2Q7YA

Structure of the endogenous inkt cell ligand igb3 bound to mcd1d
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mouse CD1d-iGb3 Complex and its Cognate Valpha14 T Cell Receptor Suggest a Model for Dual Recognition of Foreign and Self Glycolipids.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
total genus 70
structure length 269
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q7yA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2q7yA01
1GC1C 4HIXL 4KPHL 3U0TB 3QDJE 1HH6B 1T1WB 5ISZB 3K46A 3VGBA 4P9HC 4ZNCD 3WO3B 5KS9E 4WFFE 1DSFL 4OAWA 4Q9RH 1F13A 3L3JB 3D2UA 1MCPL 2D7TH 5FUOH 5I1EL 1K2DB 1MQ8A 3O2WL 1MRFH 3DMMA 4YXLL 2H45A 3VG9C 2OM5A 3BZ4A 4OZGB 3EYUL 5EFIB 1HSBA 4YDIL 3OG4B 1CICD 3LN5A 4HWUA 5FF6B 2VLLA 4F33A 4ZFOB 2FEEI 4IRJA 4MA8H 5BOPA 3TZVB 2WAHA 5BVPH 4PIRF 4GRWH 5HHNA 3H9SE 3HI6H 4M8VA 4Y5VB 3MRMB 2MCPL 4H1LA 1X9QA 2X42A 1VPOL 2J1KA 4XBEL 4N90D 2CLZB 3RVXC 2GUOA 3DVIA 2MKLC 4OFYA 1A2YB 2QTEA 1BFOB 1EHNA 1OARH 1UZ8B 2X7LB 4RBPH 1U3HB 5D1ZA 4I0KA 4I0PA 3QCVH 5IB1A 4KHTL 2WUCL 4NUGL 2YA0A 4NKOB 1DBKL 4U6VL 5E8PA 2HT2D 1OGTB 4WCYH 4OLWH 3RVWD 1FGNL 2ARJB 4O00A 3MRRB 3TJEL 4Z18A 3RP1A 2CK0H 1KSRA 1T3FA 4X7TB 4P9HH 1REIA 4NFBA 3LDBB 3ZKSD 4H5SB 1FQ9C 5DJ6B 5FHBH 4LEOA 4Y19B 3MJ8A 2OLDA 1J9CT 3JV4B 4KKCD 5C07D 5C7XL 3F5WB 1GIGL 1JPGB 1HE7A 3MFFA 3H9HA 5ITBL 3RDTB 1J12A 1U58B 1IAMA 4YE4H 2NZ9D 2P1YA 4H1LH 4D9RE 2X1WL 4JANA 5T3ZE 2YD5A 1DQLH 4OQTA 3CXDL 2X4OB 1M7IB 3NIDF 4O4YL 5C07B 1P4IH 1QG3A 1CFTB 1DLHA 5IT2L 3TA3C 4A2MA 1QA9B 1CXEA 3HRZA 3ZKMD 4MWFA 1MCWM 5FEBA 2NZIA 1V8HA 4IIQA 1YEFH 3D18A 4RFNC 4QKXB 4NQVA 4TTDD 1TDQA 2ZOLB 5C9KA 3CFKA 4R97B 4DOHE 5BCAA 4ZYKA 4MXQD 5HYSB 2FGWL 4YXHH 1MWAL 4NZRL 5E1AA 4YPJA 2MKWA 2X4SA 1JK8A 3SE8H 5C0FB 4TSCH 3DTXB 2PYEB 3L3HB 4EXPX 5FGCB 3U0TA 4QT5A 2IFGA 4RQQA 4KZEL 4H26A 4LBEB 5F7UA 1D6EA 4G3YH 1FL3A 3EHBC 4TRPL 4XX1E 5IW1B 5EZIH 4FQCH 2FR4A 2WSKA 4UQ3A 5T1DH 5KTEH 4JDVA 4BH7A 2Z93B 3DRTA 4EN3D 3UYOD 4P5TA 3OJDA 4P2RD 3TVMB 5I8CB 1MAMH 5DK2B 4F7MB 3BYTA 1DQQA 3BQUA 4KGJA 4R26L 4JZJC 1I8LA 1E4XI 1U36A 1ZLWK 5FYKL 2EYTB 1U2HA 3EO9L 2J7LA 2VLKA 2VLRD 3VG0H 3BOVA 4OCSH 3MLWL 1A6VH 4MQ7B 4PBVC 5GS0C 3RL2A 4KFZC 4EIGB 2H3NA 4LLWA 4NGHL 1S5HB 2DICA 4CVZA 3HUJB 1F2XK 5FYLD 1W72B 2NX5B 4RFOL 2NTSP 3U2SB 1D5XA 4LCYB 4OT1H 4CRPA 1TZIA 4MHHG 4MAYC 1A6ZA 4LAQH 1JFMA 4DKFH 4WV1B 1JUFB 3QSKB 3R8QA 4JQIH 4FN0A 2ARJA 4QRPE 5F9AC 4APQA 4LPYA 4V1DD 1N0XL 3C2AH 3IGAB 3T1WA 1CFVL 2BSRB 4KTDL 1JZ5A 1FYTA 1BPVA 4C58B 5DJ6A 5HGHA 1MHCA 3QPXL 7FABL 4XPTH 1P84K 4JFDB 5I76A 1TJGL 3QDMD 3IJHA 1SJEB 3O4LE 5ANMB 1JRHH 1HXMB 3GSNA 1NLDH 5TF1L 3RIFK 1R3IL 1IBGL 1MF2H 1Q9LA 3FB5B 5C0GA 5TGBA 4JFHE 2F54A 2X44D 5HYJB 5KZCD 3WS6A 1NAMB 2ZUWA 1HHJA 3HZVB 4E42B 2O5YH 3VXSA 2X4OA 3MOQA 4QNPF 3VFPB 3MRPB 4NNYB 3EBAA 1GOGA 5IQ7H 1WISA 1G7IA 2NXZB 1UT9A 3SDDA 4I4WA 4YHZH 5SWQA 4PJ8C 1LO2L 3MXWH 3C08H 4BFIB 5JW5A 5T5FH 3DIFA 2KH2B 2X4SB 1JK8B 3HNSH 4QRPB 5GJSH 5C0FA 2C1OA 4PJFA 1KCSL 3T04D 1RUAH 3B8YA 5DRWA 4YJZL 4KMQA 1MCLA 3FO0L 4Z0XA 3B4NA 4P4KD 1NQBA 2E7LE 4XH2A 2XZQL 1MPAH 2AERT 3P11H 5FO8B 1JPFA 4GQ9H 3RWIB 4RGNC 3KR3L 5F7FA 3GKWL 3F65A 3E6HB 1EFXD 4PV9B 5IFHL 4HC1L 4MCZA 3W5NA 3D87B 1BQLL 1M7DB 3KLAB 1H3UA 4K9EL 2F74A 4UTBH 1X5LA 4NQCB 4XC1H 1RIVL 5F71A 3PQYD 4X0KA 3KXFB 3OJDB 3ZL4H 5T33L 5DK2A 2JCCF 5DJ8A 3MR9A 2IAMA 3T4AA 1II4E 2MQ0A 5HSFA 5CSBA 3CK0H 5EOQH 3RVWC 2VC2H 2VLKB 2IJ0C 3ILQD 1X4YA 3IVKA 3SHSA 1KIQA 1IRAY 4M6OL 4LSVH 4FFVC 3GRWH 2ZCKH 2BC4A 1YNTA 1DBAH 3DX6B 5JIIA 2Z4QB 1R3KA 3ULSA 2NX5A 2J5LB 4XXDA 3O3UN 4KRNA 1R0AL 1F3DJ 3G5ZA 2AK4D 3PWUB 4Z95H 3U0PB 4HZLB 3BVNB 3RRQA 4WV1A 3JTSB 1H3PH 1I85C 1FYHB 2H32A 3TC9A 3L1OH 3U9UA 2P47B 2X4QB 1H8SA 2LFGA 4P2QA 2VLJD 1N4XL 1FJ1A 5B3JE 4O02L 3ARBD 3V6BR 4KTYA 5HHOE 2ZUUA 1LD9B 1K8DA 4X6BA 1ZLUH 2EDJA 2C5DC 3FT3A 1JGUH 2DLEA 2ZWLT 2YUXA 1YZZA 5KW9L 3CJJA 1IJ9A 1QBLH 4LCIH 1NBZA 1TVDA 1XEDA 1EEZA 3QH3A 1FSKC 3D85D 4ZSOA 1EAPB 3PGDB 2EEBA 3FRPG 4LCCA 3IT8D 4OCLC 4JB9L 1CFSB 2CDFA 1ZMYA 5D2NC 1U8QA 1AQKL 1WCBA 2AI0H 5DQDH 3EDEA 3IDJB 1AGCA 2UZIL 4XAWL 2WANA 3TN0C 3KPQA 2XZZA 1J86A 4EDWH 2ZZUT 1QHPA 2NW2A 4KC3B 5F70A 3PV7A 3HA0A 1I75A 4NHCH 3S36H 3DBXB 4JPIB 3PWVA 5TDPA 4WY7L 1KYOJ 4ZOBA 4C59B 1AXSA 1PG7L 5L2JB 4RISH 1IGMH 3OV6A 4ZO6A 3WSQH 1ITBB 4PJBE 4HUWB 1C12A 3MRQA 1QLEL 3WHXA 2WBJC 3LKRB 4GAYA 1WEJL 5JPNA 1JGDA 2D7NA 2IF7A 4MXQC 4NO5B 3MCKA 2A77H 2YEZB 4Y16B 4D3CH 1EHAA 3GSNH 2Y5TB 3C2SA 4PY7B 4WVRA 4P4RA 4R90L 3H7BB 5MP6H 5IJKC 1XR8B 4P0DA 2NYYD 1O7SA 3QCVL 4N5EA 2B8OT 2NY6B 1EFXA 4F80A 3MBEC 3E8UH 1YDPB 4M7LH 4CN4A 1FZKB 4HMEA 2BVYA 5TE4L 5GRUH 1J5OH 4EI6B 3G5ZB 1GPOL 3WNPA 5F6HJ 2XZAH 1DQTA 5FUCE 3MLZL 3OKMA 4NKMA 5FOBB 4D9QD 1HKLL 3TBWB 3QIBB 2NCMA 4I5BA 3VXQA 1I8MB 4MMXC 1DQMH 5D7LB 5GS0H 3GSQA 4ZDHA 2VXVL 3GBLA 4MZ3A 1FJ1B 3NIFF 1T04A 3QXWA 2FYYB 2Y1VA 4KROC 4L8DA 5CIPA 4YBQD 2EICA 1T0PB 1VACB 3O0RL 1T7YA 3I50L 3WN5A 1JYNA 3MGAA 7CGTA 3HC3L 5C0RH 4KUZL 4HWBA 4Y19E 5DJ2B 2CJUH 3VFRA 1UH3A 2BVTA 3EYFB 4Z0BL 3PHOB 3S37L 3EYSH 1I85A 3L7EB 4V3EB 5HHXL 4DQOL 2IMMA 1MHEA 1PG7X 1MCBA 4HV8A 1FFNA 2R0ZL 5I74B 4Y4FC 3T3ME 5IEKB 1OARL 1RI8A 2V7HB 2VABA 2BHYA 1RY7B 3DX8A 2NW2B 4ODHH 3DUSA 5HHPA 2BOCA 1BQHA 5EU6E 4DN3L 1RUPH 4G7VH 2ZPKL 4Y4KA 1RZ7L 3MLUH 3T0EC 2Z92B 2RCSL 3JV6B 1H5BA 1X6NA 1YEKH 3MRBA 4MS8A 1KBGH 4AH2B 3FFCA 1QFWI 3BN9C 3RU8L 4OCNC 1RIHL 3INUL 4IDJH 2AJUH 4NWUH 1J0HA 2R4RH 1HSAB 1H8NA 5CINL 3GJFK 2I25N 3EO1A 5D72L 2YK1L 3UZVB 5KVDL 3U9PL 2LE9A 3S34H 2HJFA 5IGXH 3MCKB 3SGKA 8CGTA 4Y16A 2CDGB 4PY8J 4Z7VB 1A6VL 1X3DA 1JGLH 4PJXE 5IBTH 2YPLB 5D2NE 4JJHA 5BMFH 3UBXI 3MV8D 1BF2A 5FM4A 1CR9H 5J12C 3BXNA 1U8LA 1EBAA 3JBG7 1OGAA 2MCG1 3GJFH 3DROA 2CIKA 3GO1H 1RPQA 4LVOC 4O51B 4B0MM 4YNYB 1EO5A 1TTFA 4QHNA 2BNUA 1JV5B 4JDZA 3ARZA 5DEGB 3K80A 1G9EA 3HCVA 2CKNA 1SBSH 5KVFL 4RMQA 3MJ9L 2X1QA 4EJ1C 3IU4H 3WIHL 4M48L 5A3ID 3ISWA 1I7ZB 5E6IA 5MEPA 1F90H 3ULUD 1INQB 1NMCC 3RWEB 4PD4K 1ZHNA 4WWKD 4N9OB 2R2BA 2EZ0D 3NVQA 1AIFA 2PXYB 3LD8B 3DI2B 4U3XA 5AYUH 2NY5L 1FL5B 4I3SL 5CEYB 5I1JL 1H15A 5ICYB 1QKZL 4X5WB 4HUNB 1P7KB 4K3EL 3PP4L 5C08B 2UV3A 4QHKI 3RL1B 4JG1L 3BKMH 5AZEL 3ZYOA 1KC5L 2FJFA 2ZUYA 1N0LA 2X4NA 4JE4B 3G6JF 5ESQB 3RWHA 3FKUS 2RQ8A 2EDHA 2VWEE 1I3UA 4GRWE 3Q6FA 1AD0A 1JHTB 1P4LB 3JWOH 5EC2A 5JXED 2FWOA 5F7LB 4G8GA 2QKIB 1HXYA 3B5GA 5E9DE 2HT4D 3WUWA 1SM3L 5L9DH 1BGXL 4LSVL 1KCRH 3MA9L 2X4UB 1ES0A 1A0QL 1NC4D 4NDMB 1HH6A 4K7PL 4LPXA 4N9GB 5HYJD 1NEZG 5DFTA 1OM3L 2I60H 4K07A 3MCG1 1Z5LB 2I07B 3ARDD 4PLJD 1WBYB 1CU4H 1HQRA 2VDRL 2WWKT 2DQTL 25C8L 4PJIB 2EKJA 1K2DA 3MLPA 1H3VA 5I9QC 1A6UL 1KN2H 3S88H 3ZLQC 3X12B 1N0XH 4UTBL 4XC1L 4PTUB 3VMNA 15C8H 4ONFL 4ONGH 4AH2A 4ZFFA 4RWYH 4HUXA 4PJHA 1CS6A 2LU4A 3NPSC 2FJGA 4R4BA 4P3WA 1JZ4A 2APFA 3V0WL 5HHNB 1U91A 4CADA 4XVTL 5D2NA 4YEEA 1JWUA 1X4XA 2OL3L 3T3MF 1M1SA 4Y5VA 3OSKA 3WJLA 4CW1B 4XPFH 4HWZA 3TESA 3HZKB 3WD5L 4L3ED 5KSBF 1UZ8A 2OQJB 1J7VR 4BFGA 2AABL 5LGHL 4P4KA 1U3YA 3GM0A 3HKFA 3MOAH 2HLAB 4Q97A 3OHXA 5HGAB 1KEMH 2XXMB 3RIFF 5K9JH 2VRAA 1HHHA 4YNYA 4F8QA 4LVOB 2R8SH 3VFVA 2AJVH 2PTTA 5DEGA 3ARUA 1KJVA 4U3CA 5I1DA 3HNSL 4LEOB 2GITA 4H88H 5GJSL 4DFIA 4KVNH 1D5IH 3EAKA 3NCCB 4S2SA 3F5WA 1ZVSB 1HK6A 5E6IB 3BP6B 4JDTL 3ZE0F 1INQA 4OV5A 4KK8C 5DD0H 5MI0C 2B2XL 3AREA 3H7LA 3DX7B 3KDMB 1TQCB 3DXAE 2NXZD 3U48A 3QUYA 1NEUA 1H15B 5B3NA 1KIRB 5ICYA 2E9WA 3FO9B 5DD1H 4YXHL 1NGWA 4L9LA 4NO0B 1I9RH 4N0UE 1DLHB 3TPUE 1FNLA 3LN9A 2HMIC 5GZOC 3STBA 5INDB 2X4NB 1F4YH 3T4YB 2YC1B 4UILH 2FLRT 5D96B 3RDTD 1JHTA 3QDJB 3G5YB 4P2RE 1BZ9B 3KYNA 4LGPB 4QTHA 5LBSH 3S36L 3GHEH 3QUKA 1INEL 1FL6A 5FHAH 2IPTL 4MJ5A 4P46A 2QSVA 1ES0B 4MJIB 1K6QH 4M7LL 4H26B 4LBEA 3NCEB 3ULUL 3DRQB 5HI3D 4Y8DC 1J5OL 3QDGB 1A6TA 1IGFL 1U8IA 1S3KH 5IR1B 5KSAC 3CH8A 1NGYA 3VXRE 4KMTL 5ERWB 5JDJA 3FO1A 4JAMA 4Y4FD 5KANG 3O6LL 4HK3J 4X80L 3Q6GH 2VL4A 3W2DH 5D2NB 1SQ2N 1JWUB 3I02A 1LNUA 4WRLA 3SQBA 3UTOA 2YPVL 4NQEA 4MX7B 1YPZF 1Q9KB 4ZS6D 4G8IA 4NKDA 1FDLH 2X4TA 4RA0C 3QWOB 4FMFA 4YO0A 5A3IC 4QEGA 1PSKL 2QADC 4CVXA 4X5XA 3OHXB 4PJ9B 1UENA 5CP7B 2B1HH 4U49A 4M61A 1I9IH 1EVTC 5D7JC 5F44A 3QDHA 3MXVH 1HKLH 4Y2DC 1R3IH 3QQNA 5T1LA 3QEQA 3N1QC 3QQ3B 3CH1B 1G7QB 2BNRD 3X11B 5GGUB 5CD3B 2E9BA 5CEZD 2A1WH 1X4ZA 1NC2A 1MAML 1H0DA 4PRHA 1W0WB 3IYLW 2GSIA 1KBGL 3PJSA 4IIQC 4NYLB 5D2LB 4UIMB 4Y16C 5GGTA 1XGTB 3O6FA 3TT1L 2VERN 2AS5M 5DYOB 4QRUB 2R1XA 3OQ3B 1E4XL 2ZOKB 4BH8A 1ADQH 1JTPA 1NAMA 1OP3H 1YEDA 4HKBB 3OB8A 3IJYB 3SOBH 5C6TL 1EV2E 1EPFA 4D9LL 4BQ9A 2XI9A 2Z31B 4PLJC 4EUPA 5HHVL 1FZMB 1OB1B 3IDYC 1A64A 1XGYL 3LAFA 3VWJB 2UYLB 4HW6A 1CR9L 4G6FD 3A6BL 1AGDB 1WFTA 1FFPA 2B4CL 3ARGD 3RY6A 3U46B 1A3LL 4GBXC 2C1OB 4PJFB 1HHIB 3GSVA 3GB7B 3IJSA 2XTJB 3AMLA 1T89C 2Y72A 5J13C 2KZWA 5EN2A 4FNLH 4KXZI 3VCLA 2HT2C 3RWIA 1AFVH 1UXSB 4B7LA 3LKNA 4ELMB 3DV4A 3CCHA 3FQTB 3INUH 4N0CC 3CZFB 3KLAA 1YY9D 4WFGE 5E0QA 3ZHDA 1MCEA 4H0HB 3WJJA 5KVDH 4UAOB 4F7EB 4FQHA 4N8VA 3GRWL 3B2VH 4HDIA 4FQJL 3UTPD 5I17B 4U0QB 1Q9OA 5DHVA 1S9VB 1A9BA 3L5HA 2H6PB 2DLHA 4Z7QE 1LDSA 2YN3A 1D5ZA 4X8XA 2OJZL 3VXUB 4ZMAT 1A7BA 5D7KE 2NY5C 4EUPG 4UT7L 3GSWB 3H8NA 3D2UD 3MRCB 2DQGL 1VFBB 1EUTA 3RGVB 3C8HA 1CD1A 1UB6A 1A6AB 1WK0A 4ZO9A 5FDYA 3MV9E 2IBZX 2Z4QA 3ULSB 1FV1B 1EUUA 2A6IB 2V17L 3PHSA 2GT9B 4P2OA 1D6VL 4EZMA 3VFSB 3D85B 3G6AA 1MHHB 1G7HB 2HKFL 4GQ9L 1KCRL 3MA9H 4PJAA 4WI6A 5IBUG 4M61B 3QXDA 3IFPB 1RZFL 1KJ2H 3LEXB 4FQLH 3P4MA 3PWNB 4NN5C 2DD8L 4XI5C 1OAUL 4YXKH 1NC4A 2NY2D 5DMYA 3U4EB 2YKLH 5EU6B 3MRIA 4U1JA 4MNQB 1Z9OA 1SEBB 3BYYA 4PBWD 1DN2A 3PP3K 1KC5H 2CQVA 1OTSD 3H0TB 4P49A 4G43A 4WO4C 1XGTA 4OM0L 4LP5A 3O6FB 4KRPD 3QEQE 1QACA 4GAFB 4M1DL 1DVFA 1LDPL 1XGPA 5GHWH 5J57B 5L2KA 5TPWL 3RX5A 3S34L 2Q86A 3OGCB 5IEHA 1AGCB 1JF1A 4UIKL 1I1CA 2AEPL 3BPCA 5F89B 5HHQA 2ID5A 1FLRH 3MRGB 3FT4B 5GGRA 5DRZA 2CR6A 4JN2A 1MJ7L 2Q8BL 3WFZA 3CSGA 1QBML 3BEWB 3U46A 2PYFB 4ZUUB 5D1ZD 3HHRB 2E5EA 3P40A 4OCXH 3VH8G 1NSNH 2C1PA 4LASH 1PLGL 2HAZA 5E9DA 4Y5YA 3HPJB 3N50A 2VL5A 3DVNA 3DSNA 1HI6B 2G5BB 3KXFE 4JY4A 3SQOL 3TFKD 5JPNB 3VRIA 3OKDB 1QFWH 1OW0A 4XVTH 3SE3A 1ZT7B 3PABB 5CS7A 5ALBH 1TZGH 4X6CE 4Y1AA 4KKAD 4QRQA 4XPFL 4Y4HD 2IPKB 4M1GH 4PJDF 4S1RL 4MAYA 4PJGB 2VLKE 4XNYL 3LKSB 1IKNA 4KH2A 3R0MA 4M9OA 5JO5A 3C9NB 1DP0A 3D3VE 5DD1L 5TE4H 4OLVH 2EDNA 2LV4A 1QO3B 2JJSC 5DRXA 1G7LA 3QIWA 4ORGB 5C0CB 3ZTNL 5ESAB 1VGKB 1FZJB 5KSBA 2VZ3A 4JFFE 4JM2C 4NHCL 2HFEA 3AB0B 2X1PA 4EI5A 3BKJH 4ZUSA 4WJ5B 1N26A 5F9JA 1K85A 1A21A 5HGBB 3REWA 3SKUD 3CMGA 1AI1L 4OLYL 4I77L 4MVBC 3QWRD 5I1CL 3O2VL 5DD6A 1RJLA 4YHOH 1AKJA 2ZCLH 2I26N 5D7LA 1EFQA 4H8WL 5CBAA 4Z7WA 4ZXBA 4YK4B 3U4EA 1FVDA 4KI5C 5E9DD 3MRIB 4PJIE 4XBGB 5I1IH 2E6PA 2DN7A 1P1ZA 3IFLL 4QOKE 4XNMB 3TO2B 3MOBL 4XMPL 5ETUB 1YJDC 4NQDD 4CMMB 3NH7L 4NJAH 4P3DA 4WWKA 5ICZA 1KGCD 4M03A 1RUPL 3Q6GL 3W2DL 2VMFA 2HLFC 2PO6D 1ZA6A 2WQ8A 4U6HA 1IQWH 4F7TA 1ED3A 4MLIA 3KJ6L 4OD2B 3ZDXE 4RAUB 3S96A 1GPOH 1D3CA 1WAAE 3WYRA 4WEMB 4JM4H 5IIEA 1KOAA 3GJFB 1I1YA 4GW5A 3CU1A 4Z77A 3ULVE 4J3XA 5TJWK 1PYWA 1BBDH 4M3JA 3JV6A 1HN1A 1ZANH 5C09E 1CGVA 3UC0L 1UM4H 3CDCA 3W9DA 5IBTL 1WC7B 5SX5H 4Y5YB 3SY0A 1XGQB 5BO1H 4WEBL 3VXTA 2DMKA 5JHLL 5JZ7C 4NHUB 4E41E 1X7QA 4JDTH 1PDKA 5J56B 4N5EC 4WI2A 2DWEB 1KB9J 3MO1A 1QLRA 2XN9B 4JZOB 5L2KD 2YPVH 2VOTA 4NQSB 2ZJSL 1UJ3A 3ZZ1A 1CTOA 3L3IB 1OD9A 1G0YR 4GW4A 5SV3A 2A9ML 1IEBA 3PE9A 5H35B 4DEPB 2CMRH 2XY2A 2MMXA 1FFOB 2P44B 2DQHL 4AG4H 5KBNC 1KXTB 4JN1L 4PTTA 2DQDL 3KPNA 1A9EA 4GT7A 4ODHL 2DMCA 2ZG3A 5HHVH 2F8XC 5J9PA 3JUYA 3SDXE 2CSPA 1P7QD 1UM6L 4J8RB 4PRPB 2YHGA 3QEHA 4QRRB 5GIRA 2V6HA 4GRLA 4QOKA 1AGBB 3D0LB 2JIXD 3PL6A 3SDCA 3CVIL 3IXAA 2VXQH 5IW6B 1CE6A 2H26A 2Y23A 4IDJL 2J8UF 2WINA 4E41A 4G5ZL 1AIFB 4ELKB 3QA3B 5CBAB 5I1LA 3HNVL 1KB5L 6FABL 4FQ1H 1SYVB 3ARQA 1LO4L 3FB7A 4WI3A 1MFNA 4NBYB 1BECA 2C26A 1LO5B 4ZUVB 4ENED 5DMJB 4YDLB 2EDKA 3L7FA 2RFXB 1MNUL 5DJAA 5ICXB 3C6LC 5I1AA 2ESVB 3FB6A 3BMVA 3M1BA 4NN6C 4YHPA 2DLIA 2EEDA 3DPBA 5ETUA 4GKZB 2UY6A 2YD1A 3CX2A 4U0RC 4HKXB 2R1YB 5C0DB 2P4AB 3LEVL 2QADB 4DGVL 3P4NB 1GXEA 4Y4HB 5HHME 1SBSL 4ONFH 4PRDB 1MJUL 4S0UC 5E8NB 5CFHA 4M5ZH 1PSKH 4POYA 4QRRE 3KLSA 3HLAB 1IZKA 2V2XA 1P6AB 3IDGA 1MRCL 4YHLH 3KG5A 4FFYH 3N9GH 4N8PA 5J1TC 3ZHLA 4WI5A 2HKFH 2DM2A 1EJOL 2ZNXA 5FYJH 5CJ5A 3PIQA 1U8JB 3QAZB 1KPRA 3VFOA 4CU8A 1NANH 2DQEL 1OPGL 2NY2C 2VITB 5JQ6H 3V5HA 2EKSA 1AR2A 2EE3A 3O8XB 4TUOB 2HLFD 2C3XA 4KY1H 2HJLB 5HDLA 4PJ9D 2WWKO 1I7UB 3WN5C 3EOBB 4ODSH 4UT7H 1VENA 4P5MB 4PP2B 3C5ZB 1PX3A 4F7PA 2NXYB 3EJZC 3JZ7A 4NRXA 5SX4I 5CZVH 5F8QC 4IRSB 4TQEL 1M6OA 4MCYB 5JW4M 1RURH 3DX9A 3K81A 3VGFA 4IRJC 3WNKA 5IMMA 1YQVL 2OSLB 3U7AA 2NY0C 2D9CA 2A6JA 4PV8B 1YMMB 5D93C 5C3LD 1L9MA 3PWLB 2BSSA 1IFHH 2VR4A 5I8OH 2B4CH 5FKAB 3GUTA 3R4DA 5D7KD 4LEXL 4QRTA 3TA3D 2W60A 5EPMA 5SWSE 4FP8L 1XIWB 1ORSB 2R0WL 3BT2H 3PV6B 1XGRB 4QYOA 4RWYL 3FO2B 1EZVX 5F9DC 1E27A 4JKLA 2H26B 4LIQH 3SE9L 2OR8A 4PJBB 3SJVB 2LTQC 4KROD 4XZUB 3D3VB 4KKCC 4OF0A 1MHPH 3VXRA 4ZUVA 5TDNA 4PG9B 3VFGL 1C7SA 1J0IA 4LSTL 5C0IB 1J1PL 2YC1A 3EJYC 1ITCA 4X4ME 3AC0A 5H94B 4N0CA 1UZ6E 5I1GL 4NWTH 5K33A 2A9NH 5SWSD 3PG2A 3BPNC 4BSVA 1WIPA 4LCUA 4MB3A 1OAZH 1BZ9A 1T80A 4YBLB 3V6ZA 2GJ6A 1JTOA 3OJ2C 2PTUA 1MFCL 1NBVL 3ZTNH 1XZ0B 3NACL 3P30L 2HKHH 3IFOB 4P9MH 2ARJQ 3QUMB 2XG5A 4YDJB 5DC0A 3DUHA 4XNUL 2VH5L 4PRAB 4F37K 1IAII 3HMXH 5C09B 3P4OB 1YEEL 4RDQF 1OQXA 3O2WH 5T1KA 2A83A 1U8HA 3TBVB 4YX2L 4ZAKA 5B8CC 4R2GC 2B2XH 4OCRH 4LVNC 1KTDB 3QT2A 2BOBA 4JFEA 1LVEA 2FB4L 1XF5A 5DZLA 1KCKA 4RNRB 2HT4C 4LSRL 1N7ML 2CLRB 1IAIH 1CD9B 5D7IA 4AL8H 2V2TB 4BK5A 3FQUB 2JTDA 4H20H 4Q6IC 1R5VA 4L3CB 3HB3D 5D1QD 4PJFF 5I1IL 5JZ7D 4H8WC 3DVFA 1X44A 4W81A 2XNAA 2VZVA 1I3VA 3LQAL 3BAEL 1AY1L 2X1OA 4LRIA 4JFFD 2FECL 8FABB 3FTGB 3QQ9D 1E4WH 3EYVB 1YECH 4G8IB 4NKDB 3RKPA 3FOMB 2AP2A 5DF0A 4IRSA 2DI9A 3NOIA 3AROA 2WUCH 4OB5L 2P42B 3GBNL 4PGBB 4G7YH 2HJKA 1OOAA 3RPIB 3MROA 3MUZ1 4Z78B 4UIKH 1T89A 3J8F7 2AEPH 5CP7A 1ZHLA 3C6LD 2OSLA 2HN7B 3MLYL 1TVHB 3QPQC 3TT1H 3MLTA 4HX1B 4PFEA 5K93A 1CXLA 3CC5A 5FKAA 3V9FA 5E94A 3BJLA 3TIDB 4I8DA 1EZVY 4JFEE 5EPMB 3AMKA 5CD3A 3RNQA 1L6ZA 5DEFA 1DFBH 4DVBB 5KVEL 4D0DA 4M6ML 2X2YA 1LE5A 4GLRH 3RTQA 3GSXA 3OJVC 2WWMC 1MY7A 2IQ9H 4UZGA 1KLGA 3LN4B 1QR1B 3C5JA 3DUUA 5D70L 3I3BA 4QRUA 2DYPA 5JHLH 3BZEB 3K2UH 4IRJD 2XPGA 5AD0B 3OKOA 1ROWA 5DUPL 2YSSA 4FFZL 5GSRB 5I15H 2VDLH 3UEZA 5C0IA 1C5BH 1OB1A 2E27L 2EDBA 1ADQA 4NRZA 2NY3D 3MV9A 5EUOE 5FYJD 4Z5RB 4P2OC 4XPHH 2ZSWA 3ZKQD 1AGDA 3QWRA 2Y36H 3O8XD 4BSVB 1UXWB 5FKPA 4GXUN 3Q3GB 3W82A 5IMKB 2GJ6B 3QEQD 1NAKL 1QSEB 1WIOA 1A7PH 2ZP0T 4ZFGH 4HXBL 1OTTD 1U41A 5D7IE 4G3YL 4YDJA 1UXSA 1FIEA 3Q5TA 3WJLC 4R0LA 4ELMA 4O5LH 1JHLH 3K3QA 3RGVD 5BS0D 5FYKU 1WV7T 3CSYA 4PJ7E 3W9EA 1UB5B 2N56A 3TGXA 1RK0A 5IB4A 2DTML 5F1OB 1Z9LA 1Q72H 2BOBB 1UEMA 5I17A 2W0FA 2ZKHL 5T5NF 4YZFE 3EOAA 3DVGB 3L3KA 5DTFB 5DHXB 1YYLL 2IAMC 4WW2F 2OTPA 4NQCD 1PEZA 5A2KH 4NKIH 1YUHB 4JLRB 1VFMA 3ARRA 3GRWA 1ZOXA 2ITCA 4L5FH 3T2QA 3U7WL 2EXWD 5ACLA 4LPVA 3U6RA 3V4UH 1QRKA 4LOUD 1G7PB 2DQDH 3ILPB 3A6BH 5F6IC 4FQLL 4AIZA 1A1MB 3MUJA 2P5WA 1DBKH 3G6JE 5KVMC 2RHEA 3UXFA 3PXHA 43CAA 2HJKB 5EU4A 5BJTA 2VN4A 5F7MC 3W5MA 2MQCA 1F6AB 5HI5D 1IGYA 5I1KL 5FM5M 4KZDL 1W0VA 1VEPA 4YFLF 3PNWB 4ISVB 2EXYC 2IADA 4M1DH 5HGDB 3EJZD 4E5XB 3MRLB 2CO6B 4ZXBD 3QXAB 3VFNB 4KROB 3B6SB 1C16A 5DEFB 3K4DA 2EECA 2X70A 1IM9D 2VDOH 2FBJL 4P5KB 5HDOA 2JB6B 3WIHA 4CAGA 3TBTA 3C5JB 2ERJB 3NZ8A 5EBMB 4XP5H 4BSWB 2JIXB 1N5YL 4N8VG 5C0CE 4FG6D 4K3DH 1YEFL 3BP7A 3MREA 5EC1A 4LNRB 5HYQB 2V9TA 1BM3H 4OCMC 5HGGS 4BK4A 2A9MH 4BYHA 3HS0B 3FT4A 4ERSL 4X4XB 5CZVL 1ACYH 2DQJH 5GGRB 3X13A 4OSUH 2X4PA 3GEWB 4L29A 1IQDB 3ILQC 4LQFL 4M93C 1AJ7L 4CBPA 1JBJA 2YUVA 4KZEH 4XPAH 4UINL 4IJ3C 2DD8H 3I6LE 3WNOA 3ALXA 3B3IA 2CKBL 2GJ6D 4HEME 1MFAL 3D0VB 1LO0L 1YEHL 5T3XE 2L7UA 4PJHE 2FECI 2NY1D 4MD5B 4V2BA 2YPKB 3CSYB 1R24B 1I8IA 5FO9A 1OSZB 3VRIB 1UCBL 5IM7B 4YDLC 5IK3A 3HZYA 5TQ2L 1JFQL 4K9EC 5JW3H 3VFWA 2FJHA 3B9DA 1XF4B 4R26H 1N2RA 1NL0L 4JHBA 2VDMH 5GHWL 4HWEH 4HS6A 4M8QA 2JELH 1JNHA 3ZE2F 3DVGA 1Y18B 1INDH 2VQUA 4U6VH 3UJJH 3KXFD 4X6DE 4WCYL 2R69H 1QO3A 4B5EA 5I2IA 5CP3A 4YDIH 3VRJA 5C0CA 1A3RL 3UX9B 1RIUH 5I18H 4LRIC 4HBCL 4U2ZA 3QG6A 4C57C 4LDLB 1T7XA 2QADD 1YC8A 4O2EA 2BVPA 4JFED 1DL7L 4JO4L 2ZSVB 4MJ2A 4NQXA 1A4JA 1MUJB 4N1CA 1BX2A 5JTWA 4WO4A 3SGDH 3B2UD 5DK0A 5EU7E 4R7DB 1QFWL 1WZ1H 5HGDA 3CVHA 3QFJB 4KHTH 5E4EC 4A6YA 3MBEA 1E6JL 2VDKL 3MRLA 1JRHL 3ES6A 3V52L 1NLDL 4G6AD 3ARFA 2YRPA 4LHUG 3TO2A 1IQWL 3MMEA 4JRWA 3BX7C 3A67H 2VAAB 5IMOB 4OF6A 1UKSA 3LSOA 4XC3H 2CLZA 4K2UL 4NT6B 5HY9A 4HIXH 2DAVA 4WWKB 3TCLA 1KLUB 3D39A 4F15C 1RJYB 4M7ZC 1WZLA 2DLFL 1A4KB 1AY1H 1NMBL 2WWMD 1WLHA 1ED3B 2WLZA 4RAUA 1K5NA 4HIEA 5T1MB 3N1GC 3UJTL 5TE6H 3G6JB 2X4PB 3KPSB 1JHKH 1I1YB 5GS1C 3ETBF 4UI2A 5BS0B 3RWJB 3O2VH 1MQKH 5IW3A 5E2TL 1DCLA 2ATKB 4OQTL 3SO3C 4B7IA 3VGEA 2Z91A 3BD4A 1Q1JL 5JMOC 3MODL 4JO3L 2GY7B 3TH2T 5D1ZC 2O5ZL 2VLJA 1T22A 2AXJA 4LHUA 4H1LG 3FAWA 1QBBA 2D0GA 3HC0B 4KU1A 3OAZK 1NGXA 1CK0L 1KJ2B 4NGHH 3UTPE 5F7EH 3R8BB 3BIKB 4RMWA 3BP4A 1JZ6A 2J4WL 4RMVA 4KKLC 4L9DA 4NUGH 2J6EL 4NSKA 5EUOB 3HRPA 3T8XB 2NMSA 1ZHKA 1OTTC 2ZOLA 3QZWA 5J12B 5EWIL 4RGOH 3VXPA 4K7PX 2J12B 3FRUB 2V9QA 3JXAA 4ZPTB 5E24E 4YPGB 5DGQA 1V3LA 1D9KB 1DBAL 4U6XB 4ZQKB 2ILLA 3I3DA 3HR5A 1QNZL 1TJHL 3PGCB 3S5LG 4KQ4L 4N0YH 2Q3ZA 5CSZA 1QFWM 3GNML 4M4RA 5DMGC 2QSTA 1BBJB 1NFIA 1GIGH 3MUGB 4YFDB 4OCYL 4MJ6B 1ZV5A 4NZDA 4X6CA 1NBVH 2F53E 1G1CA 4NQEE 4Y1AE 4Z7VF 4ZO8A 1SJXA 2Z93A 3G5VA 3RWFB 4MAUH 4NZUL 1DQLL 2BY1A 1C5DB 3CFEA 4LQ1A 2AKRA 3JV0A 1G0DA 2O5YL 4NO2B 4WU7B 4NOFA 3VE0A 2FIRT 3CLFH 4P23A 4TNWF 4FRWA 2A6KA 5K9QG 3CVHB 3WFCL 3CX5K 3B5TA 5ISZD 3K8KA 3NIFE 1DEEA 4YDKL 3MA7B 2DQUL 5F7WC 1C1EH 5ICXA 1UWXH 4LF3A 4JFYA 1NGQL 5MERB 3MMEB 2QQKH 3C2AL 4Z9KB 1DBMH 5DQJA 3VI3F 4B53A 1X5KA 3OAYH 4Z0BH 3S37H 3F12B 3EYSL 4QWWD 3SDDD 3AS2A 2A0LC 5KS9A 1KLUA 5HTSA 3CIQA 2EYSA 3U2SA 4IMLA 3RWDB 2OTWB 4HH9B 2DRUA 4EOWH 4MD4A 5EZIL 3GM8A 1IBGH 1MF2L 1UM6H 3UTSA 3OKEA 3S4SG 2WP3O 3KHQA 4TULL 1I3RA 4ZUTB 3FFDB 2OZ4A 2WW8A 3NBNA 3MV7D 3NA9H 5GJTH 5JDSA 5D1QB 3QNYA 4PJCF 3O6KH 3HI1B 3LCYA 3ZL4L 4QY8A 1L7IL 3ZE0E 3PIQB 1T2XA 4ZODA 5GRWA 2GCYB 4NPYA 1S9WA 5FYKH 3VXSE 5ANMA 1FNEB 4YHYB 5DA4A 2J8OA 4U6YA 3GSNB 1NCUA 2ZKHH 5EOQL 2VLRB 4TQEH 3QIWC 5JW4N 3D9AH 1EO8H 2F54B 1CN4A 3T0EE 3WKMH 1NGXB 3ALPA 3GSRB 2XZQH 3EYQD 3CPLA 3RZCD 1IM3A 2FIKB 3BP4B 4QHMB 1RJZA 2P46B 2QHRH 4TUJB 2J88H 3LEVH 4NSKB 1DQDH 3ELAT 2Z0BA 3RWGA 2JJTA 1QVOB 2NZ9C 4C4KO 4RDQG 4I13B 3QXUA 5GGQL 1WZKA 5FUZH 5DRWB 4JGUA 4YHLL 1ACYL 2DQJL 4OSUL 3KLHD 5HDQL 2Y36L 4U1KA 1IGTB 4NZTL 1MJ8L 3VFTB 5KW9H 5BS0E 3CFBB 3DYOA 2FO1A 1T1YB 5CD5D 2ATPA 3QUML 1A14H 1UKTA 3LQZB 5ESVB 1C08A 3O45A 4EKXA 4HCRA 4U6TA 1KNOA 5JW4R 4KWUA 1OAKH 2DTMH 5AZ2L 3VXRB 2OZ4H 4EI5D 4Z6AT 5EBGA 1YQ2A 3G5XA 1MH5B 4R96B 1M71A 4PJGE 3BH8B 2ADGB 2AV7B 4P9ML 5B39A 2PN5A 5CJXA 3KYKL 5J6GA 4DQOH 5JLZA 1FO0H 1RU9H 3U7YL 1INDL 2P8PA 1J8HB 2KBGA 5DUBA 3X3GH 3BDYH 2AVGA 2UZYB 1IL1B 1E28A 1U8MA 1KTRL 1CWVA 4K7PH 4P99A 3QI9B 3QUYC 3BVNA 4UTAL 3L9RA 1NDMB 4P2CG 4UUJA 5IFHH 4JFQA 4KDTA 3EZJB 5D7SL 1IKFL 5JHDD 1KT2B 5K9KB 4NQDB 5D2LF 1IAIL 2B5IB 3AUVA 4P2QB 2IANB 2R29L 4XP1L 3KAAA 4FTVA 3GSNL 3RTQC 4G9FE 5DO2D 3HI1A 15C8L 3MNVA 4PBXA 4DEPC 3Q5OA 2YUZA 2P5EB 5CINH 5KJRH 4Z76B 2BMKA 4IOIB 4LNVA 2FATH 2EE6A 5E4IA 1SVCP 3BN3B 4XPBL 1EAPA 1A1NA 3KPPB 5DMGD 4JPVL 1QFOA 3E2HB 5BMFL 4LIQE 5D1XA 3IDJA 1A3RH 2A9NL 3G08B 3BIBX 4WTZG 3GMPA 5IUSA 1OCWH 4GMTH 3O2DL 5J3HD 2DWDA 4J12A 4MDIB 4OFYD 4UMGA 4PGBA 3RWGB 1FVEB 3MTRA 5IROC 1AXTH 4G9DB 4XCYA 4KKLD 3TPKA 1BD2A 1H5BC 1JPSL 4OZIA 4O02H 4FZ8L 3MRNB 1WTLA 3QIUA 3IFNH 3MJ9H 1I7RB 4KK9C 1IGJB 4HHAA 5JOPD 2FH8A 4H0IA 3VI4E 3S5LA 3VFTA 4KJWC 4PB0H 3SGEH 4UU9B 3DHJA 1VDGA 4FFZH 4LGRB 4MXWL 4AEEA 4FQ2L 3GMNA 3HUJE 4R4ND 1RD6A 3PQYE 1U9KA 3EO0A 5DR5L 3O3AB 1C08B 3O45B 3ZE1E 4Y5XB 4DKEH 3FFCD 1DVFC 2MOVA 2FHFA 1AD9B 1ZT1A 4XC3L 4XPHL 3BZEA 1HH9A 3KPRB 4XCEA 5GSVA 3NCJH 1TITA 1UWEL 1VGEL 4JFOB 4Y2DD 2JB5H 3OKKB 3FN0L 2DQFB 2JELL 5F96L 1CDBA 4YXLH 5E08H 3RVVC 4NRZB 4RGNB 3WIFB 2VN7A 1SM3H 1XAUA 1NDGA 4PREB 4L3EA 3QULB 4ZNEA 2RCSH 3VXOA 5DUBB 4R2GD 2Z35B 5AUMA 5FKPB 4BFBD 3ZDYF 1YNLH 4XVJL 2VXUH 3TPUB 5GS2D 2I60L 3BUYA 5FF6A 3TN0D 4JFQB 4RGND 1PGRB 2DJ4A 1I8MA 3QIUD 4FXGB 1IGFH 1QSFD 4AT6A 3UTSD 1BVLA 3OKLA 1UB5A 2XWBA 2KDGA 3MRMA 3KPOB 2MHAA 4AIOA 1C8PA 3W11C 4L5FL 5BZWB 1MAKA 2YXFA 5F7EL 4Y16D 4LLYA 5KSAD 4PJXF 5H37G 2J6EA 3ULVF 1RULH 1KCVH 4UOW0 3QDJD 4Z76A 5IF0B 5ISZE 1FZOB 2QSQA 5DUPH 2Y5EA 5DJ2A 1RZ7H 3T2NH 3FMGL 3NN8A 3MNZB 3S35X 4XCNA 4OV6F 2ITCB 1IC5L 4DZ8B 4CNIB 1EXUA 3MJGX 4D0BA 5FYKE 4OFPA 5SX4H 3WXWL 1G7JB 5K9JL 5DJ0A 4BQ6A 1K8IA 1KCLA 4YE4L 3IRPX 1RV6X 3V6FB 1G6VK 1A7PL 3D2UB 4XCYB 3B9KB 1F6AA 1JNLL 4PRNB 2CRYA 3OJMB 4WUUD 3H9SB 5C1MB 1NCWH 3KPRE 1KN4H 3S3PA 1ZLSL 4L4VD 2Q8AH 1E4KA 3LPFA 4R7NB 2VLRE 4JG1H 4XP5L 3UTQB 5DFVC 3HFML 5J6HA 2WNGA 1XH3B 4NUJA 1JYWA 2WMPA 1Z6JT 4YDKH 3SBWC 2YA2A 1V3JA 3H6JA 2NLJA 4PJCE 1OHQA 3IDYB 4MQTB 1Y6NR 1UC6A 4TVPE 5SX5K 5HPOA 3EGSA 3NZ8B 2GUOB 3IDNA 3SGEI 4CDHA 1J0ZA 3ULVL 3CD4A 1UGNA 3I3EA 4I0PB 2AXFA 1HHGA 4I18C 4WUKL 3V4VH 2OP4L 3SDYL 1KB5A 4RZCB 2O61B 12E8H 4FFEX 3FOLA 3WE6B 1MWAB 2W9LA 5I1JH 3OL2A 5I19L 1T3FB 3EYQC 4HXAL 4JDZB 4X7TA 5DEZA 1NDGB 2Z31D 4PREA 1IEHA 3HE7D 4L3EB 1JF5A 5E03A 1R3LA 2XACC 3A6CH 3K0WA 1U8PA 1MI5A 2VO5A 4P5TB 4QTIL 1FN4B 2R4RL 4JRYD 1FH5H 2E9IA 3BPLC 5F7DA 4HWEL 1QP1A 1U58A 2FNBA 3HG1A 2ZUXA 1J10A 3DHMA 3STZA 3CUPA 1MJ8H 4BZ2H 1ODAA 4HSQA 3LH2L 1SYSA 3E3QE 1FCGA 1KPVB 1HEZB 3SE3C 2N7BA 4FMKA 2DJUA 3PQYB 3VFWB 3L3GB 4LLYB 4JQIL 5HHOA 3ARBB 3QUZA 5KSBE 1B0RA 4WNQA 1SEQL 1CQYA 4F7CB 2DQUH 1X5ZA 4R3SB 4I9WD 1AKJD 4KDWA 3MNZA 2VUYA 5L8LB 2HFTA 1OGAE 4K94C 3QNZA 4JZNB 5KVFH 4ONGL 4HT1L 5L2KE 3L3HA 4YAQA 3KYKH 4C56E 4OZHB 1NANI 4QT5B 1LWRA 1MFEL 5FDWB 4Y89A 5JORB 2FHCA 1G7JA 4X6FA 2VWEC 4QXTA 3IRZA 3L95B 1UVQB 1EO7A 4OKDA 5AYUL 4GMSH 4PJIA 1QKZH 2BJML 1W0YT 3CFJA 4PTUA 4OIIL 3VMOA 1MFBH 5IKCA 2Q6WA 5GRYA 3IU3A 5ITFB 4OLZL 5F21B 4XP1H 1B0GA 1GGCL 1SMAA 2ADIA 1WFNA 4Q0XL 5I8EB 3EOTL 1JPST 4LSQH 4M7JH 4HK3N 3UBXB 4U1NB 1FBIH 2EDEA 2Y9RT 1G7IB 4RGMC 2AJ3A 1R5WA 1B4RA 5I16B 4LVEA 5F7HA 2UWEF 3DIFB 4DTGL 5HHOD 1KGCE 1D5XB 4LCYA 1CG9B 1TMCB 3T0EB 1TZIB 2ICWB 1XGYH 4ZXBC 3RZCB 4HC1H 3TO4A 3RVUC 1H3XA 4WW2B 3ULUH 1BZ7B 4APQB 1FRGH 4F9PA 4MA7H 5EBWA 3WLBA 4HIJA 2AJYH 4C4KT 3CDGA 4R6UA 4PJDB 4HUUA 3OAUL 2NX5D 2IGFH 2P48B 5BS0A 4JCLA 4LRNH 3RWJA 1OP5K 2X1XR 2DDQL 1FN4A 5FGRA 1JYVA 4OV5B 1HWHB 4ZTPH 4N1EA 2F58L 5IB2A 1U3HC 5ADOH 3G6DH 4J7RA 3OPZL 3GMOA 4OLEA 2EDRA 1DJSA 1A14L 4WHYH 5IHZA 4JFDE 5HD8C 1QNZH 3P77A 4BQBA 3PQYA 1Y0LA 5DMKB 4JRXB 1UADC 2WV3A 3FQXA 3N0PB 2YD6A 1R3KB 1JIBA 3T8XA 2K9UA 4G80B 1OCWL 4GMTL 4JHWH 2AEQL 1AO7E 3QZWB 4LCWB 3ZE1F 4KPHH 3BEVA 3D3VD 3QDJA 5AEAA 1NMBH 2HFFA 3QYCA 4HIIA 3JTSA 1NMAL 3U9UB 4IS6A 1D9KA 3ESVF 4U6XA 1OF2B 2PR4H 2EDLA 2JCCA 3SKMB 4FQIH 1QHOA 3MGOA 4XNQB 1CFQA 4OZHA 2ADJA 1AGFB 4JRXD 2CLVA 2YA1A 3LVEA 4X6BB 3QO1A 5F7YC 3TA3B 1KIUA 3QDGA 1SJHB 1Q1JH 1SBBA 1M7DA 4S1DD 5DJDA 2NY3B 4H25B 2NY1B 4NO3B 4XGZB 4ELMF 2BVOA 1G1YA 4P23B 4KTEH 1WT5A 2MCPH 3MR9B 3FO1B 1N3NA 2DYPD 1F4YL 2B1HL 1U8KB 3LS4L 3C87A 5HJ3B 1DN0A 5I8EA 4Z7NF 4XPGH 5DHYB 1FAIL 4LF3B 5KJRL 2HVJA 3CLEL 5CGMA 1B90A 5EBLA 2R23A 4MX7A 1CL7L 3BGAA 1F00I 4NC1E 4C55A 4GG8A 2H1PH 5DJZB 3DX6A 4KJPD 4YDVA 4M6AA 4JPIA 5E6YA 1TCRB 2EYSB 4G8EA 5GS0D 1TMCA 1KXVC 1FNFA 4KQ4H 3HE7B 2I9TB 4XVJH 1N64H 5C6WH 4XRCB 1BJ8A 4WW2A 5D7LE 2M8XA 3O2DH 3LD8C 1LK2B 5CWSA 5IOPA 4L8SC 1WWAX 2BSTA 3RBGA 4GG6A 2NTFB 3WLBB 2BNRE 5DWUL 5EU3A 5F1NA 1CQKA 3FFDA 5C0JA 1M05A 5C0AA 1GOFA 3TNNB 1WVZA 2DL9A 5E5UB 4DGYL 3IFNL 4PJEF 3I9GH 4PY7A 2FZ3A 2ICES 3QUXC 4U6YB 3IAGC 5GRVL 2VKXA 1DDHA 2CIIB 2Y06H 4FQ2H 2P8MB 4HKBA 1RFDH 1TJIH 4ODTL 2PNDA 2MNUA 4P2RA 5DR5H 3ARFC 1U6AH 4MHHI 4U1MA 1YDPA 4PGDB 4LLVA 4OD3L 3QO0B 3BRGC 1J05A 3RVTC 2VIRA 2D31A 5JOFB 5HVWA 3VXME 4EOWL 1BWWA 1YPZB 1URLA 2JB5L 4LMQI 4UB0H 3V5KB 3V4VL 3VWKC 2H8PB 4LLUA 3F58H 1AGEB 3BQUC 4NJ9H 2JCCB 4W4OC 2P49B 3K1DA 5BRZA 1CFQB 2LU7A 2FYYA 1OAQH 4PJAE 5E5MA 2YBRB 1C5CL 3R06A 5HPMB 3CFBA 2V5RA 2NY6C 4K8RD 4LLDB 5DJXB 1WCQA 4KVCL 3EUUA 4Y4KD 4Z7VE 4JFPA 5HHXH 1BIIA 1LDPH 3AAZB 4NFDA 1U93A 4N0FA 1MCOL 3GMLB 4XXCC 3VFRB 4OZHF 4HGKC 1LO4H 3VG0L 4BZ2L 3DMMD 3MOBH 4LSSL 4UBDC 5GGVY 3FL7A 1HYRC 4PGJA 3TEUA 3SJVD 3BUTA 3O3DB 3CXHJ 2DLTA 3U1SL 5M94B 4KJYA 5CEZL 3VWJC 5DJCA 3UZQA 4DKFL 4NBZB 1L9NA 3GSOA 4YDVB 2R29H 1FV1A 3DMMB 3KHOA 2GT9A 2Z92A 1DEDA 2B39A 3TVMD 1BJMA 2I9TA 5FO7A 1Q0XL 3U9PH 3ZT7A 4F37F 2VDNH 1ND0A 1T2QH 1PEWA 1LK2A 5CWSB 1WFUA 3P0GB 3GSQB 3NGBC 3QEUA 2QL1A 3P9WB 1BBDL 1NC4B 2J8UB 4M6NL 4IBLT 4OBRA 3OB0K 3QUMH 4HLZG 4U1JB 2CDGA 3L6FB 4H0GA 1BOGA 4GRLC 5DS8B 4PLNC 2PKDA 3DYMA 3RA7L 3IKCA 1I1FA 1OY3B 2V5SA 3KYMA 1J0JA 3H9SD 2OZ4L 3T0WA 2R2CA 3NFSL 5L7XL 1DLFL 4EBQL 1A1NB 1DDHB 4LPWA 3S98A 3QWQB 2X4RA 5IVXB 2PO6A 4Q9RL 5ADPH 5C71A 2V7NA 1G9NC 2Y4SA 4YHZL 4HV8B 3DO3A 4PLKC 4OI8A 3PWJB 3QDGE 4X4YB 2AXGA 3MJ8B 4AG4L 2F53A 3HUJF 2G5RA 2BOCB 1I7ZA 4F57H 1FVEA 4PG2A 1BQHB 1CDHA 4UTAH 4PB0L 2IBBA 1J1XH 4N0RA 5DT1H 1TNMA 5B8CA 4K3EH 3PP4H 4PG2C 4M1GL 3VA6A 4DWHA 4YH6A 4W6WB 3G9AB 3SO3B 1XF3A 1H5BB 1OAXL 4PRPD 5LGJB 1J88A 3E6FB 1JWMA 1U8NB 3OR6B 1JRHI 2C1PB 2AJYL 3X14A 43C9B 2YBRA 4LPTA 5EIIA 5IMLA 4O2CB 3DSFL 3RL1A 3S5LB 3PGFL 4PJIF 2KKQA 5C70A 1MRDH 4LLDA 4K3GA 3GJEB 4UDTA 5F88B 4PRIB 1QRNE 3VDCA 3NFPB 3L3JA 1MCFA 4Z7UE 4HC1A 4MMZC 3QB7C 3O3AA 5E7FA 2YPLD 4MAYB 1B0WA 5HYSA 4N8CL 3E3QA 3BZ4B 4OZGA 3QUZC 4PLOB 1HSBB 5LG1A 2HVKB 2VLLB 4F33B 4XCEB 1U8LB 1QYGH 3RKDD 2R15A 4YBLC 4OLYH 3S36X 1LMKA 1U92A 4GKOA 32C2B 3WNLA 4Z7NE 5IP4A 3MX0A 1J1OL 1JMXA 1BLNA 5SWZD 3ZSTA 4JRYB 5JOPE 1WBYA 5KSBB 4PJXB 3VXMB 1IGCH 4LLAA 4C83B 1L0QA 1GCFA 5E5RB 4JDVB 4JQXA 3ME0A 1UZ6F 3QULA 3L1OL 1ZANL 4AM0A 1J8KA 5D1QC 4IMKA 4M93B 3VD7A 4P23D 1F3JB 4M5ZL 3BUYB 5LAXB 5I8CA 4HGWA 1LHZA 1I1AD 3LB6D 1WTGT 4AENB 2YN5A 5IB3B 2E3VA 4L8CB 1F97A 4ZTPL 4MYWB 4PGEB 2J8UA 3Q2CA 4J3VA 1D5BB 1QSVA 3SDAA 4KJQD 5MEND 2ZJSH 4H5SA 1T0MB 3BKYH 3VGAB 4RMRA 3W81A 3L6FA 1S5HA 4CVWA 5AWNH 1W72A 1AHWB 5CLWA 3MRDA 1YY9C 4OZFG 3L5WA 4Q0XH 4WFED 4OZ4A 3QJHB 3HI5H 4XCNB 2CDEB 3E0GA 4GS7C 4JANB 3CFDA 1NMAH 3CLEH 1MRFL 2V7NB 4U6HB 4G6ML 4M4PA 3U82B 4EVNB 3QR2A 3QDME 3KYOB 5GRZA 4TSAL 2GITB 4ZD3L 2GKIA 5KSUB 2L7JA 4JQVA 4JHAH 1PG7H 5DXWA 1SJEA 3GJFA 3F7YA 3LMJH 4PRNA 4E9LA 1VERA 3H9SA 3EDDA 1VFUA 1KF9B 2JKXA 2PXYC 5EU7C 3DOSA 1YN7A 3DX7A 3VXUE 4PDCE 3GHBL 4HUXB 2OR9L 4C54A 3IFLH 43C9A 5F3HB 2AK4E 5JUEH 1E6OL 1IEAB 4LSUL 3BESR 3VFPA 3IDIA 4OZGF 3GJEA 3LS4H 5INDA 3SCMA 1FL3B 3C60D 5IW1A 4WUKH 1KCVL 2BZDA 3I9GL 5I74C 3WIIH 3P4LA 4KK5D 5CEXB 1ZS8A 5SWQB 1A6WH 4J3OC 1UJ3B 2YMXL 3P9LB 4N68A 3ECBA 1F8TL 1S7RB 4MDJA 2CPCA 3S97C 4P59H 4MQXD 4Q2ZA 2GTZA 2YZ1A 1FNGB 1KB5B 3A0OA 4RZCA 4X6DB 1N64L 4MNGE 4PTTB 4Y4HC 2X40A 1BAFH 1MLBB 2C3HA 4JHWL 4JRYA 2B5IC 4FQ1L 4PJXA 4X98A 3RL2B 2GW5A 1U8IB 4LVHB 4WFEE 4P2YA 3DWTA 3SEPA 4QRRA 5GS1B 3SKNB 3KXFA 4S2SB 5LXGH 4K94L 1HHKB 4OF3A 1JUFA 5EULV 4JM2D 4LCCC 2WINB 4L8CA 1OAQL 2YOCA 4YX2H 3B9EA 3BW9A 1LP9A 4IDLA 5B4MD 4HKZB 3FO9A 1HNFA 1NGWB 4L9LB 1CF8L 3ROLB 1J18A 4NC1C 4Z7UB 2RFXA 3CU7A 4TSCL 4S1QL 3TNMA 5L6YH 1MHCB 1DE4B 3AS0A 4UV7H 2X4TB 3RUGA 4W70A 2QR0A 4DGIL 2DIJA 3CGTA 4YHNA 5EZJA 3QRGL 1VCAA 1AHWA 4Y4KC 1ZXQA 1VADB 4OFDA 2KQMA 1K3ZA 2R0KH 2X4QA 4IRZL 5DJYA 3KYAA 1RHFA 1CL7H 3F58L 4ZSOE 1JTTA 4WUUE 2BFVH 3V95A 3FT3B 3SKOA 1CD0A 5HBBA 4ZTOH 3ULUC 1RUKH 1A6TB 1Z3GH 2FLBT 4CN6A 1FH5L 3EOTH 4M7JL 2W9EL 2BDNL 1CGUA 2PCPA 1CLYH 4XX1G 3NMEA 5DHVH 5IBUB 1FE8L 3IDUA 4OUUB 4X6EA 1RMFL 2O26U 4P2QE 3NA4A 1EH9A 3VFOB 1WCBB 4LGSB 5IGXL 5EU6D 5L88H 4ODVH 1FO0B 1JP5A 2W9DH 5F3HA 4DGYH 3F7RA 2FX9L 3X17A 2X9WA 3WEXA 3O8XA 3I02B 3LKOB 5CEXA 3EFDL 3I6KA 1X5FA 4DGVH 1Q9WB 5D9SB 1N5YH 2MQ3A 2ITDA 3IB4A 4ONOA 1UWXK 4PPTA 2NY4C 4OLUL 5TDPB 3ECBB 1Z2KA 4ODTH 4X7SH 4CVXB 4HT1H 3BPNB 3ZKMC 3GSVB 1A22B 2RBLA 4Z7WE 3ZKNC 3C09B 2GYSA 5DC4B 2IC2A 2J8HA 3QPXH 1FNGA 2WY3A 2HG5B 4HJ0C 3MRQB 1MLBA 1NLBH 3K8MA 4HWNA 5DVOA 5FA3A 4FQJH 1OP9A 1LO3L 2BSSB 3ARTA 5F1SA 5EIQA 1MHPL 5FYJL 2L0DA 3GUTB 5IVZA 2XWTB 4QRTB 4HEPG 3IXTA 5DT1L 1P6FA 3WJJC 4X9GA 1FP5A 3CDYA 1N7MH 1KPUA 4HG4J 1H0DB 5I30H 3OKNA 2PYED 1GGCH 1QSZA 4U1HB 2G9HA 2KQNA 1CE1L 4L4JA 4KMLB 5H2BB 4PB9L 3D3VA 4FZEH 1VB9A 1LO2H 2VB5A 1GGTA 2K7QA 3LIZH 2C9AA 4XNUH 1S5IH 3WCYA 1DE4A 4M9PA 1CYGA 2KZ1B 1BOYA 3QDMA 1O0VA 4LCWA 5EORL 1VFAA 1IFHL 4OCRL 4LCUB 3QXDB 2PXYD 3LS5L 4L1DA 3SKMA 1HHIA 3ESUF 4JPKH 2VE6B 1T5XA 1T04B 3F6LA 3GMMB 4WDIB 3QHFH 2VDPL 4L8DB 4XAKD 5GZNC 1CLCA 4MNQA 5F9WC 4J3UA 3PHQA 1ZGLA 3K8LA 1Q0XH 4PJCA 3VXNB 3H0TA 2ARWA 4R97C 1U3JA 2CRMA 3U4BL 3E1F1 5CKAA 1XF5B 3EYFA 5JW4Q 3NTCL 1ETZA 4PR5B 2HWZL 1T03H 1X5YA 1RZIB 1U8KA 2EE9A 1QLFA 1R5VB 4L3CA 4HUWA 1I8KB 4TTDC 3WEXB 1JWSA 4WW1B 3WLWD 2AABH 5LGHH 5KS9F 4AQOA 3DX8B 4ODXA 4KJQC 4TUKL 4Z7OE 4I0CC 5D9SA 3QNXB 1KTLA 4U2YA 4WU5B 5E56A 4EBQH 3VW3H 4G8EB 1NAML 5BQ7B 3RDTC 3KPLA 4Z78A 1ACZA 4FQXA 5C0BB 1GAFH 4OF5A 4FFVD 1ZHLB 4PJAB 3DXAB 3EKCA 4JG0H 2F5BH 4KDTC 4LQFH 4H88L 2MTPA 3OXSA 4JY4B 3QEGH 3P4MB 3GI9H 3OBAA 3PWNA 5I0ZA 3O11B 1JZ7A 4UT6H 5DD0L 4D8PB 1ZT7A 5C0JB 2OXHA 1X6LA 2HT3C 4HPYL 4Z7VA 1YEHH 3WKNA 4X4MA 4PGZA 4H20L 1C5BL 4JO3H 3SDXA 4YGVA 5C08E 3ARVA 2BY3A 5C07E 4OD3H 1TFHA 4XAWH 3OKMB 4JREC 1S7QB 2NR6D 3DSFH 4PJ8B 1GGIH 3ARGA 4NM4L 2CIKB 3K1KC 2GAZB 2ORBH 1FVCB 4O51A 4OTXL 4ZDHB 3DGGB 4ORGA 2Q86B 1F4WH 3QXTA 2BNUB 5CIPB 1GC1H 1AO7D 3CSPA 3UJJL 5C6PB 5JA9A 1TVBB 4MAYD 3FT2A 4G6MH 1QD0A 4ZUSB 3MRGA 3I75A 4WJ5A 1TNNA 1MIMH 5I1KH 4H8WH 4PJ8D 4ZD3H 5HYSG 2BVQB 3FN9A 2ZSWB 1K6QL 4PJ5A 3VJ6B 2PYFA 1N59B 5CGTA 3QAZC 1FL5A 5C86A 1K4DA 1IGCL 3P2TA 4U7SA 3R1GL 5KVGL 3GGWB 2VL5B 4KRMB 4XBGA 4HLZH 2BSED 3QXVA 4OIAA 3PABA 1DR9A 3LDBC 3HAEA 4ZS7H 5T3XH 3NCYS 3FQRB 5GGSA 5CEZH 2CK0L 5ICZB 3SN6N 2HRPH 2YWYA 1RZJC 3MZGB 4NC2B 1A6WL 5I15L 2EH8L 3MRBB 4K3JH 2QQNL 4JM4L 1D7FA 5DI8A 2X4UA 4F7TB 1I8KA 4ERSH 2HA1A 1K9TA 1JF6A 1YEJH 5DD5L 2AJZB 5J11B 3SDAC 5C8JB 1BREA 5IVOA 3FONB 4EI5B 4GW5B 1QTYT 4UINH 5BO1L 2BRRL 2BVEA 3ROOB 1SY6H 4ZOCA 4EN3B 2EE2A 5BJTB 2ED9A 1JGVH 1C5CH 1IZJA 3RIAF 4KUZH 3RI5F 3ARDB 1OGTA 3TH4T 2MWCA 3HE6B 3AY4C 1MVFA 5TQ2H 5FYLL 3V79C 1FVDB 4E5XA 3MC0A 1MEXH 4P57B 4NRYB 2M26A 1P1ZB 3AU1A 5DS8A 2OR9H 1FNSL 2OK0L 3IKCB 3QCTH 5BV7H 4S1QH 1LE9A 4JO2L 3KPSD 4RAVB 5C6TH 3SOBL 3H9HB 1NCAH 1NGZB 4ODVL 5A16B 1QBAA 1FVCA 1J1XL 1CU4L 2XTJC 4TOYH 5J13B 2IPUG 4MSWA 5L8KB 4YC2B 1RZ8B 1PKOA 3CVIH 3IAQA 3JWDC 2VXQL 4U1GB 3HN3A 4MWFB 4PRPA 1EMTH 5I1DB 3SCMC 1DL7H 4JO4H 3UTTB 2I27N 2MPAL 5J1AA 3D18B 4P59L 3RWHB 1TJHH 4NQVB 3BP6A 1JE6A 4GSDL 4X9HA 1FGVL 4FXKB 5B8CB 4PJ5B 3VJ6A 1N59A 2Y7QB 3ZKND 1HXYB 4UQ2A 4XHJD 4GOSA 4YHIA 3FB7B 1C7TA 5D1XC 5A2IH 3GGWA 2R69L 2E8YA 5IBLC 4QNPE 4YWGH 3C6LA 1CDIA 1U3ZA 3QFDA 5I6XC 5FUCC 3RA7H 5JIPA 4UQ3B 4GKZA 1F4XH 5KN5B 2Q20A 4KK6C 1HILA 2VR5A 3M45A 3HB3C 1I3GL 4F7MA 5CZKA 4PJHB 5FB8B 1FL6B 4OLUH 3Q0HA 1JI1A 1T83A 4QRPD 7FABH 1U92B 1GHFH 1U91B 3QIUC 1XF1A 4CADB 3MV11 1HKFA 1S5IL 1F90L 1HOCA 5JA8B 1QOKA 4PJGF 4CW1A 4FS0A 4JQVC 3QRFM 2BXZA 4IOFC 2I5YH 1LGVA 4HWBL 5IR1A 5FA4B 4Q9QL 4O2EB 1NGYB 1AGBA 4QCIA 1ZTXL 3BKML 4FQXC 4HGWB 4HS3A 2O5ZH 3VWJD 2Y25A 4OF8A 4Z7QF 3ARDA 4JHZA 4YBQC 2VITA 3P73B 4UOJA 1RUKL 2ZG1A 1JJUA 3M8OH 3VFUB 3IGAA 3D39D 3C08L 2BDNH 4WGVB 3LV3A 4MNQD 4Q6YA 4EDXA 1KJVB 5DJAB 2ESVD 3ARFB 3EJJX 4XP4L 1X5XA 4NRXB 2JK5A 2Y07H 2FATL 3C5ZC 4WO4D 3VGAC 3IJHB 3VRLF 3BHBB 4EXKA 2FX9H 5DUMH 2AJSL 5LQBH 3MBED 3H3PL 2VSDA 4HQQH 4QF1A 3V0AC 2DQTH 3BT2L 2PYEE 3BI9X 4LLMA 3CMOL 1RZ8A 2DQCH 3QQ3A 2NNAB 1PFCA 4D0CA 1S9XA 1V7NL 4S1SH 1S7XA 1TZHB 2V2XB 3IDGB 1B9ZA 4NYLA 4WHTA 4UIMA 2CH8A 3PL6D 4NQTA 3G5YA 4KAQL 1CVSC 1IKNC 1P2CB 2OJEA 2BX5A 4PJBA 3TJEH 3SQOH 5IJVA 1CXHA 4OZFA 3UP1A 2Z91B 1ZLVH 3SDAD 5MENA 1I9JH 5EZOL 4MJ5B 3DLQR 4KUCF 1KTKE 5FHBL 1NUNB 2VLJB 3EYOA 2G60L 4XNYH 4LHUB 1BEYH 1F4HA 3SE4C 5I30L 3S3SA 4OBSA 1BHGA 4AY0A 3MLXL 5H94A 1HCFX 1OAKL 2Z8RA 4F7PB 2WP3T 3HI5L 4NM4H 3WFEH 3ZE2E 4MDJB 1DBBL 3PDGA 3QHTC 5FB8A 5J0BA 4MB5A 1L4IA 3MRKA 5LGKA 1KG0B 3BKJL 1WFOA 5TDOA 4CN1A 2EDWA 3FFCE 3AM8C 4CL7A 3IVKB 3PWLA 5JXAH 3V0VB 5EORH 3QEGL 3GI9L 4PJEA 5TF0A 3ZYIA 2XTLA 1OQOA 4ZAKB 5F9WB 4MJ6A 1NGQH 2QQKL 1UA6L 2ZUQC 1WIUA 4HZLA 2VDPH 3RWFA 2H6PA 4QHLA 3R1GH 1H9VA 2N4IA 2AKRB 1YECL 2IH3B 1FIGL 2ICEB 5DMIL 3BGMA 4ODUA 4XZUA 3TBYA 3VFUA 3LZFH 3QI9D 4HJGA 3B2UC 3CH1A 5EWIH 1K8DB 3TJHA 3NAAL 2JK5B 1V3MA 3RUGB 1OWWA 1ZK9A 2IPUK 1BZQK 2A6IA 4IRSC 4M62L 4RISL 1L0XA 4OZFH 1G6RB 1VADA 3F12A 1YMHA 4G6FB 2IQAB 4D94A 3KJ6H 1PY4A 3VGHA 3LB6C 1L7IH 1CZ8L 3WFDL 2W9EH 2FEEL 3BD5A 1U8QB 3WXWH 4KUCD 3MLTB 4WI8A 4PJBF 2XFXB 4JZJB 5BXFB 5EO0A 4R90H 3NABH 2A73A 3OKEB 5E2UL 5MP6L 2D4DA 1PG7W 1MVUB 1S7XB 1OAYL 2FD6L 4NCC1 5BVJA 2PW2B 1IC4L 1Q38A 3FB8B 4NBXB 3TBVA 1NCWL 1N8ZB 3PDOA 3CXDH 2ESVE 1O5DT 1PKQE 2OJEB 2F19H 4YHKL 1P7QA 1XGPB 3GIZL 3MGTA 5MENB 2CXGA 2J2ZA 3OAZH 5DDHA 2CLRA 3T65B 3MLVL 1DBML 5EN2B 5IEHB 5BV7C 2VXSH 1JF1B 3IS1X 1I4FA 4XCFL 3T2PA 3BMWA 3BPCB 3EYOB 5F89A 5HHQB 2VDQL 1ONQB 3BISA 4JFXA 2XNAB 4M5YL 2Y6SD 2JE8A 2B1AH 1L0YA 3F7VA 3CPLB 2XWJA 3MV01 1T20A 1DQML 5GS0L 1GSMA 2DQHH 1V05A 5KSAA 4HD9A 4KK6D 4I3RL 3FRPA 4RA3A 4JKPL 3PWPA 2VQ1B 4JFFB 4FQPA 1JHLL 4J2XA 2GSGB 2BVUA 5LWYL 3JVGC 1LQVA 1MCDA 4KI5F 2F15A 2A1WL 4O9HL 1MREL 1XCQA 1JGVL 1PZ5B 4CKVX 1QFUL 4FFWD 1ULVA 4MQSB 3JTTB 4K7FA 3ZKXC 3ARWA 4M02A 4L8SB 3O4LA 1PW3A 4NFCA 4ZS6C 2CJUL 2HYMA 4G8FA 5E94B 1D5MA 1A6AA 4PB9H 3BRFA 1FZKA 1UH2A 3IKKA 4UDUA 4XT1C 3OR7B 4DJMA 1FE8H 3SDDC 1T1YA 4PJGA 4BELD 4P2OB 2R9HC 5EOCJ 5TPWH 1UM5L 4KKBC 3EO9H 3GSXB 3ZT6A 4U1HA 2QBWA 4JRYE 1FNSH 2OK0H 5ESVA 1G9NL 5BV7L 3VXQB 1YUHA 4DZBB 3LEXA 4U33A 4Y2DA 3UJIL 2YD2A 3OKOB 3EFDH 5KOMC 3FHAA 1CDYA 3MLUL 1PBYA 5TH2B 3DO7A 3LS5H 1UYWH 3KPTA 4GW1A 2UWEA 2FBOJ 1QBMH 2UVFA 4TOYL 1A3QA 3R0NA 4NO0D 2P5WB 3EDKA 1RZJL 3BH8A 3WXVL 1BMGA 5IFJA 1N6UA 3QFJD 3RU8H 3GK8L 4ODWA 4EIZC 5JLZB 1JPTH 2JJTC 4QXGH 1YC7A 1E28B 4GSDH 2FCBA 1DUZA 5IQ9B 3NIGE 3OGCA 1AP2B 5FGCE 1T5XB 4ZFOA 3NCMA 4CDGC 3IDMB 4O2FA 1WZMA 1JVKA 3DI3B 3MYZA 1PKQA 4D2NA 1R0AH 2Z8SA 3AY4A 2EC9T 1HCVA 4GKNA 1NFDE 3TJHC 3MV7E 4P2QD 1H3PL 4JN2B 5IB4B 1ZTXH 2APVA 4HFWB 3PDOB 5DVMA 4L4VE 4P3DB 1N5AB 1MLCB 2DQGH 2EDDA 3MGTB 4WV1C 1GZPA 5GQBA 4OQ1A 1ETZB 4DN4L 2BMKB 2P5ED 1HINH 1WT5C 4IOIA 1LEGB 3C8KA 1QLFB 1JGUL 5E8PB 4WW1A 1P53A 1D6VH 4Y4FB 4OGXL 5JR1L 5T5FL 3E2HA 3BDYL 5J7CC 1E0OB 1P9MA 3VGDA 3ILPA 4AIZB 3VDBA 4BM7A 4Y1AB 5I73C 3QNXA 1RZFH 5KSAB 3HG1D 2ZCHL 4W4NA 5GS2H 2YPLA 1PYWB 2A2QT 3LKSA 4HK0B 5C0BA 5BZDB 1CICB 4OZIB 3VXTB 1B6UA 1MCQA 1PZ5A 3KNBA 3QIWB 3OAUH 2YD3A 4S1SL 1K4CA 1JV5A 4LLQA 2UZXB 1CFTA 2P7TA 4N1HB 3UTTD 3H9ZA 4JZOA 2FJHB 2K3TA 3CK0L 2VQTA 3KLHC 1BGXH 3PL6C 2F58H 3BH9A 2HWZH 5GISH 3RWEA 2CGRL 3BDXA 3UROR 3TBTB 1ZHNB 3WS6C 4IJ3B 3RX8A 2WBKA 2Q8BH 1A9EB 2BHZA 3KPNB 3EFFA 5TH2A 3DO7B 3H3PH 3O9WB 4ONHB 3REVB 3MLXH 3RQ3A 3UZEA 2HRLA 3LKQB 4PRHE 1ZVHA 1IT9L 3I75B 5GIRB 2BVPB 3TYGH 5ESQA 4DW2L 3D0LA 4J1UA 2OR7A 3D48R 4E41B 4WO4B 2QKIA 4S0SD 2YWZA 5DK0B 3WFBH 3ZYZA 5K59F 2WBJD 1K4DB 4DAGH 4XNZB 1MCHA 4LARL 2XA8H 3IDMA 4O2FB 4A6YB 3D69A 3FMGH 1I9JL 5EZOH 5K9OA 4K3JL 2LAGB 4MD5A 5FYLE 5CD5C 2CUHA 1Z5LA 1BQSA 2XWBB 3LOWA 1KEML 4MD0B 1MFBL 4AL8L 2VAAA 2APXA 3HAEB 1IAOB 4GUPB 4QGYA 2SEBB 3QPQD 5DD5H 5GGSB 4X7FC 5CMAB 1N6QL 1YEIH 2R8SL 1MLCA 3M8OL 1EX0A 4U0RB 4LSQL 2NY4B 2E8ZA 1W72H 1RJYA 3MV8B 2JJUA 3O41B 1A6ZB 1GJIA 4MS8D 3MJ7B 4KVNL 3SY0B 3NN8B 1SJVA 4HXAH 4HIEB 5T1MA 1TQBB 2AJZA 5E2TH 2DWEA 3QQ9C 3SDXF 1VESA 4HWZB 4YHOL 5IV2A 5AYQA 1X5JA 4NQSA 4HQQL 5DZNA 1U42A 5EUKB 3L3IA 3TWCH 3F7PC 2O93L 3ABZA 4HGMA 2ADFH 1QQDA 4HK0A 4JJ5B 2EIZB 3B9KA 5HGAA 1XCTA 1MJJB 1FFOA 3RHWF 3RY5A 3CNKA 5C92A 2JJSA 5MENE 3GIVB 4TUOA 5D2LE 3HE6C 2APWA 4FA8A 2OI9B 4NJAL 3HZMA 1U95A 2BY2A 4NNPH 4KQ3L 4W68A 1CIDA 1LQSR 3G6DL 3T0DA 3T2NL 3MACH 1CTNA 1NCDH 3KPMA 3QUXD 1B3JA 4GRLB 4QOKB 5E7BA 3VXSD 1ZVSA 4PJ5D 3PL6B 4RAVA 4R4NC 4LKCA 5HHMB 5DO2C 3UTZA 3OXRA 4J3TA 4ELKA 5IMMB 4YPGA 3X3FL 5FFLA 3GBMH 4E0RB 5I8KL 1S3KL 5IB5A 1HHGB 5EB9A 4OF7A 4RWHA 5B3JF 4HPOH 1NCCH 1WWWX 3MUGA 2ESVA 4YBHA 3O2DA 1CLOH 5F1KC 4NJ9L 3VH8A 1E27B 4HKXA 3OG6B 4RIRB 2Y7QA 5E2WL 4QXWA 2DBLL 2XQYK 3QUKB 5T3XD 3ZDZF 1QRND 1QFUH 1F4XL 5HXMA 5IHUL 3BO8A 1T1XA 3PF2A 2FDBP 2NQCA 2IAMB 5CGYC 2FHBA 4ODSL 5IQ7L 1CBVL 2H2PC 3STZB 4PG9A 4OD1H 2V5MA 3MLVH 2VYRE 1HQ4B 2CMRL 1S7UA 3Q1SH 3QFDB 1GHFL 3OF6D 1KIQB 3WDJA 3RNKA 2N7AA 4JM2B 2KPNA 2IFFH 4S10A 1RUAL 4XWGL 4ZFZB 4RMUA 2P45B 1J87A 4XXDB 4JO1L 3HC4H 5E99L 1KENL 4NQED 4MA1C 4ZO7A 3O41A 4C56A 4Q9QH 1CDUA 2CUIA 4MD4B 2V2WA 1UACL 3U1SH 3RJDA 5LWYH 3V7MA 2CXKA 3V5HB 3STLB 4LAJH 3JUZA 2C7UA 3T1FA 1LNUB 3A6CL 2GFBB 4MXVF 2AGJL 3KS0H 1NFIB 5C2BL 4YO0B 3L95A 1FBIL 2RJMA 2DMBA 5EO9A 4X5XB 4MCYA 3DX9B 5IESH 1XCTB 4V3DB 4R8WL 1C5DA 4XWOC 3CFJB 3OZ9H 4LCCB 3HG1E 1CFSA 2CDFB 5FCUL 4OGYL 2A6KB 2AJSH 3RVXD 3QEQB 1DEEB 2GIYA 3HZMB 1KIPB 3T0AA 1I1AC 3FTGA 3KPQB 2WBJB 2W65B 4KRPB 1XIWA 2VJXA 3RGHA 2AEIT 4U1NA 5DQJB 4AEIH 3N1PC 5FUZL 1MFCH 4GRLD 4QOKD 4PJ7A 2DS4A 1NUDA 5HDQH 1QFHA 4X9IA 4GG6F 4FQIL 1UKQA 1PVHA 4QF1B 2G2RB 2ICWA 3JVGA 4M48H 1KXQE 1PZUB 3SJVE 4OJFL 5D1XD 1DANU 1OLZA 4P46C 1JNJA 3MQIA 3LKRA 4EUPB 3RNQB 2FB4H 1TZHA 2Q87A 3RZWA 2P5WE 4D0DB 3VWJA 2CKBH 1K3IA 4Y0GA 4HUVA 4RIRA 1T1ZA 3U83A 2VZOA 1KNOB 1KJMA 3JWDL 2VLRA 1WICA 4EDWL 2YSSB 3B8SA 2CKBA 4R4FL 4XP4H 1DBBH 3RAJL 1MH5A 4R96A 4FTVD 3CCHB 2DM3A 4OB5H 4Z5RA 2H1PL 3U30C 3V5DB 5JR1H 3TFKA 1DUYA 5L9DL 4GAJH 5EOTB 4YR6B 4LHUD 4TUJA 5MEQA 4FQHB 4N8VB 1ZKAA 1S8DA 4PS4H 3TT3H 3EDJA 1RHHB 1Q9OB 2OXGA 1QVOA 2DI7A 5ENWA 1VHPA 2F54E 4AEHL 5FOBA 5GGRY 1T5WB 3STLA 4A6YL 1TLKA 2X10A 1X5GA 5FECA 1CD1B 1UB6B 4NQCE 4DW2H 1U8OB 5DQ9A 4KAQH 3QDAA 3WN5B 1AO7B 1QRNA 2WUBL 1M4KA 1KFAH 4AJ0A 2YUWA 2NXZC 4MQXC 1Q8MA 1S7SA 4GRMA 3D85A 3G6AB 1FLRL 4H25A 1E6JH 1WBZB 2VDKH 3V52H 4YFEA 2X6MA 3GMQB 4LPCA 5TQ0L 3PUCA 1SHMA 1RFDL 1TJIL 4LP4A 5DC9B 2BVOB 2QEJA 5DURD 2WK2A 1N3NB 1OT2A 3OAYK 4HJGB 3TO4D 3CC5B 4DK6A 1AXTL 3MOAL 2AEQH 4L4VB 1SEBA 3GMPB 2W65A 1KEGH 4DUXA 4Q9BA 5A2FA 4ODBD 2KL6A 3RTQB 5EU4B 3H9YA 4XMKH 5DRNB 2IQAA 1TPXC 4POZD 2AJVL 4CJ0A 4O4YH 4U1SB 1AR1D 4AZ8A 4RCAA 3RY6C 1BFTA 1TZGL 5AD0A 4U1LB 4NN5B 3L9RB 1YEGH 4F58L 4DK3A 4TSAH 3EDFA 4EQ2A 2A73B 4WTZA 2X9YA 4HULB 3LMJL 4UU9A 1MVUA 1UA6H 5EU3B 5F1NB 5DRZB 2NX5E 4L1HA 3T3PF 4H1LB 1YYLH 2FGZA 4JQXC 2JB6A 3MNVB 5F9OL 2IALA 2B1AL 1J0KA 4PRPE 3LQAH 5DMIH 4Y88A 2X7LA 4TPRL 2R0ZH 5FXCH 4Y5XC 5F96H 3S3JA 1KULA 1E6OH 3BXNB 5I1EH 4PJ9C 4U4BA 1PQZA 5IB1B 3C5SA 3DROB 2J4WH 2PW1B 5EC1B 1D9KD 4I2XA 5HYQA 2EDQA 2XN9D 3DVNB 4EUPH 2D0FA 2G5BA 1BJ1H 1ZAGA 4XP9L 3T0XA 4OZGE 2VXUL 2W1NA 4QHNB 3F7VB 1NFDF 5IHLB 2V5YA 1QYGL 2ZCLL 4LLVB 3P3YA 5EOTA 5D5ME 1CT8B 3CZJA 3ULUE 2D31B 4Q74A 3FZUC 4MDIA 3C5ZD 1I7TB 1P69B 4JFFA 3ZTJG 1NJ9A 4QHUB 1SY6A 5SWZE 3GNMH 5IJKA 1DFBL 4Q6IA 5KVEH 4OCYH 5ELIA 1KLFA 5CHNA 3F7QA 3U6RB 1FZJA 1T66C 2YPKA 5BRZB 2NY0D 1CGXA 4RFOH 3TZVD 1M7IA 1A1MA 4XNXL 3K2UL 5CP3H 4HH8A 5C0AE 3H3BC 3LQAC 4JPWL 2X41A 4P9HL 5IF0A 3REWB 2E7HA 5HGBA 5JQHC 1AD0B 1AFVL 3M17B 2DJSA 5EC2B 1NC2D 1DBJH 1RJLB 1FDLL 3HNTH 2DL2A 4NN7C 1TCMA 5IFAL 4Y2DB 4OKVA 4CNIA 4JFOA 5L6YL 5EO1A 3OKKA 3QG6B 3QRGH 3UCRA 4OM1H 1EK3A 2I07A 2XY1A 2OJZH 1T0NB 2Q8AL 5DRNA 3CDFA 1ZWIA 4GRWF 2Z35A 5CJOH 5EBMA 6CGTA 1QSFE 4WEUD 4GFTB 3SPVB 3GMRA 1DUZB 4CUCA 5FIEA 5FO7B 3TV3H 3BP7B 1ZA6B 4W4OA 3UTQA 4PJHF 4LNRA 5C0BE 1PKQB 5DK3A 2BNQA 4OGAC 1F6LL 4YHMH 3T0VA 2D03L 3M07A 1TETH 4RFNB 5ABDE 1KCSH 5ID1A 2BRQA 4QRRD 4XI5D 4LLWB 2IALB 2X89D 2ERJC 4R8WH 5HY9B 1R6VA 4MA1B 3TCLB 4TRPH 2R2HA 4S11A 4KKNA 4D9LH 3JTCA 1JPGA 5H8DA 1IMHC 2R56H 1JZ2A 1A7QL 3G04B 1A4KA 5I19H 1WWBX 1XGQA 3AM8A 4HFUL 2ICWI 4P3CH 4I2XB 4OIBA 4ZG1A 1OAXH 2GJ6E 4Y4FA 3FOLB 1R24A 1EXUB 3I6LD 4K71B 1KN2L 3S88L 2OX5A 4G42A 4X8JA 2FX7H 1QR4A 1R3LB 1EEQA 4I9WE 3ZMRA 1N2RB 4EEEA 1K8IB 1NFDA 2VDNL 4IIQB 4XBPB 3BKCH 4JFDA 5J89A 3MYJB 4KJPC 3GI8H 3IDXL 1Y18A 5CILH 4OFKA 4HPOL 1YMMD 1NCCL 3BRDA 5F7DB 5JNYB 3F62A 3NIGF 5LGJA 2VDOL 4M3KB 5E8EA 5I0DA 2NPLX 1V5JA 2W0KA 3OZ9L 3TN0B 3ZDXF 3HR6A 3WMSA 3BQUD 4DVRL 4Z95L 1D6EB 3L3GA 2DM7A 3T4YA 4FFWC 1S7TA 2C4FU 3B9VA 5IW6A 3VXPB 2F8VA 1IGIH 5T3ZL 1KCUH 4WWID 3KYNB 4QTHB 3TVMA 1ZA3B 2F5AL 3QNZB 4R7DA 4KI5D 1T21A 2LQRA 2QJDA 2AXFB 1SYVA 3N1MC 3T77B 1X5HA 3KVQA 1JPFB 1MAJA 4GMSL 4GRWB 5FYJE 4XPAL 3V2AR 2O61A 1QSFA 1SVZA 2B7DT