2Q7YA

Structure of the endogenous inkt cell ligand igb3 bound to mcd1d
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
273
structure length
269
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
publication title Crystal Structures of Mouse CD1d-iGb3 Complex and its Cognate Valpha14 T Cell Receptor Suggest a Model for Dual Recognition of Foreign and Self Glycolipids.
pubmed doi rcsb
source organism Mus musculus
total genus 70
structure length 269
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2q7yA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2q7yA01
2FSEB 1J10A 3P77A 3ALXA 3BPCA 4PTUB 5T33H 3BEVB 1NPUA 2LU3A 4QHLB 1CE1H 2DKSA 5EUKB 1XGPB 2HN7B 3EJZC 2PXYA 2GYSA 4NRZA 3GMPA 4F15B 3QHTC 5HHPB 1PX3A 3IDNB 3UP1A 3F58H 5BVJB 4CAGA 1G1YA 4EIZC 4YBQD 5FHAH 3TO2B 5DRXA 1ITBB 2NW3A 2IH3A 1F8TH 4GBXA 5SWSB 4JPIA 3V6ZB 1N0XH 2XN9A 3CX5K 1NANH 1KCVH 1MJ8H 3VGGA 1DN0A 3VD3A 1NFDB 1IAKA 2R29H 3HCVB 4OBSA 2Q76B 1KN2H 3ARDD 1MF2H 4P2OA 3L3JA 1BJ1H 4XXCA 3LD8B 4MD0B 1FFNA 3ULVE 3ZE1F 3OR7A 3QIBC 3IFPA 1QSFB 4ZFOB 3ARWA 5F8RC 3BH8B 3DUSA 4P46B 5J06A 2FWOA 3PWPB 1EPFA 2OSLA 1ZEAH 1A7NL 3MJ6A 3O6FD 3GKWL 1A4KA 1D6EB 4KGJA 2JB6B 2GIYA 3RGVB 1I1AD 1QBMH 3NA4A 3PUCA 4QTIL 1NQBA 1V3KA 4RMUA 2FDBP 4D0DA 1TTFA 2NX5A 2XPGA 1DBKL 5JR1H 2C4XA 3X3GH 2DN7A 1QG3A 3CDGA 3LEVH 4XAWL 4MA7L 4UU9A 3IDYC 4L3EE 1P2CB 4LAQL 4MJIB 3CNKA 3WIFB 1OB1A 1T6WA 3C08H 1YEDA 4FABL 5K9QG 3W5NA 2VR9A 5BZDB 4ISVB 4Y1AE 4QF1B 2QHRH 5CEYB 5ICXA 1VESA 4L3ED 4PRHD 3IGAB 3QEQE 3KPMA 3VI4F 3TYGH 5KVMC 4NQCA 1KEGL 5E2UL 2BNRA 5DD5L 1WAAE 1UZ6F 4XNMA 5B4MD 1Q9KA 3VCLB 4KVNH 3QEQD 3RTQC 3ZYZA 4U1IB 1MIMH 2XQBH 1U3YA 3GSNB 1TCMA 4XPFL 5I19L 5KS9B 4YGAB 3PABB 4HUWA 3ULUH 7FABH 4GAGH 2WBJC 4GAFB 2W60B 2OTUB 4RMVA 3FRUB 4K7FA 1OTUD 4C57C 3ARFD 5FGRA 2HG5B 5JO5B 3DTXA 1CFNB 1P4BH 1BFOA 3NCEB 5EBLA 2HFEB 1KULA 4IMKC 5IKCB 2I26N 3QO1A 3RWCA 3VXSE 4JVPA 8FABA 5IK3B 1T0NA 1Q0YH 3B2UD 4J4PA 4X6EB 3WN5A 4NGHH 2AXGB 4WI8A 4G5ZL 1ZA6B 4OQTH 3DUHA 4GSDH 2XZAH 2N4IA 2YPVH 3DV6A 3MNZA 5DJZA 4ORGB 1RZFL 3VXSD 2GEEA 1S8DB 3HFMH 3SCMB 3H42H 2FJFB 5DD0L 4MZ3A 2ARJA 1YPZA 1S7VB 1NCAL 3MRMB 3P0VH 1PBYA 4WEBH 3TPUE 5GGVL 3LHPL 3EJYC 2DWDB 4W4NA 4MA8L 5I74C 3MREB 5JQ6L 4YC2B 2NY2B 4PJXE 5E1AA 5JOFA 4BZ1H 43CAB 3IDXL 1FYTE 1RZKH 1E4KA 5JW4R 4ZNCD 1SHMA 2A9NL 1UXSA 5E9DE 3ILQC 3NGBC 1JK8B 4APQB 3BIKA 5C9JA 3VG9B 3V4UL 3NACL 1HZHL 2C1PB 5T3ZE 1RIVL 1TCRB 3U4BH 4OLZH 4GRLA 2XZZA 4HS3B 1A3QA 4GS7C 1RY7B 5D7JD 1AKJB 5CP7A 3O0RL 5D1ZC 3VMPA 3VFVA 1NCCL 5EZLA 4ODVL 5C6TL 2KBGA 3TYFA 5CWSA 5DEFA 2VRAA 1ETZB 3O4LB 4QTHB 1PYWB 3O6MH 5E2VH 4P59H 3IFLH 2GFBB 3BPOC 3DX8B 2EC8A 3WHE0 5HYJB 5IMKB 3QEHB 5FKPA 1RU9L 4WDIA 2E7BA 1XMWA 5GJSL 2R9HC 1EGJH 2D0FA 4LCIH 1F2XK 1JGEA 4NQDE 5C0GB 4P9HC 5DQJB 1QSEE 3T08A 5GGQH 1ZVSB 4JO1L 2MCPL 3V6OE 2NTFB 2I07A 4LGRB 5I1GH 2J2ZA 1C1EH 5E7FA 4OZIF 5GS2H 1DE4B 1U8PA 2DL9A 4OZGE 4NT6B 5E8NB 1MVFA 5IGXL 4NQDD 1QSED 4D9LH 2DDQL 3GM0A 4OFPA 3VH8A 5JDJA 3RWIB 1F3DJ 3S98A 2FIKA 3DXAE 2FATH 4MX7B 1A6WL 2OBGA 3G5YB 3UTPE 1LK3H 1EEZB 2FD6H 4RRPA 1R5WB 3VRLF 3QRGL 1NEZB 4WUUE 4EDWL 4X6CF 4LCUA 4C56B 3UZVB 2I5YH 1NFIA 3DXAD 3ULVC 1QEWA 3V6FA 5ISZA 4LNVA 1YEHL 2H32B 2IBZX 3KPOA 2ESVB 2LU7A 4ZXBB 1NGXB 2R2HB 1IT9L 1WZ1L 1L9NA 5C09A 2BP3A 2DMKA 3IB4A 3D2UA 2PKDA 2H41A 4UOJA 4OD1L 4PY8I 4K3JL 3VU2A 1LO5A 1B0GA 4LPXA 5LXGH 3H7BA 3QUXB 3OAUH 2Q6WB 4M7LH 5HYFA 2IH1A 5FYKU 4JFED 2NY4D 4OZFB 5JIIA 3O9WC 1LE9B 3S4SA 4EVNA 4NRXA 1CLCA 1ND0B 4PRPA 4I9WE 3QHZH 4Q6IB 4Z7UB 1N8ZB 3ARBC 4ODTL 4OLUL 2IPUK 3JV5A 2VLRB 4HW6A 4LFHD 2OTPA 3RX5A 4KGLA 1RMFH 1QNZL 4W4OC 4LSPL 4X0KA 1E28A 2FZ3A 2KKQA 2UWEE 3MV9E 4YDJB 3UJTL 4WV1A 3MNWB 1I1RA 4I18C 3Q6FB 4YPGB 1IM9B 3B6SB 3WEXA 1W0VA 1WFUA 2NW2A 3N9GH 4XCYA 4FXGA 2GT9A 5EBGA 3TFKC 3H9SA 3MC0A 3V5HB 1BGXL 3CH8A 1NGYA 2XKSA 5T1MA 3DROA 3P30L 3SGDH 1KCLA 4AK1A 2AAVA 2VERN 4LCWE 1TQBC 1AQKL 1A6ZA 2ARJQ 3SE3A 1OGAE 5ID0B 5IBLD 1QO3B 1FNSL 2QTEA 4LF3A 1BHGA 3G6JB 1YNLL 2A6IB 3P4NA 3SDXA 3CGTA 4NJ9H 3BE1L 3KYOB 4NHCH 4XWGH 1NMCB 3GIZH 2PTTA 5FB8B 2ZKHH 3E2HC 4FFZL 4XCFH 4V1DE 5J6GA 4ZS6C 1T66D 4LHUB 1N2RA 3GDBA 2X2YA 1U41A 1LO4H 1JI2A 1JRHL 4Y8DC 3RL1A 1MFEH 4WCYL 3L7FB 3M1BB 5DK0A 1BWWA 1OAYH 3QDGB 5F96H 5ADPL 4OZ4A 3FAWA 3UTTB 1KIQA 1H8OA 4A2MA 4IRJB 2IMMA 5DRNA 2VLKB 5J9PA 4YAQA 4OIIH 4N1CA 4Y5VA 3MBED 3UZEA 3D39B 5MENE 3I6LD 3RY4A 1QBLL 3WNNA 4PLJC 3GSXA 4G6ML 2JIXA 2PNDA 3ZE1E 1I3VA 4NZRL 2VIRB 2BVUA 5KSAB 4BQCA 2YEZB 3EBAA 4F57L 2ZCLH 1VFAA 1C16A 2GJ6A 1U8HA 1M4KA 3GMLB 3MXWH 4PJBB 4ELMA 5GS1B 1HKLH 3WLWD 1ZT1B 4NQVB 4L4TE 1CDBA 5HGGS 3MA7B 1N3NB 1CF8L 2VWEE 5D72L 2XNAA 5M94B 3CK0L 1RK1B 4BQ9A 4DGYL 5B38A 5D9SA 4KDVA 1GRWA 1DANT 5EU6A 1E27A 5IB4A 4OLVH 5F93C 3HZVA 2IADA 5KVGH 1NUFA 4RIRA 5C0CE 3KXFE 3T4YA 2X10A 2X6MA 1CG9B 2PW1A 3MLYH 4AH2A 3TBVB 1K8IB 1SJEB 2R4SL 2VITA 4R2GC 1TETH 3DVNB 3UPRA 2VE6A 1N4XL 4KY1L 1D5MA 4GW4A 3KLHD 4MQTB 1P7QD 1JVKA 1JPFA 3A6BL 1SQ2N 4GG6E 5EH1A 5CP3H 3QQ3A 1DBAL 4KFZC 4PJ5A 5IT2H 4Y0GA 4H25A 3GGWB 3BP7A 2V9RA 1A5FH 4EIGB 5LKNA 3RVXD 1K3IA 4FQIL 1N64L 5DJ2A 2D9QB 3QUKB 5E2TH 1JIBA 4JM2F 3QUML 4DN4L 2LABA 1P1ZB 5AWNH 5TH2B 3VI4E 2A6JB 2BX5A 5E6YA 3U46A 2BDNH 3Q48A 2FEDC 1KTLA 1UZ6E 4NO5A 4P9ML 3T0XA 3V6OC 5BMFL 1CFVH 3P9WB 3BKYL 3OKMA 4YFEA 2J5LB 5DRXB 2EDOA 3TJHA 2IH3B 3BZDA 1PD6A 2WANA 4GBXB 4JPIB 2IAND 1FSKC 2XN9B 3VE0A 4YK4C 2WK2A 3IT8D 2VABB 1BZQK 1ZSDB 1B6UA 5FGCE 3RWGB 1I9RH 4XMPH 2YD2A 1CDCA 4P2OB 5KN5A 1CBVH 4NBXB 1TVHA 2E8YA 4DW2H 4N0UA 3OR7B 3IFPB 2XXMB 5EZJA 4YHML 4FMFA 1AE6L 4N8VG 2H2SD 1A7PL 4G7YL 2IQAB 3DUSB 3HPJA 1RFDH 5TE7H 3U4EA 4JPKH 5I1DA 3C09C 2OSLB 4UDTA 5IFHH 2CUIA 1RD6A 2P8PB 1J0YA 1ZVHA 2QKIA 2VL5B 4OLXL 3PL6C 3RHWF 4HPOL 1A4KB 5IEHB 3V52L 2DQTL 1G6RA 3RY6A 3AFLA 1PLGH 3RP1A 3K8LA 1EJOL 5FM4A 3AVEA 1U3HA 1JZ5A 2DQCL 4AY0A 5BRZE 2SEBA 1BZ7B 5DFVD 4D0DB 2GKIA 1F42A 2NX5B 1Q9WA 4UTAL 1QP1A 4XT1C 3AB0B 5J1TC 3BMVA 2EE2A 2A0LC 1DLHA 3CLEL 4WTZG 2FJGB 5ACLA 1OB1B 3ET9F 3F6LA 5JXAL 5INDA 3WFBL 1QFWH 2BY2A 2CD0A 5F71A 5CIPH 5C08D 1OAXL 2FGWH 3KJ6L 2B20A 4YHYB 3HMWH 1JNLL 2AK4A 5ICXB 2J88H 2DB8A 35C8H 4TUKL 4OB5L 5EDXA 3TN0A 4NFBA 3I3DA 4P5MA 3BHBA 1G7IA 1J1XH 1RZIB 3GK8H 3SQBA 5H35A 5DD3H 2ICWI 4NQCB 5IHUH 2V5MA 4Y19D 4LQ1A 3VXUD 3QIUC 4XNMB 1Q9KB 4JO4L 1SVZA 4O02H 5HHXH 4I3SL 5EPMA 4QO1A 5F3BB 5TDOA 3U7YL 4ZO9A 3O41A 3W9EA 4WW2A 4L29A 3N1QC 4HUWB 1NSNL 1MRDH 3IDUA 4HKZB 5EA0H 3SO5A 1AXSA 1T2JA 3M07A 4K7FB 1ZV5A 4OFVA 3HI1A 4WENB 3Q5OA 2YA2A 1A0QL 3D69A 3K4ZA 1IZJA 2I24N 4BK4A 2A2QT 2MSPA 3DTXB 5E6ZA 3RBSA 4OLWH 1CR9L 1A2YB 2IALA 1H3GA 2CKBL 3LRHA 3OJVC 4O58L 2JK5B 1J1OL 3VFGL 3QIWC 4MDJB 3WLBB 2DF3A 5HTSA 4DZ8B 4KKLD 5FV2A 4F9PC 4TTDC 4KJQD 4XMKH 3VFOA 3PGFL 4HUUA 5C86A 3DV6B 5C0ND 1AHWA 2ARJB 1K8DB 3CFEA 1YPZB 4IIQB 4LIQE 1UYWH 4YDLC 1A02N 4HBQA 4X6BA 1SY6A 1FORL 3HN3A 2HMID 1BIIA 3H3PL 2HKFL 3GSQA 4WI9A 1NBZB 4LVNC 5L2KE 1G1CA 1I7TA 3PHQA 1YQVH 4DUWA 2OR9L 4MLIA 2AKRA 1RPQA 3VI3F 2WWMD 2FCBA 3MRKA 2VWEC 1BAFH 1F58H 4PJCF 3T2NH 5E1AB 5JOFB 2RAMA 4HULB 3QDMA 5ESVA 5L2KD 3Q2CA 2EDRA 4OFKA 3OKOA 3DX7A 4ONGH 3VFNA 4JN1H 1U58A 4FQCH 3V0VB 4NYLB 1S7UB 5F7WC 1INDL 5C9JB 1T3FA 3ZO0A 4WVRA 3UAJD 3WIHH 5KSBA 4U7SA 2F54D 4J7RA 4GRLB 5FCUH 1T2QH 2DD8L 4RCAA 4QOKB 3IFNH 5EZLB 1J5OH 3PGDB 5D5MB 3FCTB 5J1AA 3TYFB 1AGDB 1MI5A 5CWSB 5DEFB 5DRWB 4PREB 5IMMB 4NBYB 5EU7E 1UJ3A 1IILE 4GQ9H 1E0OB 1JGUH 3MRJA 5FKPB 4NCC2 4HIXH 2X4RA 4WDIB 2W9EL 3CC5B 1H15A 1P7HL 1JWMA 3P0YH 3CLFH 5F7EL 4GAYA 1JHLH 3WDHA 4FQ2L 32C2A 2AEPH 2CRMA 1E4WH 1N5AA 1KJVB 2VISA 4UILL 2FX8L 1AO7D 5DD6B 1A1NA 5IJKC 3QCVL 1DVFD 2XQYK 3C6LD 3IYLW 4WEUD 3V0WH 3UO1L 1U8PB 4ZODA 4Q97A 3EZ8A 4FP8H 3HR5A 1Y0LA 5GRWA 4R7NA 4R7DA 5EO9B 1RUKL 5AEAA 2VSCA 3B5HA 5FGSA 3LY6A 2FIKB 4NKDB 1VA9A 1EHNA 4RGNE 4YXHL 1MLCA 2B1HL 1Q72L 4Z7WA 1N59B 2VDOL 2P49B 3RU8H 3I6GA 4NFDA 5T5NF 3V6FB 5E56A 2DYPD 2NY5C 2PETA 3KPOB 4HDIA 1JPGB 4S0UC 1O7SA 4XWOC 5IB1A 4EUPA 4NJAL 1ONQA 1EUTA 3LN5B 3AY4A 3WHXA 5EIVA 1B0GB 3H7BB 1CICB 3HR6A 1BVZA 5IQ7L 4NCDA 1IQWH 1EMTH 5CBEB 1PKQE 2J6EA 1K85A 4LRIA 1LGVA 2D7QA 5SV3A 5DUML 4BSJA 1NMAL 4TVPD 3S4SB 5F9AC 4EVNB 4NRXB 3L3DB 4XNZC 3TZVA 5EU4B 1F4XH 3RZWA 4PRPB 4U1KA 1NBQA 1YECH 2OI9C 4ESKA 2OM5A 2YD3A 4X5WB 5J1SC 1WLHA 5CEZH 4MNQB 5J12C 4X0KB 5C9KA 5K93A 2FZ3B 3ARGC 2EYRA 1JNNH 4OFYA 3WXWL 3LB6C 3MRBA 1EXUA 4O2EA 5CJQL 4FXGB 5IVXF 4DOHB 3DYMA 2GT9B 1CD0A 1GHFH 2DQEH 5IMOA 3DROB 4TULH 1ZMYA 3MR9A 4KXZH 3QG6A 3CPLA 4LF3B 2IBBA 4Z7QF 1QFHA 4JKKA 3RWEA 3P4NB 3SDXB 4DKEH 2NNAA 4YLQT 3ZDXF 4QXTA 5I17B 5H94A 1MQ8A 3E6FA 1QRND 3QPQC 3VWKD 1IC5H 2PTTB 2YUWA 4G6KH 1L4IA 4P4RB 3C2AH 3SGEH 3T77B 5J6GB 1OAUH 1D9KA 4GRWB 1WICA 4NKMA 4UIKL 4WO4A 4CMHC 2WP3T 4X7CC 1NUDA 3PNWB 5DK0B 3SGJA 4JM2D 4M6NH 3OKDB 4OZ4B 3SE8L 4CKVX 1KIQB 2R0ZL 1MVUA 3WFHA 4R96A 1MCBA 2J8HA 4K3EH 5DRNB 1VEOA 4DTGH 2XFXA 5BOZG 4YAQB 3W11D 3K4AA 5I0DA 4Y5VB 2K1MA 5GS0C 1HDMA 3FFCB 5HYQB 1C5CH 2JTDA 4HV8A 1CDHA 1RI8A 3GSXB 2OK0H 4KUZH 3I6KA 4ONHA 2XTJB 4JO3L 1VFAB 1JZ6A 2GJ6B 3IFOA 4K07A 1U8HB 4ELMB 3QYCA 5F1KC 4XNYH 3MLZL 3OAYH 3GHEH 3O6LH 4Z9KB 3BEWA 3P9MA 2CUMA 2CR3A 6CGTA 4YX2L 3LV3B 5I1EH 3WO4B 1KENH 5EU6B 1E27B 3MJ9H 3OZ9L 4FFYH 5D70L 3HZVB 2IADB 3V95A 2WNGA 2IC2A 3T4YB 3MO1A 2HTLC 3U9PH 2PW1B 3GSOA 2VITB 3GB7A 1FFOB 2VE6B 5TF0A 5FIEA 1UACL 1BQLL 1D5MB 4GW4B 4Z77B 3QNZA 5FA3A 1ZLWK 1F90H 2VLMD 3V4PL 4O5LL 3PHSA 4LLDA 3QI9C 3QQ3B 1YEJL 4NQEA 3TGXA 4PJ5B 1KB9K 1BM3L 1B0RB 4H25B 3BP7B 4HC1L 5EU7C 4M7ZC 4TRPL 2ADGB 4K2UH 4M1CD 5DJ2B 1C12A 1I85C 4I8DA 3HI6L 4NBZB 2V17L 4TQEL 1XH3B 4XBPB 2DBLL 3JTTA 2O5YH 3DX6B 3JWOC 1FZJB 4XNXL 4JFFA 4LLUB 3OAZK 3TT1L 4AM0B 2AI0L 3U46B 4GKOA 1KTLB 4JRXD 3WS3B 3QO0B 3FB5B 4JFDA 5A2IH 5IESH 4YHOL 4G8FB 4NO5B 1OTTC 2A38A 3CFDA 4X4ZA 2O61B 1A4JB 3OKMB 3HZKA 4KHXL 1YUHA 4HJ0C 3TH4T 4YFDB 1CT8A 3GSNH 1BD2D 1CIDA 2IBGA 2QQNH 3SDYL 4OV6F 4KAQH 4XHQA 2EC9T 2DQUH 1LO2H 3PWJA 5ERWA 1T89A 4XXDA 5IFAH 5T1LA 4NDMA 2YBRA 2R39A 4RGNC 3LIZH 4OTXH 3RIAK 3V7AE 2YWZA 2JB5L 3FZUD 1QPXA 4F7EA 2OXHA 5EZJB 5KVDL 4KRPB 4O00A 2O5XH 3U4EB 5I1DB 1EO7A 4UDTB 1FBIH 4EBQL 3KPSE 4XZUA 2QKIB 3GO1L 3BN9D 5F9OH 4OIAA 2AJVH 2Z8SA 4DGVL 4TVPL 1ZHNA 1ZANL 4KK5D 1CTOA 2O5ZH 1MCCA 4OCXH 4PJHF 3UBXG 3VFPB 3B8SA 4R4NC 1G6RB 2CRYA 1I9EA 5EZOH 1CGSH 3NA9L 4H1LB 5FCSH 5ID1A 1WIPA 2VLJA 5T3XE 3MOBH 2SEBB 1IFHL 4LARL 2V5YA 1JP5A 3VI3E 1INEL 1Q9WB 4Z0XA 3QWRD 5EUOA 3N1FC 2WWKT 1T1XB 3C60D 2CK0L 2XACC 2P5WA 3HC4H 1FC1A 3TVMA 4DAGL 4ZYKA 4ERSH 1K4CA 4LPTA 1VFUA 5C0BE 3MUY1 5C2UB 1R3HA 2AK4B 3B9VA 3QFDA 3VXRB 4WGWB 1AGBA 5L6YL 4LLQA 3U36B 4ZSOB 2ZWLT 5HHME 2AJSL 4P5MB 5DS8B 1G7IB 3MLRH 5GRZA 2CLVA 1M05A 1Q94A 3PWUA 2C4FT 1JBJA 1HIMH 5JXEC 4OI9A 4XHJC 1WITA 5EPMB 4FQXD 3DMMA 3KPRE 4MQXD 5TDOB 2DM4A 1II4E 4Q0XH 3QWQB 1RZ8A 5GXBB 4L29B 1IC4L 2HFGH 5HHQB 4AG4L 1LK2A 1SMAA 3MROB 1BFVL 2W9LA 5DGQA 4HXAH 1AXSB 1E4XH 5HVHB 4M7JH 2VL4A 2X41A 1AD9B 3X13A 1UM4L 2XRAH 3D69B 2MFNA 2WIMA 4I3RL 4B7IA 4FFWC 4S1RH 4JZJA 4FZ8H 1EJ6A 3ZLQC 4P2QB 1KIUA 2IALB 2GI7A 2FH6A 4OCWL 4F7CB 3ETBF 8CGTA 3F5WA 1UG9A 2OL3A 3AAZA 4DKDC 4CMHB 3O81A 2DQHL 5FAAA 4J1UA 1JFQH 3QUYD 4XC3H 4RFOL 1AHWB 1F3DH 4XP1H 3CFEB 1LWRA 2HLFD 3KLAA 1CGXA 2H32H 4IRSD 4X6BB 2NR6C 4M5YH 4ZTOL 3GSQB 3BMWA 5L7XL 3PHQB 1I7TB 4D9RD 3PF2A 1NAML 1R3KA 2AKRB 4MA1C 3KR3H 2YA1A 4Y16C 4Y4FA 1NC2B 2FX9L 4BFGA 3EIFA 4XAKE 3STLA 1WC7B 1REIA 1J8KA 4UT7H 3QDMB 5ESVB 5IB5A 4M8QB 2PYEB 1JTOA 1BEYH 3EO9L 3QA3A 3UJJL 4G8IA 1OP3H 1FCGA 3X11A 1FLTX 3HNVL 5KSBB 4XAKD 6FABL 5F7MC 5J6HB 5MI0B 4WJ5A 2D03H 3V5KB 1KIPA 4OUUA 2CLZA 4EI5B 1QPPA 4Z8FH 2PW2A 5IV2A 3TH2T 3GMNB 3VWJA 4E9LA 5J1AB 2MJWA 3NFSH 3PQYB 3G6DL 1NCUA 1UVQB 5MERA 2N56A 2X70A 3ARDA 5E24E 1X5AA 4PGZA 1UJ3B 4JO2L 2FX7L 5IVXE 3MRJB 3BT2L 2X4RB 4POZC 3OJ2C 2IAMD 1H15B 2V7HB 5T1DL 3U4AA 1FFPA 5C0IB 4UT9H 3RQ3A 4JRYE 3P9LB 3PWVB 32C2B 1S3KL 1F3RB 1RAMA 1N5AB 4FQ1H 2E9BA 2HAZA 2VISB 2ED9A 4Z7QE 1A1NB 3ZDXE 1K3ZA 4TSCL 3O6FA 4IOFC 1NKRA 1MJ7L 3TO4C 3CXDH 4GG8A 4JRYD 3QISA 1YC8A 3HR5B 5DJXA 1XGUB 4ETYA 1Y0LB 4R7NB 4R7DB 4AIXA 1LQVA 3BRGC 5FYJE 2AEQH 3EYQD 1I1AA 3CFJB 1H3PL 2GY5A 3BGAA 5EBMA 1HYSC 3GBMH 5AYQA 2WBKA 2VDML 5SWZD 1BBJB 1MLCB 1X3DA 4WFFE 1IAII 1P4LA 5FGBC 4Z7WB 3NCMA 4E0RA 1G9ML 5I8KH 1DBJH 3I6GB 2BNQB 2R0KL 3FHQA 4KJPD 4HD9A 1QLRA 3ARBA 1HQRA 4RWHA 2C3XA 3RZCD 1ZTXL 2WZPD 5IB1B 4EUPB 3HAEA 1ONQB 3UTSB 3LEYL 3WHXB 2G60H 3SKJL 3K1DA 3QZWA 4L3EA 4I18A 1FPTH 2FEEL 4PRHA 3ABZA 3HB3D 5E08H 5GSRA 4HKJA 3CU7A 3Q3GA 5H8DA 2MQ0A 5I1HH 1F2QA 4JFHE 4RAHA 1U0QA 4TOYH 4U1KB 2V9QA 3QEQA 1G7JB 3EHBC 1PG7L 3SDCD 3C5SA 1CU4L 4CUCA 2KDGA 4LSSH 2EYSA 1W2KT 3FN0L 4I2XE 1N5YL 1MCLA 4BELD 4RNRA 1WAAA 2NY3C 2UZYB 3E2HA 1MFAH 1J8HE 3VGFA 1JNHA 4FTVE 3MRBB 4IRZH 1EXUB 1IRAY 4O2EB 2VQ1B 1GC1H 3ARFA 4OCYH 2NY7H 4Y4KC 5GRYA 5IMOB 3ULUF 4WW1A 2R0WH 2H8PA 3FOLA 4WEMB 3MR9B 1C5DA 2VUOA 4HGWB 4XPTH 4ZAKC 1KPUB 1A3RH 3F7VA 4HLZH 2ZCHH 3CPLB 5M95B 2Q86A 3REVB 3RWEB 3EDEA 2NNAB 1K4DA 2HT4C 5DLML 3F12A 3VXSA 2I9LA 4K3DL 1RZGA 4DEPC 1EFXD 2GSIA 3GSRB 5FYKH 2ATKB 1GGCH 1N26A 4QEGA 3QXTA 1S7XA 1PJ9A 5EBWA 1D9KB 4NKMB 4UQ2B 4R90H 4BH8B 4WO4B 2HVJA 1IARB 4FQLL 5I2IA 4Z76A 4EN3C 3JTSA 4FZEL 2A9ML 4ZD3H 1MFCL 3FRPA 4OM1L 1MIEL 3WFHB 4R96B 4G9FE 1V7ML 3P0GB 1OGTA 2BC4A 1ZS8A 3TPUA 5KJRL 1DANU 3RIFK 4P9HH 5L88L 3N1PC 3NFNA 1MFNA 1IEHA 1MRFH 3O3EB 3PDOA 4HT1H 5I1JH 2HT2C 2P5ED 3GM8A 4R8WL 3DBXA 4OBRA 1NBVL 2GHWB 4UB0H 3I6KB 1P4IL 1KFAL 1ZA3A 5E9DA 5D7JA 4NKIH 4HK3N 4K9EH 3IFOB 4WUKL 4HWNA 5I30H 1DQTA 5EG6C 2CLRA 5F1IA 3BEWB 4GKNB 5DF0A 4YBQC 1WF5A 1TNMA 1SM3H 5CD3A 1V05A 3NIFF 3RGHA 1XEDA 2Q3AA 2DLGA 3H9HA 4PRNB 4G8GD 3WJLA 5DD1L 4P4KD 1U93A 4I77H 1G7QA 5D8JL 3I9GH 4EDXA 3QUMA 3HPLA 4QRTA 3O8XB 1I7UB 3IKCA 3EFDL 3MO1B 3AXLB 3NCJH 4QRPE 4FXKB 4NQDA 3GSOB 3RUGE 1JGLL 3DRTA 1QSEA 3GB7B 3ZTNH 1H0DA 4FQQB 1G7LB 1I7ZB 3QNZB 5FA3B 3UYRH 3BQUD 3RVTD 4F37F 4LLDB 1BMGA 4NM8H 2AP2A 4NQEB 1KPVA 2A77L 3DX9A 2EDDA 3LZFH 3RY5A 5KBNC 4G3YH 3B9KB 1UM5H 4OKVB 1IGCH 1FH5L 3SKOA 1C12B 4LSTL 2CO6B 3DXAA 2P7TA 4O2FA 1ZKAA 3ZTJH 5F8QC 3HG1D 1G9NC 1DR9A 3ARED 1DBMH 1AR2A 1I9JH 1B2WL 4Y4HC 3MV7E 3CFDB 2MQ3A 5EOTA 4JR9H 3HZKB 4HWUA 2F5BL 2IPKA 4L9LA 5D2LE 3U48A 1OF2A 3RBGA 5LGJA 4JHWL 4CRPA 1CT8B 4KZEL 2X4PA 3MACL 1GGUA 1TJIL 2VOTA 3PL6A 3ROLA 2OTWB 3PWJB 4RSVA 4KMTL 1FNEA 4X83A 4OUOA 3TBSB 4NDMB 1OCWL 3CFCH 2VXQL 1UCBL 4PS4L 4F7EB 1DSFH 5D96C 4TNWK 1CXFA 3KPPB 4XP4L 5GGUB 1KLFA 5E8DL 2F58L 2DWEB 1LO0L 3CSGA 1IAMA 2D9CA 1I8KA 1SJVA 4XZUB 4P3CH 3IXAA 1F5WA 2DQIH 4K3GA 3L3IB 1DEEA 3MV9A 2UZXB 5FK9B 3K2UL 2CMRH 1KXQE 1Q9LA 5IJVB 4YDVB 1U42A 2VDQL 1W8NA 5ID1B 4U6HA 3GSVA 3TBYA 3GRWH 1RHHB 2DQGL 2VR4A 1GXEA 4HWEL 5ACZA 3TNMA 4Z0XB 3LKOA 5FYLH 1OGAA 2WUCL 4EQ2A 5CBAA 5GRUL 3TVMB 2P5WB 1BPVA 1T1YA 4ZYKB 4OZHF 1TFHA 3MJ7A 4N8CL 4V1DA 2CJUH 1R3HB 1A7RH 1JHKH 3QFDB 2FB4L 4WU7B 1A47A 2HP4A 3BP5A 4ZMAT 4LLQB 1N6VA 4PV8B 3FN3A 1JGDA 3MUGA 1HHGA 4Z5RA 4KHTL 4PRIB 3D3VD 2CLVB 2ORBH 1Q94B 3PWNA 1CVRA 3QNXA 1TZIA 3CAFA 3X3FL 3K8MA 1MHEB 1ROWA 5IQ9A 3QIWA 5HDQH 3DMMB 2DS4A 4JDZA 3L9RA 3DGCR 3TA3D 1RZ8B 4MJ6A 4N5EC 4RQQA 1NL0L 2A6KA 4I5BA 4NN5B 2ZUTA 5AZ2L 5MENA 1X4ZA 3JUZA 5HPMA 2H2PC 2B2XL 1MY7A 1A3LH 1T6VN 3MODL 4RFNB 4CGTA 3L95B 1ZHKA 4HJJL 4JN2A 4E42B 2NXYC 2NY0B 4JZJB 1Q0XL 1XAUA 4L4TA 4I48A 3BXNA 4JKPL 1AI1H 1I3GH 1LNUB 5J4MA 4X8XA 3F62A 1EEYA 4O9HL 2WQRA 4MJ4A 3TV3L 4IMLA 2V2WA 1DQDH 4IBLT 4PGCA 2RBLA 3S7GA 5EIIA 4J1UB 1H9VA 4LKXA 3HKFA 2EEDA 3LKPA 1Q38A 1CQKA 1WBYB 1XF5A 3HE6C 3KLAB 2EH8H 3REWB 1P7QA 4P2RE 5C0CA 2ZSWA 3KXFA 4LBEA 2BY1A 3MLPA 4YXLH 1X5HA 1J0KA 4YE4L 1T7WA 2AABH 4KZDL 4Y4FB 5TF1H 4P2RD 3STLB 1DQLH 4GG6A 1L7TH 3GZKA 4QRQA 4OF6A 2DI8A 5IB5B 3BVNA 4IM8A 3OB0K 5I1KH 3QA3B 2E7MA 4ZO7A 5SX5K 4G8IB 4PGBB 3FO9A 5K33A 2MNUA 3X11B 2IPTH 3M17B 3FJTA 2Y6SC 4PYHA 3ERYA 4WJ5B 3HMXH 5ICZB 4PP2A 5FF6A 5MP6L 4YHPA 1CVSC 4OUUB 3L3HB 1M7IA 3BDYL 3GBNL 2GAZA 1KJ2H 2QQKH 2PW2B 5H2BB 5IB2A 4NCC1 1TTGA 1KCUH 4XCCH 4OFIA 3GNML 4XP6L 1HXMB 2ZUSA 4M62H 1R5VA 1MRCL 2ZCKL 2X70B 3ARDB 4KDTA 4YWGH 1Q8MA 5DMYA 3H6JA 1JMZA 5I1LA 1RUMH 3BPNC 3JWDH 2AW2A 1X44A 5J11B 5F6HJ 1A7OL 1S9YB 1FFPB 3ULUE 2NY4C 1VKXB 4LHUG 2YRPA 2BMKA 3MRRB 3WJJC 4JM4L 4FQJH 5KG9A 3O6FB 5IOPA 3ULUD 5DQ9A 4BFIB 5DJXB 4HS8H 5D6DA 2YD1A 4BQ8A 5C07D 1LP9E 4MNHB 1U3ZA 1XCQA 4OCRH 1I1AB 1I8LC 3Q5TA 5B3JF 4Y5XC 3KPNA 3U30B 4YUEL 3EYUL 1FCCA 2FHFA 2MWCA 5FHBL 3DYOA 1Q9OA 1QFOA 2RHEA 1GZPB 4LSRH 4HF5H 4Z7VF 3OB8A 1P4LB 4HWBH 2XICA 3P73B 4E0RB 3LKRA 4MD5A 2ADFH 3DVIA 3I50L 3G04A 5CCKH 1UWGH 1AGFA 4HUNB 4TSAL 4M6MH 1QLRB 2OI9A 5BRZA 1ZLVH 4K94L 1W72A 1FDLL 2AQ2A 4S1SL 4NUJB 1QZ1A 4FFVC 5C0AE 4WU5A 3E1F1 4OSUL 5E00B 1T66C 1JN6A 4L3EB 4DFHA 1HQ4B 4PRHB 2DIJA 4JKMA 4YHKH 4UMGA 3H3KA 2E7CA 1QLEH 2XQYG 4ETQA 1FE8H 2PXYD 1HWHB 5LAXA 2ZNWA 1RUQH 1AR1C 3NIFE 2XWTA 4KC3B 3HRZA 3QEQB 4J12A 5CINL 4MQ7B 1KCSH 3SDDC 3ZE2E 3LVEA 5GHWH 2EYSB 3MCKB 3I02A 4U1SB 3MLSH 4XC1L 1KTDB 4RNRB 3MBEC 1KF9B 2GITB 4M93C 4FG6C 3NH7L 1BBDL 1SYSA 4FHBD 3GMMB 1S5HA 3VA6A 1HILA 1BJMA 1YEEL 5FM5O 5DMIH 4L4VD 2BJML 2H6PB 1OAKH 1DL7L 3ARFB 2HH0L 4F8TA 1FN4A 5FUZL 3QCUL 4GMTL 4WRLA 3MLUH 3BGMA 2PF6A 1B4RA 4PJGE 4WW1B 2H8PB 5E5MA 3ES6A 3NCYS 4KH2A 1C5DB 2YWYA 4PJEF 4PGDA 4OZIA 4F2MA 1MCKA 3F7VB 2ITCA 5CEXA 2Q86B 1ZT4A 3VJ6A 5EC1A 1K4DB 4Q9BA 1AD0B 3VD4A 5DI8A 2R1WB 1Y6MR 3F12B 3VXSB 3DHMA 3WBDA 4QT5A 2GSIB 1CLZL 2APWA 2X05A 1S7XB 1D5XA 4PJFB 3QWOA 2P44B 3A67H 3WSQL 4X6CA 2HVJB 4NNPH 3S36X 4OI8A 1MWAA 4GKZA 3W2DH 2C3VA 1T20B 3U0TA 5JW4Q 4UNTA 5HXMA 5ACMA 4KKNA 1LEKA 3K4DA 2W9DL 1LEIA 4RISH 1OGTB 4JZOB 1GH7A 1ZS8B 3TPUB 5L2KA 3ORJA 2R69L 1Z2KA 3B83A 4NO0D 3NFNB 5A3ID 5A16A 5HHOE 4G6AD 3PDOB 1U95A 3RVXC 1UADC 4MGXA 2F54A 3PXHA 5I75C 5DMGC 1ZA3B 5D7JB 5E2WL 4GW1B 5EWIH 3EYSH 5E8EB 4MJ5A 5GGRA 2X42A 4DVBA 4PJAF 1N7ML 1Z0MA 4X7TA 1OQXA 1UB5B 3QAZC 2BNRD 1GZQA 5CD3B 3UTQA 4MAUL 5JTWA 3VFSA 3UPAA 2ADJA 1L6ZA 3H9HB 4NO2B 3V79C 3LEVL 4CU7A 3L3OA 1G6RH 2VC2H 4HC1A 3WKML 5CZVL 4YDIH 2EYTA 2NY5H 1Q1JH 4KTDL 4MSWA 4H1LH 5BW7C 1AO7A 3WXVL 3PP4H 1I85A 4EDXB 1V3MA 4NWUH 1NH6A 1IGMH 1DVFA 3QUMB 3HPLB 3DHJA 4QRTB 4M6OL 3OBAA 3UDWC 1Z9MA 3U7WH 3ZHLA 4NQDB 1KNOA 2ZOLB 3SE9H 3IRPX 1QSEB 5GGVY 1T4KB 4F58H 2A74A 3ZTJG 1SBSL 5KVEH 4X9GA 2X4NA 3ZKXC 4EZMA 4W6YB 1DDHA 4KU1A 3HNSL 3J7HA 2EC9U 4U1MA 4OZHE 1MREH 1FGNH 4L5FH 4OGZA 3MLWH 3GI8H 3Q1SH 3GSUA 1R5IA 3RAJH 1M7DB 2FO4A 3DXAB 4ODSH 2DYPA 2GUOA 3NZ8A 4V3DB 3MXVH 3ULUL 5E8OA 4WFGD 2CDEA 5C71A 3VFTA 1X5KA 4M4PA 5D6CB 1YYMH 4NZUL 5GJTL 4L9LB 2IPKB 3BPNB 1AY1H 4K8RD 4UIMB 4LQFL 1OF2B 2D7PA 5LGJB 1S5IH 3K8KA 5E4EB 4PBWD 1HNGA 3U2SA 3NCCB 2X4PB 4JFEB 2NY4B 5KZCD 3ROLB 3WUWA 1E6OL 1FNEB 1Z3GL 5D93B 2VXSH 4MXQC 1FLRL 2YPVL 5AD0A 3DETD 2Y36L 3ECBB 1PKQA 2E6JA 2OZ4H 5F7YC 2Q8BH 3SQOH 1FNAA 1B4JH 2X1QA 5I1CL 2GK0A 2VN4A 4X4XB 4LLMB 3O2DL 1FJ1B 3BO8B 3WE6B 4M9OA 5KANI 5CUSH 2FR4A 2X9XA 2B1AL 1BLNA 1GGBH 5FFLA 4HXBH 3SY0A 1DEEB 1UA6L 1RZKC 1KCKA 2E7HA 1KG0A 3GHBL 2VKWA 3KYKL 1R0AH 4YBHA 1WBZB 1J0HA 2EDYA 2C4FU 3TBYB 1UKTA 5GS0H 4OLZL 1HKFA 2PO6C 3L1OL 2EE3A 4QGYA 5ACZB 4M1DH 1P53A 1YEGL 3BKCH 4LLAA 4Z6AT 3NCYP 5JXEA 4G8EA 2IFFL 3G08B 5DJAA 3K0WA 1I3RB 4DN3H 5I8OH 1CL7I 1WGOA 4R4FH 5J7CC 4GUPA 1UENA 3SJVE 4JM2A 2LTQB 1YYLH 3D9AH 1A1MA 2BVOA 1CE6A 1DFBH 4X7SL 5LCVL 1U8NB 1YEKL 3R1GH 5I6XC 3BP5B 5CJXC 1JPTL 5ISZD 1A9BA 1CZ8L 1EO8L 3MUGB 1HHGB 4Z5RB 5GGQL 3PWNB 5KTEH 3RVUC 5C09D 1TZIB 3D2UD 2CKBB 4MDIB 5AUMA 4U1JA 3WDJA 1FL6A 5L9DH 3L9RB 3IDGA 5CJOH 3TF7A 2W0FA 4RQQB 1HXYB 1OW0A 1KBGH 1PQZA 5MENB 3MLVH 3QDJE 2HJKA 5DJ8B 5D2NB 3AM8C 1ZHKB 4DZBB 4OM0L 4JN2B 1ACYL 5IVZB 1RULH 1W0WA 5E99L 1P9MA 3BXNB 3VMOA 4JEGB 5GIRA 4DKFH 5B3JE 4JG0H 1NMBL 4KKCC 4R3SA 1NEUA 3HNTH 2V2WB 3ARXA 4YXKH 4UDUA 3IVKA 2ILLA 2I60H 1TPXC 4K7PY 2LV4A 1TJGH 3ILPA 4Z7VE 5GGTH 5EIIB 5B8CB 4LKXB 2WV3A 4G80A 2EZ0D 3DNKA 3H9SD 1MEXL 3A6CL 1XF5B 3H8NA 2VXUL 4UBDC 1EHLL 1P7QB 2F53E 5ANMB 5EOQL 2ZSWB 4ZFGL 3MJ8A 4J8RA 4LBEB 1X6LA 3OXRA 1HINL 1L7IH 2Z31C 5GGSA 4ZPTA 1DQJB 5JPNA 3BZEA 2HJLB 3BISA 5TDNA 3QULA 1OM3H 5IB3A 2YUZA 2F53D 5LVEA 2KQMA 3ARPA 4JY6A 1K6QH 4OGYL 3CMOH 4QRQB 2YC1A 3BVNB 3KJ4C 4JRXA 4PGJA 1F4YL 4GRMB 4ALAL 3MYZA 4DCQA 3L7EA 5L0QC 3QEGL 1OSPH 3JZ7A 3QAZB 5LWYL 1R3IH 4PP2B 4DFIA 1MCEA 5FF6B 5B39B 2IANB 3UZQA 1M7IB 2DIBA 5JQHC 1BD2A 3QRFM 2GAZB 1ADQA 4PUBL 2P47B 2BSRB 3TO4A 4X99A 3T0EE 5J3HD 5F7DB 4KKBD 3MNVB 4R0LA 5I1LB 3V5DA 1UM6L 3MV11 2EDWA 4TUJA 1A6UH 2JIXD 5KS9F 1MPAL 1NJ9B 2VDRH 5IBUB 3T0ED 4PJEE 3MRDB 2GJ6D 4V2BA 1KUMA 1HNFA 1JCKA 4K8RL 2BVTA 2YPLE 3EOYG 4LEOA 3T8XA 4F7MA 1XF1A 5C92A 3THMH 5KG9B 4LEXL 2VAJA 3FB8B 1AGEB 5DQ9B 5HGAA 4P57B 5BQ7B 4LPWA 3RNKB 4JFXA 4ODXA 1XCQB 2X4SB 3Q6GL 3KPSA 2MMXA 2B39A 4B53A 4MAYD 3KPNB 1Q9OB 1WFTA 2DMBA 4JGUA 5E8PA 1IVLA 1LE5A 3O6KH 3LKRB 1QBBA 4P5TC 2YK1L 3G04B 3GSWB 2DTSA 3D25B 4JQIL 2Z93A 4V2CB 1X5ZA 3AC0A 3MXWL 1AGFB 5SX5H 2WY3A 3C60A 4XCEB 3N85H 4FQHA 2P43B 1IGIL 3V8OA 4PRAB 4ZTPL 1ZLSH 3SBWC 4PJCA 5C08B 1J88A 4MHHG 4YQXL 1JN6B 2Y06L 4BH7A 3WYRA 5BVPH 4JAMB 4PJAE 3P11H 4XP9H 4MWFA 5DHVA 1RVFL 5C0BA 2W65A 4ETQB 3L6FA 4NZTL 4Y4KA 2P8MA 2BSED 4LDEB 4Y19B 3VXUB 4QXWA 5BS0D 4WY7L 5ETUA 2XWTB 4HWZA 1MH5A 3HRZB 4AL8L 1VGEH 5LQBL 1ZLUK 1TETL 3U0PB 4Y2DD 4X7DC 4OJFH 1KPRA 2AJXH 4DVRL 1F02I 5CGYD 3QG7H 1B3JA 4NP4L 1TMCA 5CZXD 4QXUL 1S5HB 1HILB 4M48H 4XMLH 4YH6A 2D7TL 2CH8A 1FN4B 3T0VA 2NY1D 4ODBD 3BGMB 4KRNA 4KVCL 3LDBC 3ALPA 5E5MB 5AWNL 3H9YA 1F6AB 4OZIB 4AEIH 4F2MB 1KB5A 2YA0A 5CEXB 4BFBD 3SO3B 2C1OA 2UYLA 1EX0A 1J7VR 3MCLL 4J23A 1EERB 3QUYA 3JSSA 4QT5B 2JCCB 1GIGL 1ZHLB 2Z8RA 5E6ID 4IRSA 2EDKA 1D5XB 4Y89A 3QWOB 4X6CB 3WFEL 4JDVA 1U3HD 4GKZB 2YMXL 5TE6H 1IC1A 3C8KA 2C3VB 1CBVL 4NSKA 5GRJL 1A7NH 1LEIB 1CFSB 2DOCA 2NZ9C 5L2KB 3BDXA 3LS4L 3GKWH 1RFDL 4JQVC 4OT1L 5A16B 2GTWB 4Z7OE 5DO2D 3GEWB 1AIFA 3C6SA 2F54B 4NHUE 5J89A 5HI4C 3RDTD 3O2VL 3BIBX 1CTNA 4P5KA 4QTIH 1G0YR 4CW1A 5IWLC 1T83A 2J8UF 4MJ5B 5GGRB 4ELKB 2QSTA 1J0JA 3TN0D 2C7UA 1DBKH 3DPBA 4X7TB 2AEWA 5HGBA 4H1LG 3T0BA 4Z7UF 4F80A 3MSPA 4XAWH 1GZQB 4MA7H 1D5IL 2H26A 4OCMC 2BXYA 1JZ8A 4LAQH 1S7WA 2OJEA 3CVHA 3CSYA 3VFSB 5CEZE 4ONFH 2IAMA 43C9A 4UI2A 2COQA 1EZVX 4G6JL 4JVWA 5JMOC 1M6OA 5MEPA 3GMRA 3L3GA 4FABH 1EO5A 2EYTB 3BZ4A 4YEFA 4ORZC 2CIIA 1AO7B 1EBPA 1H3UA 5IVXA 4P99A 1ERNA 2Q8AL 1DVFB 5CKGA 3C6LB 1A6PA 3QFJE 4NC0B 1T7ZA 4FOMA 4JRYA 4XPGL 1HHKA 1KEGH 5CD5D 5DD5H 2EH7L 2W0LA 4Y4HA 1U92A 2EIZA 3B4NA 3G6JF 2X4NB 3KDMA 3GK8L 4C58B 2DICA 3MV8E 3EFFB 4U1MB 2ICEA 5HGHA 5DSCA 4BKLA 2HRLA 4XPFH 4RFEA 5I19H 4ZO8A 2ATPA 4OLYL 5L0QB 3LMJL 4KRMB 5JHLL 2VXVL 4P0DA 2DYPB 2VNCA 3NZ8B 4OGXL 5E8OB 4HEME 2H45A 4RMRA 2YD4A 3VFTB 4HUVA 5JZ7D 3LPFA 1OD7A 1IKFL 5HBBA 5SWSE 4M7LT 1OAZL 2ED8A 1VB9A 1WBXB 4CADB 4G5ZH 5DYOA 5MEQA 1F6FB 1NFDE 3NIGF 2VDKL 2DRUA 2HT3D 2VZ1A 3U2SB 4EEEA 1RZFH 4JPWH 4ZFZA 5DD0H 3WUWB 1RUAL 4RMSA 4GMSL 5AD0B 1NCAH 1A9EA 1PKQB 3T0WA 1U8IB 3SDCA 5GGVH 3LHPH 3B9DA 4PJBF 4F8QA 3MLTA 1T22A 1EVTC 4MCZA 4MA8H 3PWPE 2P42B 2GK0B 3GIVA 3QDHA 2P24A 1ZGLP 3S8WA 4GAJL 5JQ6H 1WFOA 2HTKD 1BOYA 1MI5D 3IU3B 1XFPA 2BXZA 3IDXH 2FIRT 2FR4B 2BVQB 1KT2A 2A9NH 2B8OT 2P4AB 4LVHB 3MJGX 4HH9A 4KMQA 2OS7A 4BJLA 4I2XA 3T2NL 3CSBA 3V4UH 2PR4L 4PJIF 3NACH 1DUYA 1RIVH 1VFBA 2QV2A 4U3HA 1KG0B 1J8HA 4ONGL 1MAML 4FTVA 3EUUA 2EDLA 4QLRA 2VZVA 3JBG7 3LQAL 2X7LA 3O0RH 4RMWA 1ZHBB 1T1WB 3WIHL 1NCCH 4OLEA 3HE7C 4ODVH 5DJDB 1QRNB 3VWKB 3PE9A 1DLFL 4QHMA 5D1XC 5DZNA 4RX4A 1EFXA 2Y9RT 4MJIE 1P7KA 4J6RH 4M1GL 1RV6X 2XY2A 4G8EB 1RU9H 3LQZA 5EC2B 3LSOA 4GT7A 5DJAB 1KIRB 4N5UA 3RVVD 3S34L 1CLYL 5BV7L 4JM2B 2JF1A 1A1MB 2BVOB 1T03L 2MCPH 4JO1H 1YZZA 1EDQA 1JTTA 1A9BB 5IGXH 1BFTA 3FT3A 4PP1D 5DTFA 1WZLA 2RCSH 3WNOA 2DDQH 2P5EA 4I1NB 4PIRF 5F3HB 5IHBA 3V0WL 1RZ7L 1EK3A 1HI6A 3RL2A 4KROC 3BDBA 3NZHL 5KS9E 1VEPA 2F74B 4UUJB 5C0RH 3QRGH 3IDGB 4Z0BL 1A7QL 1WSST 2W0FB 4QXGH 4EDWH 1GYAA 5I1AA 1L6XA 4UQ3B 2Q3ZA 1SEBB 3TPKA 3TZVD 1IGJA 1OOAA 3VXOA 1IT9H 1BP3B 2VSDA 3OG4B 4PJ8C 1W0WB 3EO0A 1D3CA 3IU4L 1I8MA 2BOCA 4OD1H 1NAMB 4K3JH 3MRPA 2C3WA 1G9NH 1GGTA 3K46A 1Z6JT 4FQPA 5JW5A 4E41D 5IW6A 2JJTA 2MPAL 4XGZA 3ILPB 4PJHA 3QUZC 5D7KE 4F3FB 4G80B 2NXZD 4KK6C 5EFIA 1INQA 1PZUB 1NC4D 4OV5A 4EOWL 4U33A 4ODTH 2PTUA 3RNQA 2RQ8A 3MJ8B 4OLUH 5DK3A 4A6YH 2NY6D 4HX1B 5GGSB 2CQVA 1QNZH 4LSPH 1RQ5A 2WIIB 1XIWD 2XA8L 1U91A 3EDDA 5TDNB 4F37K 3QULB 5J13C 5DMKA 3DIFA 4X7EC 5IB3B 5FO8A 1WV7T 4K71B 1FGVL 3ULSB 3HG1A 4LCCC 4WWKD 1JF6A 2YC1B 3AREA 1LO3L 4JRXB 3IETB 2F19L 1BGXH 2BNUA 5AZEH 1HEZA 4P23D 4W81A 3P30H 4LPVA 5FOBA 4DCQB 2ZUVA 1KC5L 3JUYA 1AQKH 3D1MC 5F9JA 1FNSH 4GW5A 4QWWC 4WFEE 1YNLH 1I4FA 1YMME 3JV6B 3O4LE 4TULL 1BD2B 3BE1H 1D7FA 4PRBA 2BSSA 3MV7A 4FFZH 5HYJE 3LN4A 2QADC 5MEOB 4R0LB 1Y6KR 3DV4B 3V5DB 1UB6A 1SY6L 3GKZA 4TUJB 1YMMD 1I8LA 4Y5XA 1JRHH 5DT1L 4WCYH 1T1ZA 5F1NA 5GGRY 4TSBL 4MS8C 5ADPH 3ARSA 2G75A 4ZQKA 5GZOC 2ZJSL 4F15C 3T0DA 1RIHL 3T8XB 4F7MB 4JJ5B 1KXVC 3EO1A 4EKXA 2ITDB 4HK3J 5I76A 2V2XA 3I75A 5HGAB 1OTSC 1IKNA 3FN9A 4EI6A 1OPGL 4ODXB 4QKXB 1VADA 4G6MH 1G7PA 4NZRH 3AUVA 3ZDZE 1IQDB 4TTGA 4C56E 4F57H 4ZOAA 5IR1A 2GW5A 1W8OA 3NIDF 4KUZL 4XX1E 5E8PB 2ZPKL 2VTFA 3FOMA 1UH3A 2IWGA 3DGGB 1F11A 3EJZD 1CF8H 1RURL 4P46C 5D72H 1HH9A 1S7SB 3C60B 4PPTA 3CK0H 4FQHB 4LKCA 3WL9A 1T5WA 3STBA 3SDDA 2X4TA 1K5NA 4NOFA 4PJCB 1ES0A 5K9QI 1XF4A 1SYVA 5JORA 4BH7B 5AAWA 3PG2A 1EAPA 2AVGA 2CXKA 3C87A 3K74B 3RGVC 3JVGA 3BGFC 1NGWA 4JFFD 4QCIA 4FFYL 3IDIA 4W70A 2A83A 3D3VA 1UH2A 4MWFB 2X4OB 4Z7UE 2R4SH 2W65B 3I3EA 4JFDD 2HA1A 3OKNA 2P8MB 5TE4L 1N4XH 4KY1H 3QIBD 3BKML 1KCRL 3ZT7A 5F89A 1MH5B 2W1NA 1VGKA 3A6BH 4FQXB 3TIDA 2ZSVA 5D5MF 4LAJH 1GAFH 4MCYA 1DBAH 4PJXF 1QVOA 2AXFB 1KPRB 4FQIH 2X4QA 1N64H 2A1WL 3U82B 3RIAF 2OMNA 4BA8A 3SDAA 5T1LD 2CIKA 4ZS7L 5GISH 4NRYB 1S7QB 2GJZB 2R1XB 5IG7A 3S9DB 1NCWH 4P9MH 1Z0NA 3BZFB 2CGRL 2RGSA 3G6JE 3BKYH 2DLEA 4Q74A 1S7TA 2Z4QB 5TQ2L 4I0PA 4LCYA 1QUNA 5IESL 3GJFA 1MHPL 2UYLB 2B4CC 4L8SA 3QUYB 1QQDA 4DUXA 2KH2B 4W6WB 2R2EB 5BZWA 3VGHA 1X7QB 4IRSB 2JKXA 4KK8C 5FECA 4M5ZL 2D7NA 3QDGE 3SKMA 4NWTL 2VLJD 3UTTE 4YHMH 1WEJL 4BYHA 4N8VA 5CILL 1AE6H 3C8KB 1A7PH 4G7YH 2VLKE 4OZGF 3WKNA 4Y5YA 4P2RA 3W9DA 3NCFB 1D5ZA 4OLXH 1M1SA 3D39E 4HPOH 3BD4A 4PD4J 2Y7QA 3RTQD 4DQOL 1CFTA 4JQXC 3V52H 1AIFB 2DQTH 2XZCL 4LGSB 3SCMC 1JYXA 3D5OF 1JHTB 1JV5A 1CGVA 1EJOH 1D5BB 4P5KB 4PJBE 4OCXL 2BRRL 4CW1B 2DQCH 2WBJD 3L5HA 4KRLB 4JKWA 1NDMA 3ARTA 5FO7A 2C7UB 4UTAH 5HGBB 5HI3C 3GJEB 4HPYL 2H26B 4M43H 4YC2C 4HMCA 2LE9A 3ARRA 3CLEH 2NY2C 3CVHB 4K23L 4WTZA 3W0WE 2FO1A 2IAMB 3X12A 43C9B 1KLUB 4JB9L 5JXAH 1T7YA 4X80L 3WFBH 3KYNA 1M6OB 1CDYA 5MEPB 3G5XA 3RVWC 4APQC 1OAXH 3KJ6H 1JNLH 3BZ4B 3TESA 5EORH 3BUYA 3MRFA 5IVXB 4TUKH 2VDNL 4OB5H 2W92A 4UV7L 3W0WD 3SGKC 4EQ3A 5F88B 4MVBC 4JRYB 3RPIA 1U92B 1VPOL 5C07A 4JO4H 3EJYD 4I3SH 2UWEF 2A6DA 3DI2B 4RMQA 3U7YH 1U8KA 2ICEB 4BKLB 5SWZB 4CDGC 1J12A 1N0LA 1NCBH 4C4KO 3SN6N 1IAIL 5FYKE 4LVOB 2K9UA 1FVDA 1NSNH 2ATPB 5T5FL 1WTLA 4U3XA 3ILQD 4R6UA 3VXME 5E94A 5JHDD 1A0QH 5GQBA 4G9DB 4DKAA 3U9UA 2YZ8A 3C9NB 3RZCB 4HXAL 2UVEA 1WISA 5GGSY 4U6XA 1CR9H 1YEFL 1MJJB 2CKBH 5D1ZD 4O58H 2XRAL 4B0MM 2XI9A 3VXMD 1J1OH 1WUNT 4NNXA 5SV4A 5FO9A 3VFGH 3WFDL 5MEQB 2EDBA 3K81A 3PGFH 1I7RB 1L0QA 2AV7A 3WD5L 3KNBA 4U1GC 4ZFZB 4GKSA 2J7LA 2R9HD 4X8JA 4QRRD 3FO1A 1OY3B 3ZYJA 1U8MB 4Z95H 1FORH 2R2BA 3H3PH 1A9EB 2HKFH 4F9LC 2B5IB 1BREA 1SEQL 2AJYL 3SDCB 5DJ6A 4KK9C 1U8LA 4NFCA 2OR9H 4ZXBC 1H3WM 2G2RB 3DWTA 3GIVB 3MMEA 4J3XA 5FOJA 3VWJD 3T1FB 4C55A 1MCPL 1MLBA 4IJ3B 1YN7A 5C2BH 3B5GA 4FNLL 5IROA 4L4VA 3QUXC 1WCBB 3FB7B 4NQUA 4AT6A 3TIEA 4EJ1C 1INDH 4NIKB 3DO7A 4H0GA 4XPHL 2FL5A 1DUYB 1GGIH 1VFBB 15C8L 5DWUL 3FQWA 3VFWB 2DD8H 1CDIA 1EGJA 2R8SL 3R8QA 2I25N 2X7LB 3G5ZA 5DVNA 4Q6IC 2ENSA 1MHCB 1MNUL 2AV1A 2GTZA 3ULVD 2B7DT 1UCTA 2QEJA 3V4VL 4PJGA 3BSZL 1EFXB 4LSVL 4D0BA 2VKXA 4HKXA 5F7NC 4HEPG 5ALBL 1JF1A 2W9EH 1M7XA 3BGFB 3LQZB 3U0WL 1CD1A 5ADOH 1RUPL 5I8EB 4UILH 2FX8H 3O9WD 4R26L 4KWUA 5HJ3B 1ORQA 3UJIL 3UO1H 3D0VA 1WIOA 4GXVL 3ZKQD 3FT3B 1DP0A 4NO0A 1MCOL 1GOHA 1L8JA 3ARBD 4GG6F 5DTFB 3TEUA 2P5EB 5GZNC 3DVGA 1RUKH 1NMCC 1HI6B 3RL2B 2Y4SA 2VAAA 5CJ5A 4YXHH 3B9AA 2B1HH 1JYNA 3QT2A 1Q72H 2VDOH 2DAVA 5I1AB 3MFFA 3ZT6A 4I13B 1YY9C 1IGJB 5IIEA 2XZQL 4Y1AD 1T04A 2R1YB 3GUTA 4OI7A 5EO0B 3VXOB 3MX0A 3B2VL 4IRJC 1I8MB 4NJAH 3S6CA 2BOCB 2WM0A 4G8GB 2AGJL 3QQ9C 3MRPB 3N06B 4P4KB 5IQ7H 3G5VA 1MJUL 1S7RB 4ZS6D 3NIDE 4XGZB 4PJHB 1YPZE 5DUMH 1NMAH 1XZ0A 5K9JL 5KSAC 4KQ4L 4BK5A 4BQ6A 1IAOA 5GS1C 3OJDA 4E5XA 3BQUB 5CFHA 1OP5H 3D0LB 2EDXA 5FYLE 3MGTB 1MCSA 2QSCL 2IGFL 3HG1B 3EGSB 1NANI 4QHKI 4OZHA 3AREB 4AENB 4PLJD 1XR9A 3BI9X 1MFAL 2BNUB 1HEZB 4RBPK 4QOKE 5FOBB 1GC1C 2DKMA 1S9KC 1QKZL 1FVEB 5D5ME 2V5RA 4GW5B 3RIFF 4D3CL 2DJ4A 1I4FB 2OL3L 2ERJB 3O4OB 1DUZA 5HY9A 4RAVA 4YJZL 4PRBB 4D9QE 1LQSR 4OFDA 4YDKL 5F7LB 4XCNA 5ESAA 2VUYA 1UB6B 5EIQA 2E9IA 4UIKH 1FYTD 5CSZA 5E9DD 2AJUL 3H3BC 1T1ZB 5F1NB 2FGZA 5ENWA 2G75B 4ZQKB 3SE8H 3VXQA 2R0ZH 3OKLA 4R90L 3FT4A 4XTRD 5T3ZD 2Y72A 4P5TA 4LPCA 4ODUB 4R2GD 2LVEA 3LN9A 4UAOB 4LASL 3EO1B 2J5LC 3C5ZA 3ZKMC 2BVPA 2V2XB 1AC0A 3I75B 4GBXC 5MHSE 3T3PE 3QXDA 3IJYA 3MRCB 4EI6B 1EAJA 1VADB 5FUCE 1EH9A 1G7PB 4LRNL 4RWYH 5JIPA 1FNFA 2VXTL 4P3WA 4P2OC 3NABL 2XG5A 4XXCC 2Q20A 4JO3H 5IR1B 3ZL4L 4JLRB 3RWHA 3MLZH 2QQLL 2UY6A 4IDJL 2ICWA 2DM2A 2FEDD 4K9EC 4YX2H 4S1DD 1HH9B 5I30L 1B90A 4HQQH 3U7AA 4CVXA 4U1GB 3S37H 1T5WB 4WI4A 5E2JA 2WSKA 4XPBL 1T7XA 2X4TB 4Q9RL 1K5NB 3HHRB 3ZHDA 4JPVL 5ITFA 3OZ9H 5GRXG 5JW3L 1Y18A 3RWDA 5CP3A 1GPOL 4NNYB 1SYVB 5JORB 4KV5F 4X5XA 4S2SB 2C9AA 1F00I 3E0GA 3UTPD 4LNRA 3ULVL 1NGWB 1V7NL 4QCIB 3D3VB 3MQIA 4PRPE 2NMSA 4WUUD 3I3BA 4CVZA 3S37X 1UACH 1BQLH 1UFUA 3OQ3B 4MNQE 2JLLA 3V4PH 1VGKB 4N1HB 5J8OA 4P2CG 2ZSVB 1YC7A 1YEJH 3AB0C 3ZTNL 1BM3H 3TA3B 4HC1H 1ZAGA 5HHVL 2X4QB 3ROOB 4TRPH 3PL6D 3HI6H 2V17H 2F15A 4TQEH 4DOHE 2APXA 1S9XA 4M02A 2JJWA 2CIKB 3IRZA 4XNXH 1UM5L 4YHYC 1CK0L 4TNWF 3TT1H 2AI0H 1X5XA 4M61A 5IG7B 3WFCL 2PYFA 4YHOH 3LS5L 3RFZC 1IJ9A 1CXLA 4PB0L 1LDSA 3SDXE 5D1QA 4KHXH 4LSUL 4LCYB 1CFQA 2GY7B 4I9WD 1VACA 3GJFB 3OAYK 3RX7A 3OXSA 4H5SA 3SDYH 4L8SB 4KUCF 2A0LD 4JQVA 2ZUXA 3MV9D 2Z8VC 5DVKA 5FECB 1JZ4A 1SVCP 2R56L 2X89D 4RGMB 1H8NA 4YHNB 4Z7VA 2JB5H 4HCRL 1UWEL 5IWLA 5KVDH 4MB4A 2KZWA 5D7LE 4N8VB 4JFZL 3CFCL 1FNLA 4LFHG 5C0JA 4Y5YB 2VZUA 4P2RB 2F53A 4I4WA 3W9DB 1IMHC 3KGRA 4LCWD 2AXJA 3SOBL 4J4PC 4B50A 1HH6A 1D5ZB 1FIEA 1OGAD 4K7PL 3VFMA 3QIUD 3FFCE 2IMNA 4DGVH 4TVPH 2AS5M 5D7LD 2Y7QB 1ZANH 3UBXA 1CFTB 4N0RA 5DDHA 4V1DD 2XTJE 3HS0A 3NA9H 1L9MA 4PB9L 1JV5B 4IIQC 4ELME 1U8QA 4RZCB 1NDMB 1IFHH 4LARH 5JW4M 4YO0B 5CIPA 4GJTB 1INEH 5FO7B 5DUBA 3SPVA 3GRWL 3BYYA 4OGAC 1S9WA 1IEBA 4HG4J 1UXWA 4M3KB 2CK0H 3QIWD 1X5GA 3X12B 4DAGH 5EU6E 1E4KC 2LU4A 1AXIB 3KYNB 3T0EA 1V3JA 2J3SA 4PY8J 5BO1L 1ZVYA 5EOCL 5MEND 5M7QA 3BUYB 5L6YH 3DETC 4CJ1A 4GRLC 4MMZC 5HYSA 5DURD 3FT2B 1JYWA 5IBTL 4PJEA 2KUTA 5BJTA 2YD9A 2ZUQB 1NUNB 3NPZB 5KSVB 1AQDA 3RPIB 1HOCA 4L4TD 5C07B 2YPLA 1UEYA 5DJYA 2ORBL 4MA3B 4MAYA 2A6DB 1DEDA 1A1OA 1DTUA 1FVDB 3MRLA 4AG4H 5T3ZL 5E94B 3STZA 1FZMA 4I3RH 2BY3A 5C0CD 5EZIL 1P69B 3KXFD 1TNNA 2OQJA 4JHAL 5I18L 1HWGB 4L1DA 4C54A 2GSGA 4OCWH 3CFBB 3IS1X 1IBGL 2F5AL 1KJMA 3OKEA 2QJDA 1AGCA 3S88L 1TTUA 3ZMRA 2HLAA 4NN6B 4PJ9A 5HSFA 2DQHH 3BWAA 3P77B 3QXUA 3RKDC 3BPCB 3KNBB 4MLSA 4RFOH 5FUCC 4AJ0A 2XOTA 4X8JB 2PXYB 2VYRE 4NRZB 3GMPB 4YHIA 5BS0A 2HRPL 4CL7A 1RZJL 2R2BB 5ITBL 3KG5A 1RJYA 2ICES 3EDJA 4ZTOH 2NW3B 2APFA 4YHLL 3IAGC 4PJAA 5DJ6B 2YZ1A 3O3DA 4OD2A 4Y2DA 3WIHA 5HHNA 4JFYA 1NAMH 5ECJE 3L3KA 4UNUA 4JY4A 3MMEB 3SGDI 1DN0B 1IAKB 2FX9H 5D1XA 3INUL 3L5IA 4OCSL 3MLXL 1KJ3L 3BN3B 3UROR 2AABL 3L3JB 4C59B 4PG9A 4L4VB 1CICC 1FFNB 4AT6B 3TIEB 3DO7B 1H5BA 2D4DA 2VLLA 2OYPA 1I1CA 6FABH 1PW3A 5JUEL 2DLFL 3KS0J 3FQWB 1NLBL 3OR6A 1CD9B 2FWOB 5SX4H 4IS6A 1OVZA 2AV1B 2GTZB 1TIUA 1DQML 3G6DH 1CXEA 5B39G 4XWOD 5E6IA 1KJ2L 2Q7YA 4JO2H 3VG0L 4LP4A 2FX7H 2EO9A 4HKXB 4WV1C 1OHQA 4N0CC 3S35H 3VGDA 5T1DH 5HD8C 4Q2ZA 4R9HA 1CD1B 2AK4E 4BZ2H 1I1YA 1S3KH 3JWDC 4ZUTA 3VXRE 3IJHA 1JFMA 1BOGA 2XPGB 2EO1A 2X1PA 4ZSOE 3DRQA 4L3AA 4IHOA 3C5JA 4G42A 5IBUG 3CDGB 4NQSA 4TSCH 3S35X 1MJ7H 3SE3C 4UU9B 4NO0B 5BRZD 4X9IA 2DQDL 1FAIL 4NUGL 4H88L 1YEDB 1PVHA 2DQJL 1H3PH 4PDCE 3RDTA 3ARGD 2VDMH 2IG2H 4HMDA 4F33A 3LB6D 3KPMB 5DUPH 5DHXB 3QUZA 3MFFB 1G9MH 3LPGA 4YGVA 2BNRB 3QQ4A 1R24A 1T04B 1OP3K 1EIBA 4P2QE 3LH2H 3GUTB 1ZTXH 5ESQA 3RWJA 4UNVA 1OLLA 4F7PA 2JE8A 1BQSA 3LEYH 2PN5A 4N90E 4ZNEE 3OHXA 4Y5VC 4HKBA 1R3JA 3QPQD 1U8OA 1FRGL 3BKJH 3T65A 4H0HB 4HAFA 4YIQA 4X4YA 5INCA 3P40A 5ELIA 3RI5K 2XTJC 4N90D 2GQHA 4I3GA 5EBLB 1BFOB 3G9VA 4PJDF 4M8VA 3RWCB 3QO1B 4JG1H 3EZJB 8FABB 1T0NB 3WN5B 5DZOA 1PG7H 3S5LG 4E5XB 3QFJA 4BSVA 2B0SL 4HUXA 1CU4H 2EXWC 2Z0BA 4JREB 1KYOJ 3FN0H 1N5YH 1GCFA 3MNZB 5DJZB 2VN7A 3CCHA 4JY5L 3TC9A 3QDME 1YN6A 3WO4C 4RA3A 4KV5E 4M7KL 1BVLA 3TWCL 2PYEE 4HMEA 1UWXK 5KAQG 3MV8A 3MLSL 1PG7X 3DURA 4OZHB 3JXAA 4XVJL 4QHLA 4MS8A 1HK6A 1XGPA 2HN7A 1NUGA 4PLKC 1OL0A 4UV4L 3PQYE 3QH3A 5L2JA 5BVJA 3OV6A 5HY9B 3TO2A 5DLMH 1UXSB 5KZCB 4K3DH 3BIKB 5SWSA 1G0DA 3V6ZA 3S36L 3CVIH 4U31A 4XCNB 5ESAB 4ZG1A 3HCVA 4FQLH 5CP7B 4FZEH 2A9MH 2C3HA 1WT5C 3VFVB 4N1EA 4MD0A 5ENWB 1MFCH 2HTLD 4OM1H 3OKLB 1MIEH 4X5LA 5ILTL 5IHZA 4QRUA 4ZFOA 3W2DL 4HG4K 1F13A 2BVPB 3TJHC 4P46A 5L88H 3LQAC 1QD0A 3PWPA 1MFBL 3QI9D 1JGEB 4R8WH 2ICWJ 1F4HA 3IJYB 3UBXI 1A14L 5J0BA 1NBVH 3S97C 3FL7A 1KFAH 2AEIT 4KUCD 2I07B 3W82A 1UT9A 2K3TA 1BF8A 3NMEA 1QFWI 2MKLC 3RWHB 2BNQE 4XNUL 2ICWB 4KRPC 1G0XA 5DR5L 3VH8B 4N0FA 1OTTD 3UTSE 4RBPH 1CL7L 4CVXB 4HJ0D 1CXIA 3VDAA 4NKOA 3JWNC 5DC4B 5T1KD 5DD1H 4EXPX 5ITFB 3LPWA 5D8JH 4LCUB 1BZ9A 4KI5E 4X5XB 1NFIB 4TVSa 3MCG1 1QEWB 3EFDH 5ISZB 3T1WA 4LNRB 4S0TD 4RGND 4QF1A 2Y25A 1JGLH 4CVZB 3GFUA 4NWUL 5F7UA 4OAWA 5C09B 5FM5M 4UINL 3D2UB 2DI7A 2D3VA 3U7WL 5I15L 2VB5A 5DHYA 1LO5B 3ALWA 2QSVA 2A77H 3UTZA 2IF7A 4NQTA 3VCLA 3F65A 2X09A 1CLOL 5HDBE 3SKNA 5D7IF 2IH1B 5AG9A 3VGAB 1FH5H 2JELL 4LSTH 1G6VK 1S9XB 5KS9A 1MCHA 3MLWL 5D4QA 4R4ND 3KAAA 2OTUA 1W72L 2VH5H 1B2WH 3FRUA 3KPLA 2J12B 2XKNA 4X98A 2J4WL 1E28B 4GFTB 5JO5A 2F5BH 5CLTA 4WV1B 4IDLA 1CFQB 4E41A 1VACB 3NN8A 3WEXB 1W0VB 1U2HA 3OXSB 5IK3A 1YYML 2NW2B 2EDTA 4X6EA 4XCYB 3VDBA 4KZEH 3MACH 2AXGA 1AXTL 5JA9A 1D6VL 4KMTH 3H9SB 2W0PA 25C8L 4LPYA 1NC4A 1NGYB 5JW4N 4CU8A 5T1MB 3D85D 4JQXA 1OCWH 3CZFA 1S8DA 2VXQH 4O2CA 1A6ZB 5HVHC 1UCBH 4PS4H 1NKOA 2VXSL 1S7VA 1XIWA 4WTXA 2OZ4L 4J3OC 4XP4H 2DTML 3W39A 5DVMA 4R4BA 5C0JB 5E8DH 2F58H 2F53B 4I4WB 1LO0H 1B4JL 1HH6B 4PLNC 3VFMB 1N2RB 5JXED 4WWKA 4ZOCA 4XHJD 4XBEL 3NTCL 3UBXB 43CAA 3K2UH 3RL1B 1E4JA 4P23A 5DDHB 3HS0B 3VMNA 2VDQH 4APQA 2IBZY 4OCNC 1AHWC 1MELA 2C1PA 3SE4A 2BVYA 1TCRA 3U83A 2DQGH 1JTPA 3SGKA 5J9PB 4QYOA 1R0AL 1U3JA 5DUBB 3N50A 4HWEH 4MVBA 2FBJL 3SPVB 3QXVA 2M26A 1F4WL 4GLRH 1S9WB 1IEBB 1UXWB 1YMMA 5GRUH 1ETZA 3O4LA 1A64A 2JIXB 3NCBB 4PRDA 5IM7A 1MWAL 4PBVC 5HYJA 4N8CH 3T0EB 5IMKA 1JF5A 1C16B 2MCG1 4LIQL 1U9KA 3B9EA 3Q0HA 3VW3H 1QRKA 1C08A 5C0GA 1ULVA 1PG7W 5I71B 5MI0C 2W0KA 5F6IB 1C5BL 1KELL 5C8JA 5HYSB 4KHTH 2XNAB 2NR6D 3IJSA 4J3UA 5LBSL 3R1GL 4EI5C 5BJTB 2LAAA 5DEZA 3X3FH 5B38B 5D9SB 1DE4A 1HOCB 4NQEE 2RJMA 2BY0A 2L7UA 5IB4B 2Z8WC 4MAYB 4Y16D 3IDMA 1UJ3C 4RIRB 1NL0H 4KMLB 3WIIL 4XI5C 1EEZA 1MFDL 4AH2B 5TFSL 5L9DL 2B2XH 3FO2A 1QR1A 2DMCA 1R5WA 2HFFA 4PJFF 2NPLX 5CJOL 3D18A 1FO0L 3UPRB 3STZB 3MODH 5F7KC 5TPWL 4XBGA 4HJJH 5LGHL 2J1KA 1EEUA 1JPFB 1RK0A 4MZ2A 1Q0XH 1KYOK 4JKPH 2H32A 3UXFA 4AZ8A 1NGXA 5JDSA 4O9HH 2R2HA 1KJMB 4OD3L 3TV3H 3MA9H 3OKEB 3ZSSA 1AGCB 4ENED 4KKAC 4OIBA 1P84J 1CS6A 2V9TA 3BWAB 1NCTA 3JWOL 1JE6A 1U8JA 1Z9LA 3RVVC 4POZD 2MKWA 4H20L 4YHIB 3QIBA 5BS0B 2APTA 5GGTL 2J8UA 2B4CH 4LL9A 2EXYC 4PJAB 4HFUL 3O3DB 4OD2B 4Y2DB 4YE4H 1RIUL 4Q6IA 3L3KB 4Z7UA 1N8ZA 3VE0B 4JY4B 4IOFD 4KXZI 3TO4D 3DYPA 2QQQA 1DCLA 1B0WA 3QPXL 1LVEA 4WI5A 5HI5C 3BESR 2JJUA 4PG9B 5KN5B 2WUBL 4LLYA 3EW3B 1LDPH 3B6SA 1TVHB 4N9GA 1H3XA 4LRIC 1HYSD 1TLKA 1H5BB 1PY4A 2BZDA 2NY1B 4PJDE 4N0UB 3SGEI 4KI5C 5BV7B 3HPJB 3TZVC 5MP6H 3OR6B 3BDYH 3GBNH 4IS6B 3DJ9A 5F7FA 5ID0A 4XP6H 1QO3A 1R3IL 4LOUC 1T5XA 1MRCH 3G6JA 2A6IA 2ZCKH 5E6IB 3KYOA 2Q7YB 5HPOA 4UZGA 2CUHA 4XP5H 3KPSD 1A7OH 4Q2ZB 1L0YA 1U3HB 3IJHB 1BOGB 1JGVL 2D7MA 1TZGL 1B6DA 3QSKB 4IHOB 4JM4H 4PRIE 3RUGF 3L7FA 2ZG3A 1YJDL 4YPJA 2EDNA 3UTTA 5T3XD 1DLHB 3EHBD 3RTQA 2VLKA 3MOAH 5INDB 2VJXA 5DFTA 3UC0H 1WWBX 2NY3D 1N6QL 4YUEH 3RDTB 3EYUH 1IGTA 2WBJA 2P48B 3O3UN 4HIJA 5FHBH 1KSRA 5A2KH 1D9KC 4F33B 3TN0B 1N6UA 4WO4C 3BHBB 3I50H 2HJFA 5H35B 5C0BD 5KSAA 4YGVB 4RGOH 2YEZA 3AMLA 3T04D 1J05A 4Y4KD 5IUSA 3QQ4B 4IMKA 1R24B 4PJBA 5KOVC 5GS1A 4TSAH 4NQVA 1FDLH 1NGZA 5D2LF 5ESQB 4S1SH 4ZAKD 5HHMD 3RWJB 2Y1VA 4F7PB 3ZT5A 4XVSL 3O41B 1N3NA 4WW2B 3W9EB 3BP6A 1BQUA 3OHXB 2HT4D 4HKBB 1R3JB 1FFQA 1U8OB 1RK1A 3L5XL 3KVQA 2ZP0T 3HTLX 3NAAL 1PSKL 3W0WA 3KPRD 4X4YB 5INCB 4PJIA 3HI1B 3QHFH 3U1SL 4WI3A 2FRGP 2H1PL 4LSDA 3NPSB 4CN1A 2HKHL 4EN3D 4QHNA 5CINH 4XP9L 1QSZA 1K8IA 4BSVB 3DVNA 4HUXB 5JMRA 4ODHL 4U1NA 3VFOB 4XC1H 4HUUB 1CGYA 2VQTA 3CCHB 3FQTA 3NH7H 1BBDH 1YN6B 1BVLB 4IOSD 1F97A 5JHDA 2F8OA 1YEEH 2AJXL 2HT2D 2BJMH 1DL7H 2HH0H 1BIIB 4B7LA 2OJZL 3QUKA 5FUZH 2QSQA 3QCUH 4GMTH 3O8XC 1P1ZA 5D1ZA 5TH2A 1OAQL 2A6JA 4M48L 4XMLL 3VXMA 4J3WA 3MRKB 3QH3B 3BPLB 5L2JB 2EDJA 5D7IE 5C6PB 4OZFH 4AEIL 2VZ3A 3DX7B 3OKOB 3VFNB 1U58B 4DGIH 2KL6A 1T3FB 4QRRA 1CLZH 3B9KC 1ZLVK 2VABA 4Z78A 3QJHA 4FN0A 1ZSDA 3WSQH 3RWGA 1V3LA 5TQ0L 4PBXA 1MI5B 4UTBL 3GJFH 5IHZB 2W9DH 4QRUB 5HGDA 2MHAA 5TE6L 3CMGA 4XPAL 2IQAA 2R69H 3I84A 2DIAA 5T5NG 1PFCA 4HZLA 3B3IA 1JWMB 1KV3A 3EAKA 1CWVA 4GAYB 1WJ3A 2P8PA 2R0LL 2VL5A 2D2OA 1OSZA 3FB6A 1T89C 3ESUF 5AAMA 5E2WH 5IEHA 1AH1A 3C8DA 5C7XL 4X4ME 1N7MH 2H9GA 1ADQL 3ZKNC 5D7SL 2D31A 3UTOA 1UWXH 2KZ1B 1BZ7A 4Y4HD 4N0FB 4MAUH 2VQUA 5J56B 3DLQR 3RJDA 3DSFL 3DUUA 4NKOB 1MQKL 5CZVH 3WKMH 4PRHE 3TNNA 2FJGA 4ONFL 4KTDH 1JZ2A 3WXVH 3O9WA 1BZ9B 5FYJD 3LAFA 4M6OH 5FDYA 2WMPA 4HDIB 4AEHL 2VDPL 4O4YL 1Z9OA 4OAWB 4WFFD 3HZYA 1E4XI 1SBSH 4W4OA 5F97E 3TM6A 4KJWC 5DHYB 1RZIA 3HNSH 1FIGL 1A6VL 2F8VA 3UTZB 1P84K 2VDLL 2CO7B 1AJ7H 3SKNB 3TVMC 2HWZL 4ZUUA 3FQNA 4AMKL 5F3BA 4X6DF 1J9CT 3TFKA 1FYHB 3TZVB 4Y1AA 1OT2A 4ZO6A 5T3XL 4H8WL 4HKZA 2MQCA 3EOTL 1H3TA 4HCRA 3LEXA 3KPLB 4U05A 5IW1A 2XKNB 4X98B 1QLFA 4JDTL 4JFHD 4NZUH 5GJTH 5KVFL 4LQFH 2ZUYA 4E41B 2EYRB 3NN8B 4TPRL 1EHXA 1A2YA 3MYJA 1X5JA 2JK5A 2E8ZA 4MDJA 3WLBA 3DMMC 1BQHG 4DZ8A 2NXZB 1FQ9C 2Q1EA 1SJHA 4PJFE 2RB8A 1E6OH 1Z3GH 2APBA 3A6OA 4NN5C 1NC4B 1FLRH 3CFKA 3T3MF 2Y36H 4ZOBA 4ZUWA 4JPWL 3CZFB 1J8HD 4FTVD 1G7MA 4O2CB 3QG6B 2NY6B 1CD8A 1K8DA 3M8OH 4IIQA 4RFNC 3PHOA 1P5VA 5DQDL 5I1CH 2I9TA 1XIWB 4QXTB 5H94B 2DM3A 4WWID 2NY0C 3E6FB 3W39B 4XVUC 4JZJC 4U6VL 3O2DH 3AU1A 1NBZA 4R4BB 4RX4D 1YNKL 3GRWA 4PV9A 2B1AH 2X5PA 4WWKB 1LP9F 3HA0A 4KPHL 2GJJA 1UA6H 3OGOE 1KN4H 4U0RB 4C83A 4P23B 3GHBH 5F21B 4N5ED 3CSPA 3V0VA 3KYKH 4NYLA 1S7UA 5AYUL 1GJIA 1KB5L 1MVUB 3K80A 2CRZA 2H2PD 1S78C 1XT5A 3GI9L 2XFXB 4QYOB 3L1OH 5C3LD 2XA3A 4QOKA 4WIQA 1YEGH 1HDMB 2NXYD 3PGDA 5D5MA 3FCTA 5ALCL 4HV8B 2IFFH 4PJXA 4Y4FC 3O45A 1AGDA 1YMMB 3PP3K 4G9FD 5DRWA 4KQ3L 5DVOA 3X14A 4PREA 5KAQF 5IMMA 1FYTA 2CDGA 4PRDB 1TQCB 5IM7B 1NCDL 4J6RL 4ONHB 1JJUA 4FA8A 5DJ0A 1B88A 3OPZH 2NLJA 3CC5A 3PIQA 4MXWL 4X7SH 5LCVH 3AS0A 1YEKH 1C08B 1MUJA 3P9MB 5JOPE 5I9QB 1JPTH 4NN7B 1CZ8H 3HE6D 1EO8H 5C8JB 1KJVA 5DD6A 2G5BA 3IJSB 4G7VL 3ZE2F 3KS0H 4OF0A 5CHNA 3VWJC 3F6IA 3HRPA 5JOPD 3ARDC 2RCSL 2UZIL 3IDMB 3HUJF 5F9WB 5EO9A 2FJHA 2JCCF 4L8CA 5J11C 3HC3L 1BX2A 4XVTL 3CDYA 4NKDA 3EDKA 3FO2B 4Q9CA 1QR1B 2HFFB 3BIAX 5C0RL 3D18B 4QXGL 3IS0X 1HCVA 4PJGF 3RA7L 3V6OA 1N59A 2Y6SD 4Q9QL 3G9AB 2D7OA 3CVHL 1OARH 1E6JL 4OM0H 4XBGB 1ACYH 1RK0B 4KTEL 5E99H 4OZGA 1IGFL 3O6FC 3I2CL 4Y4FD 4QRPD 3ZHKA 1JPGA 5JDSB 1NMBH 4JFEE 3IAQA 3MPCA 4J3TA 1RJLA 3LN5A 3JTTB 4U7KA 2ENYA 1I1AC 1KLGA 2LFGA 4JFFB 5DEGA 1G9NL 1CICA 1U8JB 3U30C 4WUUA 1MEXH 5CBEA 3DI3B 4BFEA 4JFDB 3A6CH 3CUPA 4LU5H 2VXUH 1EHLH 3QIBB 5I16A 3B8YA 5DJCA 5EOQH 5CLWA 4ZFGH 2J8UB 3M45A 1HINH 3L3DA 2R23A 1TDQA 1YUHB 5EU4A 3N1MC 1WVZA 3HMXA 4A6YL 4LSQL 3MV7D 4X5WA 5FYJL 3R0NA 5ERWB 4MNQA 4XXDB 4N0YL 1KJ2A 5LJYH 4OGYH 5T1LB 2YBRB 2QLVB 4N0CA 4LLYB 4N9GB 1F4YH 1FL5A 1QSVA 2E27L 4ALAH 3QEGH 5LWYH 3AS1A 3TLRA 2FECL 1WZMA 5B4MC 5AZEL 2VR5A 2UV3A 5C3TA 5K59F 1KEML 3O2WL 4MNGE 4AEFA 4PUBH 3IDYB 3PGCA 2E6PA 1T5XB 3RKPA 3TCXA 1ZHNB 2UWEA 2D4FA 5I17A 1F3JA 1UM6H 2IQ9L 4FFVD 2X89A 1MCDA 4P4RA 3T77A 2VLJB 1OTUC 1MPAH 5C0EA 3ARFC 2X1OA 4K8RH 3RRQA 3PV6A 1GVIA 3PNWA 4LCWA 2Z35A 3B2UC 1TJHL 4YZFF 4LEXH 3OKDA 5EUOB 5HVWA 2OP4L 3QIUA 1AR1D 3I6LE 4HWBA 4B5EA 5D7LA 4LMQE 3RTQB 3FKUS 2YXFA 4P48A 3SDDD 2Z9TA 1K4CB 3Q6GH 5FXCH 3TJEL 2Y07L 3FFCA