2Q7YA

Structure of the endogenous inkt cell ligand igb3 bound to mcd1d
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Mouse CD1d-iGb3 Complex and its Cognate Valpha14 T Cell Receptor Suggest a Model for Dual Recognition of Foreign and Self Glycolipids.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
total genus 70
structure length 269
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q7yA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2q7yA01
3HAEB 4ONGL 4I48B 5I16A 3TN0A 4HKBA 4M48H 1F58H 1J0ZA 1W72L 1QHOA 3HMXA 1OQXA 3KPNA 3SDDA 1FYTE 4XWOC 5LGJB 5FF6B 2A9ML 5B4MD 1LEIA 3MODL 1QLFB 5HVGB 3VI3E 2GFBB 3PF2A 2VYRE 1TVHB 3KPPA 1T3FB 5C2UB 3VGDA 4HS3B 1DJSA 2EDLA 2ESVD 2CK2A 4CAGA 4OF6A 1WBZB 5GJSH 1A7PH 3GJFK 4P9ML 1ZLUK 2EH7L 1AR1D 4X5XA 3L3HA 4DTGL 2HVKB 4LSQH 2IGFH 4PGCB 4WTZA 4HIJB 1FZKB 3MR9B 4UV4L 4WNQA 4NO0B 5F44A 2EDJA 4ZAKC 4MDJA 4XH2B 4XPBL 2LABA 3IYLW 1WZ1H 2DWDB 2CDEB 1FLTX 3NN8A 2XWTA 4JY6A 4PJDF 1HXMB 4ZOEA 5TH2B 3FRPA 4Q6IA 3G04B 4P4RA 1KG0B 3QISA 4WEUD 4YDVB 1G84A 2X9WA 3SKMB 5FYLH 1CIUA 4M5YH 3QUYD 4R4FL 3QUYB 4PY8I 4CUCA 1T0PB 4MS8D 1VKXB 3LRHA 3EOBA 4C56A 5CHNA 3HNSL 1TZGL 1OAYL 3EDEA 5FDYA 4S0SD 1DZBA 1XZ0A 4O58L 4E5XA 4GBXB 4L3EA 1MCKA 3IDMB 2Q8BL 2ZOLA 3QPXH 3U7WL 3ARBA 1U91A 2J6EL 2Q1EA 1QFWH 3HI6H 1KJ3H 3HRZA 3UP1A 1MJJA 4TVPL 3H3PL 4O2FB 3NOIA 2IALB 4GOSA 5FYLL 2BJMH 2BNQA 2F58H 2WLZA 1RURH 1XR9B 1YQVH 1QFUH 1UB5B 5C0CD 3QUMA 1IC5L 3SQBA 2VABA 2IG2L 1PDKA 4Y19A 4YGVA 4Y5YC 3GIVA 2FZ3A 4Y4HD 3NABL 4BZ2L 4NZRL 1OGTA 1FL6B 2GCYA 4JRYB 4QOKD 5BV7B 3V52L 2EDEA 5DRWB 4I48A 1U8LB 5I16B 3FQUA 2OTWB 5DEFB 2ZNXA 2O5ZL 4FTVA 1F4WH 3FB7A 5FA4B 3CFEA 3PABA 2V7NA 3X12A 3P11L 5T3XH 1CFNA 4MQ7A 4OQ1A 2OL3L 3ILQD 3TT3L 3AY4C 4LHUG 5BOPA 3UTQA 2MPAH 5FYJH 4KJPC 1LO4L 3VXMB 1I1CA 1T3FA 5CEYA 4NPYA 5C6PB 4MS8C 2I25N 4D94A 1S9YB 3DXAA 1NAMB 1JYVA 3KJ6H 1LEGA 4PP1D 2NX5B 3GSXB 4DQOH 2XKNB 2MTPA 1CGYA 3SKNB 4IOFD 1KIQB 3MRGA 5D7JD 2YPKA 5E6IC 1Y6NR 4QRPA 1GCFA 1EAJA 1ZEAL 5C09A 1WZMA 4NRXA 3O2DA 3AS0A 1T2JA 1CLYL 5IK3B 2R0LL 2X1XR 4Z7QE 4KVNL 2X4QB 4ONHB 1R5IB 4KGJA 1DN0B 4YXLH 5DA4A 4LSPH 3VXPA 5H94B 1G6RB 5I66A 4WFGD 4N9GA 4YUEH 2RB8A 3BP7B 4OF0A 4G42B 5IBUB 5C0BB 5GS0C 2VSCA 4K94L 1EGJL 5EIVA 5KG9A 5DHYB 5DJCA 2ZUWA 3OL2A 3TWCL 3D18B 4M4RA 4EI6A 5MERA 3O4OC 3QDGD 4FFYH 1CLOL 3ARWA 3WLWD 1ND0A 3T0EC 1NUDA 1UZ8B 4X9BA 1H5BB 3FB5B 4NQXB 1JYWA 1AO7A 1JPSL 5EU6E 2X1WL 5EBMA 1V3KA 4PGEA 1P5UA 5LAXB 1OAUL 2CRZA 5E2TH 2CKNA 2P7TB 5DQ9B 1RFDL 5TQ0H 5E8NA 2FX7H 3D69B 3AM8C 5L2JB 4UOW1 3SDCD 3CSPA 2BCKA 2X70B 4PV8B 4TOYH 5JIIA 3E3QA 2O5ZH 1CFVH 1A6ZA 3VXNA 3MSPA 2Z4QA 4NQVB 1WWBX 4ELME 5IQ9B 1XIWA 1AC6A 1Z5LA 2B4CH 1TJIL 3FOMB 5GRVL 3CDGB 5AZ2H 4Y5YA 4O2EB 4K8RH 1SJXA 2AJVL 2D7TL 2B0SL 2I60L 1FJ1B 4Y4HA 1LO4H 2OQJB 1ES0B 2PO6D 4OD1H 2BOBB 5D4QA 4OTXH 4WWKC 4JB9H 1RIUH 5AYUH 4LDEB 5IHBA 2QQNL 2WUCL 3QRGH 1U41A 4OFKA 3HFMH 4HZAA 4D3CH 4L8SB 2R1YB 3CFEB 1HHKB 1MQKH 1FO0H 1OAQH 4L29A 4XNMB 3UTTA 4DCQB 5I0ZA 4Y4KB 4OZFG 4XP1L 2EIEA 1TNMA 3JWDC 4M5ZL 1F00I 2OM5A 2NR6D 4WO4A 2I26N 3IS0X 2VLLA 5I1JL 1QEWB 5FM5O 2WQRA 4K7FB 1HILB 2YC1B 4HWBA 3IKCB 2VZ1A 4GMTH 3QDJE 1EAPB 3ALPA 3GSOA 4XXCC 2WWMC 2ADGA 1CFSA 1BGXL 2R0ZH 2Q86A 5EUOA 1X5ZA 4NUGH 5F96L 4F7PB 1QLRA 4Y4FB 4ONHA 4EN3A 3O8XA 5GISH 4NJAH 5DJ6A 2ZKHH 1KEGH 5I66B 3DI3B 1K8IA 4PLKD 5HHXL 3VD7A 3OAUL 1OAUH 5E2TL 3IDJB 1NMAL 4XVUD 5DK0B 5IMLA 1JZ6A 6FABH 1DE4B 3U36B 5GRJL 4PJ7E 4XX1E 4N0FA 3B9EA 2BVYA 2J12B 4HS8L 2YD9A 5ACZA 3CFJB 3BP4B 2ZPKH 3JV6A 3LZFH 3IAGC 1F4AA 4M7LT 4XPGH 5CBEA 4ELMB 4Z7QF 3U2SB 3GMPA 4GKSB 3PNWA 5JOEA 2IANA 1T4KB 1X9QA 2Y5EA 2Y25A 1MLCA 2VXSL 1W0WB 1SBBA 4LPTA 1OTSC 4NJAL 3GMMB 5DEGB 3DRQB 4Y5YB 4KFZC 3U82B 5DFTA 3FRPG 1OWRM 4I5BB 4PB0L 1A1MB 4I0CC 1A6VH 1RVFH 1QBBA 3W0WD 1PZUB 4NKIL 5C6TH 2GK2A 4YAQB 1M05A 3RJQB 1NFDA 6FABL 2AJUH 1B0RB 1IJ9A 4I2XA 4I3RH 3ZKMD 4WU7A 4GXVH 1EXUA 2APWA 2R2CA 4QYOB 1TTUA 1JGUL 4HIEA 1LP9B 4JPVL 5EZJB 2PW2B 4HXAH 4OLZL 1KLGA 1DSFL 5I76B 2IF7A 2FIKA 1H15B 1S9KC 5IHZA 1NCWH 4RFNB 3O2VL 5DJXB 2AABH 3RZCB 2AJ3A 3TCLB 4OZGB 2VWEC 1LE5A 5F96H 5CEZL 3MO1A 2UVFA 5SWQA 2IPTL 5JMOC 4G6AC 4BELD 3PV7A 1FNGA 4HSQA 4WFFE 3LEXB 2MNUA 4Z9KB 4RNRB 3RVWD 4M7JL 5GZOD 2P4AB 3GB7A 4HIHA 2V2WA 3DUHA 5DC0A 1KJ2B 2OCFD 3RVVD 2Z31D 3P4MA 1NMBL 3RWGA 5HDQH 1HQ4A 4PJDB 4R7NA 4WU5B 4WV1B 3QHZH 2A83A 5KVFL 3PWVA 4G6ML 4OCLC 5DMJB 1LO5A 1YQ2A 4RMUA 4C57C 4X4XA 3BN9D 4ZUSA 1WTLA 1T66C 1ZE3C 2VXUH 4JJ5B 4X4MA 4WI3A 4GLRH 5ETUA 2OI9A 1XF2B 3IAPA 2FL5B 4PJCF 5GRXG 3TBVA 4F8TA 4UT9H 3BT2L 1RHHB 2VDQL 1N7MH 4YNYB 4FOMA 4X6FA 2JIXA 3JV4A 2E7LC 4HMEA 4L4VD 5DFVC 3LSOB 1RIVL 3C6LA 3VMNA 1NMCB 2H9GA 4P5KB 3MRIB 1LE9B 1FN4B 2JJSC 1N5AB 4N0FB 4K3HA 2D7OA 4D0BB 2GEEA 4MJID 1G6VK 1NUNB 4Z7WA 3M07A 4ELMA 5J57B 3DHJA 4KRPC 4J6RH 3KWWB 2UY7A 3QA3B 2HTLD 1SMAA 5F88B 5I9QB 3NA4A 5GS0L 4P46D 2VH5L 3QT2A 3C8HA 1AO7E 1KB9K 5HGBA 3RNQA 3QXDA 5DQDL 3BXNB 3S96A 2DLTA 5I1CH 4ODHH 3PWUA 1G7IA 1A1MA 3CLEH 3DSNA 1V3JA 3CCHB 2WNGA 3JTSA 3CSYA 1UM6H 2OL3A 2DQIH 1B0RA 3VXME 3BH8A 3DWTA 1H5BC 1S7UB 1LP9A 1TETL 3DXAD 3SE4C 1R3IH 1DFBL 4G8GA 4JFQA 1SVCP 1PW3A 1U3JA 3TZVD 4MMZC 1V7ML 2JCCF 1UC6A 5D7IE 2XTJC 3UPRB 5DD6A 2P47B 1ODAA 4PPTA 5GSRA 2RJMA 3FQRB 4X9FA 5DHVA 1MREL 3ZE0F 4PJBB 3B8SA 4O9HH 4JY4A 3GSQB 3ZMRA 5EU6B 5T1MB 3GSUB 1ZA6B 4PJHF 3SGEI 4CADB 3ZKNC 4QHKJ 3PWJA 1T1YA 1TVBA 4FQ1L 3FZUD 4QRTA 3EYUL 1M1SA 1N26A 4B41A 1WT5C 1CGWA 3C5ZD 3RWDB 1TQBB 4FHBD 5IMOA 4OKVB 4PJDA 4IBLT 4OD3H 3OB0K 4PJIF 4HV8B 1FNLA 5CP7B 4YE4H 3H9SD 4HZLA 2YK1L 1IQWH 4ZFOA 3NCJH 4RWHA 1T21B 4MNQA 2VLJE 2WWKO 1TJGL 1Y0LA 2CJUH 2P8LB 1FLRL 3AREA 5LQBH 3L5XH 4Q9BA 5I1GH 3VI4F 5IGXL 1N2RB 4PJAA 5HJ3A 5GGUA 1P84J 4WUUA 4X6FB 1BFOB 2WK2A 5AUMA 3NCEB 1C1EL 1Q38A 4CN1A 2YD7A 4NRYB 5C0JA 3UBXI 4S0UC 3QFJA 3ARZA 4QKXB 5JIPA 2F74B 4RGNB 4N5ED 1YEGH 2APTA 4H88L 4C54A 3CXHJ 4JQVA 3VWKD 1XF5A 2AGJH 2DBJA 3UJJL 3KWWA 3JXAA 3RPIA 1UWXK 4XVTH 5GRUH 2JJTC 4NZUH 4F2MB 2HLAB 2PXYD 3OJ2C 1ZTXH 2DM7A 4M7KH 3HCVB 4RMRA 4LCCC 2CLZB 4Z0XB 4PRPE 4NN7C 5JW3H 5C2BH 5E1HB 3KAAA 3O4LB 3B2VL 2DQGH 2HTLC 3SPVA 1G7IB 3MV9B 4PY7A 3MFFA 1Y6KR 4ZTPH 4Y5VC 1NSNH 4EXPX 4H20L 4DZBA 5CHNB 3LKSA 2V5SA 2FJHA 3MGAA 2GIYA 5CGYD 3G6JE 4LLMA 1HYSC 4G8GB 4JFQB 4QTIH 1D6VL 4LAJH 5ANMB 2R2EA 2AJYH 4KJWD 1S9WA 3W82A 1QLEH 4S1RH 4WEBH 4Z77B 4DWHA 4YO0B 4HWEL 4WGVB 2DYPA 1YJDC 3MOAL 4X7EC 4FQ2H 3WIIL 4G3YH 3PL6B 4HGMA 2YZ1A 1JGDB 5TF1H 4EKXA 2I24N 4S1QL 3QEQD 9CGTA 4PJGF 5IFHH 4UBDD 3RGVC 4M43H 1TVBB 2EE9A 2KQMA 2KZ1B 3B2UC 4EN3C 2NW3A 5DUPL 4MB4A 4HG4J 4MJ4A 4NJ9H 2VLKB 2J8UB 2AV1A 1MAMH 4QTIL 5IB5A 4NZDA 1QFPA 3MYJA 3ECBA 3VE0B 4XPHL 4UTBL 2A77H 1EO7A 1FZJB 2DQDL 3PGFL 5CP7A 5CEXA 2ZNWA 1NAKH 2ORBL 2NY7H 1WV7T 4FTVB 4GS7B 5IWLA 4P5TC 4G7VH 5B38G 4OGXL 4P2QB 4YIQB 5FKAB 4BZ2H 4L8DA 3O3EA 4MA1C 4PJCB 4PG9B 1Y0LB 4JANA 3OBAA 2QLVB 3BEVB 4WWID 3O6KL 2GY7B 1G9NH 3B9KC 1JPTL 3ARDB 4ONFL 5HJ3B 5T1DH 5KVEL 3T4YB 4J2XA 3FKUS 3SKOB 3V4VL 3MRNB 2GJ6A 1LO3H 3V4PL 3EFDH 4XVUC 1C16A 5FGRA 4KY1L 2K7QA 4PLKC 3WKMH 5EOCJ 4L8SC 4LPUA 3R8QA 5IV2B 3Q6GH 1UFUA 4BSJA 5SWZB 4XC1H 5DJ8B 1L0XA 5D7KE 2BNQD 1WVZA 4IS6A 1I85C 1KEGL 1UJ3B 2YBRA 4RIRB 3TPKA 1JPTH 5C0CA 2P8PB 2H6PB 2YPLE 3G5ZA 1FDLL 2DJSA 3MJ6A 5LWYL 4A6YB 2ZCKL 2E7MA 1DQDH 3MROA 1OTSD 4I13B 2FBOJ 4XZUA 4TSCL 2DIAA 3WKNA 1IC7H 1OGAA 4UINL 4XAKE 4R7DB 1OSPL 5L2KA 4LSPL 2QL1A 1C5CH 2HFGL 2EYSA 2NLJA 3BGFC 3PL6C 5EBGA 1JL8A 4O00A 3M1BA 5HI5C 4EI6B 5IB1B 4JAMA 4YFEA 3FQNB 2HT4D 2VZSA 1QPXA 2EXYD 2DLEA 3QCUH 2ERJC 2I9LA 5HVHB 5I74C 5TDPB 2VL5B 3Q6GL 5DD5L 4XCYB 2B1HL 5E8NB 4NGHH 5TE7H 4WHYH 4UDTA 3H9YA 1CXEA 2WIMA 1HHJB 1QSVA 3FQWA 1P4BH 2PO6C 1A6TA 1NUFA 2F53D 3A6BH 5DEZA 4QHUB 1NGQH 1I1RA 2X4PB 3VXOB 4DVRH 4OFDA 4JKWA 4UU9B 5I1IH 1RZJH 1X5IA 4ACPA 3CDGA 3UO1L 1AQDA 3TBSA 3X14A 1CICD 3L5WA 3VDAA 2E27H 3K3QA 4Y89A 1DEEA 3DX6A 3EYQD 1VFBB 3TA3B 3QDJA 3ARRA 1OSPH 3JTTA 1DSFH 3T4AA 3C9NB 4OZIF 1MUJB 2JIXD 1LDSA 4ODWA 4TRPH 3BISA 4OZ4A 2GITB 1REIA 5KBNC 4ZDHA 1B0GB 1TCMA 5SV3A 3GM0A 4N8VG 3MXVH 5TPWL 1U8JA 3O3EB 4PJCA 4HS6B 1A7RL 2MCPH 5HHXH 2AJXH 3U0TB 4L9DA 5BS0A 3S5LA 1ZEAH 4OZHB 1G9MH 2EXWD 2HMID 1A1OA 4PJFB 5E8OA 5HYIA 2OXGA 1EV2E 4HQQL 5ACLA 1XGTB 3FO0H 3MGTA 4POZD 4XP1H 5EPMB 4LLVB 4X5WB 2ZUVA 1U3HD 4O02L 3INUH 3ZDYF 1HILA 1G7QA 2ICWI 2V5RA 3A67H 2VITA 2H8PA 5JIKA 3SE8L 1JF1B 4XPGL 4MNHA 1J1PH 2IEPA 4TTDC 2DWEB 5DDHA 1R5VB 2HLFC 4YPJA 5FXCH 1GL4B 3ZE1F 2EZ0D 5GGRA 5INCB 1CDCA 3QDMA 1MHPH 5FYJU 2UYLB 1D5ZA 2WZPD 4C4KT 4OB5H 3WJLA 1UGNA 1S78C 3QNYA 2PO6B 2WAHA 3WD5H 3LKOB 4HIIB 4UZGA 3BZFA 3STBA 1FO0B 5I2IB 1EO5A 2LU4A 4HXBH 5KSAA 1I9RH 4JKPL 1KTKE 1QQDA 3TIEB 5ERWB 3C60B 3W11D 1CGSH 2OYPA 2P42B 1A7NH 1NGZA 4A2LA 1FVCA 1VEMA 5EU5A 1OT2A 1EEQA 5I1LB 3LV3B 3ALXA 1J10A 3B9VA 3PWLB 1CXLA 5BV7H 1IM9B 2YPVH 4EIGB 1RUPL 4NQCB 1IM9D 4MAYC 1T4KA 1AKJD 2E7CA 1RIUL 2XTLA 3S3PA 4YQXH 3P30L 3H0TA 5F1OB 4QF1B 1RZKC 3V2AR 1YY9C 1UJ3C 1ZWIB 4V2CB 2BDNL 3K2UH 4UDUA 3GGWB 3X14B 1KJVA 3TF7A 2QQKH 5HHVH 5DVLA 4PJIA 1G9ML 3IF1B 4Y4FD 4XB8A 3QDJB 4B0MM 4DW2H 2FRGP 4K23H 4QOKB 1AD0B 1I7UA 3G6JF 4HKXA 3ARGD 4FNLL 3EOAA 2EDDA 1IGJB 3ARGB 1M4KA 2DTSA 4U1NA 4ZAKA 3S6CA 4ZMAT 1IAOA 2VC2H 1B0GA 5JXEC 2AXHA 4IOFC 2PW2A 4JZNA 3MCLL 4K71B 1WFTA 3MLWL 4MXWH 3IDYB 3RUGE 2AXFA 4G8GD 5D72L 3RZCA 4OKDA 4OZHA 3IU4H 3RU8L 1OPGH 1MJUL 1I4FA 1DANU 3KPLA 1G6RH 3NH7H 1WFUA 4R90L 2XXMB 3QEGL 3LEXA 1UXWB 3WFHA 4FQHB 5DTFA 2ZKHL 2NY6C 5EA0L 3OX8B 4AMKH 3FAXA 5CEZH 4LCIH 3EOYG 3DYOA 3I2CH 4MA7H 5DUMH 3RA7L 3O8XC 4HUKB 5FUOL 2Q76A 2H8PB 3O6FD 1JN6A 2A6JB 4YHIB 2VKWA 5EOTA 3SBWA 1ZAGA 3C5SA 4JHZA 5EC1B 3BO8A 2X4TB 4FFVC 3P2TA 4U6YA 4U0QB 1YDPA 4HH9A 5TGBA 1YEJL 2VLKD 3H2WA 4TUJA 4KXZH 5DWUH 1LO5B 3TH3T 4CJ1A 5E6IA 3P4OB 3W2DH 1BWMA 4UB0L 3HZKB 4FNLH 4UV4H 4XMLH 5DSCA 5AWNH 2IJ0C 2X5PA 4PJEA 5JHDE 4O2CA 5KSAB 2CLVA 4Q7DA 1CN4A 3KPQA 3O2DH 4BSVB 3KLSA 5CJOL 4ODSL 1CLZL 3CLEL 2FB4L 3CXDL 3F7VA 3VW3H 1MJUH 3H9SE 4P5KA 3I9GL 4JKKA 1MIEH 4OLXL 5D71L 3OKNB 3QNXA 3J8F7 3U30C 4YJZL 2AW2A 5FYLD 5B4MC 5M95B 3ZDZF 1JVKA 4K9EL 4XP4L 1TITA 3T08A 4HJGB 4WI7A 3LV3A 4I18A 1MCFA 1CFQA 1RK1B 5MENB 4PJ8C 2X89A 2Q6WB 4N5EA 5JW5A 1JZ8A 5IMKA 1H3PL 1CGVA 5B8CB 5C8JA 2AEPH 3MA7B 2G9HA 5C2BL 4HG4K 5BMFL 1FBIH 1P69B 1B4JH 4HPYH 3CXDH 2B7DT 4M1CD 3IETA 5I8CA 1YJDL 3KYNA 1WIUA 3HC0B 1NCDH 2DQJL 3PP3H 1FV1A 4Y19E 2DLFL 4UDUB 5D71H 1HINH 1Q72L 2HA1A 3MLVH 1S3KL 5INDA 5BVPL 4U1MA 1NCWL 3NPZB 2HLFD 1CD1A 3UTPD 4CKVX 1G9EA 1MFBH 4PB9H 3ULVE 2DBLH 3KPMB 3CSYB 3JTSB 4PRDB 3MLSL 3I6GA 3FT3B 1JFMA 4G6KH 3LN5A 3TBYA 5K93A 3RTQC 4J23A 4J1UA 2P8MA 4JDZA 3QJHB 5IROA 2RCSL 5GGQL 3T0EA 2GFBA 4NZRH 5D96B 2E7HA 3BYYA 3VFWA 1DLHA 1YJDH 3QRGL 1QKZL 2R69L 5J13B 3OHXA 4L3EE 4HD9A 3L3HB 4NT6A 3SKJH 1EEYA 4FQHA 2C3WA 2NY4C 2Q3AA 1W0YT 3UAJC 3U9PL 4CADA 4QCIA 2ZCHL 4GG8B 4BFEA 2A1WH 4M00A 4YHOH 1FL5B 4RMQA 4PJGE 4NRZB 4L5FL 4I1NB 4P23A 1JP5A 5DLML 3UC0H 1F3RB 4N0UE 4KKNA 2A6JA 3V6OE 4LNRA 1EFXA 1GH7A 1JPGB 1TENA 1I7ZA 1JGEA 3EYOA 4OBSA 4Q6IB 2ADFH 4HZLB 4XPFH 2FATL 4LVNC 2ZG2A 1II4E 5FHAH 3SO3C 3BVNA 1LEKA 3QH3A 3HNSH 1WLHA 5DJ2B 1M7XA 3RPKA 3I02B 1I7TA 1CE1H 1G7PB 3OKEA 4RAUB 1AY1L 4M1DL 3FONA 4U6VH 2D4DA 2CLVB 8CGTA 1NBYB 1CLYH 4G80B 4XI5D 1SHMA 3SE3A 4XNYH 3BKYH 5AUMB 3WJJA 5DLMH 3TO4A 1LK2A 1H8OA 4FABL 2YSSB 3BDYH 4GW5A 3SDAD 2GSIA 5ENWA 2BNQE 4KROC 3SKJL 4N0UB 4YDIL 4PJ7A 1OD7A 2NXYB 2HT4C 4YX2L 4PS4L 1I3GH 2ICEB 4IOSD 5LGKA 1CR9H 1FC2D 5IMKB 5F6HI 3VXUB 4M5ZH 4WFFD 1ORSB 5D7IB 5C86A 5FFLA 4WENB 3TT3H 5DJZB 1Q9OA 4XNYL 1JK8B 3O3BB 4MAUL 5IFHL 5IESH 1U3ZA 4WJ5A 3DMMB 3IVKB 1NPUA 4LGSB 3HB3D 3O4LA 5KVGH 1QR1B 4U1MB 5F7EH 2GTWA 1LP9E 3VFTA 1QSED 1VENA 4X9GA 4YDKL 2QADB 3W9EA 2KDGA 2H1PL 3LN5B 4XBGA 3ARED 2VQUA 1Q9KB 4JZJC 3BRGC 3DX8A 3HI5H 4LLMB 4UTAL 2R0WL 3TH2T 2BERA 3OF6D 1LWRA 3FB6B 3VRLE 2X4NA 4ZNEA 2ZUSA 5HHNA 1DLHB 2LFGA 1D5MA 5K9JL 3BH9A 5B3JF 1GOFA 4X7DC 4JFOB 1K2DB 4NN5B 3GZKA 5B21A 3GSXA 4S1RL 1RZ7L 3KYMA 3TNMB 3AS3A 1CDBA 1U6AH 4G9FA 3VH8G 2R56L 1FCCA 3NIFE 3V0VA 1CLOH 4NRXB 4R2GD 3VH8A 3AMKA 2VLRB 4WW1B 4S1QH 2UZIL 4DN4L 2EYTA 3RAJH 3F12A 5C07A 5EC2B 1NAMH 5KSBE 1BZQK 3ECBB 3VE0A 2PYFB 3BIBX 5KW9H 3V5DA 1JF6A 3ULUC 4HGWA 5FECA 1VFOA 4GRWF 1LEKB 3BVNB 2CUIA 1A9EA 1TZHA 4TVPD 1DBBL 4FFEX 4QRSA 1GIGL 1T1WA 3L9RB 1G7PA 4GSDL 4Z7UF 1MNUH 4HWZB 4JFYB 4KHTL 2G2RB 2SEBB 4PRPD 4Y5XC 4U3HA 4NUGL 3ARDA 3LQAL 4U1HA 2IQ9H 3D18A 1S7TB 5GS1C 4PB0H 2D0HA 4AL8H 1E4XI 2IH3A 1H5BA 1J1OL 1X5FA 3WYRA 1CIDA 3UMTA 1MFEL 1N3NA 3HMWL 2ICEA 3VWKB 2QSCH 4PJ9B 5IWLC 1GGCL 3WNLA 4M62H 1WAAF 4KI5D 2YD1A 4P2OC 1N59B 1SVZA 1YMHB 4P9HL 3EFFB 3EO9H 1MFAH 3TLRA 3HN3A 4YXHH 5KW9L 2H6PA 2BNRD 3SBWC 3RWFA 5IR1B 4CU6A 2CO6B 2DICA 1JZ3A 4Z78A 1EERB 1YEKH 5T33L 2BRQA 3ISWA 4YC2C 5CP3H 1U8MA 5D7IF 1OGAD 4K7PY 4XC3H 2L7UA 4GAJH 1OGAB 2GTWB 3QCTL 1LO2H 3GSRA 4YZFF 3LIZL 3BKJH 1OWWA 4C58B 4EVNA 3WIIH 4JAMB 1CXIA 4YHNB 5KS9F 2OTPA 2APBA 3KYOA 1I9IH 1QO3B 5CEZD 5BV7L 1U8NB 1NFIB 4XBGB 3MRMA 4L29B 4DCQA 3IU3B 3RL2B 4X80L 4X6EB 1NANI 3OF6A 2I9LB 1JV5A 2QKIA 5MP6L 5I1DA 3FB6A 5EZIL 4WW2C 1JFQL 4NN6B 4YHMH 4WO4B 4GRLB 5MEND 4Q9CA 1V8HA 5IBLD 5K9QI 2F5BL 3D0LB 4AIZA 4XPHH 4QHUA 1FFOA 4IMLB 3TA3C 2PKDA 2XKUA 1JNHB 4C4KO 1YEHL 1MEXL 4UU9A 3WV0A 3TNMA 2LE9A 1BQUA 3VFOB 4KMTH 1VERA 4FZ8H 4IOIB 4U1LA 3MUGB 1K4DA 2RBLA 5ICXA 1HN1A 3DTXA 2MHAA 2HFFA 5D7SH 4S2SA 4RGOH 4KK8C 4E0RB 4NKQB 4P23C 5DJYB 4XMPH 1UEYA 3D2UB 1R3KB 1NCCL 4GQPH 4ZPTB 4LLDB 4ODWB 1T0MA 3D2UD 4UI2A 4RZCB 1K8IB 5JDSA 3MV8E 4PJ7F 1FVEB 3E6HB 2XG4A 3PQYE 5CUSH 4ZXBA 2HVJB 3DUSB 2X09A 5B3JE 4WI8A 3VMOA 4IHOA 2XN9D 2XTJB 2E6PA 1JFQH 1QOKA 2R0KH 5JNYA 1H3TA 5FYKU 3MXVL 3MXWL 3MZGB 5DUML 2F53E 4AIOA 5H35A 1T03H 1IGFL 3WS3A 4WWKB 4DTGH 4GXUM 2IGFL 1E6OL 4FXLA 4YDLC 1U92B 2A6IA 5D70L 4PRIB 2VLKE 4F7CA 5HVFB 4NQED 1J18A 1CVSC 5CZXD 2HT2C 3GSVA 1D6EB 1F02I 4JCMA 4ODBD 4RDQG 1LO2L 1PVHA 4KKLC 1V05A 3T77A 4L9LB 4XMLL 1A7QH 8FABB 5EORH 5T5NF 1CK0L 1IGTA 1H0DB 3SJVB 3QDMD 3QO1A 4NN5C 1BZ7B 4ZNEE 3U0PA 3B8YA 5E9DA 4KI5F 3I6LE 3P0VL 4G8EA 5E56A 1U8MB 4GT7A 2DOCA 2X10A 2RFXB 1BZ9A 1ERNA 3CVIL 5CILH 1IGFH 5I30L 3ULSB 1BVKB 3CFCH 4OB5L 3C60A 4CL7A 3T8XA 3QIBB 3HZVB 2FEDC 1WC7B 1BD2A 1AFVL 3MPCA 5KSBB 3S8WA 3MJ7A 3HPJA 3B9KB 3C87A 2AV7B 2VDKL 4PGBA 1Q0YH 3IU3A 4M4PA 4ESKA 3ZDZE 2QKIB 4GJTB 4AEHH 1KTDB 2F54A 2R2HB 3BWUC 5T1LD 2NNAA 1JZ2A 2LAGB 5HI4C 4MXVE 4FXGA 2APVA 1KGCE 4XP6L 2HG5A 1NDGA 4RISL 1QNZH 1QSFE 4BA8A 4M1GL 3KPRA 2YZ8A 3WHXB 3DV6B 5J6GA 2LTQC 4ONOA 4Z76A 3H0TB 2ID5A 1C1EH 5BW7C 1Q0XL 2CD0A 4LAQH 2PXYA 5KJRL 4DZ8B 3E2HC 3MRLA 4NO0A 5FIEA 2JELL 4LF3A 1MHHA 4DUWA 4Y8AA 3HAEA 2FO4B 2ADIB 5FUCE 5J0BA 3DMMD 4R96A 2OZ4L 1YN7A 4ODXA 2HFFB 3DNKA 4P57A 3S88H 5FA3B 4O58H 1XGPB 2XWTB 4P2RD 2P5EA 4HKXB 1R3KA 3GI8L 4LRIC 5CJ8A 2DL2A 5CSZA 1XCTA 1KJ3L 1SEBB 4AEIL 4EDXA 4ZS7H 25C8H 2WBJD 3IT8D 4XNQB 3CLFH 2DB8A 4S10A 3R06B 3S36H 4LAQL 4JO2L 2CXGA 3S37X 3EAKA 4XI5C 1B4RA 4ODSH 1U8HA 5I73C 3MRIA 2C3HA 3QEHA 4FMKA 2EDNA 3QFJE 2DKSA 3QG7H 2BVPA 4M6NH 5L88L 1NBZA 5JORA 1UACH 1ZLVH 4D0BA 3MR9A 3SO3B 3O3AA 2WMPA 4WWKA 4Y7MA 2DQHH 2EH7H 3CX5K 4PRIA 4FXKA 3N1PC 1ZHKA 3ZE2E 1EBAA 4HXBL 4Y16C 2YUXA 2IALA 2CKBH 3HUJE 3T77B 1NL0L 2BNQB 5IOPA 1XFPA 4X7SL 5F88A 5TGBB 5FV2A 2EDXA 4BQ6A 1JMZA 3TV3H 2WWMD 2UWEA 4X6DB 5ICYA 3LCYA 3VXTA 1TPXC 3SKMA 3UAJD 3DVNA 1YEDB 4HPYL 1B4JL 3KPSB 3VFGL 3VXUE 5BQ7A 1U2HA 3AM8A 3S3JA 3GIVB 1MFNA 4PBVC 4PJ5E 5CIPB 4KXZI 1BZ9B 1TTGA 2ZUTA 3MV9D 3MQIA 4JRYA 1JGVH 4K7PL 3PGDA 4Z7VA 4K07A 2CUMA 1MFDH 3BDXA 4M7KL 4KJYB 5DEFA 4UAOC 2AXJA 4HGKC 1PG7W 4LDLB 3B9KA 1OP5K 2B4CC 3GBML 5F7FA 4F15C 4PJBE 3X12B 1R3LA 3C8DA 1MJJB 4PJGB 3TNNA 4P2CG 1OHQA 2Q6WA 3BESR 3CIQA 4JLRA 4FQ1H 4NWTL 1J7VR 4ZUTB 5DHVB 1T7YA 3QUZA 5E99H 3HG1E 3LQZB 1F3DH 1L7TL 4KVCL 3NTCH 4Z76B 5KANI 5H37G 5J7CC 4QTHA 4I3SL 4AEEA 3MGOB 3KR3L 3SKNA 4BK5A 3MRLB 3CLFL 1FORL 2RHEA 1FG9C 5E8DL 4N9OB 1A1NB 2GK0A 4BSWB 2YD2A 4WTWA 2L4OA 1F8TH 3OKDA 4BQ8A 3FQUB 3REVB 1XGPA 2P5EB 3LKQB 1DN0A 3CC5A 4KI1A 1J0HA 1S3KH 5F1SA 2A2QT 1CDHA 1F3JA 4UNVA 1LDPL 5DVKA 4DOHE 4XNQA 3D39A 3SE3C 2QQLL 5D6DC 1FYTD 3VRJB 3RI5F 4UQ3A 3SCMD 2PCPB 5GS0D 4F15B 2X9YA 5FYJL 5BXFA 2RCSH 5C0EA 4LVEA 4BYHA 5IEHB 2IBZX 3DVGA 3HI1B 5ESVB 3O6FA 4GKNA 2K9UA 4FS0A 5EBMB 4JVPA 3CNKA 4WY7H 2PYEB 5DQ9A 4NZJA 1LQVA 4JQIH 4DKAA 3RPIB 2X1QA 2DIJA 3UTPE 5ALCL 4ZS6C 1R5IA 1YC8A 3VDCA 2A6KB 1E27A 5E8PA 3EJJX 3L6FB 4XXDA 2IG2H 2EKSB 1X5LA 5ICYB 4N9GB 3C5JB 4PP1C 5DRNA 4DGIL 4KH2A 1SY6H 2DMKA 4G42A 4JO4H 5C0BA 3WNOA 3KYKL 3V7MA 4B7LA 3MLXH 3C08L 3RX7A 1INQA 3EYFB 4TNVF 4LIQH 4YXKL 3HE6B 5DGRA 5JDJA 3LRGA 5TF0A 3BZ4A 1N4XH 3P9LB 4OGAD 2AP2A 1PEZA 3OB0H 2R2EB 1A14H 1NLDL 2F15A 3D48R 5LAXA 4Y1AD 4Y4KA 4R6UA 4YUEL 5C0IA 1OVZA 4GFTB 4WHTB 2P24B 5CSGA 2BVQB 2BCKB 3QJFA 4HC1A 1YECL 3DETD 1EGJH 3OPZH 2FNBA 3ZDXE 4LLWA 4NJ9L 2X41A 1AKJB 1NC2B 3I85A 1MCHA 1J8HA 3MRRA 2IBGA 4EQ2A 1FNFA 4WUUE 1UKQA 1S5HA 5DD1L 5DD5H 1NGWA 4OIAA 4BM7A 5A3IC 4PGZA 1T83A 3VXSE 2ADGB 1CFSB 4PJEE 5DRZA 5IB5B 3PQYB 1EFXD 2GJJA 1DBJH 3H3KA 2GUOA 5DD0L 4X0KA 4YHPA 4LIQL 4YXKH 2Y1VA 4TOYL 2FHCA 1WEJL 3O8XB 4I3RL 4L8SA 4AG4H 1IBGH 1JTOA 4MCZB 5IT2L 3BPCA 3L3OA 4QOKE 1KXTB 3IDNA 3WXVH 5HDBF 1OCWH 4HAGA 3I3BA 3DX9B 5JUEH 3SE4A 4L5FH 5HGHB 5CINL 2H1PH 4XP5H 5C0RH 4KTEL 3T4YA 4KV5E 1DE4A 3O6LH 3MRNA 1D5MB 2HP4A 4HWUA 4LIQE 3U4AA 2E9JA 4CVXB 1FFNA 1YMMD 3T2PA 5TPWH 1R5WB 2VZOA 1E4WH 3LH2H 3QIBC 1ZANH 4GMSH 3KYKH 3QWOA 2EZ0C 3EDFA 1YEIH 4M02A 4U7MA 2J5LB 5DMKB 1WAAA 4ETQB 2PETA 1FAIH 1OSZB 1QSFB 3KHQA 2VSDA 5C92A 5CKAA 2FDBP 4Z7VF 4JFED 1S7XB 4AM0A 5EC2A 5EU3B 1PLGH 4ZSOB 3S37H 5A3ID 3RKDD 2PYFA 3NZHH 2IAMA 5E2WL 2K1MA 5FECB 3L6FA 4XXDB 4M8VA 1YY9D 1XGUA 4I0KA 2ITCB 4JM2D 4XZUB 1GC1L 4JPWL 3DRQA 1CGXA 1JE6A 3SE8H 1UYWL 1YEEL 2DJ4A 3L3KA 4UT9L 5L2KB 4HWZA 4JFYA 1YECH 3OR7B 2CKBB 4HKZA 5I8OL 4JB9L 3F58H 1UA6L 3U36A 1KIPB 4Q6YA 2V2TA 3RWIB 4JHBA 1WQVT 3WNPA 1WSST 2B1HH 2W9DL 1ZHNB 1IGCH 1NQBA 1YNTA 4J8RB 2IMNA 1EXUB 2X7LB 1F6FB 1JHKH 5ADPH 5D7JA 4PJHA 5GS1A 2HKFL 1KLGB 4UV7H 3SQOL 3BP4A 1BQLH 4FQJH 4Z18A 1S8DB 3PHQB 1MRCL 2OR7A 4KJQC 4AENB 1YEIL 2NY0D 4JKLA 5KSUB 3MREA 1OAZL 2F19H 1MI5A 4IEFB 3BIAX 5D72H 2IH1A 3ZKSD 1EO8H 1KPRB 4J4PA 4MA3A 5KSVB 2ESVE 2R4RL 2FEEL 4OLWL 3I50H 4WTXA 4XCFL 3ZT5A 1KT2A 2BOCB 3VFNA 2VLRD 2Y6SD 4HJ0D 5IVOA 3Q1SH 1N7ML 4OCXL 4ZFFA 5EBWA 4TVPE 4G7YH 4BJLA 1AGEA 1JMXA 4KI5E 3UEZA 5DRZB 1I85A 4FQPA 4TTDD 4LLQA 4X4ME 3GSRB 2D0GA 2ICWA 2LQRA 1CQKA 1WCQA 4WU7B 1TCRB 3QDME 3AB0B 1ACYH 3C60D 3EO0A 5I76A 4XVSH 1WTGT 3L3OB 4LLAA 4U2YA 4Y4KC 4HDIB 1IEBB 1CCZA 2FH8A 4HMCA 3NPSB 3LDBC 4WRLA 3TVMD 4K3DH 5D1QC 3DX9A 5HI5D 3SCMC 3MO1B 4O4YH 3O3DA 1KCKA 1CF8L 3C6LB 5T1LA 2C3VB 5KAQG 3MGTB 1GGBH 5FAAA 4G9FD 1FNAA 3OV6A 4HS8H 5F9JA 5FCUL 1MCRA 4PJ9D 5EZIH 5IQ7L 1SJEA 1JYXA 3MRKA 1VEPA 1XAUA 4NIKB 3V5KB 2C1PA 3CFKA 2DRUA 2KZWA 5GS2D 1IM3A 4XHQA 1BAFH 1V5JA 2NW2A 5GRVK 2XOTA 1I9JH 1FH5H 4AM0B 1HKLH 4KKAC 5I0DA 3D2UA 1N6QL 1S7RA 3H42H 3EO1A 5GHWH 4HWBH 4KTDH 2OI9B 5T5FH 4OT1L 3FJTA 4PP2A 2FECL 3TBVB 3Q6FB 5CEZE 3G08A 3UXFA 1CE6B 4OF7A 2MQCA 4KAQL 3BXNA 3S96B 2HJFA 3L3KB 2X1OA 4Q9RL 1P2CA 1DLFL 2R8SL 4P4KD 3FN0L 3WN5B 5IW3A 5KVFH 2I5YL 4PG2A 3BKCH 4OCSL 4KKBC 2HRLA 1HCVA 4OFIA 4PJCE 1A7OL 1MHEA 4ISVB 4NQSA 2XWJA 1T5XB 1QRND 4LLYB 5GGRY 3X11A 1NGZB 5DS8A 5DO2C 4P5TB 4NQDB 5GS1B 2QR0B 4P5TD 1BF2A 1NL0H 4ZUUB 1KB5A 1LP9F 5GRZA 1Z2KA 1TZGH 2EO9A 2YA1A 2JK5A 4KTDL 4XBPB 4LVOB 4R3SA 2XZCL 3BGFB 4M6OL 3U46B 5GSRB 3LAFA 1ZKAA 1NJ9A 1RZ8B 4J4PD 3VXUD 4M48L 3O11A 2NCMA 3SJVA 4RMTA 4TVPH 2BSTB 3C8KA 5C7XL 2R69H 3TBTB 3H42L 2YKLH 4UBDC 1NKRA 4AQOA 3ULUF 5E2UL 3RNQB 1A7OH 1EEUA 1J88A 4X80H 3AMLA 2R4SL 3CZFA 3CCHA 3QNZA 3QEGH 4M61A 2D4FA 1D5IL 3FO9A 1FQ9C 2WIIA 3BH8B 3HZVA 4N5UA 4LCIL 2ED7A 5FCUH 3W9DB 3SDXA 3P9MA 1BF8A 2AV7A 1CBVH 1T6WA 2BNUB 4XPFL 1RUKH 3B3IB 5DWUL 4G8FA 4HFUH 1KFAH 1AIFB 1PFCA 2Q20A 2P1YA 3MOAH 2ILLA 3WNKA 4NN7B 5KZCD 3QDHA 3MBEC 3PP4L 1HNGA 4RFOH 4X9IA 3NCMA 4JN2A 4NNPL 3OX8A 1BOYA 2AJUL 3PWJB 3OKLA 4O9HL 3IFLH 3QHTC 4M43L 3RGHA 2X40A 4U0RB 4LVHC 4EUPH 2VMFA 5AAWA 4P57B 2A9MH 4N0CC 3HG1B 1RUKL 3FFCE 5DRXB 4Z5RB 2M2DA 3HG1D 3QQ3A 4F2MA 3B2UD 4CN6A 1WT5A 1VADA 2VLRE 1MCDA 2FB4H 4L4VE 2DTMH 3TJEH 3ZSTA 1CQYA 4OCRH 1LQSR 2CLZA 1ZVHA 4PJEB 5JW4Q 3PP4H 3DURB 2Y36L 4WW2A 2I27N 5D70H 4PJAB 4S1DD 5ADOL 3I6LD 3FHAA 5E4EC 4X6CA 4ONFH 1FBIL 1MHCB 5HI4D 3MLZH 1KFAL 5IB3B 3QI9C 3QXWA 4NCC2 1AHWB 1P7QA 3LKSB 3SDAB 1WCBA 4JPKL 1NCAH 2YEZB 4LLYA 1HI6B 5JORB 4TSAH 4AYFA 4P5TA 3O3AB 5E4IA 4OI7A 1MFBL 4PB9L 1ZGLM 2FIRT 1IEAA 2GSGB 4NQEB 4BKLA 3VD4A 4MX7B 4DEPC 3IFNH 3FO2A 2JK5B 2HWZL 4QEGA 2YR3A 4CDHA 3O0RL 4C83B 4PTUA 1NCDL 2FH6A 2XWBA 5KTEL 3WIHH 4LSSL 3MA7A 3JUYA 2VAAB 1G7JB 1U8QA 2BRRL 2UWEB 2BSTA 4X6DA 4CMHB 2W0LA 3KS0H 2BNRB 2H26A 3V7AG 2A9NL 4PRAA 5LWYH 3DJ9A 3KYNB 4U1SA 3STLA 3BP5A 3KPSA 4XMKL 4Z8FL 4JM2B 1I75A 7FABL 3L5IA 2B2XL 2J8UA 1ZA3A 3GI9L 4DZBB 1S7QA 3GRWH 1FG2B 2WIIB 5ISZB 4IIQC 2GT9A 3HC3H 3KPOA 3G5XA 4DGVH 2D7TH 4JPIB 1BMGA 3TBYB 3NIGE 5JHDA 1XT5A 1QBML 4CMMA 3X3FH 1Q9LB 1K8DA 4RGNE 5ANMA 3C09B 3T0WA 4BUGA 3QG6A 2PYEE 2CMRL 1OM3L 1C5BL 5K9KB 5HGGS 2IBBA 3E0GA 4JJHA 4WO4D 1Z6JT 43C9A 4Z8FH 4CGTA 5DMIH 4ODVL 2KPNA 2ATPB 2CK0L 1MSPA 1AGBA 4NO0D 4IRJD 3CZJA 5HGAA 1MCIA 1YPZB 3FTGA 4QCIB 1EHAA 4JN2B 2BVEA 2BRRH 1RY7B 2J88H 4XGZB 1W8NA 4JHWH 3DLQR 3JWOH 4P46C 1MOEA 4NQEE 4DKFH 3UO1H 4MNGE 4KI5C 3X3GL 3RWJB 3CFBB 4NHUB 5FYKE 5DHVH 4LSVL 1KXQE 5GXBB 1UJ3A 4PJEF 4MQXC 5J06A 3EYOB 4PS4H 3VGHA 3LKQA 3RFZC 1CFBA 4FQIL 3CDFA 1WBXB 3L95A 4EOWL 4QWWD 1KB5H 2YPLD 4MAYA 4Y88A 3ZYOA 2LTQB 4RAUA 4ZYKA 3DURA 3EJZC 4OV5B 1EHXA 1CT8A 3TBWB 4OCWH 5DFVD 4JHWL 4LPYA 1F6LL 4WI4A 1UWEL 2OP4H 4DKFL 4LOUC 3ZO0A 3SKOA 2HKHH 3KNBB 4DUXA 2YSSA 4P3DB 3GSWB 4YFLF 1M7DA 4H25B 2CK0H 4Y2DC 3BP6A 4I0PC 1S9XA 5F7KC 5TDNB 4XHJD 2YK1H 5DGQA 1MNUL 4YHKH 3BN9C 5SWZA 1A14L 1NLDH 1GXEA 5IHUH 4G9DB 5E5RB 5KSAC 5J11B 1ED3A 5HD8C 5F7WC 3SGDI 1CVRA 1MCWW 4FQ2L 4WEMB 1A3RL 3RVVC 3Q5YA 4WY7L 1U8QB 3T3MF 3VXOA 5IVXE 1J0YA 5GZOC 1M71B 1GGTA 3VWJA 4NNYB 3BW9B 1W0VB 3FFCD 3TA3A 3IXAA 2IWGA 2EYSB 2NLJB 4NBXB 1JNNH 3FQTA 1RZ7H 3LKRA 1KN4H 3VRLF 4EI5C 5DI8B 4Z0BL 3HE6A 5EUOF 4ZUVA 1JZ7A 4KK5D 3MRFB 3D3VA 1EHLH 5AD0A 4XVTL 5K9JH 5DR5H 5I75C 3HNTH 5ALBL 1BD2E 2W9EL 4UT7L 5LBSL 4PJHE 1P6FA 3RAJL 3QB7C 4HCRH 1XF3B 3D39D 3H9HA 5DT1L 4H1LH 3QQ4A 4WFHE 2FECI 5EOCH 3VXQB 1YUHB 1WBYA 5K9KA 5M94B 5IJKA 3BQUC 4GRLD 3BH9B 4OLZH 2C3GA 2NX5D 2OR8A 1LO3L 3V4PH 3VWJC 4S0TD 5E7BA 5F8QC 1KC5L 3THMH 1ZS8B 1AGBB 2B0SH 2I60H 4R8WH 5J1SC 1L0QA 3BPOB 4LCCA 2J8HA 1G7QB 3N0PB 3ZKQD 1U2CA 3L5WB 1DEDA 5LJYH 1OAXH 1YEFH 3V0VB 4J3WA 3C5ZB 3DROA 1J5OH 4JDVA 5BVJA 1S7WA 3RWEB 4DGYH 4BH8B 5LBSH 4TSBL 5IVXA 3F12B 2DWEA 3OXSA 1R5VA 2R1XB 4N90E 4OZ4B 2Z31C 1ZVSB 1QBAA 5SX5K 3GMNB 3QUMH 1A9BA 4LKCA 3DSFH 2PO6A 3EJYD 4ZO8A 4MAYB 3U0TA 4U6XA 2RQ8A 1QHPA 3IGAA 2IC2A 4G6AD 2MQ0A 1CT8B 5FM8A 3MUHL 1CFTA 1D9KB 4BZ1H 3BHBB 4P4KC 5FUCC 4K94H 1HHIB 5ICZA 3BKMH 1Y6MR 3UTTD 2FX8H 3NBNA 5A1AA 5JUEL 1FFNB 2CRMA 1QUNA 2VXSH 3AREC 4HKJA 2KQNA 4S11A 2BVTA 3L1OL 1AFVH 1TJHL 3HPLA 1ZLWK 3I2CL 3GK8L 1HKLL 5D5ME 3SGEH 5HHPA 4OZIB 4JG1L 2NY2C 1J5OL 3N1GC 4NQCA 5GRJH 2OS7A 5HHOA 3E8UH 1PEWA 1ITBB 4AEHL 4CW1A 3MRPA 3QDMB 1AQKH 1CLCA 2GJZA 1YY8A 2AK1H 1IE5A 5E1AB 1F4HA 4QT5A 1XGUB 3QUML 2WBWB 1PG7L 2OX5A 1FNSL 5F1KC 1ACZA 4OF8A 2DM2A 3GGWA 4R26L 5EOCL 2PTTA 5ID1B 3REWB 3IF1A 1OPGL 3BW9A 5ERWA 4PGJA 1F2QA 3LKRB 4TRPL 3RWIA 3ARTA 1I7UB 3PWPD 5EIIA 4YHNA 4DK3A 4S1SH 4UAOB 2GW5A 5EB9A 1QACA 3ARBC 4PFEA 4HMDA 4IDJL 5CS7A 4WUKH 3IDIA 5KVDH 4JFPB 2NY1C 4J3OC 3QUXA 3IJYB 4WWKD 4JRXB 5EWIH 6CGTA 3NCYS 4EI5B 4UB0H 1A6UH 4IMLA 5CD5D 1UWGL 2IH1B 3ZZ1A 1FFPB 3WIFA 2VDKH 1A4JA 3S3SA 3QULA 3SJVD 1UQSB 1NGYA 5C0GA 3P30H 1P4LA 1X5XA 2IAMC 3BPLC 4MB3A 5CJOH 5C0ND 3DTXB 4ERSL 3R0MA 1PAMA 3ZTJH 5I18H 5EOTB 3MBEB 4GRMB 2CDEA 4XCEA 1N5YH 2R4RH 4OLWH 1VFMA 4WI2A 4L3CA 3WUWB 2R1XA 4QHMB 4X9HA 5CWSA 4JG0H 5F9WB 3TT1H 3ULUH 4YDVA 1FVEA 2VDLH 3E6HA 4PJ9C 3OB8A 1S7SA 2OSLA 4CRPA 3PJSB 5KAQF 1IEBA 1IGML 4U6HB 3TVMA 5BRZB 3BRDA 5DUBA 2VDOH 1OTTD 1UM5L 2HVJA 2Z91B 4X6CF 5I1IL 4YGAB 1A4KB 4MS8A 4C56B 4HX1A 2EO1A 3RIFK 5JMRA 1ZGLP 1HSAA 5ESQB 2K3TA 1URLA 3T1FB 3V6FA 5T1LB 4X8JA 1LNUA 1MCJA 3BKCL 4OCSH 4LQ1A 3L3DB 5DTFB 2BSRB 2AXGB 1FZMB 4XVJH 3H8NA 5F9JB 3LN9A 4HKJB 3ZL4L 5IB4A 3K8MA 1LHZA 5JOFA 1L6ZA 3Q3GB 2FBJH 3RKDC 2BZDA 2MWCA 2WANA 3BPLB 1IL1A 2XIDA 3H7BA 4LBEA 3WEXA 1NEZA 1PJ9A 1NCUA 3VCLA 4GUPA 2R9HD 8FABA 5I6XC 1JNLH 1IC1A 4XXCA 3VXRB 1X5AA 2HTKD 3EO1B 1OD9A 1S5IL 4ZFZB 3MOBH 1U42A 3VG9C 1BAFL 1TETH 5I17B 5K59F 4JFDA 1FV1B 4KVCH 4QRUA 3RA7H 4FQJL 1HQRA 1FL6A 2EDTA 1FCGA 3C2AL 1TQCB 3D25B 4BH7A 3QPQC 1A3LL 1D5BA 3WSQL 3WN5C 5FA4A 3HTLX 1EO8L 4X4YB 2Q8AL 3W2DL 4KU1A 3JVGC 4J6RL 4HJGA 4UT6H 3HRPA 4FFWD 3QJHA 3CPLA 2ENSA 3FT4B 3VGFA 1RI8A 1T7ZA 1KYOK 5BZWA 4OGZA 2J6EA 3WD5L 3LS4H 3WFZA 3OGCA 3VFMA 2W92A 4E41B 5MEQA 1CDYA 5J6GB 1MAJA 3OHXB 3V79C 2LAAA 4EDWL 3JWDH 4D0CA 3ZTNL 4G6JL 5I8CB 4JFZH 1XF1A 4G43B 1F11A 1F4XH 4H5SA 5GGVL 1MJ7L 2HT3D 4ENED 2APXA 5MEOA 4Q6IC 1QVOB 1FPTL 1A0QH 1BJ1J 5IKCA 5INDB 4DJMA 3L5XL 2FO4A 4QRPE 1T0NA 4K3DL 4XCEB 2YN3A 3KPMA 4F80A 1EFXB 3EIFA 5ITBH 2X4QA 4C59B 4XPBH 5DVOA 4LHUA 3SOBL 3WFEL 1CGUA 5E08H 4E5XB 2AI0L 2H2SC 4PREB 3P9MB 4XB7A 5FGSA 1U93B 4OGAC 1KCUH 2OSLB 3KPTA 2B8OT 3S35X 4U7SA 1YYML 4M6NL 1FL3B 1ONQA 5JZ7C 4GO6B 5BO1L 4O2FA 2W07A 3NA9H 2ATKB 3QXAA 1Q72H 3W11C 1NBYA 3AC0A 4QNPF 4JO4L 3VGEA 1MIEL 4OLXH 4WVRA 1WWCA 3OKYA 3JWOL 4X5LA 2XRAH 2BVPB 1QP1A 2OXHA 1C8PA 2BFVH 5MEPA 1AO7B 4ZD3L 3NCCB 5GS3A 2J3SA 1FZMA 5GHWL 4GG8A 2VL4A 1DTUA 2VLME 4Y19B 5E08L 4GKZA 1FZOA 3D69A 2RIKA 2E9WA 4M8QB 2EDBA 4MZ3A 2DDQH 2RR3A 4J3VA 5BJTB 3GDBA 4W4OA 3IJHA 2CDFA 1KN2L 3D0VA 3WHE0 1MJ8H 5EBLA 1XIWB 3S34H 5TQ2L 1CD0A 1CD9B 4QRQA 2HT3C 4Y0GA 3QH3B 5SX5H 2UUDH 4FQXC 3PABB 5F9AC 3QXUA 1KELH 5BQ7B 3WS6C 4MQ7B 1T2QL 4D3CL 4ZPVB 5HPOA 1QR1A 4P4KB 3I75A 5L2KD 2BOBA 2J1KA 4BQCA 4LCWB 4QXUL 4J7RA 1MHCA 1S9YA 3CU1A 3X13B 1OTTC 4GXUN 1P7QB 1IAMA 2IPKB 4PBXA 1WCBB 2GSIB 1YPZE 2NX5A 4P0DA 3V4UL 4EBQL 2MQ3A 1RV6X 2A6DA 3MRGB 1KIRA 2WY3A 3UYRL 4RDQF 3BX7C 1YYLH 2C3XA 4YDIH 4C83A 3GO1L 5EU6D 3D85B 1MAML 3OGCB 4LPCA 1KN2H 4JFFA 5DMIL 3QUYC 5HDBE 3LB6D 3U48A 4EIZC 1S78D 3HS0B 3BGAA 4WHDA 2H26B 3HNVL 4H5SB 3EHBC 4HT1H 1FRGH 1BLNA 1ZLSL 5CD5C 2KL6A 5MEOB 4KVNH 1CG9B 2R9HC 3BQUB 5EUOB 4W6WB 1ZA3B 3WHE1 3REVA 3VFRB 5KVGL 1P53A 1QLEL 5D2NB 1K5NB 5HYSB 1EHNA 2JKXA 4LU5L 3GMQA 1QG3A 1IKFL 3MLRH 4EQ3A 4JGUA 5L2JA 3VG0L 2EXWC 2XICA 4HT1L 5IFJA 2HMIC 2CGRL 3EKCA 2W0PA 5DZLA 5T1KD 5GQBA 4MYWB 4ODTH 1UA6H 3UTSB 1CL7L 1OP3H 4K71C 5MEPB 1OTUD 4K94C 1MEXH 4A6YL 1NC2D 2D03H 3GMPB 1H3XA 3L5HA 1PX3A 3MRHB 5D1ZA 2IANB 4NBZB 3IRPX 5AAMA 5HHME 4XWGH 4KRNA 3NGBB 3CK0H 1W0WA 5C1MB 1UVQA 4AT6B 2ZUXA 1EMTH 5CFHA 4L9LC 1HHKA 4L4TE 4ELKB 4NC2B 4NC1E 4KRPB 4U1HB 5J3HC 5DMYA 4YAQA 2W1NA 5D6DA 4LEXL 1IC5H 1UKTA 3VFSB 3WKML 5FHBH 4JRXE 3LS5H 4NCDA 3IFPA 2CRYA 2VDPL 4JO1L 1EA9C 3P9LA 5L0QC 4Z95H 2QQQA 4Z7UE 3DECA 5FUZH 5TDNA 1U3HB 3BUYB 5J1TC 4X6EA 3D3VE 1FGNL 4OF3A 4WHTA 4PJ9A 4JQXC 3TCLA 2FGWH 3PL6D 4N0YH 4MMXC 2XFXA 1NUGA 4PRNB 3D85A 1CDGA 4MLIA 5C0AD 1AKJA 4CDGC 4GW1A 4TSCH 3D0LA 5EORL 4RNRA 4AIZB 1OCWL 1HXYB 1DBJL 1X5JA 4MA8L 1NBVL 5DD0H 4HULB 4OI8A 2V2WB 4NDMB 1XGYH 4M7LH 2YWZA 1WEJH 4IOIA 1JBJA 1K4DB 1FVDA 3SKUD 1CG9A 2XTJE 4DEPB 3WXVL 2XPGB 1DVFD 2BVUA 3NFSL 1UG9A 4EVNB 1K85A 5KVMC 4MJ6B 2YPLB 5DQJB 2FCBA 3MX0A 4JJ5A 2EDRA 4PJFE 1E4KA 3TYGL 1K5NA 3ET9F 3LS5L 4XTRC 3D3VB 5L6YL 5HYSA 3N1QC 2FJFA 5JDSB 1YN6B 4Z7NF 5TE7L 3RL2A 1DBAH 3R8BB 2VR5A 5ACZB 1H3WM 1AGFA 4KHTH 3MJ9A 3VA6A 5HGHA 12E8H 1KENH 3U2SA 5HY9B 2GKIA 3RZCD 1NMAH 3O2WL 3VGGA 1RZJL 4NP4L 2EDKA 4PYGA 4R4BB 2WBJC 4CVXA 2YMXL 3KGRA 1MLCB 5E2JA 5DT1H 5F8RC 3UTSA 4ERSH 1Y18A 5CCKH 1V7NL 2PUQT 5KN5A 4LCCB 4XRCA 2BC4B 2ZUQB 3T0DA 3MJ9H 5FYLE 2NY5H 1C08A 1ZT4B 15C8H 1FGVL 3GJFB 5FOBA 4D9QD 4XNXL 4V1DE 4YC2B 3BAEH 2JCCE 1YA5A 4QHLA 1UM4L 5IFAH 2AEWA 2O26U 1WF5A 3ARXA 5F1NB 1IGTB 1BOGB 3ARFB 5IVNA 1L8JA 2F5BH 3ARFD 2VDOL 4N5EC 1BVZA 2VQTA 3RGVD 4LEOB 2NZIA 5K33A 2EDQA 3QO1B 4A2MA 5J13C 1OARL 3OKMA 4LKCB 5HBBA 4G8EB 4HUXB 1EEZB 2FGWL 4N0YL 3VWJD 2E3VA 1IC7L 4HBQA 4KGLA 2AEQL 3P4LA 2AJ3B 4WIQA 3P4NB 4XCNA 2Z93A 1D9KA 5H37H 3LKPA 5SWQB 3M17A 5JLZB 1HHIA 4M7ZB 3N1MC 5KSBA 5D6CB 1FFQA 3A67L 5H35B 4RA3A 3KYAA 4JZJA 1Z9SA 3MA9L 3HPJB 4S1SL 3R1GH 4NSKA 2A6IB 4F7CB 5IJVA 4RWYL 1MI5E 2HRPH 4YH6A 4U1IB 4LLUA 1KLFA 2BXZA 1DLFH 1X4XA 4KHXL 4KK8D 1KTDA 4Q97A 2WSKA 5HHPB 3GHBH 1MHPL 5C07D 3PDOB 1WJ3A 3MREB 4TULL 5EWIL 1JF5A 4TUKH 1A6PA 1NDGB 3GI8H 1KPRA 3LKNB 4MA3B 1JCKA 4CW1B 3PIQA 2H3NA 5IW1B 1HHHA 2NX5E 1E28A 3RX5A 3QFDA 1I1FB 2Z9TA 3GBNH 5IIEB 5ALBH 3WDHA 1BM3H 2X44D 4LF3B 3RWDA 5FKPA 3S36L 3W81A 3MLWH 3GIZL 4B5EA 3REWA 1UXSB 1ZT1A 4OCNC 4ODXB 5IGXH 2VXTL 3QIBA 4K8RC 3IU4L 5CMAB 3VWKC 1FSKB 1TCRA 5E24E 1PZ5B 1FN4A 3U30B 5HYQA 3EO0B 5HPMA 2EICA 5CSZB 4UUJB 5CP3A 2W65A 4HLZH 4EDXB 2AJZB 4XX1G 2EEDA 3RWHB 2P44B 2XQYG 1CTNA 4MA7L 5EFIA 2F54B 2R2HA 1G7LB 2MCG1 3TZVB 3BGMB 1JGLH 4WUUB 3PWPE 4IRZL 3OKOB 1HYRC 5HY9A 4WUUD 1I8MA 3FB8A 5FV1L 1Z9OA 2O5YH 2C3VA 5IUSA 5F89B 1WWAX 2OBGA 2ZSVA 2JLLA 3BUTA 1NGXB 2XV6B 1Y18B 3INUL 4P3WA 4MXWL 1ZTXL 1NGYB 2AS5M 1M6OB 4PBWD 4P2OD 3TH4T 4HFUL 1OB1A 4U33A 5C0AE 5L2KE 1FNEA 3RWCA 5AZEH 5FA3A 3RBGA 1SYSB 3I84A 2YD5A 3KJ4B 2OL3B 2X6MA 1P4IH 5SX4H 4LCWE 4ORZC 1S7UA 1DUYA 1F6AA 4PP2B 2EYRA 4LEOA 5JA8B 3VXTB 3HUJA 1KJMA 4O51A 3WE6A 1P9MA 4JRYE 2ITDB 4I0PA 4KHXH 2X4RA 4TYUA 3SPVB 3G6DL 1U8HB 1F13A 5GGSA 4PJ5D 4KROB 4KK9C 3PGDB 3WUWG 1RIHH 3QEHB 1L7TH 5T3ZD 4PJBA 3B9AA 3ARYA 5D2LE 1KCRH 4JZJB 4HEME 4H0HB 2WINB 1BVLA 1AGDA 1U8PB 4JFFD 4NSKB 4OM1L 4ZUUA 4GAYA 4JREC 3QG7L 4PJGA 4LLUB 3WJLC 1MJ8L 2RGSA 3UX9B 4MVBC 2B39A 3VI4E 4JLRB 4XVJL 4ELMF 4JO2H 2C5DC 1W72H 3PDOA 4QY8A 2X4SA 2IADB 4N8CH 3VGBA 1VESA 4ZFOB 4X7FC 1IFHL 1DQLH 2HAZA 1TMCA 3O2DL 3MGOA 3MBED 1OL0A 3QIWD 2NW3B 4DGIH 2LVEA 1AC0A 5CIPA 4GLRI 3QQ9D 1JHLH 4M61B 3S88L 2D7MA 4ZQKA 2P49B 4NO5B 1K6QL 5D1QB 1VA9A 4K3JH 3NAAL 3QFJB 1MF2H 3NCYP 5KVEH 1CS6A 4P2QA 4RGNC 4LCUA 1MFDL 5D93B 1L7IH 4FQQB 5FDWB 2D7QA 1MVFA 1QFWL 1YPZF 3NFNA 1KV3A 2A1WL 5CIPH 2BNRE 4S1DC 1P4IL 4W68A 2HJLA 2VXVH 4K3EL 3MLYH 3VFMB 1RURL 1DDHA 1C16B 3EW3B 1L6XA 5IEHA 4GW4B 1IEHA 5IV2A 3OKLB 4WNQB 1T66D 2Y5TA 2V9QA 4P2OA 4YEFA 5D9SA 5A2LH 1RSFA 4U0RC 5JQ6H 1FNEB 4JY5L 1FORH 1Z9LA 4F7EB 5DRXA 1F4XL 4OLYH 3ROLA 1VGKB 1IKFH 1PBYA 3ILPA 1QSEB 2CIIB 1JNJA 5D2LA 1F6AB 3DV4A 1T1XA 1XGRA 2EKSA 4YK4C 3T3PE 3N85L 1U93A 3TO2A 3C5JA 2UZIH 4DN4H 3QSKB 5DRNB 1RQ5A 1RU9H 3D3VD 1L7IL 2Z0BA 5MENE 3GMRA 2H2PD 1DN2A 4P48A 4PP8C 4HH8A 4H8WH 3ARDD 2YRPA 4UQ3B 1INQB 4KTEH 3QI9A 5I73B 1JWSA 1JI2A 3KPRD 4U2ZA 1Q94B 3T3ME 1D6VH 5C0BE 3QIUA 4ZTPL 1JGDA 2E7LA 2ENYA 1J1XH 3HI1A 3IDMA 4WDIB 5IROC 5ESVA 2ZOLB 2FSEA 3DX7B 4HLJA 3RTQB 4GH7B 1NGQL 5TDPA 1A6AA 2PYEA 3EBAA 5C0IB 3TFKC 1VGEH 3L7FA 2I9TB 1HHJA 2AV1B 32C2A 2QQLH 2WUBH 3MYJB 2CDFB 5C70A 2FYYB 2NYYD 3GKWL 3PXJA 4P2RE 5FYJE 1BQHG 3G5YA 1G7JA 4LSUL 5EBLB 1MFCL 4JRWA 2ZSWA 5KS9B 1B2WL 3BSZH 1T89C 4XPTL 2VABB 2WBJA 3QIWA 1GC1H 1BGXH 1AXSB 1VFAA 2R0ZL 2VN4A 4TNWF 4KQ4L 4MXQD 5K9OA 4N8PA 3PQYA 2W60A 1BEYH 2ERJB 5HVHC 3MLYL 4B50A 4OGXH 5FM5M 5HYSG 3O81A 2R2BA 4HIXL 2DBLL 3BZ4B 4ZDHB 1R0AL 4I18C 5JHDB 1G9NL 3KS0J 3A0OA 4MCZA 4EDWH 4HK0B 2AQ1A 3BPNC 3IDNB 3HE7A 4FQQA 1NH6A 3QG6B 5FDWA 1CFNB 1BJ8A 3UTQB 3IDGB 5DF0A 5BS0B 2FR4A 2VLMD 5TJWK 3PDGA 2DQUH 4PJFA 4KY1H 5LKNA 4NKIH 3GHEH 1I3RB 3V6OC 4C56E 4OAWB 3JWNC 1HNFA 3D5OF 2Y6SC 4HJ0C 3RDTD 3EHBD 3HNTL 5T3XD 3HMXH 5JIHA 3LQMA 3TGXA 5BOZG 2XKNA 4X6CE 3T2QA 1J0KA 3HLAB 4P46B 4LBEB 3UJIL 2YPKB 3K0WA 1QFUL 2Y5TB 2COQA 3QWOB 1X7QA 4NM4L 4TUOB 1D5XA 5HHQB 1LILA 4JRYD 4R7DA 3RWJA 3ZDXF 1UH2A 3F65A 1OAKL 1QSFA 3SDCC 5DA0B 1MVUA 4OSUL 3WFDH 4F7EA 1HH6B 4PIRF 4NNXB 2XY1A 2F54E 1F97A 4X83A 1T6VN 3OJVC 2R1WB 2XXCB 5H94A 3IDUA 12E8L 3T04D 5I1KL 3GMQB 5HVWA 4D9RD 5I19L 5L7XH 5I1JH 1RFDH 3B9DA 3GMOB 2FX7L 4G8IA 3TO4C 4MCYB 4NZUL 3TBWA 3O9WA 1DBML 3SCMB 3OJMB 1KPVA 1KIPA 3QDGA 2XYCA 3QUZD 1M7DB 2B4CL 4H25A 1FE8L 4I9WD 3S4SG 1JPST 4JM2C 1DBKL 1QA9A 2VXUL 3AXLA 5D7JB 5H2BB 3RQ3A 3C60C 1X6NA 5JXEA 5EG6C 4YFDB 4GSDH 4DVBB 2RAMA 5GISL 1S8DA 3OAZH 5IVXF 4DQOL 5F7YC 3K4AA 1OSZA 5D1ZD 3OAUH 2QBWA 2DQTL 2I9TA 3MRHA 32C2B 1EHLL 2HN7B 4APQD 4QXUH 2FX8L 3T4AB 4X98B 4ETYA 1FH5L 3N50A 3TF7C 1XIWD 3OMZA 3G5YB 3PE9A 4U1GB 3ZSSA 3RVUD 1KBGL 1P4BL 2R0LH 1NBVH 4K3GA 3FFDA 3G5VA 3RUGB 1MCSA 1U8JB 4R97B 5I19H 1FJ1A 5L7XL 5EO0A 1CYGA 3FL7A 5HHMD 1QFWM 3OR7A 4HKZB 4GQ9L 4AZ8A 1KTLA 4H0GA 3ULVH 2V2TB 4BK4A 2NY0C 5DI8A 1DBMH 2EEAA 4PLNC 5E8OB 2ICWB 4PJ8D 1IARB 5JZ7D 3PWPB 1XGTA 1BBJB 1OQOA 4H0IA 5JW4M 1T1ZB 3F58L 1N5YL 4LLVA 4X5WA 5E2VH 1KUMA 1MCPL 2UUDK 5GZNC 5GSVA 1YEHH 3JVGA 5C07E 1GGCH 4NM4H 3UTTB 1RHFA 3P73A 2VDNH 5DFWH 1SJHB 2R0WH 3O6MH 1FIEA 5IB2B 4ZXBC 1UB6B 5A2IH 1WBYB 4OSUH 4LVNB 4MNHB 1BQLL 3D85D 4IDLA 4U1KA 5DDHB 3HR5A 2HH0H 1U3YA 3GSNB 3QDAA 4M6ML 2J2ZA 3M45A 2G5BA 1QEWA 2XY2A 4M3JA 5F71A 1D5ZB 3AFLA 3CX2A 3SQOH 4ZFFB 3JTCA 3CXHK 3V4VH 1AGEB 2NY4B 3C5SB 5AZ2L 4LLQB 1DUZB 2NW2B 1YDPB 4N0RA 5C6TL 3OXSB 4OIIH 4TPRL 3O8XD 1FE8H 1QYGL 2YD4A 1OAZH 1ZVSA 2VR4A 4MJ6A 4MSWA 2L0DA 2P5ED 5E6ID 1CDUA 4IMKC 1RJYB 2EIBA 3QIBD 1G7HB 4B7IA 1BFVL 5AYUL 4JPWH 2FJFB 5EO9B 5CZVL 5BRZD 2H32H 4Y1AE 2QSQA 3G08B 3O9WC 2UV3A 3QPQD 5T1KA 4XVSL 3OJDA 4K9EH 1UCBH 3O3DB 2Y7QB 5GJTH 3BHBA 3TJHA 4D2NA 4UOW0 4YBLC 2DQEL 5D93C 3RNKA 4WI5A 5E95B 3ARVA 1J8HD 3ULVF 3QNXB 5HYJA 3MMEA 4FQXA 3TYFA 5K59E 3FN3A 3MV7D 5JXED 1KENL 1R3JA 3S4SA 3MV7B 2HTKC 3O41B 1WIOA 3CFJA 1AQKL 4U1GC 5J6HA 1NCTA 2AQ2A 2HRPL 3MJGX 5CBEB 3GJFA 3WLBA 4H8WC 4APQC 5K9QG 3N9GH 5CJQH 2X42A 3WFCH 4Y16B 5D1ZC 4NWUH 3B6SA 3U46A 1RZFL 4OCYH 1J8KA 4GXVL 1BIIA 1NJ9B 1RZ8A 1INEH 1GVIA 5F1NA 1KTRL 1MFAL 5E1AA 4K9EC 3G6DH 3NIFF 3QEUA 3W0WB 4JEGB 1IL1B 4QXTB 2P43B 1HHGB 5IG7B 5HHMA 2QHLA 1TVHA 3KPPB 1CD1B 4FZEH 2VDQH 3HR6A 3WNNA 1IT9L 2J8UE 1ETZA 3FO9B 2ARJQ 4W6YB 2BK8A 2OJEB 3LEVH 2ESVA 5JPMB 4ALAL 1A6WH 1OLLA 1EBPA 2N56A 4D9RE 3SDXB 4NQDA 2VZUA 5EZJA 3T0VA 2JF1A 1NCBH 5FO8A 1RZIA 2A38A 3B5GA 3T0EB 4PRHA 2VH5H 3HE6C 2W0FA 2OI9C 2Q76B 1UEMA 4YWGL 4Y5VA 1BECA 1F4YL 4YHOL 3F5WB 4X7TB 1TQCC 5L8LB 3MA9H 1IFHH 4HH9B 5EA0H 2OR9H 3FCTB 4E41D 5J12B 3NA9L 2OK0H 1CICC 3PIQB 5FYKL 3WIFB 3TBTA 4LSSH 3HZKA 1RULL 3EGSB 4K7PX 3U6RA 1FYHB 5JTWA 4GAGL 5FK9B 1A21A 5AYQA 1U36A 1K6QH 3TT1L 3ULUL 2V5TA 4O2CB 1FNHA 1DFBH 3LS4L 5HYFA 2OZ4A 3AS1A 5GRUL 3EOBB 4HUUA 1ZT1B 1NC4B 1MQ8A 2P48B 3NFPB 1I7ZB 5CMAA 1O0VA 1GYAA 3MRJA 35C8H 4LFHD 3GIZH 5HPMB 1I7TB 4L1DA 1UACL 2D31A 1QBMH 4QRRE 5BRZA 2BNUA 1CU4H 3TVMB 5DUBB 4PUBL 4I18B 3QZWB 2NY5L 4YHYC 2OZ4H 3UTSE 1R24A 5JW5B 4WW2F 5D1XB 4X6CB 5ESQA 4Z7WF 2X4OA 3V6FB 3FB8B 1A5FL 4NUJB 1KCGC 1LNUB 1HEZB 5HYJD 1LDPH 2VQ1B 2BVOA 4RMSA 4R4NC 3MNZB 2DQCL 1OP9A 4Y19D 1IEAB 2GSGA 1I9EA 3NCJL 4BKLB 5F7DB 5EUKA 5J6HB 4AQ1B 3H3PH 5F72S 3QRFM 1OB1B 1MPAH 5DHXB 5ISZE 2ZG1A 5C0CE 5D7IA 5LCVH 1BIIB 1VACA 3GO1H 5MI0B 3FT3A 3FT2B 4UILH 1A2YB 1S9VA 4P59H 1E0OB 3W0WA 3HUJB 1AJ7L 3G6JB 3TPUA 2R4SH 2ITDA 2VNCA 3BP5B 4JQXA 3BEWA 5F7UA 4N8VA 3VFWB 4PTTB 2VLJA 4L4VB 1MWAL 3BIKA 1J1XL 3JSSA 2P5EE 3DXAB 5ESAB 2Y07H 3HA0A 5ADOH 2Z8WC 4TUKL 1BJMA 3K4ZA 1I8LA 4MQSB 5IBTL 3LPGA 1U8KA 2EXYC 1BVLB 1Z0NA 4Y1AA 4P23B 5I8EB 1TNNA 4F9LC 1F3DJ 4K2UH 4PTUB 5BZWB 5HHNB 4D9LH 5T5NG 5IHUL 4X7TA 4PJFF 4J3UA 4OFPA 1AGCB 1PKQE 5MEQB 4O5LH 3FQRA 2X4UB 5AG9A 4KZEL 4JY4B 3QWRA 5EO1B 2ARWA 1IZKA 3UC0L 3MRDB 2I5YH 3ULVC 3UBXB 5F7NC 1R3HA 3SGDH 5FK9A 4FN0A 3CUPB 3H9SB 2FX9H 4GRLC 3BQUD 1X4ZA 4H1LB 2EYTB 1A5FH 4ZQKB 4DK6A 4LHUB 3G5XB 3RJDA 4H20H 3WNMA 5I1HL 5F1IB 1UZ8A 4D9LL 3A6BL 3GI9H 2OTUB 2ZZUT 5IBUG 4Y8DC 1WBXA 1T5WB 3L95B 4NFDA 4Y2DA 4Z7OE 5DK2B 4GRWH 1N64H 2P7TA 2ZJSL 4PJ5B 2W0KA 25C8L 4JFFE 4XP9H 4YR6A 4HCRL 3IXTA 4NM8H 1P9MC 2B2XH 5D1XA 2WP3O 1WZLA 3VXUA 1RMFL 5T3XL 2CXKA 1YPZA 3FTGB 1C5DA 1Q9OB 5B39B 4XGZA 2Z8VC 2CSPA 4XP5L 2ZUYA 3BDYL 2NY7L 4MZ2A 2OQJA 3VDBA 4NGHL 1FZOB 4P2OB 4M8QA 4G9DA 3CFBA 4UOJA 3VFTB 4HBCH 3L3GB 3STZA 3VFVB 1YMHA 1E4WL 5CZXC 1VGKA 5T1DL 5GPRA 4HUWB 1DVFA 3RWFB 4CVUA 1CXFA 2QEJA 3LMJL 4I0PD 4RAVB 3CFDA 1T1XB 1Q9KA 4I2XE 2B5IC 2PTVA 3BEWB 5C9JB 4NNYA 2W59A 4N8VB 2ICWJ 3MFFB 4LCWA 5BMFH 1O7VA 3FQTB 1WISA 2VIRA 3IB4A 3X13A 1SBSH 5F93C 4ZUVB 3TESA 2IPKA 3ES6B 3L7EA 1QO3A 2P5WA 1AI1H 1IKNC 3MRMB 5SWSE 5CGYC 4FQIH 4JFXB 1KIRB 4NZTL 2VTFA 4JO3H 1MRFL 1S9WB 1X5GA 4OQTH 3H9HB 1JUFB 4EJ1C 3ULUE 4EEEA 1ED3B 3OZ9L 1MCOL 1N0LA 1RAMA 4LHQB 4Z77A 1JHKL 2CR3A 4PGDA 1ZGLA 5I8KH 3PGFH 1NAKL 2ORBH 3S7GA 1AP2A 4RBPK 3LN4A 5DZOA 3SN6N 4APQA 1J05B 1HDMB 1IBGL 2JB6A 2V7HA 5IT2H 3MLXL 4XNUL 2YMXH 2PXYC 2V5MA 3BQUA 3H9SA 1Q9WB 4BH8A 1G1CA 5HSFA 1KIUA 2W60B 1IAIL 1P7KA 1ULVA 3EYVB 1QRNE 5KSAD 4G6FB 2R2BB 5FB8B 4ZPTA 4YDLB 1DBBH 3U0WH 3PDDA 3TZVC 1T0MB 3Q1SL 1XMWA 2CR6A 2HJKA 4YEEA 2YUWA 4BQBA 3RVXD 4NQTA 4Y2DD 3LQAH 3RVXC 2KKQA 2XQBH 4KMQA 4YLQT 1PYWA 5GGTA 2CRIA 3BPNB 3NABH 3LPFA 3OPZL 4PLJC 4AL8L 1P5VA 5IFJB 1OARH 3E8UL 2FO1A 4L8BA 4K23L 3MNVA 1N59A 3U4BH 3EFFA 3F7QA 2ICCA 1AY1H 1BX2B 2EIZA 4YK4B 4RSVA 1MY5A 4G3YL 5FYKD 1DBKH 4Z78B 2Z92A 1Q1JL 3HPLB 5HHOE 1GPOH 1OGAE 2A73A 4XNUH 5BVJB 1S7WB 3SE9L 1NFDB 2J4WH 3DO7A 3PV6B 2DD8L 1JPFA 2YBRB 4NO2A 4RIRA 4U05A 4P2RA 1PQZB 3FZUC 1DVFB 4DAGL 3KYOB 1DQQB 3RX8A 1YY8B 1BZ7A 3ZKND 3FO0L 4QT5B 1KBGH 3FMGH 1KJ2H 1T04B 4ELKA 3WCYA 1UADC 4LSRH 5DJXA 2BSED 5J1AA 1A8JH 5IBLC 3QI9D 4WO4C 2PTUA 2YWYA 3MV8B 4DW2L 5ID1A 2Y06H 4NN6C 5DK3A 4HWBL 3PGCB 2XTJD 5ICZB 2ADJA 1WC7A 4NQCE 1UWGH 5E2WH 3UPAA 2GTZA 1KCSL 5IESL 1X5KA 3IFPB 2P5WD 4WFED 1E4KC 3LHPL 4F3FA 5C9KA 3QCTH 3U4BL 3C6LD 1QRNA 1QFOA 1HWHB 4LRNH 3FN0H 1LD9B 5KZCB 3VFOA 4NKMA 3LD8C 4MJIB 2F53B 3QO0B 2D2OA 4XCYA 2XFXB 3DIFB 1JIBA 3AAZA 3FQWB 2F8VA 4GKOA 5DJYA 4LGPB 4X98A 1AP2B 2YUVA 2OJZH 3VFPB 1MWAA 2JB6B 3QULB 3Q48A 1UZ6E 4ZO9A 2W91A 1DEEB 4JDTL 4UIKL 1N6VA 1P7HL 4NHCH 1U95B 3WUWA 4OD2A 3UJTL 4O02H 5AWNL 1T7VA 3O2WH 3F8UB 2E7LE 2YHGA 4NFBA 4G5ZH 3LVEA 3PJSA 5CJBA 2BHYA 3BAEL 4GMTL 5D5MB 3BT2H 2GI7A 4JRXA 1M7IA 4KPHH 2BSSA 3NCFB 2YPVL 1EJ6A 4HX1B 5EZLB 1HSAB 2X89D 4U1KB 4DKEH 1H0DA 1YC7A 4X8JB 1GIGH 1FFPA 3FQXA 4KK6C 4ZO7A 1RZGB 5HGBB 3CMGA 3BE1H 4OT1H 5BCAA 2Z92B 2IQ9L 3ULUD 5JOFB 3CDCA 3R0NA 2VITB 1NEUA 2XQYK 4HEPG 2W9LA 4N0CD 4OFVA 1MI5D 1BBDL 1T22A 2QQKL 4OLVL 5HHVL 1SYVA 5FO9B 4G5ZL 4QHLB 4JDTH 4L3CB 1JPFB 1BD2B 4IRSD 3DBXB 4P2RB 4TVSa 1T7WA 3MJ7B 4QXGL 1IKNA 4OZGE 3L3JB 1S7SB 2VC2L 3U9PH 2DLFH 5I30H 1ZV5A 4N8CL 4JFDB 3UTTE 3LZFL 4W81A 3UPRA 1UJTA 4BFBD 5EU4B 5JXAL 4FXGB 3U9UB 1A64A 3V5HB 3T1FA 4KUCF 4ZTOL 4JFHD 5D6CA 4H88H 1ZA6A 2AXGA 2NXZC 3MMEB 1EZVY 1CDIA 5GIRA 1FVCB 3CH8A 3KG5A 4QRTB 5EU5B 2IFGA 43CAB 1L9MA 1R3LB 4ZOBA 3QWRD 4RX4A 2NY5C 3QCVH 1F4WL 3CPLB 2F53A 3QO0A 2IPUK 5E6YA 3PWLA 4OKVA 2AVGA 3KLAB 1NEZB 1I1AB 1YN7B 4F8QA 5I9QC 4NO3A 2PN5A 4WHCA 3LQZA 4FQCL 2OR9L 1CLZH 4HAFA 5ELIA 1HHHB 4ZFZA 3E3QE 4HHAB 1XCTB 4MNQD 2NY4D 4QXGH 3VFPA 4V2BA 4GRWB 3BOVA 1N8ZA 3EYUH 1QVOA 4J4PC 4Z7VE 2XZAH 4KPHL 1QBLL 2OMNA 2VDNL 4PJ8A 4CNIB 1T0NB 1GZPB 1CDJA 2EH8H 3S98A 2C4XA 5SWSB 4P9HC 1H3UA 3ZE2F 3IDYC 3RKPA 3H3BC 2NXYC 4LVOC 3VD9A 5JPMA 3VW3L 1R3IL 1RJLB 2DQFA 5FF6A 5E94A 1IAOB 3BE1L 5DO2D 1QSEE 5LVEA 3F7YB 5LXGH 1QLFA 2AJZA 4M1DH 4U6VL 3ZLQC 1ORQA 1A7NL 5EFIB 3D39B 4FXKB 4KKBD 1XF5B 5D2NE 4Q74A 3SDYH 3VRJA 4NQCD 3BKYL 3NACL 3F5WA 1RU9L 5ILTH 1ADQH 4E41A 1I4FB 3IDXH 1JWMA 3T3PF 4X5XB 2VUYA 3U4EB 3DVGB 2Z31A 2ZSVB 1MCWM 1FZKA 1F11B 3DGGA 4FFYL 3JUZA 2Q7YA 2Z8RA 4LDOB 2AEIT 2D3VA 2X05A 1LK3L 5TE6L 3VD3A 1C12A 4GKZB 1JN6B 2NY3D 5EC1A 2DQHL 3MRBB 3V6ZB 1RULH 3BO8B 3LY6A 2WP3T 2NTSP 4KJQD 4OGYL 3G04A 4P4RB 2GQHA 1MY7A 1KG0A 1QKZH 3SY0A 4O51B 1B6UA 3OKKA 4OD3L 3VU2A 2D31B 1GGYA 4P59L 1EZVX 4LP4A 1A7QL 3QZWA 3KLHC 5GGQH 5EZOH 1CWVA 3KPSE 1VKXA 2N7AA 3KPQB 2W38A 1QR4A 3ZE0E 4BSVA 3AROA 3EYFA 35C8L 5F7LB 5JPNA 1LK3H 5TE6H 1XZ0B 4P49A 4OFYD 3QUZB 2Z35A 3AY4A 1B6DA 3SOBH 2VQ1A 1CGTA 1QSZA 1AGDB 3RTQD 3DYPA 2YRZA 43CAA 3RL1A 3HFML 2UWEE 2AGJL 5SWZD 2VLKA 3OSKA 3E1F1 4ZUWB 5BO1H 2GK0B 4BSWA 4JGMA 4LL9A 1DQDL 5AEAA 4LLWB 2X4SB 2IADA 4G6KL 2ED8A 3MRRB 5DD3L 1AXTH 5LXGL 3KPNB 4YIQA 5FKAA 4HHAA 1S9VB 3HS0A 5DJ0A 3LRSA 3NAAH 1KF9B 3HC0A 1N8ZB 1QZ1A 4ZPVA 1AE6H 2BY2A 4KDTA 2CGRH 4JPKH 5D1XC 4PTTA 1NFKA 3FFCA 3S5LG 3WDJA 1FIGH 1F4YH 4HC1H 5D1QA 2N4IA 3VFRA 3O9WD 4GBXD 3HE6D 3A6CH 1WBZA 2JELH 3GEWB 5C0EB 5D7LA 3ZYZA 2OK0L 5I71C 4A6YH 3CSGA 4HIJA