 4PGJA 4S2SB 4OSUH 5TPWL 5CEXB 5E9DE 3L95B 1DN2A 2P8LA 1SBSH 4YHMH 4ZOCA 4IIQA 4O51B 3CDFA 1YN7A 2Z0BA 3PGCA 2VLJD 3O2DA 4OZFA 3QPQC 3OKNA 4R4NC 2NY4B 3O9WB 1KLGB 3MODH 1A9EB 3QDGA 2H2SC 1A7OL 1D5MA 3TBWA 4PJ5A 1ES0B 3MXVL 1VPOL 4MNHB 3MXWH 1DQJA 1L7TH 5CP3H 3V4UH 4JQVC 3L5XL 2VDNL 4YQXL 3A6BH 4NQTA 4ZOAA 1QG3A 3UJIH 4XNMA 5JOPD 1JYXA 4C59B 1G7IB 5DR5H 4M7ZC 3FO2B 3PGFL 4ERSH 5FYKU 4F2MA 1CD1A 4HSQA 5HHOB 1FFRA 1AY1L 1HH9B 3DXAD 4Z78B 4CJ0A 4R2GD 3SCMA 4NM8L 2L7UA 3CIQA 5IB5B 5IWLC 1R3HA 5SV3A 2R4SL 5DJZA 4ELMB 2NXZC 4MQXC 5ENWA 3QIWD 3T2QA 2PO6A 3EGSB 2K7PA 3VWJC 5D7JB 1WCBA 5F1IA 2VN7A 4ORGB 5JNYA 3S37X 5H8DA 1KPUA 4F57H 4ZUWA 5EUOE 1TTUA 4WJ5B 4UB0L 2JB6B 2W65B 4R97B 2E7LA 5BZWB 1KFAL 2R8SL 4FFZL 4XVJL 1R24B 4Y4HD 5I1JH 5FA4B 1AHWB 5EN2B 5IGXL 3U7YL 3CMOH 4UQ3A 4GXVH 3AU1A 5ECJE 1A21A 4WO4A 4XPFH 4LPCA 4G8FA 2EYSA 3JV0A 4JY6A 3ES6B 3V8CA 2XNAA 1YEHL 1X6NA 3SKJH 5BW7C 3PDDA 2CK0H 1YC7A 4QHKI 2UVFA 4P2QB 4YWGH 2O5YL 3TA3B 4H8WL 3MRHB 3IDMB 5HJ3A 2X7LB 2CIIA 1CLYL 3I6GB 4MD5A 3W11D 4EUPH 3ALXA 3E6FA 4NT6A 1S8DB 3EOTH 5EPMB 2DKSA 4P48A 1C5DA 2VAJA 5E6IB 3BIKA 1EK3A 4DVRL 1I8MA 2V17L 3JTTA 1I8KB 1PG7W 1WAAF 3IRZA 3RTQC 1Z9OA 2VDML 3L7FB 1OARH 2YZ8A 3G5YA 1LNUB 2MTPA 2YXFA 1IGML 1NGPH 4JO1L 1D3CA 3AMLA 1VGEH 1BBJB 3O4LB 2KL6A 5K9QG 4PJCF 5IQ7L 5LKNA 4PJ9B 3PWNB 4L4VB 1I9JL 1ZHLA 2PNDA 1JI1A 4G7VH 4HGWA 1OVZA 5FDWA 1DBML 2DQIH 3C60A 2VDOH 5E0QA 3UDWA 1I7UA 3ARDC 2IWGA 5CSZA 1KCKA 3P9MA 3QG6B 4J3VA 1KB5A 3KYMB 3JUZA 2C1PA 4XGZA 4TYUA 2H3NA 1AKJA 2DJ4A 4JFFB 4HIIB 1QSEE 1H8NA 4M1CD 4Y1AD 3U30B 1EO8L 3D39A 2DQGL 4R4FL 2GITB 4P4KD 1IM9B 3ZDZE 5EDXA 5T1LD 5ILTH 4DCQB 2NY7L 1J05B 1RULH 4MQ7A 2HFGH 1FZKB 5CINL 5B8CB 4LCWB 1J12A 2EE2A 1BWWA 3ZKQD 3MA7B 4F7PB 3QEUB 4OLXH 4TN9A 2FDBP 4DN4H 1RUAL 5CZVH 4HW6A 1ND0B 4D94A 2YEZB 4Z95H 5I1AB 3KGRA 4P46B 1VSCA 1ADQL 3H3PH 4XXDA 1KIPB 4UT7L 4L4TA 4OFIA 1A1MA 1BQLH 3L9RA 3VXQA 4OM0H 4Y19A 1S5HA 2HT4C 5F70A 5C6TH 5EORH 4Z7WA 1NMCC 5JOFB 2VR5A 1ZLSH 2BNRE 1PKQA 3MV7A 5C6WH 1J1OL 2X41A 1KC5H 3FT2B 4S2SA 3V6FB 2DYPB 2VITB 3L95A 3SDDC 1AR2A 2YPLE 3IF1B 5A3ID 3TWCH 5F6IC 3TT1L 1TZIB 4O51A 2OR9L 3IDJB 1F4AA 1KLGA 1HKFA 1A9EA 3C2SA 3U9PL 1SJHA 1CGYA 1ES0A 4MNHA 3GGWB 2Q8AL 1LP9B 2ZUVA 4F9LA 1DVFA 3DYPA 1QRND 1F8TL 1TIUA 4LSDA 5B39B 1DANU 4OCRL 2J88H 1G7IA 3VD5A 5CZKA 1MIEH 5JA9A 5KJRH 4KMTL 3QI9B 1UA6H 5EIIA 5EZLB 3O2VL 1HH9A 1HSBB 3OKEB 2IC2A 3HG1E 4LDEB 4NUGL 3UYRH 4Z78A 4JHWH 2CJUH 1MJUL 4NQXB 4LASL 4NKQB 3WKML 1OOAA 1JWSB 1I3UA 4ELMA 4L3CB 5TH2B 3MJ9H 3CFBB 3SGDH 4WCYL 5C0NC 3EGSA 1MFEL 5D7JA 3VXUE 1GH7A 1U8MB 2AJXL 3CFIC 3TEUA 1AXTL 4ORGA 1IRAY 5CD3B 5FF6B 1GIGH 1JBJA 5HI3C 4WJ5A 2FO1A 3GMQA 5L2KE 2W65A 4JHAL 5BZWA 4Y16C 3BW9B 2AEIT 1CVRA 2FRGP 3B5HA 1MI5B 3OJ2C 1R24A 4QTIL 1IGIH 3C6LB 2BOBB 4C83B 5FA4A 1AHWA 1MRCL 2FB4L 3MBEB 3MGTB 4U6VL 4KROB 2GK2A 3Q0HA 1L9MA 2X4OB 4NQEE 1R5WB 5HHNB 4XWGL 1J10A 4PJFF 3MXVH 1VPOH 1HXYB 1UYWL 4HPYL 3ARBB 1F90L 4P2QA 3HNSL 3L5XH 4X99B 2R29H 1KT2A 4YQXH 3TA3A 1HYSD 5I8CB 4KY1L 4QHMB 3IDMA 3WFBH 2X7LA 4PJIA 1F6LL 2GAZB 1P7QD 3PGFH 3TZVC 4P99A 1S8DA 2GIYA 5E6IA 1G0XA 5SWSD 3BKJH 3VXRB 1OTTC 5F88B 1OSPL 1ETZB 2W60B 5EC2B 2R4SH 2QHRL 2Y1VA 3QIBB 3TF7A 4Z7VE 4ODHL 3L7FA 5D1QD 4OT1L 1LNUA 3ZKSD 1ITBB 1UM6L 2X4SB 2VMFA 4IRJA 4Q2ZB 1BBJA 3O4LA 4CADB 2D9QB 3GBLA 4PJ9A 3PWNA 2Y5TB 4X6CF 4L4VA 5JA8B 4UB0H 3ZT6A 25C8H 2XKUA 2R8SH 1UB5B 4FFZH 1WF5A 2AW2A 4I77L 1OLLA 3EJZC 1N64L 1BEYL 5DMGD 5J56B 4LCCA 1QO3A 1U6AL 3QG6A 3MRIB 3DO7B 1JV5A 1I4FB 1YEHH 4BFBD 2CDFB 5JIIA 2PF6A 1P6AB 1R5IB 4JFFA 4PJHF 4BZ1L 5DLML 3FO1A 3ZE1E 4HIIA 3MC0A 4H8WH 5JXEA 5KANI 1KCVL 4IRZH 3KPPA 1F6AB 4EXPX 4PJAF 2B4CL 2GITA 4X4ZA 4ONHB 2NY2B 1IM9A 4WW2C 1QYGL 1GGIH 2CKBB 3GO1L 4DCQA 4HKZB 4DVRH 1J05A 1FZKA 4LSUL 1KV3A 4WHCA 3ESUF 4LCWA 1S9WB 2YWYA 3MA7A 4IMLB 4F7PA 2VDMH 3QEUA 4HC1A 5F7HA 4FG6C 3LAFA 1IGMH 3FB5B 1ND0A 3V6OC 4N5EA 3LQAL 4WW1B 2YEZA 3V6OE 5I1AA 4JO1H 8CGTA 4P46A 4OCYL 1KIPA 5MEOA 1J0ZA 3B4NA 4QRPB 2VDLL 4JZOB 2EXWD 5HYSB 1I9JH 4U1GB 1W0VB 2EICA 5JOFA 3L6FA 3KLDA 3CXHK 4AL8L 5CEZE 1DBMH 1WBYB 3FT2A 3V6FA 2DYPA 3W0WD 2AKRB 2VITA 2R2EB 1XIWB 3IF1A 5F97E 5CD5C 1FL6B 3QDHA 1IILE 1TZIA 2GFBB 4GG6E 3HMXA 3ZSSA 5K59F 3IDJA 1I1AB 3VCLB 3ECBB 5DZOA 3KWWB 1ED3B 1IC7L 4OLVL 4P2YA 3WHXA 1C1EL 5JHDD 3VI3F 2DQGH 1FDLH 1ZANL 4R4FH 3ARPA 4CBPA 3EYFB 1UT9A 5J12C 5B39A 2Q76B 3PQYB 4DKFL 1PZUB 2NY7H 3BESR 2C4FT 4M4RA 2R0KL 3CH1B 4XP9L 3KHQA 2E9WA 3D0VB 4NKDB 5EZLA 4IHOA 4JO2L 1HSBA 5GRJH 4WUKL 1RUAH 3GSQB 4NQXA 1QFWM 4J3XA 3OJMB 1I9RL 5F7EL 2O61B 4I3SL 1H8SA 3D6GA 1JWSA 3H9ZA 3LCYA 2HJFB 5TH2A 3CFBA 4XHJC 1FP5A 5JORA 1KCSH 1MHHB 1U8MA 3FMGH 1MHEB 1T83C 3BP4A 5CD3A 1YNLL 5CJOH 5FF6A 3NH7L 3BPLC 5IBLC 4MMZC 3DUHA 2FJHB 3BW9A 4XWOC 3KPTA 4FZEH 1MI5A 5JW4N 3HAEH 4C83A 1JI2A 2BOBA 3C6LA 3OB0K 4FN0A 3TT1H 1JMZA 4X6BB 5E4EB 3MGTA 4JPIB 3ULSA 4G6KL 5F1SA 2X4OA 1R5WA 5HHNA 3U9PH 1INEL 3WD5L 1NGXB 3ARBA 4PJGB 4LOUD 4J7RA 4X99A 1E6JL 3INUH 3T1WA 1DDHB 4QHMA 5GGTA 3HC3L 4L8BB 3DMMC 4OCRH 3IS0X 3V6BR 1B90A 4Y4FB 4DGIH 5BJTB 3WS6C 2GAZA 1YEFH 1W8NA 4DKAA 4FTVD 2OR8A 3TH3T 1T2QL 3T0ED 4YDKL 4PJDE 2YD9A 4Y8DC 4JAMA 4NUGH 5MERB 1MJUH 4LASH 2BSED 2LVCA 5F88A 1UXSB 1ETZA 2IPKB 5EC2A 3QIBA 4J8RB 3QULB 4APQD 1X4ZA 2W38A 5F3BA 2X4SA 1ZT7B 4WNQB 3JWDH 4OUOA 3C9NB 4IJ3B 5HHPA 2A9NL 1TTGA 1G7QB 3DO3A 1Q1JL 4NO5B 2Y5TA 1A4JB 3EFFB 4YLQT 1TQCB 1WFTA 2OR7A 1RZJC 4L9LB 1TNMA 5I9QC 4OLEA 2C5DC 2JCCE 2FB4H 4KJWC 4Z0BH 5H37H 3QSKB 3BPNC 3F58L 3S37L 1UGNA 4KI1A 4JZNA 4QOKB 3ZKNC 3CZFA 3MRIA 4MJ5A 4LSVH 1I4FA 5E56A 3DO7A 2CDFA 1R5IA 1UYWH 1S7XA 4OZIE 1F90H 3G5VA 3HNSH 1S7VB 1S9XB 2P43B 2B1HL 4KY1H 3OKLB 5FGBA 3R1GL 5GZNC 1P4LB 3FB8A 3FOMB 4ZO6A 1F6AA 4G8EB 1F13A 2HRPL 3RDTD 3WNKA 2FIKB 3P4MA 5FUCC 4M93B 3PWPD 5FUCE 5HYSG 1CZ8H 2DQEL 2CKBA 2HFFB 5D2NC 4HKZA 5CP7B 5D2NE 3NAAL 2MQ0A 4FHBD 1GAFL 1S9WA 4NNPL 1MJ7L 1QUNA 4IMLA 4ODHH 1IGCL 1OTSD 1HZHL 2EDHA 4OGAD 3OWEA 3FB5A 1UM6H 4HIEB 3MRDB 4WW1A 4KI5F 4KKCD 2DM2A 3H9SE 2ZCLL 3QUML 2WY3A 1EFQA 4JZOA 4GRLC 5I74B 4N0CA 3WXWL 3SGEH 1W0VA 4ORZC 1INQA 4OCLC 2QQKH 1A6AB 1NBYB 2BY3A 2ZSWB 1CE6B 2ZOKB 1VFOA 5KVEH 1N64H 1BEYH 1UWGL 3BKYL 5HVFB 1N0XH 3CK0H 4ZDHB 2AKRA 3LVEA 4NHCL 2WQRA 2R2EA 1XIWA 5GHWH 3K46A 1SVCP 5A2JH 2GFBA 3BEVB 1I1AA 3VCLA 4BZ1H 3ECBA 3DXAB 4R2GB 3KWWA 4WHYG 5GGRY 1ED3A 1TJIH 1KCVH 2I26N 2BVQB 1R6VA 3W9DB 3QIWB 2C7UA 1YJDC 2X09A 1MF2L 3NTCH 4Y4KC 3UZQA 4O5LL 3EYFA 4R26L 2Q76A 3GO1H 5C92A 3PQYA 3TPUB 3CH1A 2ZWLT 1WTLA 3D0VA 2DLHA 4NKDA 4M62L 3BDBA 2XQBL 4IRSD 5MEND 3WLBB 2N7BA 2IANA 2O61A 4UQ2A 2Y06L 1E4XI 2ATKB 4JJHA 4E41D 4NCC2 2HJFA 3JSSA 3VXSE 3MLVH 4KVCL 2VDLH 5E8DL 3IDNB 4ZO8A 2P5WE 4XXCC 5GRYA 1IM3B 5DTFB 1YMMB 1LEGB 1MHHA 1YY8B 3QUXB 5FGSA 1MHEA 5GPRA 2E3VA 1YY9D 1UEYA 3QHFH 1A0QH 1CD9B 3Q5TA 4N0RA 3HE6C 4K9EH 1DLHB 4HUMB 2FJHA 4WU5B 4ZOEA 1JGVL 1F4HA 3F7YB 3RAJL 3O0RL 1L0XA 2FJFB 4X6BA 4H1LA 5DVOA 3D2UB 4JPIA 4HKXB 2BNRD 4XX1E 4NNXB 2BCKB 5I1GL 4OLVH 1SJXA 3P77B 1NGXA 3J8F7 3U6RA 1OWRM 1ZXQA 3HRZB 3GM8A 4P5MB 1RK1B 4PJGA 1CVSC 1ZANH 2YPLD 4OFVA 5I71C 3T65B 1P1ZB 1DDHA 1IGJB 1U3HC 3EJYC 4LVNB 1BFOB 4U2ZA 5DT1H 2VWEC 2AQ3A 3BP5B 2VWEE 1JRHI 1ZOXA 5BJTA 2R0KH 5C0EA 4XP9H 1OSZB 2NYYD 1CGXA 4JO2H 4UNUA 3RHWF 4WUKH 5MERA 1A4KB 1I9RH 3TYFB 2BY0A 2IPKA 4BZ2L 1V05A 4J8RA 4LFHD 3QULA 4YX2L 4KAQL 1JUFA 4UUJA 1ZT7A 4WNQA 3REWB 2ZPKH 4EVNB 3C9NA 1LDPH 1YNLH 4RGMC 3ROOB 3QUZC 1G7QA 5FO7B 4NO5A 1PVHA 3NH7H 2BVPB 3IFNH 4HCRL 1BD2E 3B6SB 3EFFA 4LLVB 4UIKH 4L9LA 5J11C 4JG1L 2D7TH 4JM2B 5INDB 3QUMB 3UTTD 2F19L 1CS6A 4P4KB 2DI8A 4JDZB 4PJ7E 3ZKMD 4G6KH 4QOKA 5HVHB 3KXFD 4G8GB 4RNRB 4ODTL 1DBJL 4OD3L 3BT2L 4XPBL 2M8XA 2CXGA 4XP4H 1S7VA 1S9XA 3MUGB 4N8CL 5T1MB 3OKLA 3VG0L 3WCYA 5FB8A 1P4LA 4ELMF 1PY9A 2DBJA 3FOMA 1KXQE 4G8EA 1WJ3A 4YFLI 3MOAL 4GRWH 2FIKA 2ENYA 4YDKH 1YYMH 4MXWH 3TFKC 5I18L 2HFFA 5ICYA 1NMBL 3CVHH 5CP7A 3PDOB 4G6FB 1H15B 3PXJA 4KV5F 4BFIB 1TQBB 1N5AB 5EZIL 5HY9B 2CRMA 1X7QB 5C0BE 2KPNA 1YEEH 4RAUB 3MNZB 4HIEA 4K94H 4XNUL 5E00B 1AGFA 1QTYT 3MRDA 5CILL 1N3NB 1KCLA 2A9NH 2C3VA 1FO0L 1I8LA 1A7QL 3SBWA 1FRGL 1OTUC 1A6AA 1NBYA 1J1XL 2ZSWA 2ZOKA 2COQA 4WVRA 1Z3GL 1E4KA 1EO7A 3F58H 4ZDHA 3FN0L 3S37H 3MREA 4EI5B 3D3VE 4D3CL 2Y36L 4F7EB 3WIIL 4LSQH 4IDJL 3ARGD 1JGLH 3BEVA 5FYKE 1QFWL 3T8XB 4QRRD 3BN9C 3R1GH 1JJUA 4JO3L 3ULUF 4K3HA 5F3HB 3RVXC 2R56L 4MB4A 1MQKH 3RWEB 3CGTA 4JRWA 4BKLA 2DQEH 1AC6A 1VADA 3TPUA 3NAAH 1GAFH 1QPPA 4NNPH 5EOCJ 1B0WA 1S7SB 2DBLL 1UJTA 1IGCH 1HZHH 4JJ5B 4X7EC 4HAGA 5DZNA 3WLBA 5BRZE 3STZB 1PZ5B 1J86A 4S1QH 5LGHL 4XBGB 5E2JA 2ATKA 4TNWF 4UILH 2F53D 3IDNA 5MEQB 4L8SC 1U41A 3WXWH 1HHKB 3KPRD 1IM3A 5ADPL 1YMMA 2MCG1 1LEGA 3QUXA 1MCOH 3UMTA 3QWRD 1ACYH 3IB4A 4JFOB 1AO7B 4BM7A 3GSRB 3ZE0F 1PJ9A 1UWGH 3BKYH 1DQTA 3D69B 1JZ6A 1DLHA 5D7LB 4WU5A 4NWTH 5IHLB 3RZCB 2FJFA 2HKFH 1PG7X 4UT9H 3D2UA 1S7UB 4HKXA 4FQCH 1T22B 4NNXA 2BCKA 5ESAB 3OXRB 2X4QB 3P77A 2A1WH 1K4CB 3MV01 1PLGH 1DQDL 3HRZA 4KKBD 1RK1A 5H94A 2OYPA 5D1QB 1MF2H 4F33B 3GRWA 3T65A 1P1ZA 1IGJA 2E6QA 1BFOA 2NR6C 4Q58C 3TJEH 3BP5A 3AXLA 1U42A 3QIUB 3QO1B 4LCUB 3ULVD 1OSZA 4TVPD 5JLZB 1YYLL 3TYFA 5BS0D 3CDYA 5D96B 3KJ4B 3NN8B 1FAKT 3R8BB 1H3UA 2D03L 1DL7L 5E8DH 1F5WA 1JPGB 4ZUSB 2KZ1B 3ZDXF 3REWA 4PLJC 4EVNA 3HZYB 4Y0GA 5C08A 1HQ4B 2WWKT 5FO7A 5KG9B 2BVPA 2WUCH 3B6SA 4LLVA 4WEBL 4P2OD 1JGVH 3TBVB 1LP9F 1X5XA 1VENA 4JM2A 4JVUA 3O0RH 5INDA 2R0WL 3QUMA 4JANB 3RAJH 1FO0B 2AK4B 3DX7B 2CGRL 1ZA3B 4NPYB 4JDZA 4XB8A 2JJSC 2MQ3A 4XBEL 1NL0L 3QO0B 2X4UB 4G8GA 4RNRA 5I1GH 1FC1A 3J7HA 3P73B 4PR5B 2OJZH 1G9MC 3MUGA 4EQ3A 3IAQA 2HFEB 5T1MA 5CZXD 2WMPA 3LMJH 2PXYC 3ZT7A 4PBWD 4YAQB 1ZLWH 1AD9B 2XN9E 1QBBA 4M7LL 5IW1B 3UO1H 3PDOA 5T3XE 1H15A 2HWZH 4EN3D 2BSSB 4OZFH 3O2DH 5EFIB 2IMNA 4BFIA 1LK2B 4N0UB 3HN3A 4AIOA 1N5AA 1XT5A 5HY9A 4YX2H 5GS1C 4KAQH 1A6PA 3MNZA 5E00A 3MV11 4MLSA 2QADB 4NQVB 3CSGA 3LS5L 2Y25A 4J3SA 2Q86B 5IMLB 3R0MA 4JG1H 4Z6AT 1CN4A 3S6CA 2R69L 1WAAE 2ZKHL 5JHDB 3MPCA 3OG4B 4NQCE 1A02N 1K85A 5KSAD 4F8QA 4ZXBC 4EI5A 3VGEA 1C5BL 2YD4A 4F7EA 5F8QC 1CDIA 1X5HA 4PJCE 3WYRA 1DBJH 4OIIL 4OD3H 1DANT 5BZDB 4LLMB 4YPGB 1ZT4B 4XPBH 5JZ7D 5T1KD 1SJEB 3WXVL 4N8CH 2ZP0T 2JELL 4TULL 3VG0H 2BRQA 4NBYB 4P49A 3P4LA 3CFEB 1T7WA 3TGXA 3MV9D 3RWEA 2FH8A 3B2UD 4RFOH 3IS1X 4DVBB 5I18H 3O3BB 4WWKC 3VRJA 4KK9C 1C8PA 1J0JA 3U36A 3HS0B 1S7SA 5EZIH 4KK5C 2YPVH 5JOEA 1OP3K 4JJ5A 5IB1B 2H2PC 1X5LA 3B2VH 2OXHA 1BX2B 4XBGA 5D1ZD 3RWHB 4F9PA 3QRGH 1YEGL 4ODWB 4PTTB 1J0YA 3BAEL 4ONGH 5HTSA 4PRNB 4XH2B 5EZJB 4JFOA 1AO7A 3GSRA 5I8KL 1XF1A 5EIQA 4KRNA 1MAML 2FX8H 5FFLA 3WL9A 3MSPA 1Z3GH 2DS4A 1N0LA 3KR3L 3T0WA 3D69A 5D7LA 4F37F 1UADC 1ITCA 4QNPF 3RZCA 2EIBA 4FTVB 4PGDB 5DO2D 4IDJH 2VDPL 4YDLC 1QFWH 1S7UA 1UKQA 2G5RA 3LH2L 5INCB 4PB0H 1T22A 2F8XC 3IDYC 1A1NB 5ESAA 3OXRA 2X4QA 1AR1C 1D7FA 1K4CA 4NCDA 4JO3H 4JLRB 4MQTB 3RWFB 3VMPA 15C8H 2HP4A 3ZKXC 2JF1A 2VNCA 2BVTA 4M7ZB 4U1HA 2APVA 2CMRL 1CGWA 5GGQL 4J4PC 1WBXB 1U8IB 3QIUA 3QO1A 2YS4A 2H32B 1JP5A 3EDDA 3SGKC 4I0CC 2DBLH 1AE6L 3Q5YA 4XZUB 4WWID 5LGHH 4M5ZH 3VWJB 5D1XC 3NN8A 1LO5B 4EXKA 1XGRB 1JIBA 3T0BA 4ZUSA 4LLYB 5ADPH 1EUTA 3VA2C 5EUOB 1NC4B 1VEMA 1MOEA 1GZPA 1QKZH 1RFDL 2HH0H 1G9NL 3GSWB 1HQ4A 4RWHA 3MRJA 4X4XA 3T3MF 3LHPH 5LGKA 5MEPB 3TBVA 3U4EA 4I0KA 5GS0C 2P5WD 4JANA 3RDTB 2NY5C 4PRBB 2EDNA 2AK4A 3DX7A 5DD3H 3RNKB 2HAZA 1ZA3A 1MWAB 1IEHA 3QO0A 2X4UA 1N59B 2FBOJ 1A6VH 1Y6NR 3P73A 4QRSB 4DK3A 4PR5A 1YPZB 4YIQB 3GSNB 1KN4L 4X7SH 5IHBA 3C08L 3FO0H 1T6WA 4CN4A 3KVQA 1AD9A 4XVUD 5D4QA 5IF0B 2DM7A 5IW1A 2XTJD 1WCQA 3S35X 1PDKA 4PJFE 4OV6F 1YYLH 3WMSA 3GUTB 2BSSA 5EFIA 4XAWH 3WNOA 3V5KB 1LK2A 4N0UA 5EBMB 5ADOL 1OAXL 4XBPB 3SDCD 5DVMA 1DL7H 3VFTB 4QKXB 3EO0B 3JWOL 5EA0L 5TFSL 1KBGH 3ORJA 4J12A 4QYOB 4RGNC 4NQVA 5GRXG 1WVZA 5EU6E 4OV5B 2Q86A 4WEBH 1FCCA 4X6DB 5IMLA 1BAFL 4GMSH 4G43B 4PJGF 4WU7B 5JHDA 2R0WH 3D0LB 1KJ3L 4ZAKD 2CGRH 3NCYP 4F80A 3QXUA 1NL0H 4IDLA 1P53A 3PHOA 4BFEA 3X12B 4X6CE 4OB5L 2UYLB 4NC2B 1ZT4A 4YPGA 4D8PB 3MLRH 1SJEA 2OI9C 4HS8L 5MENB 4HUKB 4A2LA 4C57C 4U1SB 4E41B 3CFEA 3SE8L 1CFTB 4QTHB 4RMWA 4TTDC 2D31B 2WBJD 4G59A 4M7LH 3UBXB 4UNTA 4OZGE 5C0AD 3BZ4B 4PJHE 3BP7B 4I0PD 3F5WB 3MYZA 3HS0A 5ICXB 1WIPA 4WUUE 3QG7L 3CPLB 3IDXH 3TN0D 1V5JA 4YO0B 5TGBB 2E9BA 1JPSH 1BX2A 2V2WB 4YDIH 3RWHA 3P3YA 3W9EB 1J8KA 4JGJA 4PTTA 2BNRB 1UB6B 2R0LL 5TE4L 4XH2A 3NACL 4Y8AA 1R3JB 4GKSA 2ZKHH 2ADFH 3LQMA 1DBBH 5IW3A 5E9DA 2YPLB 5E24E 3SDDB 3RJQB 1NSNL 1CICD 5TF0A 3SKUD 4WI8A 5IIEB 3TT3L 1C5BH 4N9OB 3H2WA 1BF8A 1HNGA 1NFDE 4PGDA 3RI5F 4OIIH 1KJVB 5GRVL 1JHLH 5JHLH 1YUHA 1WFUA 3WEXB 1F4WH 3RWIB 2DM3A 2P47B 4TULH 2ERJC 4JY4B 1S7QB 1A1NA 4JQVA 4K8RD 5JUEH 4NN5C 3MLSL 4JLRA 3O41B 3UC0L 4OIBA 2W9DL 3ILPB 1B0GB 5C1MB 1WBXA 2MFNA 1U3JA 5DA0B 5D72L 4MVBC 3RHWK 1QFPA 5K59E 3FQRB 3UPRA 1KLUB 2H32A 1E28B 5GQBA 3BE1L 5IWLA 3G6AB 1CXFA 2VERN 3VI3E 2P46B 3I9GL 3QJFB 1RIUL 1VFBB 3ILQD 3VXUB 3VWJA 1LO5A 4JZJC 3VFGH 3RU8H 2BY2A 1XGRA 3BAEH 4LLYA 5GGVY 1FVCA 3Q6GL 1NC4A 5EUOA 5E2UL 4K71B 3VWKB 3GSWA 1MAMH 2V9RA 5E8PB 3ULVL 2MKWA 3O4OC 4LHUD 4MZ2A 2GT9B 1ZT1B 4TVPL 5MEPA 1X5IA 4DKEH 2NXYC 3RDTA 4PRBA 3ZT5A 3RNKA 5KOVC 2GJZB 5T1DH 4ZTOH 3SDAB 3OX8A 3TBYB 1MWAA 1MRFL 2GEEA 3IYLW 1FCGA 4RA0C 1W8OA 2ZCKH 4QRSA 2EDTA 1YPZA 1P4BL 3GSNA 2ITDB 2DMKA 1U2CA 3O6FC 3K4ZA 3QAZB 1QR1B 1PG7L 2CMRH 3TZVB 5GGQH 3FQTB 3VFWA 4OI8A 5CBAB 1XF4B 2Q7NA 5IF0A 2AJVH 3K80A 1SY6L 1AE6H 1YEJL 2AQ2A 2J5LC 4BSVB 2NY3D 3VD9A 1OAZL 3WSQL 4PRPE 3GUTA 1AQKL 5HI5C 1SM3H 4L5FL 3QNYB 1O7SA 3V5KA 1ZE3C 2Z31B 5EBMA 2FX7L 4XBPA 5JPNB 1RD6A 5C8JB 4JFDE 3VFTA 3EO0A 5DD5L 1PD6A 1D9KC 3NZ8B 2FEEI 4L3ED 3P2TA 5I76B 4QYOA 4PJEE 1G9NH 1BWMA 4OV5A 4XMLL 4HMDA 2BVYA 2NY6D 1W72H 3MGAA 4JRXE 4MNQE 4UINL 2AJZB 4X6DA 4G43A 2BFVL 4DZBB 2UV3A 4NQSB 4WU7A 4R3SB 3HR6A 3D0LA 4QXUL 3MRNA 3QEHB 1JMXA 3LIZL 2NZ9D 4IIQC 3UBXG 4HXBH 1T0PB 2FBJH 3TJHD 3UTPD 4DWHA 3QCTL 3BWAB 4KQ4H 3HNVH 4U1JB 1RUPH 5LXGL 4N90D 1KYOJ 1QSEA 3X12A 4D8PA 1MVUA 4PJ8D 3C08H 2YD2A 4E41A 3KNBA 1CFTA 4WW2B 2F53B 4QTHA 1M7DB 3UBXA 2P5EE 4GAYB 4X4YB 3HC0B 4Q9RH 3BZ4A 1N6QL 2HTKD 3BP7A 5D93C 5DRNB 5ICXA 3EDFA 2AJ3B 3LKOB 4MA1C 5E03A 1CL7H 3WIHA 3CPLA 4JM2F 5EA0H 1FVEB 4YO0A 2PO6C 1EHNA 5TGBA 3X11B 3PGDB 4LIQE 4AM0B 4DEPB 5JW4Q 1N6UA 4TOYL 1KJ2B 2V2WA 4JVWA 4GS7B 3K74B 2LU4A 1U8KA 3W9EA 3GSOB 2BNRA 4GLRH 5J1AB 1UB6A 1ZGLB 5A2IH 4TUKL 3T1FB 4JRYE 2WANA 1IAIH 1R3JA 1S78D 2X9XA 2CUIA 2E7LC 4FZ8L 3VW3L 2CXKA 1XFPA 2YPLA 3SDDA 3SGDI 2B2XL 4ZPTB 1G6RB 5IIEA 3EAKA 2CO6B 4UV4L 4GG6B 4OGZA 1MCLA 3IKCB 1JGDB 3UCRA 3SQBA 1BFVL 1KJVA 1HIML 1ZSDB 4JEGB 4OB5H 1FZOB 5T3ZD 1RVFL 3JTSB 2XZQL 3WEXA 1EH9A 4ISVB 2QJDA 4JY4A 1S7QA 1DBKL 4G80B 3ET9F 3SE8H 5J12B 4XMPL 2ITCB 4H20H 3MO1B 4Z76B 3P11L 3ILPA 2YD5A 4K23L 1B0GA 4MA7H 3BDXA 5IFHL 4CNIB 3HG1A 1JPTH 3FQRA 1KLUA 1E28A 1MEXL 2CQVA 2P49B 1MAJA 4WFFE 2HT2D 2DWDA 3G6AA 4P2OB 3FAXA 4LU5L 3SO3C 5AG9A 3QJFA 3VG9C 1VFBA 3QEGL 2GJJA 3VXUA 1MFDL 4YBLC 2J7LA 2OL3L 2R0LH 3BVNB 5TE4H 4O00A 3NACH 4Y5YB 4WFGD 1J88A 3Q1SH 4P9ML 3BPLB 3VWKA 5L2KA 4HT1L 1HK6A 3R8QA 1NSNH 1PAMA 2CKBH 3CDCA 5E8PA 3EYOB 3UPCA 2GT9A 1ZT1A 2DQJL 1HXMB 2CIKA 3O8XD 3HE7C 4RX4D 3RWCB 4NQEA 1K8IB 2GJZA 2DQCH 3SDAA 3W2DL 4R4ND 5I75B 4OIAA 2H2SD 1GHFL 3SGJA 5HHQB 2XQYG 4NOFA 3EUUA 2ITDA 2VC2H 1HHJB 1QR1A 2CPCA 3ETBF 3TZVA 3FQTA 4JDTH 4PJDB 4MLIA 5CBAA 1XF4A 5IHZB 3AS3A 5DJ2B 1FHGA 1A3LH 2APWA 4P9HL 2VZUA 3BE1H 4BSVA 4TSAH 1MIML 3BIBX 4F58H 4OF6A 5KVDH 3PP4H 4Z7VA 3I9GH 3BO8B 4PLKC 2E6JA 1A14H 2Z31A 2AGJL 5JPNA 3DX8B 3QWQB 3NZ8A 2J3SA 2MJWA 4BH7B 5I66B 2R1WB 5IHUH 1OP5K 3Q6GH 5I76A 5E2UH 5ITBH 1MCDA 5ACZB 2B5IC 4V1DD 5T1KB 5I9QB 3GSXA 4KHTL 3ULVH 4QHUA 2CSPA 2JCCB 2SEBB 2XWBB 2AJZA 4DZBA 4NQSA 5CMAA 4R3SA 1EEQA 4HFUL 3FZUC 3QEHA 4MGXA 2OK0L 2GYSA 1RQ5A 3VRLF 3CFJB 3RX5A 4OZIB 2NY4C 4PP1C 5IROC 3BWAA 2EE6A 2QEJA 3H9YA 3O9WC 3WUWB 4RWYH 4R8WL 3CNKA 4NGHL 2AABL 2X89A 1NDMB 1P4BH 4S1DC 3S3JA 4AEHL 2IMMA 3CJJA 4F9LC 3QR2A 3E6HB 2BXZA 3O6KL 2X05A 4WDIB 4WW2A 4P3DB 5D2NB 3EDEA 4AG4H 3DETC 1M7DA 2QL1A 2HFTA 1YEJH 4GAYA 5D71L 1EZVY 4X4YA 3ZDYF 3HC0A 3QWRA 5HHOE 1OAZH 4GW4B 1T3FB 3QEQE 2HJLB 1V7NH 1H0DA 3F12A 4H1LH 1JZ4A 1CDBA 3THMH 3GB7B 5L6YL 5J3HC 5DRNA 4JHZA 3TP4A 1GGCH 2AJ3A 3LKOA 5C0GB 3RL2B 3RTQD 1BJMA 5DFTA 2FLBT 2DIAA 2D3VA 3H9SB 5DD5H 2D7OA 3D48R 2A38A 2EDLA 4D9QE 4AM0A 3X11A 3FFCE 3PGDA 4ZSOE 5D7JC 3VI4F 1KJ2A 4GRLB 3S35L 4NO3B 4XMLH 2ZUYA 3GSOA 4YH6A 5J1AA 4KFZC 1ZGLA 3T1FA 4TSCH 3V0VB 2AS5M 1XGPB 4UINH 5C09D 2BFVH 4KV5E 3U0WL 4R97C 4NBXB 2DRUA 2QLVB 2OL3B 4QXUH 5KSVB 1MLCB 2R0ZL 2A2QT 4HJ0C 3WO4B 4ZPTA 3LIZH 1G6RA 3IU3B 1OGAD 4HS3A 3DVGB 4GG6A 1U36A 1P9MC 4LQFH 3IKCA 1JGDA 4XPAH 4BYHA 3KLHD 1AQDB 2A73B 3OAZH 1ZSDA 1AI1L 3JTSA 5D9SB 4ISVA 2H6PB 4XRCB 5IEKB 5CIPH 3TA3C 2XIDA 3BH9B 1QQDA 4OAWB 2ITCA 1P69B 3FQNA 3MO1A 4Z76A 5F7FA 3MRRB 4MMXC 5CGTA 2PYEE 2W07A 4UAOB 3ZYIA 2N1KA 5E6IC 5FUOL 4CNIA 1OW0C 1EAJA 2CD0A 4ALAH 1L9NA 1EFXD 3ULUC 3VXSB 2F58L 1F58H 2P5WB 3MLWL 4TOYH 2ICWI 4K8RL 3QNZA 3D9AL 4EDWL 1GC1C 3TNMB 2HT3C 1T83A 3OF6A 1K2DB 2X4RB 4J3WA 3BVNA 5GISL 3C8HA 4Y5YA 4HX1B 3JV6B 1N2RB 3VW3H 1AGEB 5GZOC 4M00A 1Y6KR 3SY0B 3EYOA 2B2XH 4X6EB 3GJFH 1FLTX 4MA3B 2VKXA 4NCC1 5IESL 2YUZA 1HXMA 3ZLQC 2FD6L 5J1SC 4R90H 3RWCA 3OXSA 2BSRB 1K8IA 5TE6L 3RWGB 1RVFH 4ZUUB 2A6JA 2EDJA 3ZE0E 2XKNB 1DBKH 2EDQA 5I71B 3EYQC 5I1KH 1FORH 3WLWD 3DUUB 1U3HB 3KLSA 4HWNA 1QSFE 4XMPH 5HHQA 3SDCB 1FL3B 3U30C 3U9UB 4XPTH 4PGEB 3WS6A 1HHJA 4K23H 4OD2B 3U1SL 2GJ6E 4PJDA 1EEUA 3PV7A 4GKNA 5B8CC 5DJ2A 2G2RB 5IM7B 3AS2A 1U9KA 3ARFC 4XTRD 1T5XB 4HUUB 1JNNL 3VXOB 5TQ0L 1CLOL 4LMQI 3WO3B 3BO8A 4N5EC 5ESVB 2PTUA 1MFDH 5DF0A 2JIXB 2AJSL 2EEBA 4HWZB 5C0ND 1EIBA 4LF3A 4BH7A 4RGMB 5I66A 4L9DA 2R1WA 1NFKA 2WBWB 3QUYD 3WUWG 4P9MH 1BD2B 2E7BA 1OL0A 2Z8WC 4HT1H 5ACZA 3KYNB 3L3OB 2QSTA 5T1KA 4KJPC 2VDRH 4PB9L 1AP2B 5HI3D 2JCCA 2RFXB 2SEBA 3QCUL 1MFNA 2XWBA 3BPCB 4GAJL 5F21B 4PJ7B 2I9TB 3EOAB 1XR9B 5DHYB 2YRPA 3KYKL 4J2XA 3CFJA 3SGEI 4LVOB 1LVEA 5GSRB 2Y7QB 3BQUD 5C0AB 4YUEL 5SX4H 4OZIA 3S5LB 5BV7L 4U3CA 1YECL 4KH2A 3WUWA 4CMMB 3MV8E 1NDMA 3BSZL 1PSKH 1LMKA 3TN0B 5GRUL 1LP9E 3E6HA 4G42B 1BFSA 4WDIA 3G6JB 3TYGL 4P3DA 5D2NA 1CFQB 4P9HH 2R9HD 1YEDB 5EUOF 4XPGH 3IVKB 2H9GB 3QI9C 1MIMH 4GW4A 5I30L 1T3FA 2X4PB 3H3BC 2X6MA 3W82A 3GB7A 3M8OL 1NUDA 5C0GA 1CICB 1HWHB 3RL2A 3SJVD 2XA3A 3HC4L 3H9SA 3OKYA 3VXTB 3RJDA 3IJYB 4MDIB 2ED7A 1MFCH 3MACL 3NIGF 3GM0A 4GRLA 2Q1EA 3MYJB 5FM4A 3RIFF 4NO3A 1T7VA 2X5PA 1RZ7H 4KHTH 5BXFB 2NY1D 3DUSB 1ZAGA 1CIDA 4PREA 3V0VA 3OAYH 1U8JB 1XGPA 1YPZF 4JFDD 4PLOB 2VZ1A 3VFNB 1TETH 5KSVA 4TTGA 3D3VB 1MLCA 2OK0H 3OJDB 2W0FB 4FQJL 2LE9A 1LQSR 4EQ2A 3MBEC 3IU3A 1RUQH 3BPOB 3DVGA 5CLTA 4KROC 1WZ1L 4LBEB 5MI0B 4OFKA 3T4AB 2A73A 4R8WH 2AABH 5F9OH 1VEPA 4JRXD 5D9SA 2H6PA 4XRCA 4AEHH 3ARBC 5IEKA 1NH6A 1UZ6E 1QD0A 4OAWA 3QJHB 2BX5A 4IOIB 3MRRA 4HUVB 2CKNA 5F1NB 2APFA 4LSSL 5JDSB 3FJTA 2YOCA 5HYJE 2FHFA 4HJJL 4PGCB 3BGAA 3O3DB 3VXRE 2OP4L 3MLXL 5BRZB 1CDGA 4X6DF 5T3ZL 1E6OL 3QIBC 1T7YA 5DURD 1V3JA 3VXSA 1QOKA 3WFHB 1RU9L 3V0WL 5KS9B 2P5WA 1A47A 1FQ9C 1T1ZB 4XXCA 3QISA 3TNMA 3QP3A 1K2DA 2X4RA 3MLZH 4YZFF 3PWLB 2IAMD 4HX1A 4M6NH 1OWWA 3JV6A 4P4RB 2XWTB 3N9GH 2OCFD 4X5WB 4S0SD 1AGEA 3RY5A 2FL5B 3BGFB 2X42A 1Z2KA 3O6LH 3SY0A 4X6EA 1OAYL 4I9WE 2EEDA 2OTPA 4MA3A 1F4XH 3HR5B 4YHOL 2WINB 5AG8A 1LD9B 2BSRA 4OTXL 5EZOL 4ZUUA 1KIQB 2MWCA 3CU7A 3QFJD 1EVTC 4GSDL 3SDYH 2XKNA 5DJXB 4PD4J 2P8MB 1T20B 3DUUA 1U3HA 3MCKB 5BMFH 2CDGB 3SDCA 1FL3A 1JHKL 4PGEA 2AXGB 4OD2A 3S97C 5HDOA 3F6LA 3RVVD 4LLWB 3VXNB 2G75B 3ZYOA 3T08A 5E6YA 4OCWL 1QHOA 2G2RA 5EWIH 5HDLA 3HI5L 1T5XA 1YEKH 1C7SA 4HUUA 3MRGB 3UZVB 3VXOA 2F58H 1W2KT 2P8PA 1IC1A 5ESVA 3U4AA 2JIXA 3D9AH 4EDWH 3RQ3A 3X13B 5FO9B 4QRPE 4WHTB 5GISH 5ISZD 3PIQB 3S5LG 3WNPA 4U1GC 1FNEB 4PYGA 1BD2A 1SVZA 3KYNA 3L3OA 4ZS7H 1ZMYA 4U7KA 1YQ2A 1AP2A 1F3JB 3BPCA 4U4BA 5IESH 5HHVL 2A74B 3BISA 4LRIA 2YN3A 4I3GA 2I9TA 1XGYL 4PJ7A 4G3YL 1NJ9B 2CRIA 3T0VA 3EOAA 4NQDE 1Q38A 1WSST 1XR9A 3GK8L 1I1AC 5GSRA 2UWEE 2Y7QA 4CU7A 4JM4L 3S5LA 5DJ6A 1FJ1B 3VXPB 4XC3L 4PBVC 1PX3A 2FATH 4CMMA 3T3ME 3TBSB 5K9JH 4HG4J 2OTWB 1B6DA 1NCCL 1RJCA 2J6EA 4ZTPL 5F89B 3TN0A 1EO5A 2XN9B 1G84A 3AS0A 3DMMD 1OGTB 4LPTA 4OKVA 3U1SH 4G42A 4U1NB 5ALBL 3MX0A 1IQWH 4AMKL 3TFKA 1CFQA 3U46B 1YEDA 3CXDL 4XP1H 5D7KD 4CAGA 3IVKA 2H9GA 1NCDH 2X1WL 3ZL4L 5CUSL 4URTB 1S7WB 4HF5L 1VACB 2X4PA 3SE3C 3BGMB 4LMQE 4Q9BA 5DD0L 5GS1B 1FGVL 5C0BA 3QZWB 1CICA 3QDME 1A22B 4P3CL 4G6ML 2AJSH 1NGQL 3G5ZB 4HAFA 1TJGL 3IJYA 1GL4B 1EZVX 4MDIA 1KLFA 4PY8I 1TVHB 2IBGA 3MYJA 4YGAB 3S96B 4ZUTB 3O3AB 4IM8A 3PG2A 1FYHB 5TE7H 3TH4T 5JIPA 1ZWIB 1NC2B 3AROA 2DQUH 3QCUH 1HHGB 4FQXD 4NQCB 4EIGB 5IT2L 4GAJH 5EU7E 2YMXH 3V79C 1AXSB 2JJWA 4PV9B 3D3VA 3OJDA 2W0FA 2R1XB 4JB9L 3DTXB 1CDJA 1N8ZB 4JHBA 5E4EC 5AAWA 1L7IL 1VFUA 3ZKND 4MQSB 4YUEH 4HK0A 3T4AA 3SE9L 4BELD 3OZ9L 4LHUG 3BSZH 1JZ2A 4JKLA 5HDQH 2IPTL 1Q9LA 5GZND 3LEVL 3QJHA 1G7JA 4L3AA 1KXVC 12E8L 5CSGA 4Y4FC 4HDIB 2FSEB 4M6AA 3WKNA 4IOIA 4HUVA 4OLYH 5F1NA 5JDSA 4MYWB 3Q5OA 5I30H 5MHSE 1Z0MA 4RSVA 3O3DA 1RHFA 2B4CC 5BRZA 35C8L 1MJJB 4KK6C 3MZTA 3HC4H 3W81A 2QSCH 2EYTB 4L8SA 5A1AA 1T1ZA 3ELAT 4HMCA 5BOPA 4NO0B 4E42A 1RZGB 4C4KT 1VHPA 4IJ3C 4K07A 5FGRA 3X17A 3WBDA 3QQ9C 3ZE1F 2B7DT 3LQAC 3PWLA 3TNNB 3VGHA 3T0DA 5CSBA 4P4RA 1TQCC 2XWTA 1AJ7L 2KQNA 4L9LC 3KS0H 4X5WA 1MHPL 1NAMB 2FL5A 3FFCD 1MCPL 4FQJH 1DBAL 4JVPA 4WW2F 2VL4A 3HR5A 1WZ1H 2WINA 1LD9A 5HYQB 1DSFH 1KIQA 1IKNC 1UWEL 5DJXA 3MLUL 1GPOH 2P8MA 5FOJA 3MCKA 2CDGA 5ID1A 4Y4KD 3I6KA 1A6WL 3ZTNL 2BNQD 5C2BH 2AXGA 4LLWA 3O3EB 3VXNA 2UZYB 5C0DA 4NRYB 3Q2CA 4OF0A 5IMOB 3MLXH 4JFED 2VABB 1PW3A 1E6OH 2XZAL 5T3ZH 1UWXK 3MRGA 4XC1L 1RU9H 3V0WH 2E6PA 4BQ6A 1T80A 1P84J 1NGWB 4HXAL 3X13A 4GG6F 5TDOB 2V5RA 5FO9A 4GAGL 4N1EA 2ICCA 2VLJE 3HB3D 4WHTA 4Z8FH 1BFTA 3PIQA 5I74C 1FNEA 4U3XA 2W59A 3OBAA 3T3PF 1ORQB 5I1IH 1M6OB 3ERYA 3RKDC 3VE0B 2EDBA 4PYHA 4FA8A 4Q9QL 4NJ9L 1F3JA 3HE6D 1E4KC 5FDYA 2ED8A 1OCWL 2ESVD 5JOPE 2A74A 2JJSA 1NJ9A 1RY7B 1CBVH 4OTXH 1HCFX 5EZOH 3MUHL 2FWOB 3DXAE 4PRID 4R2GC 1FJ1A 4OM1H 1UKSA 4JN2B 3VXPA 3MNVA 4U31A 2ADIB 2E7CA 4IS6B 3QZWG 2Q8BL 5DA4A 3TBSA 4MJID 1JHKH 3EFDL 2OTWA 5F89A 3QIWC 1PY4A 2XN9A 1OGTA 3OKKB 3LN9A 5L9DH 4U1NA 1U8HB 5HGHB 4PJFB 3R06B 3AVEA 3U46A 3HI5H 5E2WH 1KPRB 2N56A 4RIRA 1MCCA 1S7WA 1VACA 3BGMA 3IAPA 2B1AL 3NCEB 5GS1A 2APXA 3BMWA 3FB7B 1JL8A 1MH5B 4GRWE 1ZTXH 2I60L 3G5ZA 2EH8H 2GJ6D 1OGAB 5LJYH 5EU6B 1TVHA 3QUXC 1IL1B 1FFNB 1OHQA 1FFOB 3O3AA 3S96A 3PL6D 1X5ZA 4LSRL 1H3PL 2FECL 5I1EL 4WTWA 2MMXA 1Q9OB 1WAAA 1ZWIA 1NC2A 5I8EB 1HHGA 4NQCA 1YZZA 3H6JA 2JB5L 5HHVH 4KRPD 1AXSA 1XGYH 2ZUQC 4PV9A 1CTNA 4K3EL 3H8NA 2R1XA 4CVXB 4PJCA 1N8ZA 1UZ8B 4PJDF 4FFVD 5CKAA 4X6CB 2D7MA 4WFED 4XCCL 1I3GL 4QXWA 4P23D 4XC3H 5JR1L 3N85H 4U49A 4X80H 4JN1L 4R9HA 1EFXB 3I02B 1NCCH 1RZFL 5DMJB 4ZTPH 2EDOA 1Q0XL 4E0RB 4KK8D 4HWBH 5D8JL 5GGSB 3TC9A 1WZMA 4UDUA 3IDIB 4LVNC 2Q6WA 4AMKH 1IZJA 4OZGB 2FSEA 1QFWI 5DJYB 5DRWA 3ZL4H 4EBQH 2HRLA 5FYJD 3CFDB 4WUUB 1I7ZB 3MV8D 3IFLL 5DHVA 5DD0H 1T2XA 4QWWD 2JCCF 5E95B 4YC2B 4K7PY 1J5OL 3MOBL 2DQTH 4P3CH 1MJJA 1Z5LB 4CVUA 2IG2L 2XXMB 1RIVL 5AZ2H 1CDYA 4HLZH 2D7PA 2DKMA 4IEFB 4RX4A 2IFFH 1XF5A 4NO0A 2YD7A 1RZGA 2X44D 3TVMD 5DDHB 4Z7QF 1N7ML 2ZNXA 2WIMA 1CE1L 1A6ZB 4NM4L 1OTUD 3TNNA 4X9IA 5FCSH 2VR9A 5DXWA 4M1CC 4Y89A 3S88L 1NGYB 1NAMA 4M3JA 4Y1AE 4JM2C 4XP5L 4TUOB 3DRQB 3QT2A 3BX7C 1NFDB 4HK3J 4P4KC 2Z35B 3ARED 4H0HB 5HVHC 4XPHH 4A2MA 1KG0B 1AD0B 3L3GB 5HYQA 3IXAB 3K4DA 4Z77B 1XGUB 1U0QA 2HN7B 2IPTH 3LEVH 4ZFOB 2KKQA 2XRAH 4HUNB 1DP0A 4J4PA 1URLA 2CDEA 4H88H 3EIFA 4LIQL 3SGKA 1CFBA 3QUYB 3O3EA 2NW3B 4NRYA