1WBXA

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1wbxA01
4R4NC 4YFEA 1V7NL 5SWSB 3DUUB 1KLGB 3MLUH 2JCCE 3IDNB 2DQCH 4UDUB 4XPBH 5GISL 1BZ7B 1MI5A 4NM8H 3JWDL 2XWTB 2Y07L 1BZ9B 2AXGA 1E27A 5BS0A 2GJJA 3C5ZA 3UMTA 3MYJA 3BJ91 4KUCF 4P2QB 4GJTB 5E8DL 1I7TB 4XVTH 4X5XB 5F6HI 3D25B 2YUWA 2W0FA 3D39D 4AYFA 2OMNA 3MRLB 3OB0K 5J6HB 3RWIB 4H26A 2R0KH 1N3NB 1NGPH 2OXHA 1QFPA 5GZND 2IPUG 2XYCA 1HHHB 3NACL 4LDEB 5DS8B 3PE9A 5BMFL 4WHCA 3JWOC 5I66A 4LVNB 3O6FB 5CILL 3RPKA 4X6CB 4LLUA 1N59A 2PW1A 2CMRL 5TDPB 3VFWA 1PG7X 5SWQB 3DSFH 4KUCD 4L3EE 3TNNA 5I6XC 3U7WH 2E9IA 1HIMH 3JVGA 5FKPB 4XVUD 3WN5C 1EHAA 3GJFA 3BZ4A 3QNXB 4ODXA 4NKIL 1MVFA 4O2FA 5T5FH 5C0BB 2HG5B 5EOTA 2JLLA 3FRUB 4MZ3A 1DUYA 3D69A 2HH0L 3FHQA 4HGMA 1CZ8H 2VLJE 1BD2A 2AJUL 1T5WB 3H3BC 1KFAH 1QYGL 5GS0C 2C3VA 2IH3A 5DJAA 3S4SB 1YN6A 3MV9A 4WFGE 4ZUSB 4BUHA 3TO4A 3LPGA 4NFBA 3RVXC 3VXUB 1CK0L 1HSBB 3QEGH 3KXFD 4NN7B 2VXVH 5TPWL 1DBKL 4NBYB 4O02H 5T3XE 1TFHA 3BIKA 4GAGL 4R9HA 4X9GA 2VN7A 3K1DA 3LRSA 1Q0XH 4ODSL 1OAZL 5T33H 3SEPA 4JZJA 1J8HA 3BYYA 1MCCA 1NC2D 4CBPA 1MJ8H 1YPZF 4NO0A 1NGZB 1S9VA 3VFRB 2ZUWA 4ODWB 4P2RE 3UJTL 2XTJE 2HJKA 1NLBH 3ARGA 1B9ZA 4GW1A 3H9SE 5CJ5A 1WBZA 3MRIB 3B3IB 1AD9B 1N4XL 2XNAB 5ICYB 1KT2B 4NM4L 2Z93A 2QADC 3S3PA 4JFPB 4Y19D 1C16B 2M1KA 5C0GA 4RWYH 3SDAB 2J8OA 4JKMA 4P3DB 4P9HC 4ENEC 3U4AA 5E08H 2BY2A 3GSNL 5DJXA 3GRWL 1ZANL 1U6AL 2F5BL 5INCA 4YDLB 3HPLB 5F9WC 1TZGH 1H3TA 2V2WA 3EOYG 4EUPA 1AY1L 2DD8H 3BEWA 4ZTOL 1G9MC 2C26A 2Z92A 4PYHA 1IVLA 1NGQH 4WHYG 5DFTA 4ZFFB 3FN0H 4YO0B 4ZYKA 1Y6NR 2W65A 2DYPD 2CLZB 1F4HA 3H2WA 1G6VK 2BDNL 1OLLA 2OI9A 4OI9A 3DX9A 4JFDD 2JB6A 3WJLA 4FZ8L 4OQTL 4OKVA 4JM2C 3WUWG 2X4RB 4J1UA 4YX2L 5I74C 1RUPH 1V7ML 3KYNB 4IRSD 2JJSA 3TV3H 4JR9L 1J0ZA 3MBEA 3EOTL 5C9JA 4PJHA 5F89A 1CXHA 4ZAKD 3RIAK 2Y4SA 4ONFH 4HF5H 2G9HB 2OJZH 3WYRA 4Z7VE 4KGLA 3TT1L 2WANA 1D9KA 3KPRB 5DD6B 2XTLA 4U49A 4QXWA 4NQCD 1OAYH 3B9EA 3RUGF 2ZUVA 4KMQA 1H3VA 4AQ1B 3L3IB 4XH2B 4JDZB 4W6WB 5FA3B 3O6KL 1J10A 5EU5B 4NWTL 1A6WL 5C2BL 2LABA 2QSVA 4Z7OE 5GRWA 2ZSVA 3A0OA 1PYWA 5F3HA 1IJ9A 2XKUA 4NHUA 3QRGL 3TBWA 2EH7L 4OZFA 2FL5A 3FFDA 3TPUE 4BZ2H 5T1LB 3S35H 2GUOA 4QHKJ 2VR9A 3HFML 1QFWI 2A6DA 1BWMA 2H3NB 1QR4A 2YZ8A 3P2TA 4DVBA 3HNTH 3QDGE 3FFCD 3HE7A 3PWVB 3CFCL 4F7MB 5J0BA 2EE3A 4HULB 2XN9A 4U31A 1HZHH 3KWWB 3RVWC 2XTJC 3PQYE 1Q38A 3THML 5CCKH 1GGBH 1XCQB 4Z8FL 3RDTB 1KOAA 2C4FT 3MFFB 3HMWH 1XZ0A 4U3XA 3MLTB 2YPKB 5ACZA 3B8YA 1W72L 2JF1A 1TCRB 4NOFA 4XPHL 1DVFD 4Y8DC 1FC1A 3PGCB 3L7FA 3CK0L 5GGRB 2VXQH 4XMPH 4IOSD 1KYOJ 1Z9MA 4J3VA 4J6RL 1S78C 3PDOA 3U46A 3DUUA 3VWJB 4GBXA 3DX7B 3HB3C 2HWZH 3UO1L 3IDNA 2E9JA 5KOMC 4UDUA 2RCSL 2VNCA 1LK3L 5IIEA 4GKOA 2OTWB 2VZ3A 3BZEB 2DMCA 2HJLB 4ZO7A 2BRRH 3MA9H 1AGDB 4XBEH 1HXMB 4P2QA 3KG5A 1CR9H 1FGNL 1NFIA 4X5XA 2VITA 3MNWA 1EFXB 3MV7D 1VCAA 3CVIH 4GLRH 2BCKA 3UJJH 1S7SA 2CRZA 4R7DA 1N26A 2VISA 5B38G 1EAPB 5DS8A 1SBSL 1CFVH 4CDGC 1HKFA 4MQ7B 4MXWH 5IB3B 1N6VA 4HDIB 4X6CA 2GTZA 4YC2B 3VG0H 4N9OB 3ZKNC 4LMQI 5TDPA 2AJSH 5EZOL 1NAMH 2HFFB 3D0VB 2FWOB 4ERSH 4X9IA 4ONOA 5DD5L 1NMAL 5IMOB 3C09B 1N0XH 3MXVL 2R29L 5FKPA 4UINL 2MKLC 5GZOC 5JW4M 3MRFB 3QNXA 5C09E 2HN7B 3GMQA 5C0BA 5DC0A 2NY6D 4HG4K 1YEEH 1PEZA 5J89A 1PBYA 4GMSH 3UPAA 4JG0L 3HR5B 4WCYH 1MFBH 3GEWB 2Y06H 3S4SA 4QT5B 4ZUSA 3H3PL 4K7PL 4Q6YA 3NH7H 3NIDE 5D7LB 1BEYH 4JLRA 2V7NB 4S10A 4MD5B 1F4WH 4P57A 2ZJSL 5L6YH 3MACH 3FN3A 5FUOL 5ALBL 1LP9E 1CXIA 2HFGL 4KQ3L 1F3DH 4ODVL 3MRMB 2X9WA 4IMKC 4PRPE 2MQ3A 1DLFH 2EDNA 4Z7VF 1MRCL 5EB9A 5HY9B 3FQRB 5ACLA 1NKRA 3QIWA 2X4OB 4XHJD 1X5IA 4DFHA 5IW6A 2PO6C 5I1KH 4EBQL 2NY1C 3LMJH 3O3BB 2W1NA 2AV1B 4LKXB 5ADPL 4D3CH 4PJAA 4YHIB 5KSAC 2E7MA 4X9BA 5H2BA 1ZLVH 5I1JH 1I3GH 1C16A 1NSNH 4P46B 5GHWL 4P3DA 1Q72L 4XAWH 1R24B 4PJBA 4X6DB 4JFQB 2FECL 2DI7A 3OBAA 2W59A 4U1LB 4XPTH 1JGVH 2DQEL 2XA3A 5DUPH 4EI5C 2NQCA 1ZHKA 3T8XA 3TIDA 2BFVH 3AY4A 4RFNC 3UBXA 3TF7A 3RL2B 1VFOA 2GIYA 1T89C 3ULVH 1KN4L 4D0DA 1JZ7A 4ESKA 3VFMB 1CD1B 4ZFFA 2NY3D 3Q3GA 5IJKC 3IU4H 5FYKE 1LE9B 3O41B 1MOEA 2CLZA 3MRRB 4QRSB 1U42A 3ARWA 3GJEB 5EU6B 4WFFE 1ADQL 1ZGLA 2JK5B 2GK0B 2I07B 1EAJA 2ZKHH 4FXKB 4JHZA 5IQ7L 5IBLC 4OLXH 1PD6A 2IAMA 3HI1B 1J9CT 3FMGL 3FONA 2A0LC 1OLZA 2X4RA 3WHXB 3U7AA 3DX8B 4KK8D 3O3DA 5LQBL 3JTTB 5F96H 3GUTB 3VWKA 4IHOA 4RSVA 4XNZC 4JREC 2ARJQ 3RY4A 1ORSB 3MGTA 1A14L 2E7CA 2Z31C 1FGVH 3QDGD 4Z7WB 3L5HA 4DN4H 4Y4HD 1I9EA 3P77B 1DLHB 3D87B 3KPRA 1GGIH 3O3UN 1JNNL 2YWYA 4P4KD 3TVMC 4R97B 5K9OA 4QXTB 4RFOH 2YK1L 3L3IA 2QKIB 1F3JB 1I1AA 4LFHG 4XH2A 1JN6A 4LVHC 1MWAB 5D7JB 4P2YA 1TDQA 2DL2A 2NY1D 3INUL 5DDHA 4HC1L 2DBLH 5EBLB 2F8XC 1KENL 4NUGH 1I3RB 1IQDA 3NCBB 4BYHA 5F3BB 2QQLH 3C60C 5K9KB 2EYSA 3TWCL 2YA2A 4J2XA 4Q9QL 2X4SB 4RGNE 4TSBH 5IP4A 2QL1A 1MHHA 5IFJB 5DO2C 4OCYH 3H0TB 1EJOH 2HTLD 4CU8A 1U8KA 3GI9H 2F19L 5EO9B 2H3NA 3QFDB 2YC1B 3CDGB 5L88L 3VW3H 3GMOB 1SVCP 4LSTH 2F8OA 1RZKH 4CAGA 4OLZH 2IALA 1FG2B 4KMTH 5GIRB 3SO3B 3WD5L 1N6QH 3EO1B 3P9LB 3KWWA 3IGAB 1RSFA 5J3HC 5DK3A 1UWGH 1KIUA 1OW0A 1X5FA 2VKXA 2WINB 3KJ6H 3UTTB 5IFHL 5KSVB 3HAEB 2VDLH 5BW7C 3MLTA 4G6AD 1QVOB 2YPKA 4AEEA 3C8KA 1ZGLP 1KB9J 1IGFH 3PGCA 3GMRB 3MUZ1 4RGMB 4M5YL 2D7OA 2VH5H 2WV3A 2CIKB 3K74B 3BWAB 1D5MB 2DLTA 3ZE1E 3E6FA 2BSTB 5GGSB 5HGBA 4NFCA 4EXPX 5HHXH 5EFIB 2GHWB 4K3JL 2F53E 5CSZA 5GJSH 3PIQA 2GCYB 3TVMD 1RZGA 3T0BA 1FFPB 3VJ6A 1D5ZB 1LP9F 5C09D 5LXGL 3BZEA 2BVOB 2BVUA 5FO8A 5FB8A 1U8NA 4D9LL 1MCFA 3G04B 1AGDA 2FH8A 4ZNEA 3DWTA 3VE0A 4GH7B 4K3EL 4Z77B 4HIXH 3WBDA 4PRNA 3QUYD 2WW8A 4Z95H 5C70A 1GSMA 5IBUB 5SV3A 4JFFB 3QDJA 1A8JH 1QRKA 3ULUH 1QSEE 2A77H 2VDOL 5KN5B 4ZG1A 4N8CH 4HT1L 2AI0L 2CDFB 2VAAB 3QIUB 3FZUD 4YDJA 1DBBH 3CDFA 5KOVC 2BVYA 3TBYA 3QHZL 2FEDC 5FO9A 3NPSC 3MCKB 3ARED 3L3KB 2HFFA 3CGTA 2HLFD 3BKCL 3VI3E 5J13C 4J3WA 3IAGC 4E0RB 4ZSOB 4KZEL 3F8UB 2B1AL 3OKKA 4PV8A 4H8WH 3S34H 5H35A 4XP6L 4YIQB 3MRFA 4UI2A 5FYLH 1NBVL 2DI8A 3M8OH 3VFGL 2GSGA 4ZXBB 5I8OL 4N0CA 2WBJC 5ISZB 3MLYL 4LDLB 4OZGB 2B4CL 1WBXB 1OGAA 5FCUH 3UC0H 15C8H 4OCXL 5DQDL 3WFHA 4RGNC 4MJ6B 12E8L 2NTFB 2O5YL 4M6OH 3ARFD 3MRJB 4N8VA 2QHRL 1FDLH 3C5JB 2XY2A 3QFJB 2V7NA 3LEVL 5HI3C 1N5YL 4WIQA 1TJIH 5EA0H 5EU3A 4LHUD 2Z35A 4JDVA 1D6VH 5DHXB 1D7FA 2E27L 3IRPX 4MMXC 4NO5B 5IROA 4S1SL 5T1KB 4PJFF 3X13B 2AK4E 1S9YB 4I48A 4QHNA 1NCCH 5C0JB 4GG6E 1G0DA 3WNPA 2O93L 3L1OH 1PY4A 2P1YA 4XWOC 1FE8L 4GFTB 4CJ0A 3EDJA 4UTAH 2AV1A 3LH2L 2BVQA 3OQ3B 1E4XH 4YHIA 3SJVE 1INEL 5KS9A 2LV4A 3CSYB 3FRPG 3RA7L 1XR8B 4YHMH 5DJDA 3RZCB 1ITBB 3TPKA 3CFEB 5E5UB 2NX5B 4FTVD 1R24A 5SX4H 4PJIB 3H8NA 3QUZA 4NNYB 3SKJL 2V9RA 4U1LA 5FV2A 5LCVH 1QBMH 3IS0X 2MHAB 1FBIH 1BP3B 1U8IA 4GRMA 4MNGB 2XY1A 3EZJB 1WT5A 5A2IH 4HKZB 3RL2A 4ELMF 2CR3A 5CEZD 1MRDH 1GH7A 3U6RA 5DHYA 4PP2B 3RVTD 3AU1B 4K3DL 4I2XE 2BXZA 3L9RB 1I8LC 3O41A 3I6GA 1WUNT 2XXMB 2F15A 3CSPA 3HCVA 3MRRA 5JIPA 2VOTA 3MBXH 5JOPE 4AENA 5HYJB 2GK0A 5KW9L 5I18H 2I07A 1CF8L 3ZTNH 1EVUA 1FN4A 5A2LH 4FXKA 4CU7A 2PW2A 3HI1A 1J1PL 4Y2DB 3N50A 4PJ7E 1CGSL 1EMTL 1H8SA 35C8H 4BA8A 1F11B 3MLWH 5IVXE 3JTTA 4MS8A 3GUTA 4RMRA 2MSPA 1S7WA 1CLOL 4UU9B 1ORSA 4ZPTB 4U1NB 4LSUL 4RIRA 4Z7WA 1Z0NA 1CDBA 3JTCA 5HI5D 3BIAX 2VJXA 1T21B 1EEZB 4D8PB 4IS6B 5JDSA 2XQYK 5L7XH 4GT7A 5J7CC 4QXGH 2DQHL 3TA3B 4QXTA 1WWWX 5F72S 1F3JA 4FP8L 5D7JA 5E8NB 4J3TA 4G8EA 4AZ8A 3FQTA 1IT9L 1JYVA 3ULSB 4XP5H 5EBLA 2RJMA 1X5HA 2EKJA 4RMWA 1I3RA 1X6LA 5DRNB 3VFTA 3S96A 1K8IB 5F3BA 3FN9A 1OAUL 4BSVB 4QTIL 3QULB 4YNYB 2RFXB 5EOCJ 1JWUB 2EEBA 2X4SA 4WW1B 1LWRA 3DNKA 4LRNL 3T0VA 3BVNA 2K7PA 2BNRD 2ERJC 5HD8D 2HKHL 4FQ1H 3F7YB 3FL7A 4U05A 1IM3B 3TLRA 3GMOA 2XWBA 5I8KH 4F2MB 5IMMA 3MRNA 4G8GE 5JUEH 3V5HA 2PNDA 2FJFB 5GIRA 1EERB 1KLUA 3H3KA 3FQNB 1ED3B 2F5AL 1T7WA 3IGAA 5ANMB 1YJDH 1BBJA 5ITFB 3ZLQC 43C9B 1JPFB 3BOVA 3DVGB 4AK1A 4OTXH 1UXWB 5EN2A 2PCPA 1QSED 4MAUL 4KVCL 3UTTA 4CJ1A 4I77H 3SO5A 1CFSB 4QRPA 2VSDA 3QG7L 4KJPC 2EDLA 1S7UB 4L5FH 3W82A 4XCYB 3KHOA 2MCPL 3OKEA 2ADFH 4X7SL 5F8QC 1FNHA 1OAKL 1Q1JH 3V4UH 4PTTA 4DGVL 4I8DA 1G0XA 3DLQR 1D5MA 4AT6A 3ARDD 1F4YL 5EU7C 5GGSA 3EDKA 2PTTB 4GW4B 2QBWA 1CGYA 2QQKL 1FFPA 3NMEA 2I5YH 3DMMD 3GO1L 1WAAE 4U1MB 1AIFB 2BVOA 4P2OB 1CXLA 1GAFH 4M8VA 3HZVB 3VXRA 4Z77A 1TQBC 4NZTH 1A22B 3K2UL 4JY4B 2E5EA 4F37F 2FB4L 2AVGA 4QHMA 4PB0L 2IC2A 1LO2L 3CIQA 4PDCE 3B9KC 1K85A 2E7LA 4WWKC 3FO1B 3RI5F 3WHE1 3QIUA 5KSUB 1YZZA 3C08L 1MREH 2AQ1A 1PLGH 3JV0A 3QSKB 4JO4L 4MJ2A 4Q58C 4Z78B 1XCTA 1AQKL 4Y1AA 4LLVA 3QWQB 1RURL 3HKFA 4HX1B 4PRBB 4CL7A 5FYJU 3LSOA 4R4BB 5KTEH 3FB7B 1CL7H 5E7BA 4AEHL 4AG4L 2ZSWA 5KVFH 2GAZA 4OFYA 2HTKD 4QYOA 4E0RA 1NAKH 4N5EA 3L3JB 5EZIL 4K9EC 5C0EB 1NC2B 3P4OB 4JY6B 2EH8L 1AD0B 3TBVB 3D48R 5FHAL 1JZ8A 3RQ3A 2DQDL 3E0GA 3G5VB 3MRDB 4LCUB 5GGQH 4ZXBA 3QZWG 4X8XA 4ZFOL 5DJCA 1PSKL 5HHOB 4Y16C 3RWEB 1WBXA 4M6MH 4AMKL 4UQ2B 2AV7A 4Y19B 4YXKH 1RU9L 5GRXG 4YGVA 2ENSA 2X10A 1DQDL 1X7QB 2VERN 4LCCC 1QSZA 5F7DA 1D5BA 1V3MA 1VKXB 1L6ZA 4UIKL 1KEMH 2QSCL 3C5JA 3PV6B 2EYTB 2VKWA 1LO4L 1YPZB 4LGPB 5HGAB 3MO1A 2YSSB 4U7MA 1F45A 4OT1H 3ALPA 3X12B 5I6XB 5T1KA 1HHIB 4OZHA 3SKMB 2CLVB 5MP6L 4WFEE 2OM5A 3C2AL 3WN5B 2DKSA 1L0YA 6FABH 2EDWA 2DYPB 3F7VB 5D1QA 3BD3A 4M6NL 3SDXE 2Y23A 4P2CG 4TUJB 4LMQE 4KKBC 4K8RL 2G75B 3ALXA 3W0WB 5IBTH 4JFDB 4S1QH 2QJDA 2VLLA 2I9TA 4G80A 2IH1B 2BNQE 2XA8H 3BZFB 1MWAL 1ZHBB 1XR8A 4PJGE 4KKLC 3CFEA 2YPLB 3LN5A 1HH6A 2IG2H 4WW2F 4NQEE 4QXUH 1CBVL 1Z0MA 2ZWLT 2OSLB 1YEFH 4ETQA 5JQ6H 1X6NA 1NCBL 1FAKT 4PJ8D 4HEPG 3GSQB 1NKOA 4ZAKB 3VXNB 4NYLB 5K59E 1JI1A 1QO3B 2W0KA 1J1XL 2HT4C 2ZP0T 3AM8C 2PTVA 4HXBH 1RMFL 5F44A 3VMPA 4MA3B 2A83B 5HHNA 1AR2A 4QRUA 1A3LL 2AGJH 3L3HA 5FM4A 1AC0A 4N8PA 1IQWL 3GHBH 3SDCD 1KPUB 2GJ6A 4RAVB 4PJXE 3QEHA 1YC7A 3EJZD 1FPTL 1UYWL 2QADB 1U8HB 4Y2DA 4D2NA 4M43H 3S6CA 5AUMB 3OJVC 2SEBA 3OF6D 5I0ZA 4K23L 1RUQL 4TTDC 1PX4A 5CZVH 4UB0H 4NJAH 4UU9A 3MLSH 3F65A 5F9OL 4AH2B 3STLB 1CXEA 1U41A 4U1NA 1Q0YL 2F9BT 1SMOA 1IGTA 4G8GD 2JCCB 2KQNA 1T21A 2KZWA 1EEZA 5B8CC 3TJEH 3NZHL 3RGVA 1I3VA 5L0QC 4R4FL 3QJHB 1ZAGA 1GC1L 1MCRA 2CRMA 1ODAA 5E8NA 1FVCB 1MIEL 3O4LA 1G7IA 4IDJH 4HFUH 1IC4H 3ULSA 1HXYB 3QI9A 3T0EA 2R0ZH 1J1OL 5DRNA 2X42A 1IE5A 4ZUUB 2ZG2A 4WW1A 1X44A 4FHBD 5HHMA 1DVFB 3KYKL 3EDEA 2BOBB 4HS3B 3AMKA 5DRXA 4F3FB 1T7XA 4NC2B 4XP1H 1KXVC 1XGYH 5EZLB 1MCNA 4ZD3H 1P1ZB 4HCRL 4L3EB 5T3ZL 2FJFA 4OSUL 1WV7T 4QLRA 3BPOB 2OR7A 3DI2B 4HUVA 3AMLA 1YEJL 2GKIA 4KZDH 3FT4B 1IFHH 5ANMA 3T4YA 43C9A 3FT2B 5HPOA 1BLNA 3ES6A 5J06A 3LQZB 4M3JA 3WSQL 4NKMB 3ROLA 3OAYH 2DLIA 4WHTA 2VLJB 1YECH 2MFNA 3B2UC 4FQXC 3U30C 1S7UA 2P8LB 4DCQA 4XCYA 1UH3A 4TUKH 5SX5K 2VC2L 1PDKA 4JO3H 2YKLH 1A1OB 1X9QA 5IGXH 1C1EL 2XZQL 2G5BB 4HQQL 1N6UA 5HHQB 1U8JA 3DRQA 2EYRA 5SWZD 4AIZA 5IKCB 2ESVE 2DDQL 1RUML 4KJQC 1E0OB 5GISH 4XNXL 3GBMH 1AIFA 1KB5A 4P2RB 3JWDH 2XTJB 2Y07H 2GJZB 3H9YA 4FMFA 4P2OA 3TNMB 3G9VA 2P5ED 3H9SB 5IB5B 4L8BB 1RK1B 4G7YL 1MCPH 3V0WH 1CFTA 3WMSA 5E8DH 1KNOB 3I2CL 1C5DB 3J8F7 1Y6KR 3NBNA 3T1FA 5IR1B 4UV7L 1BQLL 3B6SA 3MMEA 4ORGB 5J1AA 1ZEAL 4JM4H 5KSUA 2Y5TA 2QEJA 3LKQB 1ES0B 2BVTA 3D85D 4HX1A 4PRBA 4FQIL 4PTUA 3SGJC 5I1AB 1UADC 5CJOH 5BMFH 1MCKA 4KTDL 3TIEA 4TVPD 1UZ6E 2NY0C 1DL7L 4XVSH 5ESQA 5ICZB 1OTSC 3PV7A 5K59F 4FFYH 3L3JA 4UILH 2V2XB 2NXZC 1DQJA 5C0CA 3P4OA 3REVA 4JY6A 3QQ9D 3BPNB 5GRVK 3TBVA 1B0RA 2EECA 5F7KC 1EA9C 2NNAB 4JGMA 1PX3A 5KJRL 4LCUA 5E2TH 4O4YH 5BVJB 3TH2T 3RY5A 4U6VL 5HHOA 5C0IA 3OPZH 3RWEA 2BNQD 5DVLA 1R3KB 2HT2D 3QEQD 3KPQA 4ZS6C 1A1NB 2OK0L 1G7MB 2AJUH 1X7QA 1T7ZA 2VXSH 3ECBB 3STBA 2FGWL 2H8PB 5LBSL 3EAKA 2XPGB 5F9JA 1RJYB 5K33A 3PV6A 2VTFA 1JNHB 2WUBH 4Z7VB 3K46A 4X98B 1KTDB 3QIBC 2WWKT 4NC0B 1FFQA 4M00A 1RULH 3O9WD 4G6FB 1MCDA 4ODSH 1INDL 2CLVA 1UJ3C 3WN5A 2NY3B 4OFVA 5DEZA 2B7DT 2X70A 4RISH 3PGFL 3KPNB 4Z18A 4RA0C 3IKCB 4H88H 5F9AC 3HMXA 2WP3O 1HH9B 2CIIB 3C8HA 4NKOB 4WEBL 3UBXI 5KVDH 3WJJC 5J8OA 3VI4F 4U1KB 1NDGA 3TPUB 1KJMB 3ZE0E 4F33B 2YPLA 2J88H 1EZVY 2D03L 2Y36L 4KUZL 1CTNA 3GSNH 3U1SH 1E4XI 5FM5M 1ZANH 1U6AH 1EJ6A 5CIPA 2N4IA 2ICWA 4NYLA 1QO3A 4XI5D 4BH7B 3QDGB 4PRAA 5C3TA 8CGTA 5SX4I 1YNKH 4I13B 4PJCE 3AUVA 4ISVA 4NP4L 5B3NA 1S7RA 4MA3A 2X09A 4KAQL 4F7PB 3ETBF 3PQYB 5AYUH 3REWB 2PO6B 2CRIA 3PWJA 4O51A 5C92A 2IGFL 1FIGH 4RAVA 2NY1B 4OGZA 3L5IA 4JKWA 1XMWA 3B5HA 3KGRA 5KSAB 2UZYB 1JYXA 1U8HA 5DK2A 5M94B 3C5SB 1QBAA 3T77A 2G2RB 1I1RA 4OQTH 2UZXB 3OGCB 2R2CA 4YR6A 3QDAA 1A3RL 4HWNA 5DD1H 5HDBE 1U3HC 4OIAA 5FOJA 3IDXL 4JHAL 5CP7A 4EI5B 5E8EB 4XVJL 1LE5A 3STLA 1RZFL 5J56B 5JO5B 3EOTH 3MTRA 4PJDA 3HPJA 4DOHE 2JCCA 3PWNB 3VG9C 4G9DA 2MQ0A 3RX7A 1N7ML 5FCSH 4JFHD 1NCDL 1V8HA 3QJHA 4MCZA 3OKMA 2FH6A 4X9HA 2H41A 1LO0L 3RHWF 4HJGB 2DTML 3LKOB 3QDMA 4M8QB 4ELKB 3KR3L 5F1IB 1IC1A 4LLDA 5KAQG 5DMKA 3RVVC 4AJ0A 4WV1C 4D0CA 4GRLC 3O6KH 4JM2A 1F13A 4JN2A 4U6TA 1V3KA 3BDBA 2H6PA 4YXHH 5C2BH 4P0DA 1ZA3A 1GIGH 1OT2A 3BE1H 3G9AB 4YDVA 4Q0XL 2X4UB 1JF6A 3IFPB 4XNZB 1Z6JT 3QRGH 1RZJL 5C0AD 1F4XL 2VLKE 1AXTL 3LB6C 3EOAB 3ESVF 4JFZL 1IGJB 4MCYB 3MZTA 4OB5L 4PJ5D 3DV6B 2APWA 3U83A 4NQVA 2ARWA 3IB4A 3TVMB 2OS7A 3LHPL 3KPOA 4MGXA 4U6YB 4I5BB 1Z3GH 1UWEL 3FT4A 4LVHB 1BIIA 3O8XC 5C09B 4LQFH 1CGWA 3TBSB 3MREB 3FT2A 1S7XB 4LHQB 3GSUB 2VABA 5EZJB 1KB5H 4V2BA 1OAXL 3KLAB 3GMMA 4OD3L 1SY6A 3BN9C 3AB0C 2AP2A 1U91B 1W72H 5BVPH 3UYPA 1ZHNA 2DJ4A 3ZT5A 2PF6A 4XPHH 1KF9B 1ETZB 3PDDA 1SQ2N 3CK0H 3QXAB 2QV2A 5JW4Q 4Y5XC 1A1OA 3FO9B 4Y5YB 4NGHL 3LZFL 3LKSB 2AJYL 1R5IA 2OZ4A 3NCEB 2WM0A 1LP9B 3M45A 5HHQA 1WWBX 1J8KA 1I9JL 4Y4KC 3MUY1 4P5TA 4PRPB 2IPUK 4YE4L 2OR9L 2BHYA 2RCSH 3NIFE 1LK3H 4FFVD 4P2RA 5ETUA 3CZJA 1LNUB 2DQGL 4O2CA 3A6CL 2PXYA 2L7JA 1RK1A 4N5UA 5IK3B 3P4MA 4F7CB 1F8TH 4W4NA 1ZKAA 1XH3B 2RB8A 1C5DA 1OARH 3QG6A 1IAIH 3WIHA 4GKNA 3KYMB 1CG9A 3LDBC 5I76B 3VD9A 1MAML 3LKQA 4B53A 4JJ5B 1GHFL 1QLFB 3ZE0F 5IVNA 3RWFB 3S3SA 3WNOA 5KZCD 5I1AA 4RBPK 2D7TH 2BX5A 3BRDA 1INQB 4YXLH 4XBPB 1SYSB 4MJ4A 1VACB 2RBLA 5D7SL 2HMIC 3QUMB 3RJQB 5EZOH 4HHAB 2DLFH 1NMAH 4K2UH 4Q7DA 5ECJE 1XGTB 5BS0E 5DEFB 3MXVH 2AXHA 2W60B 4PJCF 1JHLL 1DTUA 1H3PH 4O9HH 1JGDB 4WI5A 1MIML 4HJ0D 3QUXA 2C4XA 4F9LA 5D1XD 5E5MA 2AJ3B 2F8VA 3LEYL 3HMXH 4X4ZA 1FNLA 1IC7H 4OZ4B 4JG0H 1RZ7L 4JG1L 1ZLSH 1QLRB 5EO0B 3ECBA 3IVKA 2P8PA 3E6HA 1FYTE 5CKGA 2XPGA 1RJYA 2C9AA 3NPSB 4LPTA 1FVDB 1ZTXH 4X6FA 3BYTA 3H9HB 5HDBF 1JNHA 5GSVA 3NTCH 5TGBB 4X98A 3VD5A 3MX0A 2HRLA 4S11A 3Q0HA 2ZJSH 4OCRH 5FUOH 2Z8RA 4GSDL 5CIPH 4C59B 4DEPC 4ONHA 3IDJA 2RAMA 3MRGB 5DMJB 1BHGA 1MCOL 1EZVX 4CADA 4WO4D 1NUGA 3CFIC 4XCNB 2P7TB 4P48A 2CSPA 2WBJB 4M48H 1PVHA 4RX4A 4QTHB 4NKOA 2FLBT 1IC5L 4KXZI 5TFSH 4U1KA 3FO2B 4RGNB 1J0KA 1I85C 5E2WL 3UBXG 3PGDB 3MV9E 1DEEB 1N8ZB 1NFDA 4KMLB 1KJ3L 2EO9A 1J7VR 3WUWB 1YN7B 5HPMA 3DUHA 2DQEH 4YWGH 3NIGE 4NQDA 3OJDA 2UY7A 5CGYC 1G6RL 4MVBA 1KN4H 3NZ8B 1G9MH 1FO0B 4KPHL 1FV1A 2PO6A 3IDMB 3TN0C 3D0LA 4Z6AT 5I1HH 4HJJH 5F7HA 3O0RH 5CMAB 4OQ1A 1TQCC 1E6JL 3HUJE 1E6OL 2G2RA 3ZSTA 2EIZB 2DL9A 4L4TD 3FMGH 1TJHL 5KANI 1XT5A 1WTGT 3V4PH 1ZSDA 2D0GA 2EC9U 4WU7A 1GPOL 2WWMC 4G5ZL 4EI5A 5E8EA 4PG9B 2ZG3A 4HBCH 4L8DA 4PY7A 3VFOB 3WKNA 1T89A 1BFOB 2F53B 4RFEB 5LKNA 5IHUH 5HYIA 5EU4B 2EXWC 3DV4B 2EE9A 5D7IE 5CLWA 1VGKB 1JNNH 4M1GH 3KS0H 3IDYB 4LEXL 5DGRA 4MX7A 1KG0A 1CGTA 4J12A 5F8RC 3VRIA 5JTWA 1HYSD 5F1IA 1E4WL 1UB5B 2DWEB 2VDNH 3WCYA 3INUH 2P46B 1JRHH 5HHPA 3L3GB 1QSEB 5DVKA 4JY5L 2CH8A 1YMMD 4YBQC 3MCLH 4BSWA 1CIUA 3ARBD 3IFPA 4B50A 3M17B 2RQ8A 2CKBA 1KCVH 1IGCL 2Q8AL 2EXYD 3VGBA 1N0LA 4PJHE 1KJ2L 1P6AB 2CK0H 2Z31A 3ULVE 4HKXA 3UTSD 5EOQL 5IEKB 4WJ5A 1IGJA 2ADJB 2A74A 2C7UA 3PG2A 4MCYA 3B9VA 4IOFD 3KYAA 5L88H 1Z5LA 3S98A 5GRYA 2ITCB 3VXOA 3JVGC 4TULH 3X3FH 1CDJA 4OKDA 1DQLH 3BT2L 4I4WB 2UUDH 2B8OT 4Y4FD 1S7XA 4KWUA 1JVKA 3BP7A 5EUOE 3KPPB 1R5WA 3EFDL 4KJYB 5DJ8A 3C60A 3SE9L 2CD0A 5DZNA 2CXKA 5IFHH 1PEWA 4C57C 3HS0B 5EULV 4JRYA 2GITB 2ERJB 2G60H 3IU3A 4B41A 3SN6N 3WIHH 5A40E 4PB9L 1ZWIA 1HEZB 1OM3L 1D3CA 3C87A 3DXAE 3LKSA 4GO6B 4HK0A 5B4MC 1JCKA 2BP3A 3V7MA 5B38B 1MI5D 1J0JA 4YHKL 2AQ3A 3GKZA 4NRZB 2AK4B 2XN9E 3WFBH 3C5ZD 3QCTH 1I7UB 3MA7A 1YEGH 4GG6B 5LXGH 3GSRA 5EIIB 1GZPB 4XAKD 3G5XA 4KROD 3T09A 1CXKA 4BQBA 1NGXB 1HHKA 1KACB 3EHBD 3MLRL 4K3EH 4OF6A 4P4RB 3DUSB 3T2NL 1B4RA 4YBQD 3SJVB 1DQQA 1MPAH 2Q3ZA 1S7TA 1MHCB 1O0VA 2R2HB 3PF2A 5DJ2B 5FM5O 2VDOH 3RI5K 3NFSL 5I76A 5E1HB 5GGTL 4DW2H 5EWIH 1NCUA 3K7UA 4Z0XA 4IRJD 1QLFA 2A6JB 1QFUL 4M61A 1A21A 1EH9A 5BV7B 5DZLA 2OTUB 3QHZH 4HG4J 4NHCH 4M1CD 3GKWL 4MA7H 3W39A 1ORQB 1ZVSA 4LSDA 4JFYB 3TBTB 2DMBA 4MD4B 3EZ8A 3TCXA 1INQA 5C2UB 4MQXC 1VACA 3I3EA 4I2XB 3BKCH 3QCVL 1KEGL 3HE6C 4PRIA 5TE4L 4WTWA 3U79A 3WL9B 1XGTA 1KPVB 4NNPL 1A9BB 4C55A 4KZEH 2B1AH 2C1OB 2YUVA 1OSPL 1TQBB 3DETD 5DJZB 1KCUH 1M6OB 1QPPA 4NBXB 1BD2D 4PJ7B 4N8VG 2X9YA 5I8OH 1QZ1A 2O61A 1S3KH 4ZOEA 1A7NL 1MH5B 5E2VL 3MV9D 3PWLB 5IVXB 4G43A 4WWKB 1ONQA 3QAZC 4OZ4A 3TO4D 5JNYA 1UA6L 1IKNA 4HWEH 2JJSC 2H9GA 5HVHC 3KLHC 4OM1L 2N7AA 1H9VA 3NVQA 4PGCB 3VCLB 4ZQKB 4EOWH 3ULVC 1UB6A 1NH6A 3WO3B 3M1BA 1CLZH 3MJ9A 3LEVH 2GSIB 1IEBB 5ESVA 1J8HD 1H3UA 4OBSA 4Z5RB 5FF6B 3SKOB 4MJ5B 3PL6C 3JUZA 2E27H 4MWFB 4K7PX 1I8KB 2UWEE 3ARGD 4S1SH 1A1MA 3DVNA 3ULUE 4ZFOA 3AXLA 3HNVH 3V6OA 3SDCB 3RU8L 2P7TA 4UBDD 1VADB 2WBJA 3D3VD 1E4KA 4Y16B 1OF2A 4WW2B 5HYSG 5E2UL 1D6EA 1YA5A 4YJZL 1XF4B 3H7BA 1CDCA 2I9LB 4LKCA 3SPVA 2VLRA 5D72L 2B2XL 1NCTA 1INEH 5I17A 2YMXL 4R96A 4G42A 4LCCB 3PGDA 5JW3L 1CS6A 1DP0A 4MJIA 3TP4A 1XGUB 3Q1SL 4P23C 1IEHA 3WUWA 1BFVL 1UACL 3KYOB 4JO2L 4EN3C 1WCQA 2A73A 5C8JB 3LY6A 3GIVA 4FQJL 4PJHF 1MHEB 1MFAL 1FZKA 3ZYZA 1EGJA 4G8GB 4KRPC 5FYLE 3B8SA 5E56A 4PGBB 2RGSA 3QA3A 3E3QA 4Q9RL 3MV01 4OUOA 4K3DH 4YDIH 4GQPH 3N1PC 2YD8A 5FECA 1KIPB 3BWUC 3FB5B 2UVFA 5I75C 3PP4L 2EE2A 4PJAE 2YXFA 2EIZA 4HS6B 1J1PH 1CGSH 2YPVL 1EMTH 4HKJB 3MBED 5LGKA 1P4IH 4PJBE 3EYUL 4OLWL 4L29B 5KANG 4U6HA 5KAQF 1G7JA 2FATL 3SDYL 5C0RH 1MY5A 1D9KD 2CKBH 4OCLC 4LSUH 3WFEH 4HMDA 5F1OB 2ZUQC 4RFEA 5EC1B 3DV4A 4S1RL 2VE6B 4U7KA 1B2WL 1VGKA 1I8LA 4QO1A 4HAGA 3FO0H 4JFOA 3KLDA 1IRAY 3LQAL 1I1YA 1CQYA 3ALWA 2DWEA 1IT9H 4XZUB 5ELIA 3FT3B 1PW3A 1NLDL 3R0NA 4XPGL 1AO7D 5BZDA 1RUKL 1HQ4B 3I02A 3OZ9H 1BAFL 2Q76B 3HC3L 4YK4C 4NWUL 1NPUA 2HFEB 4KHXH 3H6JA 4QTIH 1JHTA 2V5RA 3DBXB 3PNWA 2R1XB 2DM4A 2ZCKH 1JHKL 1NBZB 5C0FB 2NY2C 3G6AB 2BSED 4WFHE 2MNUA 1SYVB 2C1PB 4PRHA 5IEKA 4KK9D 4XCFL 1A4JB 4J3XA 3PP3K 3HE7D 4ZNCD 4FFZH 5B8CB 3N0PB 2XN9D 5L0QB 1WFUA 4L9LA 1WWCA 1M7DA 3DTXA 4BQ8A 5DMIL 2F5AH 1M71B 2WIIA 1JZ6A 4LEOA 3CFBA 2E9WA 4KTYA 4I0KA 4EXKA 2F58L 4KVCH 4XC1L 1DQML 4TRPH 5DJYA 3WFDL 3HS0A 3EJYC 3VD7A 2ZCLL 1G7PA 3QG7H 1U2HA 3GZKA 2WMPA 4WTZA 3D85B 1P84K 1OAKH 4GBXD 1T5XB 5DQJB 3I75B 3CFJA 4HCRA 2VYRE 3TFKC 2R56L 5B38A 3NABL 4H8WC 1M7IB 2YEZB 1GOHA 3BPCA 3FB8B 3S36H 3UYRL 4MB4A 2AK4A 3V6ZA 3ZKMC 4X6CF 4HWZB 2APXA 2I27N 3UTPD 5D6DC 3UEZA 4P2QD 1I7UA 3B5TA 4NZUL 1GZPA 2GFBA 4G8FB 4TQEL 3SDXB 5BCAA 4KDTC 1NGXA 1BBDL 4P4RA 5IHBA 5CEZL 3ULUF 3SJVA 4PS4L 2BNQB 4FQXB 1KIQB 3U30B 3IETB 2XWJA 4PJGB 4WI6A 2R2HA 4OM0L 4NQEB 5EC2A 5CZXC 2P5WE 3MUGB 4KRLB 2CDEA 3C08H 4W70A 4D9QE 3O6FD 1AQKH 1UCTA 3LS5L 2OTUA 5E6YA 2JELH 1B0WA 1ORQA 4MHHI 4NOBA 5T1DL 4JFYA 3VFSB 1ZE3C 4YQXL 4WGWB 1PZ5A 1I8IA 1RJLA 4HKBB 4X7CC 1MCLA 3MJ9H 3OKOA 4AG4H 1UM6L 5ICXB 1U95A 1A4KB 3ULUD 3UPRA 3ZSSA 3WL9A 2CUHA 5C0BD 3JV4A 4ZNEE 2VIRA 4WGVB 5DJZA 5ADOL 1LO3H 4PJXB 1NBYA 2QQNL 1YQVL 2BRQA 5BRZA 3QDJE 2IAMC 4LLMA 4NO3B 3B9KA 1LEIA 4F9PC 1Y0LB 4WWKA 5IVXA 4HUUB 4JVUA 1WCBA 4PJAF 3FQWB 5DSCA 1ULVA 3RWDA 3OWEA 4PJBF 2BY1A 1V3JA 4NZDA 4EKXA 5KVEH 1YEHL 2V7HA 2GSIA 3BAEL 3R1GH 3B9DA 2VXUL 4UNUA 4R3SA 3JTSB 2FX9H 1LO4H 3BW9B 4Z5RA 4XWGL 2O5XL 3RJDA 5FF6A 3HRZB 3SKOA 4MJ5A 2NXZB 3KDMB 4MWFA 1VEMA 3OTTA 3QIWD 4G9FE 1I1AC 3C2AH 4U1GC 2H1PL 3ILQC 1X4YA 2X89A 1T1YA 4MDIA 3GNMH 4BQCA 4RMTA 5B3JF 1I4FA 2R4RL 5C7XH 1UVQA 1I1FB 1ZLWK 1OGAE 5L2JB 5I1DA 2YD2A 1B3JA 4LRIC 1U3JA 1JPST 5FGRA 5GRUH 3ZT7A 1WZKA 5I1CL 4F7EB 1MFCH 3FOMB 1QEWB 1UZ8B 5KG9B 4DGYL 4O00A 1ZT1A 2W9EL 2ITDA 4XCEB 5JZ7C 1RHHB 3VXTB 1T0MA 4X7FC 3QIBB 4KH2A 5D71H 5HDOA 1OY3B 3MJ7B 5DRZA 5D9SB 3BGMA 1DFBL 4M1DL 2FECI 1OP9A 1RMFH 2VZTA 3ARSA 4NQSA 4DKFL 1LDPH 3DX6B 1A3LH 3CFDB 3T4AA 1XF3B 1AXSB 3TYFB 3RGHA 1IQWH 3CMOH 1KIPA 3FB5A 5TE6H 3Q5YA 2AEWA 3SQOL 2E8YA 1RK0A 3PWPA 4HLJA 5KS9E 3OKNA 4HS6A 4R26L 3O6LL 5DMGD 3VWKD 2XQYG 4HIHB 3GGWA 1OPGL 3P0VL 3EYQC 1WFOA 1T20A 2ARJB 2WY3A 4WFHD 4CMMB 1HINH 2ZUYA 5F9OH 5CD5D 5KVGL 1A6VL 2NYYD 3BP4A 5CLTA 3ARVA 5FYKU 1YY8A 1JZ4A 3KPRD 1Q0YH 3AM8A 5FYJD 5I1LB 1BX2B 3F5WB 4LDOB 4OLYH 5MENE 2ESVB 1TPXC 3KNBB 4AY0A 2VE6A 4LGRB 5FKAB 3U0PB 2YN5A 4HPOL 3RHWK 5JLZA 5D70L 5ID0A 1H8OA 3Q5OA 5M95B 1OWRM 1B6UA 3NGBC 1MIEH 5CEXB 3BSZH 1JFQL 3LV3B 4F8TA 2IWGA 4PBXA 1T0NA 1JV5B 1J1OH 1MLCA 4XRCA 3MRKA 3UZEA 2XOTA 3F12A 5TDOB 2X05A 2YUZA 2HFEA 2E6QA 5T1LD 1CFNA 3MYZA 1T04B 1U3HB 4UT9H 4OGAD 3MR9B 4JZNB 5DD0L 5C07A 1NBZA 2VR5A 2VZUA 4QHLA 3IYLW 3D39A 3KYKH 3G5ZA 5C0FA 5JW5B 2FHFA 3G6AA 1AFVL 3NA4A 1XR9A 1MLBA 5ENWA 2XG4A 1G7LA 4MLIA 4LARL 3VG9B 4JFXA 1JF5A 4XBGB 4JPKL 2JIXB 1NCNA 2D7MA 5GGSY 2P43B 4HCRH 2YOCA 4QRQB 5BV7L 1ND0A 4OSUH 4UAOC 4QOKA 3ZE2E 1NQBA 3RDTD 4WV1B 1ERNA 4GRLB 3DYOA 4HLZH 2HYMA 5K93A 1BJ1J 3MJGX 1RFDL 1UENA 2IQ9L 3WSQH 1A2YB 3PXHA 2O5ZL 3VGEA 7FABL 1NC4A 1U8OA 1XIWC 4HIJA 4XCCH 5IB2A 3CVHA 8FABB 3OAUH 1U8QA 3RKDC 4CVZA 4PY8J 3V5DB 5DQJA 3F58L 1AR1C 1EHNA 3QNZB 5L8LB 1C7SA 4IEFB 4NZRL 1BVKB 1C1EH 3VXQA 1GGYA 1KTRL 4HQQH 2X40A 3FB8A 4GS7C 5JXEC 4TSAH 3QWRA 4PGZA 4QWWC 3O8XB 5HJ3B 2DDQH 4FG6D 4OGYH 5HGDA 5HGGS 5IF0B 3QPQC 4FA8A 3L5XL 3WEXA 3IKKA 4BFIB 3ZKQD 1OVZA 3EYFA 3N85L 1P2CB 1TTGA 4W4OC 3OAZH 3X14B 3AB0B 3BJLA 3BZDA 4QRPE 4UT6L 3I2CH 1RV6X 4P5MB 4GKSA 3QZWB 1BQLH 2W9DL 3DVIA 1ZEAH 3O2DL 5B21A 4MXQC 1Q9WA 1MNUL 3CU7A 2NTSP 4GAFB 5IQ9A 3L3DA 2DJUA 5EUKA 5D6CB 2X4QB 4U3HA 2B0SH 4MHHG 4PJCB 2IEPA 2Y6SD 1DL7H 3QXTA 5ICXA 1A4KA 3MLZL 3PHOB 1F02I 4FQQA 2J8UA 4ZOAA 2NY5L 3WIFA 4A2LA 3BH8B 3V8OA 3E2HC 3VRLF 4K9EH 1DBJH 4OCSL 1T7VA 3VXRE 4N0CD 4WO4B 5E5RB 4Z76B 4PLKC 3I6LE 3BP5B 4XC3L 3FHAA 4PP1D 1MCEA 5TQ0L 5IESL 4NO3A 3G08A 1YUHB 2D31B 3QQ4B 1JPTL 1DANU 2J6EA 4DN3H 5EPMB 3IJSA 3FQWA 3BD5A 4YHLL 4NNXA 5MI0B 3D2UA 2Y7QA 4HFWA 1KGCE 3UROR 4FQLL 1BMGA 4Y1AE 4YDKH 2FGWH 4KK6C 5LBSH 5HXMA 3HC0B 3CZFB 3LEXB 3LKRA 4APQC 2XFXA 3NN8A 4DOHB 4X6DF 4NPYB 1D5IL 4FRWA 1UWXH 5IMLB 3JTSA 3BW9A 3UTOA 3U9PL 1JUFB 3C8DA 1RIUL 4NN5C 1BPVA 5JOEA 1XGRA 2D0HA 3LN4A 3F62A 4WTXA 3SY0A 1INDH 3BDXA 4L3CA 3MRQB 1PFCA 3IXAB 4UQ3B 4X6EB 5FOBB 5D93C 4P5KB 4IOIA 4NQCA 2HJFB 4X80H 3UAJC 3G6JA 2OQJA 1AGBB 2VXTL 5F7EH 4WEBH 3DROA 4AEIL 4XNYH 4LPYA 2XQBH 3QUZD 1FG9C 3EYVB 1K2DB 4OLUH 1I3UA 2VLKB 4N0UA 1QR1B 3NFNB 3FOMA 5GRZA 1QEWA 2ZOLA 1CT8B 2Y36H 3WKML 1RY7B 4OLVL 4XCEA 1NDMB 3QIBA 5DF0A 1IKFL 1WJ3A 3RY6C 4Z7WF 2R2EB 4OZHE 4KKCC 1UJ3A 2J4WL 3RUGA 3O11B 2VDRL 4PJ9C 5EU6D 1FP5A 2VUOA 3HG1A 3ZTJH 1JWMB 4I18C 2ZUUA 4KAQH 3FFCA 3DX6A 1WC7A 3G5YB 3UCRA 1CE6B 5DT1L 1AXSA 1YYML 4K71C 4X7TB 2P4AB 1AQDB 2V2TB 1Q9KA 5E94A 5D5MA 4F15B 4FFWD 3IDGB 3WJJA 1VPOL 3CAFA 1JNJA 3V52H 1VGEH 4MS8D 1FC2D 4X0KA 4HIHA 2FR4A 4N90D 2MMXA 2V17L 4YUEL 2X4PA 4RGOL 5HHVL 4DFIA 3DARA 3EKCA 4Z7QF 1VSCA 3WIIH 2BVPA 3QPXH 1RZFH 2P44B 1YNLL 3PP3H 1CLYH 1KN2L 2ESVA 4ZFZB 5I19H 4LGSB 5D7JD 1IL1A 5DD3L 4LASH 1DQTA 3BD4A 1MJUL 3TN0B 5AD0A 2GTWA 2GJ6E 4XNUL 1DR9A 1TQCB 3MV8A 4FQPA 1WEJL 2CKNA 3OR7A 4LSPL 1F6AB 43CAB 4OD2A 4M7KH 3BO8A 4P3CL 1VDGA 4HD9A 4XMKL 1GGUA 2CPCA 1T4KA 1NGWA 3MSPA 4JZNA 4Q0XH 5E00A 5JHDA 1QBLL 1AI1L 4ETYA 2LAAA 4M7LH 3MV7A 4Y5VC 3C6LC 4HUMB 1AJ7L 2HFTA 3CVHH 2DLEA 4XBGA 1MFEL 4EIGB 4CGTA 1XEDA 3JWDC 3IF1B 2JIXA 3F6LA 1F90L 3V5KB 3BN3B 4HMEA 5INDA 4LLAA 2AXGB 3FCTA 1OOAA 4QRQA 1FJ1A 1E27B 5BS0B 3LHPH 1A6PA 3C5ZB 5TQ2H 3MYJB 3O4LE 3MPCA 4NO2B 1UWEH 3ISWA 2QQQA 5FGSA 4F7TB 4WV1A 3UTTD 3U48A 4GRLA 3T0EE 3VXSA 2W0FB 4HWBL 1KXQE 4QRPD 5IM7A 4TOYL 4L8CA 1K4CA 1JPSL 2W92A 4H26B 1A2YA 4OD3H 1F2QA 5L2KA 1A7RH 1NUFA 1PG7H 5HHME 3I84A 1KJ2A 3W5NA 4PG2A 1FYTB 8FABA 3P11H 1LK2A 1DBAL 3STZB 2XACC 1LEGB 5I66B 1MQKL 4XTRC 3GM0A 4LLUB 3N1QC 2PW1B 3VDBA 2CGRH 32C2A 3LZFH 5JW4R 2AJYH 1IGMH 4LIQH 1RVFL 5FA4B 3GBNL 3TNNB 1M1SA 1I9JH 3O8XA 4YE4H 4IM8A 1URLA 1C5CH 3VXRD 1QRNA 2R69L 4O2FB 3WXVH 1TZHB 3BQUC 5FHBL 4OZIE 2COQA 5D1QC 5EOTB 1DUYB 3D69B 4JFFD 4P9MH 1EEYA 3U4EB 5HSFA 4TTGA 3RTQC 3RFZC 2LFGA 3QIUD 4I9WE 4KTEL 2IH3B 5DJAB 4DKEH 1HQRB 3MV9B 1KGCD 1YN6B 4Y1AD 5BXFB 3QCUL 4Y5XA 3WLWC 5HBBA 2A1WL 3VH8A 4KK5C 1NAMB 5D8JL 4R90H 3B43A 1GCFA 1HHJA 4CVWA 1BM3L 2VL4A 4OFYD 2X4QA 4Y4KA 4G7VH 4N5ED 2Q6WB 1EBAA 4LOUC 4JZJB 3Q48A 2CDGA 3OKLA 4NO0B 5D7SH 1UM5L 1S9VB 4XP9L 3P0YL 2AK1L 1HOCA 4X6BB 1S9WB 4ZXBD 4B7IA 1L7IH 2JJTA 1WBZB 4B7LA 4Z76A 3BP5A 2X4TB 5TDNA 4JN1L 2Z93B 3WXWL 3HUJB 4Q9CA 3LIZL 1OT1A 4GUPA 1ZHLB 5C0GB 5LWYL 3RAJL 5JOFA 4JG1H 1RZ7H 4KKAD 2ORBH 4HUNB 5INCB 3LEXA 1MFDL 4PJIF 3LS4L 4NPYA 5TF0A 4FQHA 5T1KD 1J18A 1JGUL 1TETL 4JEGB 3U2SB 3NCMA 5D7IB 3ZL4L 1TJGH 5AZ2H 1X4ZA 1FRGH 4ZYKB 4N0FA 3W2DH 5IEHB 2BMKA 4TN9A 2W65B 5CP3A 5C0CE 5D1QD 3MRQA 3BPLC 4Y4HA 1JYWA 3IXAA 4BQ9A 2VLMD 2HRPL 2R9HC 3DX9B 3T0EC 2JB6B 4PGEA 5LVEA 4FNLH 5GS1C 3ZDXE 3CSBA 3CXDH 1F6LL 4J1UB 1ZLVK 3SOBH 4NJ9H 4WI8A 3QAZB 2NX5D 2NLJB 2MPAH 3CDYA 1QHOA 5I16B 3EYVA 1K2DA 4JFEE 5E2WH 4UUJA 3MBEB 5C9JB 1QR1A 4PJHB 3VDAA 4V1DA 5F89B 3DGGA 4NCDA 5I15L 4L9DA 2HAZA 4JPVH 4TSCL 4XMLH 3RL1B 2EZ0D 2BC4B 4J3UA 1CE1L 1D9KB 3VA2C 1OQOA 5L9DL 3PL6B 1YDPA 2IBGA 4N1EA 2DLHA 1G6RH 3G6DL 1KUMA 2GJ6D 1JWMA 4J4PC 4O2EA 2DBJA 1DN0B 3D9AL 2FEEL 3K4ZA 4KPHH 5EUOB 4IMLA 1BFSA 3K8MA 4Y2DD 3S37X 1YEKH 3IDGA 4PUBL 4RDQG 4PREA 2H45A 1I85A 3KPMB 5TF1L 3TBWB 1IM9B 3FFDB 2I60L 4YFLI 4JQXA 4M5ZH 4YHZH 2NW2A 4P23B 3WO4C 2ZPKH 3IXTA 2GUOB 1C08B 4TPRL 4EN3B 1U2CA 3P9MB 5E4IA 4G5ZH 3DXAB 4LP4A 2WWKO 1V5JA 4DVBB 2YZ1A 3P73B 4KRPB 3RPIA 3RGVD 2PR4H 4ZFZA 3TA3D 3MLUL 4MSWB 2XN9B 1ACZA 4XPBL 3O4LD 4NM8L 5D1ZC 1A7QL 3QI9D 3TN0A 3I50H 3RVUC 4LPVA 3FAXA 3O3AB 5I75B 1E4WH 1AKJB 5DVNA 4ALAH 5ACZB 4XVTL 3HZYB 1UFUA 4S1DC 3U9UA 43CAA 4A2MA 1FHGA 1LD9A 4JY5H 3ZKXC 3L7FB 3QUYA 2R0KL 1NGPL 3B4NA 4YH6A 5DFWH 2NZIA 3CH1B 3CC5A 2BY3A 1JF1B 3PDOB 3U46B 1FNSH 1KJ2H 4GBXB 4PJDE 4R0LC 2ZUQB 4LSQH 3I6KB 3IF1A 3V5KA 5IIEB 4YLQT 3AS2A 3DSFL 2HKFH 1AHWC 5FDYA 5DJ0B 4MNQE 1HIML 2C3HA 4NO2A 3AREA 3H42H 4LSSH 3QDME 4F7TA 4UNVA 4LAQH 1NFIB 2VITB 3C6SB 3MNWB 5MHSE 5T5FL 1IZJA 4AL8H 5IT2H 1CGUA 1JGEB 2YD7A 4G6MH 3CX5K 3EFDH 5JORB 3QEUB 2BCKB 3SE9H 1CZ8L 1TTFA 1S7SB 1N5AA 4R7DB 2VISB 2X9XA 4U1HA 4I3GA 1YQ2A 1FYTA 1KULA 1G9NH 4UIMB 5AAMA 2WUCH 3STZA 1LEGA 2I25N 4H1LA 3QEGL 4WUUE 5DHVA 2GTZB 3HI6H 3HC4H 5HDQL 4O02L 3W9DA 5HYQA 2YD6A 2DQJH 1A6TB 5FA4A 1IZKA 1Q0XL 2UWEB 4P2OD 3D18A 4RZCB 2GEEA 3Q2CA 3KPSE 1MJ8L 1QFHA 3NCJH 1TZHA 3GMQB 2AXFA 2DMKA 1NLBL 1H0DB 4KVNL 3U4EA 5LGHH 3BX7C 3K2MC 3IJHB 4QHUB 3SKNA 1HWHB 4K7FA 1HQRA 3AS0A 5JIIA 4IBLT 1B6DA 4R4ND 5BXFA 4EI6B 4M9OA 2NXYC 3EUUA 1F42A 4YFDB 3KVQA 4N1CA 1NAMA 4JLRB 4Q6IA 5ILTL 3JV6A 4P57B 1QFUH 5BJTA 1A6UH 1KCRH 2Q6WA 5IUSA 2DD8L 3VFUB 2DOCA 1WITA 4JJHA 4O5LH 3QCVH 3FN0L 1VERA 3QIWB 4X6BA 1S9WA 3GSXB 5IW6B 5HHOD 3I9GL 3MXWH 5CP3H 2X4TA 1L9NA 3ZDZE 2E8ZA 4R6UA 4PJAB 3DIFB 3HUJA 1RUAH 4YBLC 5H2BB 1ZHLA 1EDQA 4U1IA 5C0NC 3K3QA 4WRLA 1OTUC 1FZMA 3P30H 4PJBB 3UJIH 1EHLH 5E1AB 2OP4H 4GRWH 1T1XB 3TV3L 25C8L 4JDTL 1EO5A 4M93C 1ZHKB 3T8XB 3TIDB 4H0GA 3UBXB 1AGCA 3U2SA 5MEOB 4PGJA 4ELMA 1IBGL 4KQ4H 5D7IA 3UYOD 3LN9A 4D0DB 3Q3GB 3HE6A 2FO4B 4YHNA 5IEHA 2H2PC 2X2YA 4M7JH 1A6ZA 4JAMA 1ZGLB 1NEZA 3W0WD 3FAWA 4UZGA 4OI8A 3SDDC 5E6IC 2OL3A 2KDGA 1R3LA 2IAMB 2VDQL 3FONB 4FQCL 5GS0D 5FK9A 5AAWA 1T1ZA 4HH8A 5I9QB 2YPLD 2NLJA 3RVXD 3O3DB 5LAXB 2VRAA 5I16A 2H26A 3VWKB 4IHOB 4BJLA 4BZ2L 3MGTB 1L0XA 3S35L 1BFVH 3BKML 4MAYC 1VFBA 3RL1A 3QT2A 2FHCA 2BC4A 3Q6GL 4LQ1A 1FL5B 1I8MB 3PL6A 1NMCB 1MFAH 3BKJH 3NA9L 4PJDF 3CU1A 3HNTL 4XPFH 1EUTA 4ZPVA 2IANA 5EDXA 5B39G 2JCCF 5K9OB 3U36B 1A5FH 1I1AB 4HGKC 1JN6B 4Q9RH 1J5OL 1DN0A 3QQNA 1HZHL 5DDHB 2R15A 4OD1H 3TT3H 5EUOA 4Y2OA 2A2QT 4U4BA 2QADD 1SJVA 1IQDB 1EPFA 1FL3B 1GGBL 4OFKA 5DLMH 5CCKL 5E8PA 2IFFH 3HMWL 4ENED 2EYSB 3KPMA 4YHOL 1DE4A 1NANH 1IM9A 3PP4H 4JM2F 5BO1H 1MHHB 4P23A 5DURD 1NFDE 2BNUA 5JMRA 4HS8L 1C08A 2VXQL 4XMPL 4EN3A 1U8KB 5I1EL 3P9MA 4OLWH 3DXAA 2WBWB 5DUBA 3U4BL 5FXCH 1ZT7B 4EZMA 1CICC 1UGNA 2FATH 3P73A 4NQDE 3SDYH 1FZOA 4XHQA 4H25B 2IALB 4MSWA 2HWZL 3D5OF 4P5TC 4LVNC 4C4KO 2CUIA 3ARDA 1B2WH 2LVCA 3BISA 5F7YC 4ZUVA 2BRRL 3MA9L 4I0PC 1RPQA 5GPRA 4JM2D 2D7PA 1T03L 3O3AA 2PXYC 1AKJA 2HT3C 3DMMA 5IV2A 1IAOA 4V3EB 3EO9L 3ZT6A 3HZYA 3C8KB 4XPGH 5DR5L 2Q87A 4LK4A 1BAFH 5JHLH 2P5WB 3MZGB 2QR0B 3CH1A 1C5BH 1EXUB 1JF1A 1TIUA 1YY9C 3D1MC 4DZBA 1KC5H 3E6FB 1CFVL 2YHGA 4S2SA 3HRPA 5HGBB 5CGMA 4L3ED 1ZA6B 3NCFB 3I6KA 1TPXB 1S8DB 4XCFH 3PIQB 5CSZB 4H1LH 3EYSH 1RZGB 4NKDB 1MEXH 2AJSL 5DHVH 4HIEA 4NT6B 2R39A 2O26U 3VJ6B 2Q1EA 5FO8B 1K4DA 2Y9RT 1U8NB 5DJ0A 5FB8B 4ODHH 1OSZA 4XXCC 4E41E 3VE0B 3NGBB 4PRNB 1GZQA 3C6SA 2UZIL 5DMIH 2VLJD 1Y6MR 2EDYA 5AG8A 3QDJB 3S5LG 2X4NB 2A9NH 5M7QA 1JGEA 3QUXC 4WTZG 4F9LC 1CYGA 5JORA 4WFGD 1YEEL 3QEUA 3SKUD 4XC1H 4GMSL 3WFDH 2EO1A 2ZCLH 4YDJB 4WCYL 2Y06L 4UIMA 3TBYB 5T3XD 5KSBE 3EJJX 5FO9B 1IEAA 4KDVA 3O2WH 3SDAC 1UEMA 3NH7L 1CD8A 3V8CA 4HLZG 3OHXA 4URTB 4YPGA 4P5TD 1A6TA 3MACL 5E4EC 3GFUA 3RVWD 4YDLC 4P2RD 1FNFA 2XTJD 5JMOC 4UAOB 2UWEA 3OKKB 4PV8B 3TGXA 1Z2KA 2HVJA 4G9FB 4RZCA 5H35B 2IADB 3MRPA 1DLFL 1S9XA 1EO8L 3H9SD 3IFLL 2DQIH 3K8LA 5IHZB 2GSGB 4NUJB 4NKQB 1H0DA 2B4CC 1MAKA 5JIHA 3QDHA 5I1KL 1OGAB 3LMJL 4G6KH 2WQRA 4JKPL 3IJHA 4RA3A 5CEZH 4QHUA 4EDXA 4D3CL 3WFHB 3RBGA 4JRYE 5I1JL 1I3GL 1NSNL 1S78D 2YN3A 4EI6A 3QRFM 4N8VB 3EYOA 4WU5A 4XAWL 3CJJA 5D2LE 5I0DA 1OB1A 3HB3D 3V2AR 3V4VH 1R5VB 3TFKA 4XPTL 5DUPL 4KY1H 5EBGA 5EU3B 3RWHA 1ZS8B 2VDPL 2Z35B 2BFVL 4JDVB 3OKDA 4BSJA 5T1DH 1CWVA 3VFUA 5D6DA 4I48B 4MVBC 4PJ8A 4QHNB 4YQXH 3RX8A 2J8HA 5AZEL 2EC8A 3IU4L 1T3FB 3GSXA 4KDTA 1WZLA 4NC1C 4BZYA 5ADOH 2BVQB 4Z9KB 3DIFA 1YQVH 2ZKHL 5KS9B 1J05B 5CWSA 1TVHB 2GY7B 1U58B 5DJDB 4MXVE 2OL3H 5TJWK 4Z7OF 2QLVB 5HYSB 3QUZB 4HXAL 5E1AA 2ICCA 5E9DA 5F96L 2H2SC 3ZKND 3I3BA 1T1XA 4QGYA 3QHTC 1U8IB 2XZCH 2AJVL 4GRMB 1NFDF 1K3IA 3OF6A 5EORH 2GT9B 4EQ2A 1FGVL 1W8OA 3CCHA 5MENB 1K9TA 1I7RB 5MEOA 4PFEA 4BKLB 4G6FD 1YEHH 3U6RB 5DHYB 4DN4L 5GZOD 3BAEH 5FM8A 3OR6B 1GGIL 2FO4A 2N7BA 2O5XH 4JO1L 4B5EA 4PRIE 1BQSA 3I6GB 1J88A 3HCVB 4IRZH 4EVNA 4DUWA 4L1HA 1CCZA 4H5SB 4RFOL 3U0TB 4AENB 1F58L 3OXSB 4RMVA 3CLFH 1FN4B 4RX4D 5E8OA 1JTOA 5IMKA 2PW2B 2DBLL 1MELA 4NUGL 1FH5L 4F9PA 5DZOA 3SE4C 2QQLL 4V3DB 1HHGA 4YZFE 5LAXA 2R8SL 1S7WB 3X3GH 5H94A 5C1MB 1MCQA 4APQB 4OCYL 1UKQA 1EJOL 1S7QA 4RIRB 4UNTA 3BGFC 1B4JH 2W9EH 1G9EA 4A6YA 1FL5A 3FTGA 1I8MA 3A6BL 1SM3H 2AABL 5IOPA 5JDSB 1U8PA 3VW3L 4I3SL 1KCGC 3K4AA 3BDYH 4NN5B 1RZKL 2C5DC 3VWJC 4EDWH 3PQYD 1X5XA 4OLZL 3U36A 4KMTL 4WI2A 3N1GC 2PO6D 4G8EB 3OG6B 4M1DH 3FQTB 5D93B 1N6QL 1UH4A 4CMHB 3V6OE 5KSAD 2I24N 1UWGL 2OXGA 1FL3A 3VFTB 3S96B 4HUXB 1LDSA 5F21B 3KJ6L 4LRIA 2VDLL 2VLRE 3SQOH 5C0DB 4YEEA 2EDEA 4EI5D 3BVNB 4R26H 1IGFL 4MJIE 3ZTJG 2R1YA 1MVUA 4S0SD 2D4DA 3P0VH 5E2JA 1EEUA 2VH5L 4KHTH 1ZT7A 4ZS7L 5I8EA 3PDGA 1F3RB 5DYOA 2XWBB 5IMMB 3MRNB 3VGHA 4H25A 2IF7A 3E8UH 5HHXL 3V5HB 1KLUB 3N1FC 5FUZL 1J86A 3E3QE 4PJ9B 2R4SH 4WDIA 4I18B 4DGIH 1BBJB 3UTQB 3NCCB 3P4NA 2OCFD 5IBLD 4K71B 5DFVC 3UTZA 5A3IC 1A7OL 3C09C 2A0LD 5EN2B 2PCPB 3MODL 4ZO9A 4HIXL 1FVEA 4LCWA 5EIQA 5T1MA 4QRPB 4HK3J 4Z95L 5H37H 1N64L 1WBYA 2YA0A 4G8IA 2P5EA 3ULUL 2A77L 2OYPA 5ITBL 1HCVA 4GOSA 3OKEB 2P5WA 3V7AE 4N8CL 3S9DB 2R0LL 1FFNB 2Z31D 2PN5A 2QR0A 2YD3A 4PTTB 5GSRA 1EXUA 3MLXH 5DD0H 1DBBL 2VL5B 5ACMA 4AT6B 5HI4C 3WDIA 4MA1C 1AFVH 1ZA6A 2JTDA 3NIDF 3IDIA 4R8WH 1S8DA 4NKDA 5I1GH 2D3VA 3VGAC 4NT6A 3C9NA 4KJWC 1HYRC 2ZOKA 3VXRB 1P84J 3U0WH 1A7PL 3M8OL 3QH3A 3C60D 3OAYK 2X4NA 4QHMB 4LNRA 4JRYD 4TNVF 4QY8A 5DO2D 3S36X 3RWJA 1P7QA 4AM0B 5FCUL 3TYGH 3BRFA 5HYEA 15C8L 3QQ3B 2ZUTA 4Q9BA 2VZSA 1IKNC 1XCTB 4Y1AB 4LLVB 2K9UA 4Y5VB 4MXVF 3C6LB 3LSOB 1QLEH 4P46C 1FDLL 4PRHE 1VENA 4PRPD 1JIBA 1AXIB 2ZSWB 2GAZB 4P99A 4QYOB 3W11C 3X11A 3MOBH 5J3HD 1D6VL 1OD7A 5IFAH 5L8JB 4G9FA 2IADA 3SGDI 4OCWH 3SGEI 4OIIL 5IHZA 1QG3A 4NUJA 3V6OC 1JBJA 3L1OL 3O9WA 5DJCB 5C6TH 1E4KC 3LVEA 3N85H 4UTAL 2AV7B 1E4XL 4YGVB 1XIWA 5CBAA 2AKRA 3BH9A 4L4VA 5F7DB 2CO6B 1D5BB 1P4LA 5GQBA 2ZNWA 4YZFF 2XZAH 2W9DH 1O7VA 1R5VA 1I9IH 5LCVL 1QBML 5FGBC 1FZJA 5T3ZE 2K7QA 1ZS8A 1FBIL 3MO1B 5JXEA 2Z4QA 4Z7UE 2B1HH 5FYKD 2CR6A 4OZHB 3WLBA 1DCLA 2NW3B 4NQXA 1KCSL 1MRDL 3E3QC 4WFFD 5AG9A 3IAQA 1T3FA 5D1QB 1JGLL 4POYA 2EE6A 2NY5H 5FYJL 5IWLC 4W4OA 1JK8A 4OCSH 5DWUL 3ZTNL 3RTQB 2VLLB 2I9TB 4XC3H 1J05A 4G80B 1TVHA 2J5LC 1U58A 3LN5B 1HH6B 5LG1A 2FEDD 1JPTH 5HYSA 3GBLA 3MLWL 4MXQA 3V6FA 1HKLL 5F7LB 4ETQB 4ZFGH 1SEQL 3GSOA 1LHZA 1CD9B 5EU7E 2EDBA 2DI9A 5J12B 2GT9A 4HV8A 5MENA 1I7RA 1NUNB 1LILA 1X5YA 4BKLA 4IJ3C 1BOGA 3OR6A 4I3RH 3BKYH 4LVOB 5HHNB 4A6YH 3U9PH 4QRUB 3L3HB 1NL0H 1RIUH 1DBML 4WY7H 3E2HA 4Z0BL 1AC6A 3NOIA 1KBGH 2GJ6B 4H5SA 3U0TA 4L1DA 2WBJD 5I1IH 3OXSA 3QEHB 4C58B 1UXSB 4NZJA 4U7SA 3ZHLA 1FL6A 5BRZE 2VLRD 4RGND 1U93B 2XKSA 1U8LA 4QNPE 3GSNB 2SEBB 4LNVA 2FCBA 4AEIH 5HI3D 4GXVH 1WK0A 4APQA 4XNQA 1Q8MA 3K8KA 4Y8AA 2A6KB 3CLEH 4O58L 1IGTB 4FQ1L 1H5BA 1RAMA 5J6GA 2NZ9C 2VZ1A 1GYAA 3ZE1F 3RGVB 5I8KL 5ID1A 1QSFA 3PABA 4L9LC 5JUEL 5HVFB 3BPLB 2J4WH 4HIIA 4XB7A 3O4LB 1G7IB 4XWOD 5AEAA 4HGWB 2VDRH 4PJ5A 4U1SA 3VXMA 1HWGB 3QI9B 1L7TH 1YJDL 3T0EB 5C08E 5GS1B 4HUXA 4OTXL 3A67L 2J7LA 3T04D 3KHQA 2OX5A 1P7HL 3QISA 5F1NB 5GGVY 4I77L 2KQMA 5C0DA 5HHMB 1AH1A 4L5FL 5DRXB 1QQDB 1PQZA 1BZQK 1QSVA 4BUGA 4UOW0 1J87A 2L7UA 1Q1JL 1P4BH 2NR6C 3V4UL 2F53D 1NANI 4W6XB 3RY6A 2Q7NA 4OUUA 2AQ2A 4GQ9H 4GKZA 5GRJH 4HUVB 1KN2H 4PJ9A 1Q94B 3VI3F 4I18A 5A1AA 4ZO8A 2I5YL 4Q2ZA 3T4YB 4BZ1H 3UTQA 4OZIB 1BLNB 4XP4H 1AP2B 3ES6B 3ILPA 2UYLA 4JKKA 3F6IA 1F97A 4XNUH 3QO0A 3ROLB 4TVPH 4WHTB 1QOKA 4NZTL 1MCSA 3PWPE 2DAVA 2F54E 2HA1A 4DCQB 2DQTH 3WO4B 4PLJC 4XMKH 4L8SC 4OFPA 3SCMC 1FFNA 4U1JB 2XRAH 2YBRB 4PRHD 4C54A 2VL5A 2Q86A 2EICA 2IQAA 3KJ4C 1KPRA 1JTPA 2FSEA 3GHEL 1JNLH 4JQVC 1QBBA 1U8JB 3DRQB 2EYRB 1NMBH 4AIZB 1AJ7H 1MFEH 1CL7L 1NUDA 1IARB 2Y1VA 2H32A 2DS4A 1BECA 2NCMA 3DYPA 5D1ZB 1KB5B 2FLRT 3O45A 2UVEA 1BQHA 2Q8BH 1W72B 3VGDA 1WZ1H 3GMNA 5JPNA 4GG6F 1CFTB 3DVFA 5GGQL 2B20A 3T1FB 4LPUA 4GW5A 2B5IB 3B6SB 1MCWW 3MMEB 4X99A 3T65A 5J1AB 4AM0A 2Y5TB 3QQ3A 2AW2A 5C07E 1S5IL 3D39E 4I1NB 4Y5VA 3C6LA 4PTUB 3AFLA 1HN1A 3RZCC 4JB9H 1KEML 5IHLB 5JXAH 3TIEB 2AK4D 5ESQB 2VQUA 3OSKA 1RZ8A 1KTKE 2XKNB 4OT1L 2YRZA 1RVFH 5J9PB 1DQJB 3GBNH 5I30L 5C0CB 3NPZB 3REVB 4ZUTA 5A16A 1B0RB 4QOKE 2APBA 1KJVA 1UG9A 1LMKA 4K94L 2YRLA 4W6YB 6FABL 3UZVB 4PGDB 3SJVD 3W9EA 3TCLA 2HLAA 4KJPD 5C0IB 4PV9A 3EBAA 2KZ1B 3FQXA 1JP5A 3VH8G 1QKZH 4R2GC 3KPQB 3EDFA 1OP5K 2EDXA 4YHPB 4PJ7F 2XA8L 4JFEB 5L8KB 4JQIL 3O6MH 4M62H 5IVXF 2IG2L 4E5XA 4QRRA 5F9JB 2IBBA 5CAYB 2MKWA 1W8NA 1OWWA 4DUVA 5IG7A 5JQ6L 4J8RA 1G84A 4QEGA 1KCLA 5K9QI 5DJ6B 2ZCHH 3KXFE 4NRXA 3QHFL 2NW3A 4HXBL 1P9MA 3W5MA 4KXZH 4WEUD 1MRFL 5JOPD 2X70B 3BQUA 1WVZA 1WZMA 1IGIL 3MJ8A 3P0YH 2AGJL 2EC9T 5BRZD 2BOCB 3GHBL 4MNHA 3B9KD 2AXJA 1Z9LA 3RTQA 4ODBD 4WWKD 2D7NA 4U0RC 3Q5TA 3WXWH 1NDGB 5F1SA 1QA9B 1X5KA 3FOLB 4M6AA 5DTFB 3T2QA 3DYMA 3LCYA 4G6JH 2R2BB 5CZVL 4LIQE 4UB0L 4L4TA 3MLSL 4M4PA 5CIPB 4LBEB 2ICWB 4PRAB 1BF8A 2JE8A 4RRPA 3U7YH 3BP6A 1JGUH 4X5WA 4ISVB 1Q9LB 2FDBP 1S7RB 4WEMB 2HP4A 3TJEL 2J8UE 2IBZY 2VDKH 2X89D 1ZLUH 5C6WH 3PWJB 4O51B 3TM6A 5EOCH 4Y16D 2R1WB 4HFUL 5T5NG 1UXSA 3CUPA 1IC4L 2Q20A 3QXDB 1CGVA 5DK2B 4YBLB 1U93A 3T77B 3S88H 5E03A 4JANA 3GSNA 5EBMA 4YR6B 3GRWA 4RWHA 5CP7B 3QO1A 5DURB 1LE5B 1MJJB 4M93B 2FJHA 5F9WB 3FQUA 4NCC1 3L7EA 2VQ1A 4QHKI 3TZVA 2A6KA 4PJDB 3HPJB 4D0BB 3LKNA 3ARBA 5GZNC 1XGYL 5I15H 4G9DB 4K3GA 1JZ5A 1VHPA 1YYLH 1CE1H 4HSQA 4MCZB 4CVXA 3OKMB 4MNQB 4KKBD 4HGWA 3QDMB 5A2KH 3DURB 1IFHL 1WAAF 4LLDB 1EO7A 4OQTA 5ALCH 5DMKB 4N1HB 4D0CB 5F7MC 4LFHD 3D9AH 5GS1A 4NQCE 3QXVA 4JM2B 4JN2B 4JGJA 2H6PB 1CU4H 5I74B 1SBBA 3G6JE 4KKLD 4XVUC 1S7VA 4DZ8A 3GB7A 1ZA3B 4PUBH 4YDVB 3L6FA 5F1NA 2CO7B 5CSBA 5TH2A 1YECL 3VU2A 4JRXA 5TF1H 5DRWB 4HUKB 2J3SA 1QQDA 4N0UE 5DXWA 4TUKL 4WUUB 4RQQA 2VO5A 2HT4D 3QJFB 5IB1A 4JO3L 1DDHA 2JJUA 2PYEA 5IGXL 1R6VA 4IDLA 4AIOA 4NQVB 1PG7W 1HILA 2YD9A 4ONGL 3KPOB 4RNRB 4H20H 3RUGE 2IPTH 1Q94A 4J4PA 1BIIB 3KPSB 3HG1E 2EDTA 4OZIA 3GBML 3FFCE 1AP2A 1A7QH 1I9RL 2H32H 5TE7H 2VABB 3F7RA 2G5RA 5D5ME 3GMMB 3MLVL 4MDJA 4UTBH 4FABL 3A6OA 5JPMA 4TTDD 1MCPL 3LRHA 3V0WL 1ZHNB 4HWUA 5C07D 3OJMB 2BSSB 2YD1A 4U1JA 5EBWB 4JM4L 2YBRA 1SEBB 3UZQA 3VRJA 4RMUA 1CICB 1R5IB 1RZIB 4MZ2A 1V7NH 2JJWA 5CJOL 4M02A 3RX5A 4P5TB 4IRJA 3VFNA 1P7KA 4QOKD 4XVSL 5D1ZA 3QNYB 4PJEA 5ETUB 4FFYL 4UILL 2UUDK 4WI7A 4O2CB 4I0PB 1CXFA 3VDCA 2PXYB 1W72A 4DVRL 3P4MB 1KCKA 3MV8E 3SDXF 5E2TL 4O4YL 1A3QA 3QG6B 4H1LG 3OPZL 1NC4D 4GKNB 1TZIA 1CG9B 3ARRA 3ET9F 5HGHB 1JL8A 4S0TD 5JHDE 4JZOA 4U6XA 1G0YR 4PJGF 2VXSL 5FUCE 1A9EA 3BIBX 3NACH 3MV7E 2WBKA 4R0LA 5CILH 4IRSC 4LHUG 4TNWF 2WUBL 4C56A 2CMRH 4WFED 3QWRD 4UT7L 5HDQH 2XKNA 1RJZB 1AHWA 5FGCE 5J9PA 4ZAKC 1SVZA 1RULL 1VFAB 2BSRA 3DSNA 4NKIH 4PGDA 4RISL 1R3HA 3VXSE 2J8UF 2XG5A 3QUXB 4H88L 3B2UD 4FQXD 5CGTA 5E5MB 2HH0H 4PJXF 5HTSA 3PJSA 4KVNH 4NQED 5L2KE 5KVDL 4YHPA 1FLRL 1QYGH 4JFEA 1J11A 3D3VA 2P8PB 3IVKB 3E6HB 3O3EA 2J88L 1CK0H 4X6FB 5GSVB 5EH1A 1SJEA 5TPWH 1DBKH 5F9DC 3U1SL 1F00I 3ZHDA 5ILTH 1M7XA 4GAGH 4KJQD 1TXKA 5E4EB 4ODUB 5DJ6A 3RNQA 2VR4A 2FYYB 4ONHB 3IDJB 1OAZH 4WI4A 2ADGB 1YNKL 3PXJA 5K9QG 5CD3A 1JZ2A 4KV5E 1QRNE 4CADB 5JR1L 3UJTH 5AYUL 5J57B 2BOCA 1HDMA 1FIGL 3WNKA 5F88A 1F3DJ 3I9GH 3EFFA 2Y5EA 1N4XH 3N06B 4NM4H 1JFMA 2XICA 3SBWC 1QA9A 3D2UD 1L6XA 3FOLA 3G6JF 1NFDB 2UV3A 5DTFA 5DD1L 4EIZC 1GVIA 2R2BA 4F58L 5HPMB 2IBZX 3GRWH 2NY0D 4LBEA 4DUXA 2F5BH 1DVFC 3BHBA 25C8H 4JDTH 1WQVT 1OTSD 4NQDB 3OJDB 1ZGLM 1X5AA 2V9TA 3S37L 2NXZD 1AY1H 1NEZG 2EIEA 2WLYA 3V6BR 3HZKA 4ZTOH 1Q9LA 1LEKA 1IBGH 1AGFB 1S5HA 2I26N 2IFGA 1FV1B 2DN7A 3D0LB 2R1WA 4X7DC 3BPOC 2BDNH 3QXDA 4ZS6D 1R0AL 3OKYA 2EDDA 4FZ8H 1XGQB 2VDQH 4FQCH 5ERWA 4YX2H 5D5MF 3M07A 1ZSDB 4YXHL 4WU7B 5CJBA 1GIGL 4ZTPL 3BE1L 4DTGL 1V7MH 3WFZA 1AO7A 4CRPA 1MJJA 5FUCC 5GGUA 4JR9H 4RFNB 4D0BA 3QIBD 4L8DB 4PY7B 4ZOCA 5IVOA 4E9LA 3DO7A 3BKMH 3Q6GH 5CHNA 3TT1H 1Z9OA 3MCG1 4FN0A 4Q74A 3HG1D 3MROA 3NA9H 1ADQA 2QTEA 2ATPB 5F70A 4MNQA 4LP5A 4MX7B 1KG0B 1XF5A 1Q9OA 4E41B 2P47B 3VRIB 1Z3GL 3DURA 4LQFL 3SDDA 1J5OH 1R3JA 1T22A 5E6IA 4MB3A 3L3OA 5HHPB 1KV3A 5E7FA 5DUML 2IPKA 1KB5L 1OGTB 4NWTH 1A6WH 4BSWB 1Z9SA 4GRWE 4IIQC 2MTPA 4YHOH 4JREB 5DRWA 2EH7H 2NY6C 3MLPA 2CKBB 5BVPL 4PG2C 5KSBB 1NEUA 1B0GA 2Z31B 4V1DE 3OXRB 4WUUA 1C12A 4HKXB 3QJFA 1L8JA 3HFMH 3BGFB 4HS8H 4MAYA 5I1EH 4WJ5B 4JVPA 2A74B 2ESVD 2C7UB 1NCAL 3JBG7 4OF5A 3U4BH 5GS2D 4GMTL 3UX9B 3CD4A 1CFQB 1Z5LB 5SWSA 2FBOJ 3VXOB 1KLGA 1U92B 2ZUSA 4RNRA 3CFCH 3TO2B 1UZ6F 4OBRA 4HC1A 3KPSA 2FX8L 1BZ7A 1CQKA 2XWTA 1BZ9A 3MV8D 3BP7B 3THMH 1R5WB 4Z8FH 5DJ8B 3C60B 1UM4L 3BPNC 1T03H 3TH3T 3HI5L 1F8TL 1U3HD 1I7TA 4JRYB 1G9NC 3EO9H 4X4MA 3D25A 5JHDD 1OARL 4XHJC 3GJFH 5DR5H 1IAIL 3MRLA 2ZUXA 3IU3B 2BSSA 5J6HA 3RWIA 5EBWA 2EEAA 5D2LB 1N3NA 1SEBA 4OFIA 1ZWIB 2DIBA 1CICA 4LLYB 4J6RH 1RZIA 4HK0B 1OP3H 1HHHA 3DHMA 2JIXD 2PTUA 4MMZC 3I85A 3CX5J 5H37G 2D7TL 3UO1H 4YEFA 3O6FA 3JWOL 3UP1A 4YXLL 1WSST 3QNYA 5SWQA 3MA7B 5C3LD 3RVVD 4DAGL 2DTSA 4LCIL 1TVDA 3GSRB 4I0PA 2DLFL 4GRLD 4K2UL 3G5XB 3VXSD 3RIFK 2JJTC 1HHKB 2V5YA 4KV5F 1FGNH 2NY3C 4HEME 1VESA 2UZIH 1H3PL 3OMZA 1DQQB 4HK3N 4O9HL 4TNVK 5L2KD 2HG5A 1S7TB 3FRUA 2KUTA 4U0QB 1OP5H 4CNIB 3HMXL 5HGHA 3LB6D 1UT9A 1IC7L 1ZLSL 4Z0XB 1T5WA 4M61B 4MA1B 5GS0L 1SBSH 2OR8A 4KK8C 3W39B 5MEQB 1ZVSB 3VXUA 1HSBA 1ZTXL 3VGAB 3NTCL 3O8XD 1RJZA 3T0WA 5BOPA 4OCRL 5DD5H 4ZDHB 1QRND 3FKUS 4PRIB 1VFAA 4XXCA 2R29H 4UINH 4Y4HC 3HR6A 1EO8H 4EUPH 3BN9D 3IFLH 4PP8C 3TC9A 1NGZA 3VFRA 4ODWA 4P4KC 1HI6B 2N56A 4CU6A 1F2XK 2O61B 4M48L 4G43B 1ONQB 3MRIA 1QUNA 3B3IA 4JKPH 5JNYB 1AD9A 4KI5E 3BEVB 2XNAA 5ICYA 1KT2A 5TFSL 5DI8B 2H9GB 2YR3A 4JFPA 3IRZA 2BXYA 3QXUA 4G3YL 3H3PH 3SDAA 1FNEB 1UB6B 1RHFA 4K7PH 2EEDA 3O2VL 4OAWB 2X5PA 3M1BB 4Y4KD 4P9HL 3NFPB 4FS0A 5J13B 3RZWA 5ESVB 4YWGL 3PUCA 3HPLA 4ODUA 2VDPH