1WBXA

Crystal structures of murine mhc class i h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Murine Mhc Class I H-2 D(B) and K(B) Molecules in Complex with Ctl Epitopes from Influenza a Virus: Implications for Tcr Repertoire Selection and Immunodominance
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wbxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1wbxA01
1DCLA 5D70L 1MPAH 2R29H 3RGVB 1YYMH 1MLBA 1C12B 1NGXB 3OL2A 3QFJA 2Z31B 5DK2A 4DVBA 4KK5C 4BSWA 5DO2D 1JGUL 1RU9L 1RMFH 3LCYA 4MNGB 4U4BA 4EUPB 3I85A 4WFED 4Y5VB 4X80L 4M7KH 4BZ1L 4GMSH 4L4VE 3QUYB 1LEGB 2CKBL 1DBBL 3MUY1 2P7TA 3MCKA 3C5JA 2BERA 3TBYB 4OCRH 3UTQB 1YEGH 5SWZA 5T3XE 4XWOD 5ANMB 1RHHA 3STZA 5FK9A 5A16B 4FQQB 5T5FL 5I1GH 1F11A 1EAJA 2Q8BH 3QO0B 4YFLI 3RVVD 4GG6E 3D69A 4X6DF 5FF6B 1BIHA 5TDOB 4DVRL 2JJTA 1N4XL 2FO4B 2FHBA 2R2CA 1CIUA 3GI9H 1Q8MA 3MODL 4P4KA 1G9EA 1MREH 3PHOA 4JPVL 4JZJA 4RZCA 3BIKB 3S35H 4GSDL 5SX5K 4YBQC 3B9EA 3N9GL 4OSUL 1LO2H 4J1UA 1N5AB 1GPOL 4MHHG 5CP3H 2HT3C 3BQUD 1PG7H 1M7IB 3LDBB 4L8DB 1A9BA 5T1MB 3IDYC 1FVCB 3VFOA 1D5IL 3QG6B 5BZDA 1CBVL 3EO0A 4TTDC 5DRWA 1B4JH 1CU4H 4JG0L 5DJDB 5TQ2H 1A6VL 4OD3H 2Q8AL 2O5ZL 4HH8A 4WI5A 2JB6A 3MRIA 5IVXE 5F8QC 4PJXF 4PLKD 1NGZB 4N1HB 1JPST 5JQ6L 5DJ6B 1IGIH 1H5BB 4XH2B 4NKIL 1BQHA 4KJPC 1U3HC 5HHQA 4P23B 2WY3A 4X6BB 4ZD3H 4PRHE 3O9WD 4ORZC 5CKAA 1JZ3A 5I30H 2AABL 4GAJH 4U1IA 3PV6A 4KQ4H 4NYLB 1U91A 1IQDB 1MFAL 4M6OL 1T21B 1IGTA 3C08L 1KIRB 5DJAB 3QQ3B 2GY7B 1EO7A 1QSED 4BSJA 2XACC 4H20H 3BKCL 5HVWA 2M2DA 4P3CH 5D5ME 1ZT7A 3ARFB 4W4OA 5EFIB 2FSEB 1BM3L 1LGVA 4HMDA 4JQIH 2ADFH 3DETC 3T77A 1L7TL 4RGOL 3ZDZF 1MHPL 3DV4B 5JHDA 2VITB 1HCFX 1MCIA 4GAGL 3SOBL 2Z31C 4Q0XL 1GH7A 2VDLL 4NHCL 4RGNE 1AE6L 4XBPB 3QUKA 4KGLA 2X44D 1FIGH 4GW5A 4AQOA 1T83C 1BBDH 2KH2B 2XIDA 3QIBA 4MJ5B 4Z7QF 4ZTOL 5C0JA 3ZYOA 4D8PB 1N7ML 4JFPA 3GDBA 5E5RB 1FVEA 1LNUB 2J4WL 3LH2H 3DROB 3PWPA 5IBLC 2ZCHH 4V2BA 1VEPA 4IIQC 2HKHH 5EU5A 5HGDA 2B4CC 2LFGA 1RQ5A 3LN9A 3QIWA 3WSQL 2P5EE 4G3YL 2Y06L 4NCDA 3BEWB 2F53E 5C0NC 4PJHB 4HUWB 1WK0A 2NY4B 4QRPD 3U2SA 1I1AB 2X4OB 4NUGH 3FQNA 3PXHA 1X4YA 3KPQA 4IRJB 4X8JA 3IU4L 5IMKA 2YD6A 5C8JB 4UT6L 1Y0LA 1WFOA 2JIXD 1RZFH 2B8OT 4Z8FL 5IB2A 3VH8A 1U93B 1IM9D 1MQKL 3FT2A 3TBWA 1TNNA 5DT1H 4ODUB 2NXYB 5DHYA 3QA3B 3EKCA 3T65B 1CXFA 5ACZA 3QDGE 5TDNA 4BFBD 4MCZA 3SKNB 4I3SH 4P46C 4JDZB 5CD3B 4K8RH 4LP5A 4FQ1H 4QRPB 1OCWL 1FLRL 4U0RB 1BEYH 2G5RA 3U4AA 4PJGF 4HX1A 4Y4FA 4NQCE 5EU3A 5TFSL 3TBSB 1QEWB 4OIIL 2I9LB 2DMBA 4IRSA 3T0WA 1G9ML 4I8DA 2GY5A 4EXPX 4LMQE 5IVXA 1RUMH 3G6AB 3T0AA 4LGRB 2XI9A 2O5YH 1G6RA 1ZA6A 5HPOA 1XIWD 1NJ9B 1A6TA 1JPFB 1VFOA 1MFCH 7FABL 5L0QC 3QNXA 3F7RA 2O93L 1IGYB 4HKZA 3TVMD 5C2UB 1YN6B 3MREB 1UWEL 1KPUB 4P99A 5C0RH 1T3FB 4GMTL 5D1QB 2Z35B 4PREB 1S5IH 4KRLB 4EOWL 1NMCB 3GGWA 3OX8A 1Z9LA 2VWEC 5C08E 2C3XA 5INCB 1DQJB 2W92A 2QKIA 4I4WB 2VISA 4JY5H 1NAMB 5DUMH 5EPMB 5FGRA 4NZJA 3R1GL 5HI5D 5HSFA 3OKLB 4NKOA 3UPCA 4G5ZL 4PJIB 4KHTL 2YMXL 5HHXH 4HGWA 4HIXL 5BS0E 1U8OB 4R0LA 4Y4FB 3VD7A 4WO4B 2YWYA 4QRQA 2WZPD 1GYAA 4LSTH 4XNMA 2X7LB 5LG1A 5ESAB 3WFBH 5F9JB 5LCVL 4PRPA 2YD5A 1T6WA 4YBHA 1FO0A 2E7HA 1DL7H 1P6AB 1H8SA 3QEHB 4P2QD 4PLNC 4HUXB 2LTQB 3VXMD 4GXVL 4OCYL 4Z78A 2A9NH 2XA8H 2A9NL 5HXMA 1QFWH 2EEAA 5GGQH 1RIHL 1QNZL 2CRIA 3LV3A 4XPBL 4ODWA 4NBZB 2VZOA 3RWJA 1EZVY 3HR5A 4R4NC 3ZTJH 1CXKA 1JZ5A 3CVHB 3DGGA 3MXVH 1SM3L 5JPMA 4MLSA 4XC1L 5FO7A 4H26B 5KVFL 2R15A 1IFHL 1PZ5B 2CLVB 3KPLB 3MJ8B 1FNEB 1RULL 1HN1A 5IOPA 5F3HB 2OI9A 5E6IA 1N26A 2PYED 4KV5F 1RUPH 1JGVH 3BPLC 4YPGB 5C7XH 2PYEE 3M8OH 5FAAA 5DK3A 5DVLA 3CIQA 4U1SA 3ZKSD 2OJZL 5HDBE 4PV9B 3QXVA 4KI1A 1D5BB 3MNVA 1B4JL 1CU4L 1NC4B 1OSPH 4PJEA 3ZTNH 4NQXB 4B0MM 1UC6A 1WSST 4KHXH 4NQCA 4F15C 1NCWH 2X4QB 2D7PA 3QUMH 5IVZA 3P0VH 2DDQH 2C1OA 1JYNA 5JXEC 3CU1A 4PJCF 1DUYB 3SKJH 5E8EB 5F7LB 4XNQA 3GSWB 4PJDF 4OTXL 2DYPA 4AENB 1QSVA 2A74A 4JHWL 4MJ2A 3EFFA 3Q5YA 4BFIA 1F6FB 1SEQL 5IT2H 2E7LA 2AABH 1KLUB 4QXGH 2XPGB 2N56A 4FFWC 5GPRA 5HDOA 4GLRI 3C8KA 1XF5B 3MV8E 3QXDB 2FJHB 1FNSL 5DWUH 3MRDB 5TF1H 4HXBH 4PRID 3LQZB 4UBDC 5KSUA 5JOFA 3E6FA 15C8L 1NBZB 1ADQH 3OAYH 1V7ML 4O2FA 4EXKA 4GG6B 2ERJC 4Q9QL 1AHWB 1V7MH 5BW7A 4HKZB 4N68A 3WKMH 4K3JH 3H7BB 3K80A 1QRNE 5DFTA 5KG9B 2IANE 2NY6C 2CRYA 1VEMA 3LHPH 3AS2A 3BZFA 2OJEB 4JFDD 4N0FB 3TF7A 3ULUL 2Q6WB 3BPCB 2K7PA 2B2XL 4KJPD 4NO0B 1HINH 3K74B 4YDIH 3U4BL 4KXZH 3Q6FB 4MNHB 2EIEA 3D3VA 4MD0A 3VXUE 2XG5A 4AIZA 4OCSH 1XCTB 3FFDA 5T1KA 5T1LD 3T4YB 4KJWC 5JLZA 2GKIA 5BV7H 2AJVH 3S6CA 4Z6AT 5MEOB 5D2NE 3W39A 4LLWB 4JFEB 1FORL 3JUZA 1HDMA 5GRYA 1FAIH 5CIPA 3B6SB 4XBPA 4N8VB 5BVJB 5DZOA 1EDQA 1TZIB 4QRUB 2AS5M 4LCWB 4D3CH 2Z92B 5INCA 1KOAA 4YHOH 1J0YA 3MRJB 4L3CA 1OGAE 1TJHH 3MRBA 4IMLB 3VG9B 1U8PA 4M5YH 1B90A 2VKWA 3V8OA 5KJRH 1ZT7B 3ARFA 5EFIA 3BPLB 4HBCL 5DUBA 1YEJH 4OBRA 4C58B 4YX2H 1CTNA 5KN5B 1KXQE 1WQVT 3TO4B 5AAWA 2N7BA 3ULVF 4LVOB 4RIRB 2Z8RA 4QRRB 4UV4H 3RKDD 3NPZB 3PDOB 4FA8A 3MV7E 3RWDB 4DZ8B 4HKXA 5D6CA 4G6AD 5LGJA 4OLUL 5GSRB 5JW4R 1S3KL 1PQZA 5F7EH 4KDVA 4D8PA 5J6HB 4M7ZB 5EA0L 1DN0B 2XOTA 2XWTA 4CVZB 1R3IL 3GSNH 2D7OA 3NIDF 3BP7A 3QDGB 3THML 2D3VA 3V0WH 3JV5A 4OZFH 4Y5XA 2NY7H 1T7XA 4H0HB 1JTTA 5B22A 3V0WL 5DSCA 4PJBA 5CD3A 5I71B 4DQOL 1WT5A 1G7JA 3F8UB 5CMAA 4WI6A 1OTSC 4MQXC 1CICD 4FFZH 2J88H 1WZLA 4B50A 1KTLA 3UJTL 3MLRH 4TVPD 3QCVL 5HGGS 2ERJB 3MQIA 1EEQA 4L4JA 3VI3F 3VXRE 2DLHA 3T4AA 5DI8B 5IESH 2VXTL 1K2DB 2OZ4H 1EEZA 1NUNB 2HT4D 2GSGA 4XBGA 1RZ7H 3QWRD 3V2AR 5CHNA 2C5DC 3TH2T 4UIMB 5E2VH 1FV1B 1Z3GL 2VB5A 1A6AA 3B83A 4JG1H 4GAGH 4PTUA 4Z5RB 1G0YR 3HUJF 2VDOL 1LQSR 3WNPA 5SV4A 3OGOE 2OL3B 2IBZY 1IAOA 1U91B 2Y23A 3NCJH 4HFWB 4ZODA 3MRKA 4M8QA 4ZTOH 4XXDA 3VGGA 4EDWL 2R0ZH 2YC1A 3L3OA 2XTJD 1CICA 3LEXB 3WIFB 4FP8L 1C1EL 4PJ9C 3RIAK 2NXZC 2ORBH 3GMRA 3TPUB 1X44A 1A1NA 4JR9H 1AJ7H 1L0YA 2WK2A 1EMTL 4OLWH 4PRPB 5CZXC 5LQBL 4NO2B 5E1AA 2FR4A 3VGEA 1ZHKA 3HMXA 4OFPA 4QRQB 1T80A 1SHMA 1ZKAA 4XPAL 5L88H 4MYWB 4QHLB 2ED9A 3PP3K 5FHBH 4MNGA 1RZ8A 4WV1A 4IDJL 3FO0H 5IEHB 3D69B 1RZKH 4YK4B 1JZ7A 3ZT6A 1I1AA 4G6KL 4G7VL 5HI4D 1LEGA 3UX9B 4I4WA 2NR6C 4PB9H 4JRXA 4U05A 3T2QA 4BQ8A 3NPSC 3IRPX 4KRPD 4Y5VA 3WBDA 4IRSD 3IJSB 5D7JD 1Z0NA 3GMOB 1YNKH 4X0KA 2W0KA 3WXWL 4HPOH 4YIQA 3ILPA 3QEGL 5KBNC 1CR9L 4N0YL 5E7FA 2RIKA 1X5AA 1KC5L 3KPPA 1JZ8A 2MOVA 3O45B 4G42B 1JWUA 3AM8A 4OF6A 4YBLB 1KJ2H 2YA0A 3JVGA 3WSQH 3T1WA 4X5WB 3SY0B 5ID0B 3BKMH 3FO2A 4YO0A 1MCHA 3VFUB 4KMLB 2VXVH 3HS0A 3CMOH 3FT2B 2UWEB 4XBEL 4GRLB 3CVIH 3LPWA 5KOVC 5IW6B 1UWXH 4PJ7A 1I1FA 3WKNA 4WIQA 5E95B 3VFVB 1NL0L 2HTLD 2R23B 1KIQB 2YEZA 5BMFL 4GXUM 1X6NA 1P9MA 5E24E 1H0DB 3GI9L 3MODH 3UO1H 3GMRB 3QSKB 3QUXD 4NC1E 1OAYH 2ICCA 2VLRD 3GSUA 4NWUH 4I3SL 1PSKL 4XAKE 4WY7H 2PTTA 4HH9A 1M71B 3GB7B 5HHMB 4WNQB 1PG7L 3A0OA 1QZ1A 1J12A 1J1OL 4EIGB 5JZ7C 1SEBA 4P2OC 1KXVC 1D5IH 1ZEAL 1MJ8L 4HC1A 5DC9B 5FYKU 1NBYA 3HMXL 1RV6X 4HIHA 5J13B 4I2XE 4HUUB 4W6WB 1GZPA 3FN0L 3L5WA 3NZ8B 4AY0A 1GGCH 5KS9B 2OTWB 5FECB 3QWRA 5FA4B 5ID1B 1ACYL 5TE4H 3TJHC 1QLFB 1ITBB 3V9FA 1I1CA 4WCYL 3CUPB 3BZFB 3EYQD 4GXVH 1DBKL 1LO0H 2QQNL 1AO7B 4BH7A 5H35A 5DS8B 3RAJL 2C1PB 1DBKH 1LO0L 2QQNH 4I48A 2DYPD 5KZCB 2H1PL 2DQFB 4KGJA 2YEZB 4PBXA 1VFUA 4F33A 4PJAF 3UJTH 2APFA 5ICYB 1T20A 2R4RL 4CAGA 3GRWA 2F5AH 5CJQH 4YE4H 4NGHH 5LGHH 1BOYA 2FJHA 3JUYA 4DCQB 1NQBA 3IS0X 4QHUB 5ESVA 3LZFH 1FNFA 1MHHB 1ZHNB 3O9WA 1FGNH 1TTFA 4C4KT 1K9TA 2E27H 1NDMA 4HV8A 2YD4A 5KW9L 4WHTB 5I1IH 1BHGA 2R9HD 2VABB 4MJIA 1G7MA 3DTXA 3HZMA 5ACMA 3GHBH 4KJWD 2KKQA 4U1KB 4IBLT 2G9HB 3JWNC 3I6KA 5DRWB 3F7VB 4N0CD 5I1EL 1L7IL 1DQML 1JP5A 2CLZB 1RJZA 3BHBA 4ZFZA 4GS7B 1MWAB 3EGSB 3WHE1 1JFQL 3ZE1F 1T66C 1WWCA 4FXKB 4KVCH 3TH3T 4JFYA 2BSTB 1T1ZA 4LSRH 3TYFA 1GL4B 3WIHL 4L8BA 1WISA 1F4XL 2Q87A 5KSAA 3OKOA 4X7TB 3HG1A 4F8TA 4Y89A 4MS8A 5IBLD 5GZND 1YECL 4U1NB 5GGUB 3K81A 4MB4A 3TN0C 3UDWA 2QQKH 4L4TB 3V6OA 5H94B 3GUTB 3MNVB 4JFQA 1TQCB 3NGBB 1EAPA 4Z7OF 3G5XA 5HDLA 5JHDE 4F2MA 5KVEH 5JHDD 2OL3L 2LQRA 1UZ8B 4NQVA 5CSZA 1X5FA 3MV11 3JV6B 1I7UA 4PJGA 5TGBA 1HHJB 1A7OH 3NACL 2WLZA 3KYOA 3QWOB 4QT5B 4D9LL 5KSBB 4K55A 4CKVX 2VLJD 5C0GB 4X8XA 5C0AD 2L7UA 5IB4A 1H3VA 2BOBA 5I1CH 3BDBA 2DBJA 2JJUA 1P7KB 4R97B 4RDQG 4ZFZB 5BVPL 4OQTL 3AS3A 1CQYA 5ITFA 2E9JA 1RZIB 1HINL 2VKXA 4JZNB 1KTDA 2L7JA 1RK0B 3QEUA 3QR2A 1MCOH 1XFPA 5ESAA 3F7PC 2D7TL 2GSGB 3BDYL 4XBGB 2AAVA 3MNWA 1WC7B 4XBEH 4XNUL 1OQOA 1J5OH 4Y16B 1MHCB 1A6WH 5CMAB 4LASH 5T5NF 3NAAL 3GMQA 2OTUA 1TJGL 1N8ZB 3L9RA 3R06A 4KK6C 3S36X 2NY2D 2JKXA 5I1LA 3WS6C 1MUJA 4PJHF 3UTSE 4QTIH 4GSDH 2FHFA 2P45B 3DO7B 4JHAL 2E7CA 2FBJL 2QL1A 2DRUA 1T03H 4KZDH 1SY6L 4OZHE 1XF2A 4PP1C 3UZEA 2BSRA 2R69L 3SGJC 3F7QA 4NQED 4MXVF 4JKMA 2V5RA 1NCBL 2GCYA 5HGAA 4OIAA 1RZGA 1NEUA 1IBGH 2IALA 1BJMA 4Q6YA 4QNPF 5I9QB 2VIRB 3Q5OA 3ZYZA 5A2FA 1TTGA 1KCSL 3RVXD 4K7FB 4XWGL 1XF3A 1P5VA 3O3AB 5GIRA 4L5FL 2XXCB 5GHWH 1NANI 5E2TH 3AUVA 2V7HB 3D9AL 3DO3A 3QZWA 2IWGA 4YEEA 3VW3L 1K8IB 4K3HA 1BWWA 5CGTA 1YMHA 2CXKA 1TLKA 4YXKH 2ZKHH 4CN4A 5D5MF 2Z0BA 4MAYC 3R8QA 2P4AB 2XA3A 1JYXA 3IFPB 4P9HL 1NFDB 3KXFA 3KYNA 4EI5B 4LPCA 4OCWH 1LK3H 2EC9U 1INEL 2ESVE 2CR3A 4HZLB 3BKCH 1ND0A 1YPZF 5J6GA 3EJYD 3LKQB 2JB5L 4YGVB 1PEWA 4R4BB 5EU6B 4UMGA 3SDXA 2EXWD 3TNNA 25C8H 3G08B 3MOAL 5I2IA 1DQLL 4RRPG 1MRDL 2W0PA 1O7SA 3O6KH 1CVSC 2XRAL 1GPOH 1T0MB 4YR6B 4ZO9A 1FYTE 2ICEA 4HKBA 3L9RB 3BHBB 1S7RA 3VGAB 4LGPB 2ZUUA 5D9SB 5HVGB 4OKVA 5DHVA 1MCQA 2IADA 1RIVH 2AK4D 2FJFB 3CFEB 1K5NA 5D7KD 3PWPB 5F9WB 2XPGA 4PJ7B 4NO0A 1Q9WB 4YHNB 4U1LB 1I7RA 1YY9D 4OCXL 2GK0A 1NBQA 1IGMH 5BO1H 4DGIL 4NKOB 4M5ZL 1BGXH 1CGYA 1LP9E 2ED7A 1QR1B 3VFPA 2UZXB 1W72A 1SJEB 3SDAD 1F58L 2YS4A 1BQSA 3QI9C 1F58H 5EU6D 3C6SA 2A83B 1FSKB 3HC3L 5C3TA 2NW2A 4P59L 2R4SL 3KLAB 2V9TA 3CSPA 3JTTB 5T3ZL 4RFNB 1AXTH 3VJ6A 2MHAA 2IPUG 4XXDB 4JZOB 4GT7A 5HDQL 2DJ4A 3WFHB 2J8HA 2SEBB 2JJSA 1LEIA 4FZEL 3OAZH 4NWTH 1QYGH 1U8HB 3RZCB 3BAEL 4XVJH 4Z7WF 2EH7L 4MDIA 3FO1A 3P4NB 5F9OL 1OTUD 4JZNA 3U79A 2JJSC 4R3SA 1QVOA 4NO2A 5E1AB 4PG2C 4M9PA 4UDUB 1RFDL 1CDJA 3QG7L 4PGZA 2EDQA 4ZXBC 1OL0A 1GGBL 3B9KA 4PLKC 1BFVH 1AGEA 5T3XL 4OCSL 3PNWB 3HC4H 1PD6A 4HWNA 3CLFL 1A6ZB 4S1RH 4ISVA 1XGUB 4JO3H 2YSSA 7FABH 2CD0A 1YPZA 1BQHB 4OCMC 4NP4H 1MLCB 5F7UA 5DLMH 4BFIB 1DANT 4X4ZA 3DI3B 3RWEA 5J3HD 3QAZB 5IP4A 5HI3D 3OAYK 5DFVC 5HYIA 3QQ9D 3T09A 2ESVA 2NMSA 5IVZB 1LO2L 2Q7YA 2CDGB 2HT3D 2X1OA 3OAUL 4ZFOL 3CH1B 4G8EA 4RWYL 2ADIA 3BEVA 3TNMB 3QDME 3OKLA 3LS4L 4G9DB 3MV9D 1G7HB 4KRPB 4AH2B 3WHE0 1HKFA 3HE6B 3OR7A 3X3GH 2V5SA 5I1AA 3FO1B 2Y4SA 4NOBA 3MLUL 5C0BD 4M02A 3AM8C 3DROA 2QJDA 1S7XB 1ZMYA 1RPQA 2WMPA 5TDOA 5CCKL 5KSAB 3EJYC 3ALWA 2AJ3A 4K71B 4MXVE 3KR3L 4R4FH 4UU9B 5C6WH 3QIBD 1HI6A 2G9HA 2QLVB 5AG9A 3IU3A 4XCNA 1I9RH 3WDIA 5AG8A 1HQRA 1A22B 3HFMH 4AIXA 1U8OA 4R0LB 4ODHL 1UWXK 4OZHB 4OD2A 3O9WC 4OD1H 3MLWH 3U7WH 1MJ7L 1FZKB 3RUGA 1K4DA 1RZJL 1FCGA 1XF1A 1FSKC 4OUUB 2GYSA 3E8UH 4FN0A 1UM4H 2HWZL 1WLHA 3SN6N 4GUPB 1IM3A 2X4PB 3KJ6L 2HA1A 3ECBB 4ZAKD 1YNTB 5IROC 3FT3B 3MOBH 3UBXI 5JLZB 2D9CA 3BZEA 1AO7A 1XR8A 3BXNB 4PJ9A 4NGHL 1BOGB 1WZKA 3IDYB 4ODSH 3R1GH 5JDJA 4F33B 1A1MA 2FJGB 1J0IA 2Y36L 3TO4A 1BWMA 4EUPG 3L5XH 3MBEA 1BZ9A 4XP9L 4I48B 4ZXBA 4HG4J 3WXVL 1KN2L 1HXMA 1S9YA 4WW2A 4HLZH 4LSUH 1QFWM 1KN2H 2R2EB 5ELIA 3ULUD 3CUPA 4GKZA 5IMMB 5DJ8A 4I9WD 1KGCE 2N7AA 3DXAE 2B1HL 3GZKA 5E4EB 2BNRA 3EOAB 3KYKH 4HCRH 1X5LA 4PP2B 3T0BA 4IHOA 4PIRF 3I6GB 5GGSA 4QXUL 1MFNA 4NSKA 1JPSL 4QRPE 2VAAA 3SDDC 3MREA 3FJTA 3EOYG 1JFQH 3LPFA 3O45A 4G42A 3IFOB 4Q2ZB 4V3EB 5FDWA 3U82B 2QQLL 1MELA 2G60H 2DQDL 4NN5C 4OLYH 5JA8B 3ZKMC 2NTFB 4I13B 4S2SA 3CFDB 1MFAH 4PRHD 3IJHB 4H0IA 5DR5H 4P5KA 4MMXC 2VLKA 5F1IA 3QZWB 3GSWA 3BISA 4Z77A 2DWDB 1XR8B 4PRDB 1JPGA 2HLFC 4EKXA 4FABH 2HLAB 4MQXD 5E8OB 3TBTA 3VXNA 5JXAH 3E6HB 5DRNB 3WL9A 4PGJA 5ERWA 3KPPB 4JN2A 5K9JH 1CS6A 4QRSB 2IAMC 1R0AH 1RULH 5HVFB 4CU6A 4AG4H 2Q7NA 1QACA 4PB9L 4X5WA 5ID0A 5IQ7H 5E08L 2ZOKA 2EO1A 4ODVL 1H5BC 5CIPH 3D25B 3DX6B 2D7QA 4KH2A 5CP7B 3GBNL 2UWEA 3NFNA 3BWAA 4TUKH 1UA6L 4LVEA 4MJ5A 3C5ZB 4KI5E 2VSCA 2NR6D 3IAGC 5INDA 5T3XH 3ROLB 1D5XB 1U42A 1KC5H 4IOIA 4G7YH 2DD8H 3DSNA 4S1RL 2G5BA 4MA1C 3V6OC 1I1AC 3MRCB 2CRMA 3CAFA 4RRPA 1F4XH 2FIKA 4RQQA 4K94L 1U41A 1SYSB 2YD2A 3VRLF 4HUVB 1KT2B 3SKJL 1I7TB 3ARFC 4LNRA 1K8DA 4NUGL 3QYCA 5FGSA 4OGXH 3CH1A 2OXHA 3W0WE 3MRBB 1A1OA 3M17B 3MRRA 4X6EB 4NFDA 1D3CA 5FM5O 5DUML 1VACB 1I4FB 4HGMA 1E4WH 4HK3J 3VXSD 3GRWH 1I8MB 2OLDA 2EC9T 2IPUK 1RZIA 3NBNA 5AYQA 2Y7QB 1DEEA 1CGSH 4XH2A 2NX5A 1HDMB 5I1DA 1SMOA 2OMNA 1B6UA 1JHLH 4P46B 4NRZA 1RUAL 5E56A 5IHUL 2H2SC 4J3SA 2CIIA 1B3JA 4ENEC 5EBMB 3AXLA 4ZOCA 3LHPL 3QEUB 2X4QA 3SE4A 4K3JL 1FG9C 3CFJB 4ZO7A 2VLJE 1BIIB 1MUJB 4I2XB 3TP4A 3HI5H 4PFEA 5CINH 4QHMB 3UJJL 1FBIL 1Y18B 1S7WA 5LGKA 1BECA 2FATL 4NFBA 5E99L 1S7UB 1YEHH 3EFDH 4Y19D 5EZIH 1VFBA 3ARGA 5E2JA 2FYYA 4QXTB 3P73A 3X13A 3E1F1 2QADC 3GGWB 3S5LG 5AWNH 3RZCA 4M00A 3MBED 4P4KC 5BW7C 3AROA 1D5ZA 1JBJA 5GGRB 1BAFL 4NUJA 1JMXA 4N5EA 3RWIA 5DD3H 2D7NA 2BMKB 1UXWB 1RURL 4UTAL 3DJ9A 3TN0D 3L3HA 1ZHBA 3IDNB 1OD7A 1NCCH 1U8KB 3BP5A 5IIEB 4JAMA 2DM2A 3GI8L 4Y5XB 2ICWB 1QP1A 3PWPD 5IESL 2AK4B 1NSNL 1A6ZA 3MFFA 4HS6B 4BM7A 5SWSB 4KK8C 4FQXC 4LHJB 4J3UA 1NCBH 5IVNA 4RMRA 4AEHL 1S9WB 3C5JB 3TBYA 2XTJB 1UZ8A 4I2XA 4K7PL 3S35X 2VDOH 2VRAA 1OP5K 2AQ1A 5ISZD 3O3BA 3P4MA 3OQ3B 5SX4I 1P53A 5BS0D 1IKNC 2LTQC 2DTSA 3DIFB 2FEEL 1I3VA 1DL7L 3S97C 3NCMA 5GRWA 4JREC 2HJKB 32C2A 5FYJH 4ODUA 2DQEL 5D7LA 5CEZD 4F3FB 2UZIH 2NPLX 3FN3A 2W1NA 3SE3A 2P43B 4P9HC 3RIFK 4X4YB 2BJML 5E6IB 5K9QG 4NNYA 2QR0A 5FUOH 1KEGL 5I75C 2MMXA 3B8YA 4HKBB 2ZNXA 4XCEA 1OAZL 3L3DA 1KB9K 1B6DA 5ERWB 3UC0H 4MGXA 4F58H 3UBXG 2F19H 1BVLA 5JIHA 3VXTB 3DVIA 3S4SG 4OT1H 4WO4D 1JWSA 1ADQA 4M48L 5F93C 5FUZL 4KI5C 5FIEA 4GW1B 4WI7A 1R5WA 1KENH 1KJMB 2DKUA 3LAFA 2X1QA 4M7JL 5I1JH 5AD0B 4KPHL 3HRZA 1SJHA 1Z3GH 2BRQA 5L2KD 3T0EB 5F7MC 5I8OH 4C57C 4PRBB 4HXAL 5J56B 1E28B 4X80H 5C86A 1HHKA 3HE7A 5TF0A 4CNIB 3CGTA 4HZAA 4LSSH 3BGMB 3QIBB 3MV01 1S9WA 2D03H 4Y16D 1RFDH 1ETZB 1HOCB 3BPNC 3FZUD 3D48R 2APXA 43CAB 3STLB 4G8IB 2X5PA 1C1EH 1KTKE 1JUFB 4YJZL 1OF2A 3VMNA 5I8EB 2HFGH 3E2HA 3H9YA 4M62H 5I1LB 3IVKA 4K2UH 4PJHA 1DANU 4M62L 1M7XA 4N0FA 2Z8VC 3NAAH 1AGDA 32C2B 1MQKH 1UZ6F 2HJKA 1KIPA 2WW8A 5E00B 5FKPB 3FAWA 1CFNA 4PJGE 2D31A 5C0AB 3VD5A 1T7ZA 1ED3A 2O5XH 2IALB 4OF7A 4BJLA 2YZ8A 4LFHD 4JFED 1M1SA 3DX7B 1EV2E 1BOGA 2NXYD 2GQHA 3DX8A 3KYMA 2WNGA 4K9EL 3FAXA 3U0TB 1N59B 4PJXA 4C56D 3PGDB 5CUSL 1O5DT 3WO3B 5E99H 2X4UA 4XWGH 3U9PL 3QQ4B 1Y6KR 4R4FL 5DMGD 4HAGA 1UM5L 4ETQA 3ZZ1A 4XB7A 5E6IC 1IL1B 1YA5A 5ICXA 4H8WC 1LE9B 1S7XA 4PS4L 2NXZD 2PYFB 4RNRA 5CBEA 1LQVA 5EC2B 2PUQT 3TNMA 5KOMC 2A0LD 1F97A 3ALPA 1VFAB 2GTWA 4Y2DC 2YA1A 3WIFA 1MJ7H 1HYSD 5HD8D 4IDLA 1J8HE 3O4LE 4I18C 1EGJA 1K6QH 1UB5A 4AM0A 4EQ3A 1FPTH 3CU7A 3HG1D 4RWYH 4H20L 1CD8A 3ARBC 3VE0B 2CO6B 4ZTPH 1BBJB 1T1XB 2V2XA 4LLUA 4MQ7A 3VMPA 1S78D 3AC0A 4JM2B 1Y6NR 5IFAL 3MRLB 3QIWC 4RMSA 3QG6A 1JGLL 3NA9H 4JRYD 4BYHA 2VZUA 2YZ1A 1EHLH 2YRZA 2W59A 5JW5A 1JK8A 3PQYD 1F02I 2YPVL 1A3LL 3QXTA 3T0VA 4U1MB 3EJZD 5SWSD 4RAHA 3HZYA 3DOSA 3SHSA 5CP7A 3QIBC 2ZUQC 1QG3A 3C60A 5BRZA 4OZFG 1QFWI 3PF2A 3HFML 4OD3L 3C5SA 4QCIA 4WGVB 2CK0H 4JFZH 4A2MA 2X9YA 2W9LA 2Y07H 3MLWL 1EPFA 4IOIB 3U7WL 1H8NA 1SYVB 4Z7OE 2P8MA 4M3KB 2BFVL 5I73B 4P23D 5E5MA 5C0EA 3HB3D 5IR1B 3QFDA 1KTRL 3JTTA 4XC1H 2HRPH 2P5WA 4JRYB 4KV5E 2P5EA 3VXOA 1RURH 2F53A 4UTAH 2UYLA 1CQKA 4L9LA 4YXHH 4JM2D 3QQ9C 1B0GA 5DXWA 1I1YA 3PWLA 5C6PB 2NX5D 2ZG1A 1MRCH 1ZWIA 3GO1L 1N6QL 3BMWA 4WENB 5H8DA 4XMLL 3HPLB 1FFPA 4WUKL 4HQQL 3IFOA 2IFFH 5BS0A 1WBXB 1FGNL 3VXPB 5AEAA 4IJ3B 4XNXH 2NLJB 4XNYH 5CGYC 1GC1L 5HHMD 3C6LA 4PRPE 1UJ3C 3MRHA 3BW9B 2R2HA 3L5WB 2J1KA 3OKDB 4UI2A 1SVCP 4WTZG 3QFJE 4X5XA 3MJGX 1UKQA 1Q0YH 4KC3B 3TBTB 3ARGC 3VFSA 1AY1L 2GJ6D 1QLFA 4MA7L 1AGCA 3K4AA 4ZFFB 4B41A 2ICWI 3G5ZA 4ZNCD 1LE5A 4HUWA 1M7IA 2IBBA 4F7PA 4I5BA 2PETA 3WL9B 4U3HA 4MCZB 3CX5K 3SE4C 1XR9B 2P8PB 3CDGB 5GGSY 1TVBA 5SWZE 1EGJL 1YJDH 1UYWH 4HX1B 1U8QA 3D85A 3NOIA 3LKPB 2MKWA 2AV7A 3CDCA 3UPRA 5FCUL 2EEBA 3KPSE 4MXQA 4YK4C 5LGJB 4CW1A 1CD0A 2PO6B 2Y72A 3I3BA 5HPMA 1S9VB 2CPCA 1P4BH 1D6VH 1S9XA 3TVMB 4NRXB 2FECI 5GSVA 3VFUA 4RIRA 3MRPA 4LCIH 1NKOA 1R6VA 3T2NH 2VDKH 3PIQB 4XAWL 4GKNA 3MJ9L 3SY0A 2AJUH 1ZA3B 4X9IA 3KNBB 2CLRA 4NDMB 1UXSB 4X4YA 3SJVD 1FVEB 2HFFB 4LDEB 1IAMA 3WXWH 2EE6A 3BUYB 3D9AH 2VXSH 3DV4A 4WU5B 2Z31A 5DK2B 3BPCA 4LCYA 3ZKNC 2AEQH 3CFBA 3A6CH 5AYUL 4RX4A 5ALCH 3CLEL 4JVWA 2ZCLH 2R2EA 3VXME 2E7LE 3PJSA 1P6FA 3A67H 4JO2L 2K3TA 4U1MA 4ZXBD 1ZGLM 4EDXA 1MJJB 4GAFB 1FG2B 5JOFB 3C87A 4LSQH 4S1QH 5HYQB 4AEFA 5B3JF 3UTTD 3I84A 1B0RA 3ARSA 3G6DL 5FHAH 2V7HA 4LPXA 1WZ1H 2QR0B 2RHEA 1CF8L 2HT2C 2EDWA 5EU5B 3QDMA 4UNTA 4GH7B 4N0UA 3RWEB 4JQIL 4G8FB 2FD6L 4YUEH 3NPSB 1WIPA 3U36B 1DBAH 3CPLA 5CZXD 4HDIA 2IAMD 2VQ1A 5T3ZD 5IB4B 4H88L 4B5EA 3IJYA 2P5WB 3LV3B 1ZHBB 1Q72L 4UV4L 2F54B 1U8LA 3MGTA 3RNKA 2IPTH 4H1LA 2DLFL 4LCWE 1E6OH 4Y0GA 1FZJB 4TN9A 2C3VA 1CD9B 1RD6A 4PJGB 1AC0A 4Y4HC 3VXUA 3L5XL 4Z76B 2FH6A 3SGKC 4XMKH 3KPNB 2EE9A 4R26L 5C0FB 1YY8A 3Q3GB 1QPXA 4G8EB 1HSBB 1JF1B 2UVEA 3ES6A 3QNYA 3HAEH 5DEGA 4L8CB 3ZO0A 4NM8H 1X5YA 2KPNA 4WW2C 4LSDA 4LPYA 4MXWH 3UYRL 1X7QA 3SQOH 5B3NA 3LEYH 4CMMB 1KPVA 2JCCE 5DEFB 1WZMA 2R0LL 1S7SA 2J88L 4KKLD 2CLVA 2V7NA 2Z8WC 4ODXB 3OX8B 2FBOJ 3QO1A 1U8NA 1AO7E 4HSQA 1ZLSL 4OLXL 3U30C 1EXUA 3H0TA 1U3ZA 3KPSA 3LKRB 3ULUF 5B8CA 1SJEA 4PRAA 1H3PH 3QUYA 4X6FB 4ORGB 2F54A 2NY5C 5EOTA 3QQ4A 5HGHB 3MV7A 3TIDA 2ZG2A 3T1FA 3TO4D 1X3DA 5F9OH 4OZ4A 5JXEA 1IAKB 4P46A 1AIFB 3NA9L 1P84K 1QVOB 3L5IA 3GM0A 1FIGL 1QA9A 1QRNA 3U46A 2EYRA 1WAAF 4UNUA 1JHKL 3ULVH 2BY2A 4UIMA 4L1HA 1TJIH 1LDPL 4NQEA 5H94A 4KKBD 3BDXA 3IDXH 5DRXA 5K59E 3REVB 1R3HB 5FDYA 4OLZL 1BQUA 2BRRL 1KJ2B 1TQBC 4Z0XA 2Q86A 4MZ2A 5IG7B 3F7YB 5A16A 3SDCB 5HHNA 5I8CA 5EC2A 2BX5A 4KROD 2NY3B 1N6UA 4J2XA 3SKMB 3MLTA 3GJFB 1DLHB 2A6DA 3P4OA 2IBGA 2DOCA 1RJLA 3WYRA 3EDJA 1YYLL 3H7BA 1T1WA 3LMJL 3GSXA 2DWEB 3OB0H 5KVEL 2CLRB 4NJ9H 1NBYB 5DJCA 4P59H 5HHXL 5DHVB 4R4BA 3MJ9H 5T1LA 5FYJD 4O4YH 4N9GA 4LRNL 3SBWA 4XNYL 4ZQKA 5EUOB 2BY1A 2P24B 3BUYA 4C56E 2WINA 5CJ8A 2OR7A 1F90L 4U6XA 4K8RL 1IRAY 3KLSA 5GJTH 1ZSDB 1PBYA 4Z7WA 3VW3H 2EH7H 1JZ6A 4PRIB 1T0MA 2AEQL 4YR6A 4WV1C 4NNXB 1OHQA 1IGJB 5C1MB 3NFSL 4ZFGL 2XQYK 2X05A 5HHOA 5IMLB 1CFNB 5KANI 1PZUB 4X4ME 3JV4A 3LB6C 1NANH 5DF0A 2C7UA 1C16A 5DS8A 4N0CC 4PJ5B 1INEH 2O5YL 3QPQD 4QRUA 3DO7A 3NGBC 4A6YH 1SM3H 1ES0B 4TRPH 2CXGA 3QBTB 1Z0MA 1BX2A 3HMWH 3WUWA 5TJWK 3T8XA 2D0HA 3FRUB 4AMKL 4ERSL 5KJRL 5ILTL 4DVRH 4PJBE 2WUCL 3GK8L 1FHGA 2O26U 1Q9OB 5IBTL 1UT9A 1CD1A 5EZOH 5JOPE 4YHYC 3V95A 4J23A 3UJIH 4YHOL 3CXHK 2C3WA 3QCVH 3PWLB 1RUPL 2V6HA 1K4DB 3S5LA 3VGBA 3PGFL 4MSWB 1PDKA 4ODSL 3X3FH 3IKKA 2EDXA 2Q6WA 1NAKL 1O7VA 3MGOA 4P2RD 1AGFA 5C0FA 1WV7T 2NNAB 4JPIA 5B4MC 1CN4A 5L2KE 4PB0H 2QV2A 2EXYC 3DUSA 4Y4HA 4PRNB 1A5FL 1LEKA 3TO2B 4EN3D 5D7KE 3BESR 1YNTA 4R26H 3BW9A 5CUSH 1EJ6A 1FYHB 1UGNA 1A7NH 2B1HH 4PP8C 3N85H 3D85B 1IGIL 2EEDA 2LABA 2Z9TA 1ZLVH 5D1ZB 3T3MF 3IDJA 1V3KA 3LQAH 4BSVA 4J3VA 4MAYB 4PJAE 1Z5LA 1CE1H 1NGPL 3R0NA 3X12B 2VC2H 3EZJB 5FA3A 4EN3A 1H0DA 4I0CC 3JV6A 1OTTD 4I5BB 4U3CA 1JK8B 4E41A 4D0DA 3O8XD 1E4KA 4B53A 4HULB 1MAMH 2VE6B 2XZAH 5DJ8B 4ZO8A 4YXLH 4M3JA 2J6EH 3KWWA 1LK3L 3JWDC 1KNOA 2F5AL 5CJQL 3VXMB 4LAJH 2DQUH 4L9LC 3IXAA 3GMPA 3BD4A 4S1DC 5D1XD 1DSFH 2AK1H 3RU8L 3X11A 4JAMB 1LP9B 3LS5H 5LBSL 1ZV5A 4ZAKB 2I24N 3O6LL 5IFJA 3M1BB 3MBXH 5C09A 5IQ9B 1HHIB 5J1AA 1MRFL 3U46B 5BZDB 2XTLA 4NUJB 5MHSE 3TEUA 4F7MA 1TXKA 1YEFL 4TTDD 4YHZL 2H26B 4LQFH 2OQJB 2NY5L 4KKCC 5DD5H 1LDPH 3LH2L 3ZDXE 1CBVH 4BSVB 1N7MH 1HHHA 4XVSH 1BLNA 4OV5A 3D3VE 4H5SA 2VZSA 2PXYC 1N59A 4PJXB 1GGYA 4MD5A 4CDHA 1U8HA 4KUCF 1RJZB 5HHOE 4XTRC 5IOPB 1JNLL 1QHPA 3EHBC 3V6ZA 1FL6A 3MV9A 3QUXA 5AZEL 4XCNB 2MCPL 3RNKB 4MDIB 4JFDA 4XX1G 3SDXF 4PJ7F 5LXGL 3MROA 2CGRH 1J7VR 3B2VH 4DCQA 2QQLH 4WUUE 1JI2A 4L9DA 1KYOK 3LD8C 5D96C 4RFNC 1NL0H 3M45A 2GI7A 1NKRA 4G8GE 1BVKB 5DMJB 3H3PL 4G8FA 2NW2B 4Z7UB 5IQ9A 4JFQB 1J1XL 3CFIC 5EC1A 5JXAL 3D0VB 4XPAH 4TVPE 3U6RB 4KTEH 5CHNB 4KFZC 3TT1H 4FZEH 3TF7C 5TDPA 1U3HA 4BK4A 2CLZA 1QSEE 4HGWB 1NGQH 4ZSOE 1FLRH 5F1KC 1UQSB 3ULUH 2H6PB 4OIIH 5EB9A 5GGRY 1ONQA 3FT4A 5CAYB 3R4DA 4EUPA 5B38B 3JV4B 3HMXH 5E1HB 3RX8A 5D7JA 4NKDA 4FXGA 5FF6A 2DTMH 2IANB 4UAOC 4YWGH 1CFQB 1TENA 1KCLA 5CJXA 5FUCC 1OP9A 3VG0L 5D93B 2ZCHL 3G6JE 4G6JL 1DE4B 2C4FT 4NFCA 3STZB 4PJHE 2VLKB 3BH9B 1J88A 2LVCA 5IF0B 3RVUD 1KIQA 4XZUA 3OXSA 4NT6A 5DJZA 3IDGB 5E6ID 1E28A 1QLEH 2WIIB 5EOCJ 3TA3C 3AU1A 3EYFB 4ZAKC 1MI5D 1P69B 4FG6C 4RDQF 4OF0A 4M5YL 2ZZUT 2EECA 3G6DH 5FYKD 2HLFD 3CFBB 4PJBF 1BPVA 1GGIL 4MDJA 2GK0B 1K4CA 1YYLH 2VLLB 5GRJL 4OLEA 3GRWL 4Y2DD 3UEZA 4EDXB 1F8TH 2P42B 3FB5B 5GRUH 1F8TL 4CVUA 1VPOH 1R5IB 4P5MB 5KSAC 4D9QD 1VPOL 3C9NA 2FJFA 1QEWA 4BKLB 4UILH 3EO9L 5J89A 4XRCA 4Z0XB 4Z7UF 4TNVF 4PYHA 5E6YA 4BH8B 4I9WE 4JKPH 2WLYA 5DD1H 4TSAL 3I6LD 1WWWX 2YK1H 4IIQB 5D72H 2OTWA 1DQMH 1L7IH 4JCMA 3GKZA 3QIUD 3WS3A 4OZGB 1CDUA 4ZD3L 3ARBA 1NGYB 3GSNL 4PG9A 2AJSL 2BVOA 2HVKB 4BELD 1V7NL 5HHOD 5KZCD 4CL7A 4MCYB 1B0GB 1OPGL 4R96A 1KN4H 1LO3H 2RB8A 3CFCH 2YN3A 2MWCA 5ESQB 2IAMA 4FFZL 4MX7A 1CFSB 2VOTA 3K4ZA 3UTSA 4YUEL 1RK1A 3BJLA 3MRHB 2WWMD 4QO1A 1V05A 3SE8H 4WFFE 3NA4A 1W8NA 5IHZA 3I2CH 3V6OE 1RZGB 4G8GA 4RFEB 5J3HC 1OSZB 3FQUB 3EHBD 1KCGC 1G1CA 1FNLA 1WGOA 4S0SD 1I1FB 3V4VH 3V4UL 5JORB 4K71C 4KKAD 2FGWH 2CKBB 5BXFA 3TNNB 5DD6A 3LRGA 3PWVA 3O3AA 5GIRB 1X7QB 3GNML 2XKNB 2B39A 4MJ4A 2VDNH 1EH9A 4PB0L 5GRZA 5ECJE 3N1PC 2NTSP 3P73B 5E2WL 5EBGA 2VERN 3FQWB 1CE6B 3JSSA 1Q0YL 4OAWA 1XH3A 4U6YA 1A6AB 4DUWA 4RBPK 5HYSB 2KL6A 4DN3H 3KYNB 4EI5A 3KPOA 4GG8A 1H8OA 1FRGL 2XT1B 5B8CB 5FO7B 5FYLL 5TGBB 5IB5B 2P7TB 3T08A 2CDEA 5CEYB 4NN5B 4W4NA 1NDGB 3MBEC 4P4KD 2Q7YB 3WIIH 1XT5A 2VR5A 5IJKC 4NHUE 1MCCA 1REIA 2FYYB 1NCDH 5C0AE 4ONHA 4RAVA 1XGPB 2V5YA 5FUOL 1NMCC 3LIZH 3QIUB 2E6PA 2DS4A 5B39G 5F7HA 2FWOB 1NEZA 3SDXE 4PJ7E 43C9A 1BZQK 2R1YA 2OI9B 1NH6A 5E94B 4V1DA 4YH6A 43CAA 2YRPA 2NY2B 1MFBL 1A4KA 4JO1L 2DIAA 4Y4FC 1FYTA 5TH2B 4UUJA 1RUQL 1R0AL 3HNTL 4J3WA 2WP3O 4QHNB 5K9KA 2NW3A 3DVGB 2IG2H 3IKCA 3M8OL 2B2XH 3Q6GH 3QUZB 5FO9A 3SDDB 2I9TB 3VFPB 2QSCH 2JE8A 3S96A 1YEDA 2VQTA 3W81A 4YWGL 4YPGA 1HCVA 1LP9A 1Z6JT 4YFEA 2EDHA 4PREA 3FB7B 4NRZB 5M7QA 2XWTB 4CVZA 1TVHB 4ONGL 2IBZX 5BV7L 2AI0H 4X6CE 3KYMB 4FNLH 5D1QC 3UYPA 4QY8B 3N50A 2APTA 3P4OB 4ELKA 4N0UB 3QNXB 5IFJB 4YDVB 5LAXB 3CCHA 5DO2C 43C9B 1B4RA 5JIIA 3EGSA 3T2PA 5EU7C 5EPMA 1MCJA 1P1ZB 5F89B 2WWKT 3F58L 3OPZL 3HC3H 1T1ZB 3TYFB 1IQWH 1Q0XH 1YC7A 3JWOH 2WUCH 3GK8H 4WO4C 5KS9E 3WLWC 3QHFH 3MCLL 3OXRA 4ELMA 3NVQA 3WUWB 3GMNA 3CVHL 4R3SB 4LSVL 4WTWA 4L4TD 2H45A 3CVHH 1CLYH 4KY1H 1EIBA 5LCVH 5J0BA 2J5LC 4IMKC 2X7LA 4OZGA 4MNHA 4PBWD 5MERA 5F3BA 2W07A 1JGEB 1MJ8H 1YDPB 1KJMA 2AK4E 3PL6C 4QTHB 4Z7UE 5B8CC 4ENED 1L9NA 2NZ9C 3WO4B 4LVNB 1U36A 4LU5H 2VXUH 4HS6A 1QFWL 5GGQL 4YHMH 5TDNB 1YMMB 2EKJA 1S78C 3TWCH 1PGRB 1T5WB 3HZVB 3I02A 4F37F 5J06A 3QO1B 4PS4H 4LKCA 4JY4B 2AXFB 2AW2A 3U2SB 4FFVC 1VA9A 3MLSH 3P2TA 3E6HA 5DRNA 5ISZB 3IDIB 4PLJC 4Z77B 4C4KO 1Y0LB 1I7ZA 2E7MA 4YDLB 4JPVH 2V9QA 1QLEL 3HKFA 2ZOKB 3ARFD 5IGXL 3UTPE 1JV5B 5IEKB 1ZHLB 1AXTL 1YJDC 1VESA 5DUPL 4FQHB 3V4VL 1Z9MA 2E27L 4LCWA 4UDTA 4R8WH 2IF7A 5E2VL 4P2QA 2WSKA 1MHHA 3L3KA 4QRRD 2A6KB 3P9LA 4LLQA 4M6NL 2EZ0C 2J3SA 5FYKL 4R2GC 4MXQD 2A9MH 2PW2A 3O6KL 1WWBX 4ZPVB 2APWA 3HPJA 4MWFB 1ZLUH 4HUMB 4JPKL 1A02N 5CCKH 3FZUC 3TZVA 3P0VL 5I1EH 4M5ZH 2GSIA 1PYWA 1HKLL 5B38A 4D94A 4DKFL 1ZSDA 1S9YB 5HY9A 1MCRA 5DMGC 4MLIA 2CK0L 5CILH 4MQTB 4Q9CA 5MENA 1J0JA 4UOW1 1GCFA 1T2JA 4GAJL 4CVXB 1A6UH 1D6EA 3UROR 4PPTA 1I8MA 4FG6D 5F3BB 4WFEE 1A7BA 5DJCB 5HYJE 2DQCH 3O6MH 2EDFA 1MF2H 4NNYB 3DRQA 3ARZA 1TCMA 3ETBF 1J18A 5E5UB 5HHPB 5DQJB 1BZ9B 4Y8AA 4UV7L 5EDXA 3C6LD 3LQZA 5KSUB 1JYWA 4U49A 4PYGA 4UV7H 1U8NB 5TPWH 1MFBH 4GQPH 4GW5B 4JJHA 4OZGF 3SGDH 1EFQA 3VWKB 1EEUA 4YNYA 1QKZH 5IM7A 3AVEA 3L7FA 1QBLH 3RY4A 4WFGE 5C07D 4WTZA 1KENL 3KS0J 1A3RH 3DGGB 2M26A 3C60C 3O4OC 3Q6GL 4WW1A 3TZVC 3B3IA 4HBQA 4PGCB 3PXJA 1L8JA 3PL6B 1KPRA 4BKLA 4Q58C 3NIFE 4PGEB 1NCTA 1FNEA 2IQ9L 2DL2A 2ADGA 4CADA 2IGFL 3MC0A 2E9WA 4ZFGH 2ID5A 2R1WA 1U3JA 4H1LG 4HUXA 1XGRB 4J4PC 4FNLL 4PV8B 1UKTA 3P9LB 5FV2A 3BP5B 5D7IE 2EDDA 4JB9H 1D5MA 1JL8A 2VL4A 1RZJC 5CS7A 3QEQE 3WUZA 5FYJU 5HHQB 1INQA 2ARJQ 2FR4B 4LHUB 3PQYE 2IC2A 5HBBA 2AJ3B 3FQTB 4K3EL 4TPRL 2ICWA 1CFVH 3L6FB 4S1DD 4YFLF 1U95B 3F5WB 4HHAA 1UM6L 5DJ2B 3V5HB 2ZUVA 3U36A 4JO4H 1EUUA 1MCDA 4HKJB 4FQ2H 1CLCA 5I66A 1JZ4A 3ZKXC 2B5IC 1RUAH 2DM7A 5EO9B 1UH3A 3FONA 1QUNA 5ESVB 3HAEA 2AXFA 3V8CA 1D6VL 5CJXC 2XFXA 4JRYE 3UZVB 4XC3H 5HTSA 1CLYL 4GRMA 3KLHC 5JDSB 2DLFH 4GBXD 5FFLA 4O58L 4YLQT 4E5XB 1A7QL 4L8BB 4KHTH 1KCUH 1HEZB 3BI9X 3K2UL 3QQNA 5C07E 1DQJA 3CXDH 5D2LB 1KCSH 1W0YT 2Z93B 4HDIB 1N64L 5J6HA 2UWEF 1WEJL 1NEZB 1S7VB 4LCCC 2YK1L 4PJ9B 5B4MD 4N0YH 1MOEA 3TWCL 1KPUA 2DD8L 3WJJC 2ZUTA 2A6KA 4RSVA 4WI9A 3BO8B 3VFGL 4ETQB 2FDBP 4PJBB 3DWTA 1KTLB 4U7KA 3V7AE 3RHWF 4TULH 4I18B 4M6AA 3QRGL 2G60L 1UB6A 2Y7QA 4LSPL 1ZHLA 3P0YL 1KIUA 5D6DC 2NX5E 5T1DL 1K6QL 2YXFA 4EVNB 3KYAA 4GRWE 5CGYD 1T0PB 3F58H 3X14B 1VGKA 2DBLH 1PAMA 1U8JA 3OKKA 3QUXC 4YGVA 2EICA 2LE9A 4RGNB 5J4MA 1WAAE 3W39B 4MAUL 2DBLL 5ADPL 5DDHB 1AR1D 3N0PB 3DMMC 3O8XC 5HGDB 3QJFA 4NZTL 5FOBA 1CFSA 1TZIA 3GHBL 1T7VA 1BJ1H 3L5JA 3CDFA 1P4IL 3EO9H 4UTBH 1QD0A 2BVQB 1NMAH 1PYWB 4HIHB 3VA2C 4UOJA 5DD1L 3IJHA 3Q6FA 3ERYA 4P2YA 3FQNB 2PCPB 5FO8B 5IKCB 3ARGD 4PJAB 3KDMB 4S1SH 5EIIB 5FECA 4M4PA 5DD5L 5CINL 1TCRB 4TUKL 3UJJH 4DAGL 5MI0C 3FFCA 2D2OA 2PTTB 3OR7B 5I1AB 2FL5B 4KK5D 1S8DB 3STLA 2I9LA 1C7SA 3SJVA 4E0RB 2VXQH 3S9DB 4NM4L 3G9VA 4OJFH 3DRTA 1KFAH 5D7IA 5LKNA 4XHQA 2QQKL 3SKNA 3QULB 2Z4QA 4FABL 3A6OA 3B5GA 1IC5L 3LKNB 4RMVA 4X6CB 1JVKA 3ZKXB 3OJDB 4Q6IB 5IBUB 4POYA 4HJJL 1U8JB 3K1KC 3AY4A 1LE5B 5EZLA 3CXHJ 5DT1L 5JXED 4NKDB 5IW3A 5HD8C 3V79C 5HDQH 1W72L 1FFPB 2WIIA 4O02H 1JRHH 2RGSA 5D1XC 2F54D 3B9KC 1KPRB 4KKAC 2W9EL 3DIFA 4X7CC 1H3PL 5J8OA 1RMFL 5J13C 2A6JB 3ZHDA 2QBWA 4LDLB 1J0HA 5JR1L 3O41B 1R3JB 3QIWD 3BQUC 5JR1H 3QHZL 1UG9A 5D7LE 1E4JA 2W91A 4X5XB 4X7FC 1ZVHA 4K7FA 3RNQA 2AJZA 3SKOB 1OT2A 2GJ6A 1GGBH 1LNUA 1D9KB 4IRSC 2NY1B 5JHDB 5DK0B 3V0VB 1PJ9A 1A21A 4H5SB 1JV5A 4NC1C 4P2OA 5M94B 4UUJB 3MRGB 3PHOB 1DJSA 4LFHG 4PJFB 4ZUSB 3RUGE 1EJOL 4JFDB 2DQCL 3R8BB 4RAUA 2YD9A 5A3IC 4ZUWA 1XEDA 4JJ5B 1S7VA 3F6IA 1BREA 2K7QA 1BBJA 1T1XA 2HG5B 2V2XB 3ARVA 3VFNB 4CMHB 5A2IH 3HB3C 1WVZA 1J9CT 2IJ0C 5EBWA 4OV5B 5F70A 2V7NB 4NZUL 4MX7B 3IF1B 1T22B 4JM2A 4O2CB 4QTIL 4KU1A 5IFHH 1BVKA 5F7WC 2F53D 3G04A 5D7IB 4P4RB 1M6OA 1HSAB 4U1LA 4Y1AD 4U1NA 1YZZA 5ABDE 2ADIB 2P8MB 3BEVB 1MPAL 3LMJH 4PJ5E 2BVOB 2LVEA 3GKWH 3ILQC 3GIVA 3NCFB 5KSBE 4D0CB 1A7OL 4JGUA 1N2RB 2UY6A 1U8KA 4PTUB 5D9SA 2A73B 3WFEH 1A3QA 3TGXA 1O0VA 3AB0B 3QUMA 4PGDA 1KELL 2L0DA 3A6BL 3MNWB 4AZ8A 3FFCE 3MYJB 4XHJD 3V5DB 4NN6B 4XVTH 5IM7B 5I1HH 1NC4D 4A6YA 4HS3B 4JM4H 3H9ZA 1HHGB 1MCWM 1FLTX 3GJFA 3I3EA 3BZDA 2BHUA 5GJSL 5I1GL 5ITFB 3DURB 3GBLA 3HA0A 1DQTA 5CEXB 2QQQA 5IWLA 1AO7D 2D31B 1N3NA 4UB0H 2HVJB 1KSRA 4F8QA 2FX8H 1OW0C 1UM4L 2OMBA 4QOKB 3WNOA 5B21A 3X17A 1LO4L 2CSPA 3IDGA 3I6KB 3DX7A 4PY8I 4PGEA 4ODBD 3BKJL 1MREL 4K94C 2HTKC 3FCTB 5C08D 4J6RL 1DBAL 3FMGH 3CH8A 5GGTL 2DQHL 1JGVL 5DURD 1KGCD 4GG6F 1QQDA 4CBPA 1CYGA 1KNOB 2WAHA 4ISVB 1IL1A 4TUJB 4YNYB 1T5XA 4LLDB 4ZS6C 5LJYH 1MEXL 1I4FA 3H9HB 3TT3H 2X70B 4OM0L 2F58H 1FNGB 1HYSC 5ISZA 4G9FE 4KKNA 2D4FA 3VXUD 1CI5A 4OKDA 3VXUB 4Z76A 2PTUA 3LVEA 5ICZB 4M8VA 5K9QI 3KVQA 2F15A 3LN5B 5BO1L 3TCXA 4JE4B 4CVWA 3Q1SH 4ZNEE 2H41A 3F12A 3LQAL 1AKJB 3V4PL 3BN3B 5DZLA 1MCNA 4NKQB 4HC1H 1F4AA 3WS6A 1A2YB 3BPOC 1PEZA 2FIRT 4KZEH 3GHEH 4I3RH 3OR6B 2FB4H 2QHRL 1CL7L 2BDNH 3NH7H 3QB7C 3BUTA 2J6EA 3UBXB 2FHCA 5GZOD 4JFHD 2AJYL 4QOKD 3RY6A 5HY9B 3B9VA 4UDTB 4PJIE 5E0QA 5LWYH 5BVJA 1FN4B 3W0WA 5IGXH 3G08A 1P7QA 2Y6SD 1U95A 3V5HA 1WBYB 4LIQL 4OI8A 3VXSE 2GJJA 4OI9A 4KTEL 4LK4A 3ARDB 4POUB 4MWFA 2H8PB 3WJLA 3MROB 3DUSB 4Y4HB 4WNQA 5J7CC 5K9JL 2M8XA 1LO5A 4XTRD 4LEXL 5KVGH 2HLAA 4WI8A 1BJ1J 4XVJL 1RI8A 4HF5H 2WANA 4YHLL 3MBXL 3BN9D 3DBXB 4G9FD 1P4IH 3AREB 4UTBL 4KDWA 4OZ4B 3AB0C 3GEWB 5ICYA 1IGCH 3QHZH 1G9MH 5C0CA 3JBG7 2E7BA 1MNUH 4QY8A 3IDMB 3GSVB 3VDBA 1KB5L 4HFUH 3QEGH 2J12B 5ETUA 4F7TB 1NGWA 2XN9D 5AZ2L 1U92B 1D7FA 4F7EB 4NHUA 4MNQA 1QRND 5F6IB 4W70A 2Y06H 1CFBA 2AI0L 1OLZA 4UT9L 1YQ2A 3RTQA 4XCEB 3R06B 3KPRE 3AFLA 4AEIL 1HYRC 1HK6A 4K9EC 2V2WA 3GSNB 4OGXL 1VGEL 1N5YH 5EUOA 2DQGH 2G75B 1P7QD 3FO2B 4X99A 5CP3A 3GMOA 2HP4A 4XNQB 3RGVC 4PGBB 4AEHH 4OM1L 3WUWG 3TIEB 5ITBL 5GGVY 4L4VB 4DWHA 4YHIA 1QFHA 3HI6L 4N9GB 4LKXB 3O2DH 3U9PH 1OTUC 2DKSA 4JN1H 3ZLQC 4NRYB 4U1GB 4RMWA 2MSPA 2OTPA 4I77L 5F7KC 1WITA 1A7QH 3QXAB 3V5DA 3PNWA 1TQBB 1ZS8A 5KSBF 1G7IB 1XGYL 2P44B 2DQEH 1MCPL 3FB5A 3HPJB 1EXUB 1FFNB 2DTML 5CSZB 4JFZL 3OG4B 4I0PD 4R7DA 4HS8L 1G6RL 1N64H 3LSOA 1OAQH 1BFVL 3HAEB 4JM4L 4R7NA 3H9HA 3I75A 3RVXC 1FGVH 1OAQL 3KPLA 1FVCA 3VFOB 2OM5A 1G9NL 4KKBC 3C2AL 3DVGA 1L6XA 3GUTA 1JGDA 2CIIB 3D2UD 4TPRH 2KZ1B 3HZYB 4PRHA 2VN7A 2E8ZA 4WGWB 4LPVA 4FFWD 1OLLA 2ITCA 1LO4H 2HWZH 2AJZB 3SKOA 25C8L 3MOAH 3OSKA 3ARDC 4PRAB 2ZOLB 3BO8A 3WNKA 3G5XB 4P23A 1PSKH 4NZUH 1MAJA 3OR6A 2GFBA 1A64A 3QXUA 3QRFM 2PW1B 5C0BE 1XGTB 5TE7H 5T33H 1JHTA 3EYSH 3ORJA 3S4SB 3LS4H 3VWJB 2X4TA 4GAYA 4R8WL 3ARWA 5FUCE 3VG9C 5FA3B 1CDHA 3LEXA 1CT8B 3RI5F 1MCSA 5H37H 5IK3A 3V6FA 3SKUD 3QWOA 4QT5A 4XP9H 4K7PH 2RR3A 5F1NA 3EO0B 3VFWB 4LLAA 5CJOL 5IJVA 3NCCB 3KHOA 4LVHB 2AJXH 4S0TD 2HYMA 4P23C 5E70A 4WHTA 4JDVA 1GAFH 2O61A 5IVXB 3RTQD 1LE9A 5EUOF 1ITCA 4Q7DA 1PY4A 5ALCL 3VFGH 4X7SH 1PX3A 4QXUH 1YY8B 2G5BB 2XN9A 1FNHA 1AC6A 12E8H 1C5CH 1P9MC 3RIAF 2WQ8A 3OXSB 2V2TA 4G6FB 1MWAH 2FLRT 1CL7I 2EZ0D 2H1PH 2W38A 1G9NC 4GRWH 4WWKC 4L9LB 1UYWL 1QNZH 5L9DL 1I9JH 2MHAB 3BT2L 1NDMB 4H25A 1TPXB 2VR4A 1OAZH 4MAYD 3KWWB 1IGYA 3GMMB 3G5YA 2VABA 4MJIB 2I5YL 3IYLW 4QYOA 4KRPC 4R7NB 1BM3H 2HG5A 2VLRB 4BSWB 1OTSD 2CDFB 4MD5B 4PJIF 5TPWL 2B4CL 3BAEH 5F7YC 4XI5D 4G6KH 1LEIB 4LEXH 1JWUB 5HHME 2HH0H 2R1XB 1ULVA 2RJMA 3QP3A 4RBPH 1KLFA 2UZYB 1AD0B 3PABA 2BK8A 5IQ7L 5K59F 5E08H 3WNLA 1AE6H 2AV7B 2LU7A 2VAAB 2L4OA 4GRMB 4LCUB 1MY5A 2QSCL 6FABL 5T5NG 4QRTA 4ZPVA 4PP2A 1DFBH 2IFGA 3T4YA 4HJGA 1K3IA 5FDWB 3RPIB 4JVPA 2DMKA 5MENE 3K8MA 4LBEA 1QA9B 2GUOA 1NBVL 5MEND 4LPTA 4DKEL 4Z7NE 3VU2A 1TMCA 1Q94B 1X5IA 3NZ8A 4HC1L 3FCTA 3BGMA 2BNQB 2RBLA 3ARTA 4OF3A 3W11D 2VLRE 2P5EB 1NMBH 3MTRA 4P3DA 4GKZB 4L3CB 1X6LA 1Q9KA 1MJUH 4HH9B 3V52L 1Q9OA 3B2VL 3LKRA 3DGCR 3NIGE 4Y2OA 3ULVD 4UT6H 4K2UL 2AXGB 1DQQB 2O61B 4PJCE 5DHYB 1VB9A 4NSKB 1Q0XL 5FKAA 3LKQA 4LCIL 3B5HA 4HWBA 5DR5L 3S34L 3IFLH 4U33A 1W0WA 1JNHB 3UO1L 4MAYA 3MRGA 2BVYA 1BFTA 4EVNA 4WFHD 4ZPTA 4O2EB 3STBA 4Y16A 3KNBA 4OZFA 1QSFA 1TFHA 2P5ED 3B9KD 5D1ZA 3PL6D 4L3AA 5C08A 1Q72H 1H3WM 4Q9QH 3P77B 1AFVL 1EERB 1YEKH 2LV4A 5DDHA 3G5VA 4MVBD 4ONFL 4J3TA 4WI2A 5DRXB 2YPKA 1FVDB 5C07B 1ZEAH 2X09A 4ZFFA 4GMSL 3TJHD 3NFSH 3VXSB 4LBEB 3LSOB 1WBXA 1JN6A 1XF2B 2PYEB 5C92A 1I1RA 4DEPC 1DVFB 1EO5A 1CGVA 4HS8H 4NQXA 1IM3B 5BRZE 3C6LB 3LEVL 4KKCD 3GMPB 2VWEE 1GZQA 5D96B 2NY6D 3EFFB 8FABB 2VO5A 4TRPL 5F1NB 4MJID 1CFTA 4TNWK 2HRPL 3L95A 1J1PH 1WF5A 4JFOB 4F7CA 2CUHA 1G7LB 2HFEB 5EORL 2X1PA 3PWUB 3EDDA 2HKFL 1GSMA 1VFMA 3SE8L 1G7PB 3E3QA 2H26A 5CGMA 3OKKB 35C8L 4IOFC 3MACL 5IV2A 3PV6B 4NYLA 3I3DA 2BZDA 1A4JA 5HHVL 2I25N 4HS3A 2ITDB 2ZP0T 5AAMA 4U2YA 4G6MH 4I0KA 4JFPB 3HS0B 3MCLH 2FZ3A 3VE0A 4G5ZH 4Y1AE 2ZSVB 2HVKA 4NZTH 4F80A 1E6JH 2XQBH 4LEOA 3HE7C 2ICWJ 3DVNA 4WFHE 4BUHA 5C2BH 4N8CL 3BYYA 4UQ3A 1CICB 1FDLH 3RTQB 1KUMA 1HSBA 3V6ZB 2EDRA 3L3IB 4KY1L 1A9BB 1A7PH 1AGEB 4DKFH 5H2BA 1ZLUK 1PKQE 5I8KL 5K9KB 5GGRA 3O3DA 5JO5B 3JXAA 5F7EL 4JEGB 3HI5L 4X98A 5JUEL 4DGVL 1XGUA 4C83B 2BOCB 3OZ9L 1WJ3A 3IDMA 4PJEE 5EOTB 5HGHA 3C09B 4XHJC 3VGHA 1YJDL 1UKSA 3MR9B 3IDJB 4QOKA 5D1QD 4LU5L 4JDTH 1U8PB 4JFFB 3O6FB 4XPBH 2OL3A 1H3GA 3MLXL 2YUXA 3P11H 4U6VL 1DBJL 1JWMB 1QFUH 3UTPD 3VI3E 5I0DA 2VLRA 5J11B 4PJEB 3BRFA 2CDGA 1MSPA 2F19L 4KTYA 5L88L 2XNAB 4OFYD 1XIWB 3TN0A 3UC0L 4GLRH 4KRMB 1N4XH 3BKJH 3KPRB 4WWID 1A9EA 2IH3B 4GKSA 2APBA 4LRIC 1PG7X 1EA9C 1MRDH 2X4SA 3MV8A 1DDHA 4NJ9L 1YMME 1CGXA 3TA3D 5IW1A 1YMMD 3PDDA 1JHKH 5GSRA 3ULVL 4LPUA 4KVNL 2EYRB 3I75B 2I60L 1HE7A 4LCWD 4RNRB 1OP3K 1G6RB 2BNRE 3OV6A 5GS3A 4D0DB 1DFBL 3JWDH 4FXGB 1DVFC 2GCYB 2SEBA 4WEBL 3F7VA 4YAQA 3FQRA 4M7KL 4HMCA 3C6LC 4LNVA 3QXAA 5DJXB 3CJJA 4I1NB 3OKNB 4XXCC 4YZFF 4E41E 2VZVA 1OAKH 1WCBA 2GJZB 1TJIL 5A2KH 1HKLH 5EBWB 1J87A 2BNUB 3S4SA 3GHEL 3IDXL 4I3RL 5DMKA 5I1DB 4KJYB 3HUJE 3P4LA 3D1MC 1MJUL 2P49B 3FFCD 2R0KH 3QIUC 1NCAL 4JZOA 4FFYH 1NAMA 2VLKE 3S88L 4N0RA 5JIPA 5DYOB 1FO0L 1SY6A 1I1AD 1MAKA 2EE3A 2IMMA 2AQ2A 4JLRB 1ORSB 2FX9H 5DTFB 4ZUTA 1DDHB 2CIKA 5FGCE 1CG9B 2K9UA 3ZKMD 4N0UE 1JJUA 2J8UE 3VH8B 2XN9B 4RGOH 1JE6A 5MEPB 4Y8DC 2VR9A 3QUZD 1MH5B 2IPTL 2MQ3A 8CGTA 4ODTL 4Y5YB 1QBLL 1KCUL 3KGRA 3SO3B 1RJCA 1ZTXL 3N1FC 2CKNA 4G9FB 1RJYA 3ZE0F 3D3VB 4MD0B 4EQ2A 1G1YA 1CR9H 1UH4A 2DMCA 3NCYS 1PKQA 1KJ2L 4JANA 4PBVC 3VCLA 3VFMA 4UINH 1CGWA 5GGSB 2VC2L 3O11B 2IGFH 2ZKHL 5FGBC 4KMTL 4MS8C 5JPNA 4LARH 4QOKE 1CDCA 4N8VA 4LSQL 4R4ND 3FQRB 5HYJD 2UY7A 2JCCA 4RCAA 1T2QH 3CC5A 2DQUL 4BZ2L 4QTHA 1NSNH 5GRXG 5L2JA 1JNJA 3DRQB 4BUGA 3RJQB 4Z7VB 4OM1H 5EZOL 4ALAH 5DRZB 3SGEI 1YEJL 3KAAA 3JTSB 4HK0A 3SOBH 4P57B 4LKCB 1NLDL 1IQDA 1T6VN 4XPFH 4OF8A 1E4XI 2PCPA 4X0KB 1E6OL 5MEQA 5T33L 3FB8B 1T7YA 5CLTA 4O51A 3WLWD 4FTVD 4PJFF 1S7QB 1UENA 4Z95L 4G43A 2X4NA 5E94A 2HAZA 2NX5B 5DURB 2G2RB 4ODHH 1A7RL 1ZLWK 4JVUA 3V4PH 4P2QB 3ES6B 3QNYB 1F6AA 4UOW0 5CFHA 3P9MA 3D18A 2B0SL 1DUZB 3CSGA 4GG6A 1BAFH 5H37G 1I7TA 5EORH 1ZOXA 5C08B 2X4RA 2X4SB 3L3GA 3ZL4L 3O6LH 4FFEX 5GS0D 1MRCL 1AQDA 5DI8A 2W0LA 2ATPB 4HQQH 5D7SL 4FQJL 4PJ8C 4WU5A 1V3LA 5T1DH 4WU7A 5GRJH 3PQYB 4WFGD 1KB9J 1JF5A 4DOHE 5HYJB 1QYGL 2AKRB 4YQXH 5ETUB 4F7TA 5D2LA 5KAQF 3VDCA 4OZFB 5EO1A 1IARB 4RISH 5JHLH 2IQ9H 2NY0C 5GZOC 4QRRE 4ZOAA 3T3PE 1OSPL 1TZHA 4LVNC 5FXCH 1NMAL 3QISA 3ZE1E 4WEBH 1V8HA 4KAQL 4LSSL 4JN2B 5E9DB 4R6UA 2Y25A 1G7PA 5DK0A 1EO8L 3D3VD 1UJ3A 3E0GA 4Y1AB 5GS1A 2MCPH 4JFXA 3UMTA 3HC4L 5EBLA 2NYYD 4WHYG 1TTUA 4XVSL 1GGTA 3OTTA 4EBQL 4G9DA 2R0KL 1J5OL 4Y2DB 5F9WC 1Q1JH 1SBSL 5HYEA 1J0ZA 3KG5A 2X4RB 2VXQL 4NJAL 1BMGA 4FQIH 5MHSD 1EBPA 5DD6B 2K1MA 5B39B 3NN8A 3PE9A 3U0PB 1KIPB 5KVFH 2B20A 1H3UA 2A83A 3IGAA 1FZMA 1FP5A 1SYVA 1TMCB 1TITA 4ZUUA 3KPNA 1AD9B 1P4LB 1XGRA 4KZDL 2YN5A 5C09D 4R2GB 5IWLC 3CX2A 4IS6A 2ADGB 1D9KD 5C6TL 2I26N 4PJFA 4ZUSA 2C26A 3T2NL 5D70H 4PR5B 3CSYB 4ACPA 3OMZA 3HZMB 3EOBA 5EN2A 1CXIA 3ULSA 3VA6A 3U0TA 2EKSA 4YGAB 5A2JH 1DEEB 4L3EE 4RQQB 1DQQA 3ZTNL 1F2XK 3VXPA 1TVBB 2NCMA 3DYMA 1R3KA 2NY4D 4Y4KD 2UUDH 2PKDA 2QKIB 1CE1L 2H3NB 5E8NA 3MRRB 2X4PA 4XVTL 5KAQG 3ARYA 5GGUA 3W9EA 3ZKQD 1KEML 3BP6B 1I8IA 2ZUXA 3ZE0E 1BF2A 2ADJB 2B7DT 1OT1A 4KK8D 2YRLA 4J12A 4DN4H 4LARL 4XRCB 1JZ2A 2F74B 2XWJA 5IUSA 4DGYL 2HVJA 3S3PA 3VWJA 4F57H 1U8MB 2PO6A 1DSFL 2AK1L 3QI9D 3PIQA 4NBXB 2GFBB 5FV1L 1FNAA 1VERA 3HRPA 3DMMD 4PJ8B 3RWCB 4ZYKB 5C0RL 3KJ6H 4PTTB 4WUUB 4TQEL 1ZVYA 2DN7A 3LKNA 3C60B 3T0ED 3RWIB 3FTGB 1XCTA 3BSZH 1SY6H 4JY5L 1J0KA 4R96B 5GGTA 1E4XL 5C09E 5L8JB 2CDFA 4E9LA 2AERT 1U93A 5C9KA 3ESVF 4JFFD 2Y36H 4TNVK 3ARGB 1U2CA 4QRSA 2VDKL 2XTJE 4HWZB 4N1CA 3WXVH 4AYFA 1BFSA 1AGFB 3WS3B 1A7NL 3RY5A 4QHUA 5I73C 3HE6C 1JYVA 4NM4H 4L5FH 1JNNH 5C0EB 3WFBL 1NCWL 1WIUA 4OZHF 3UTZA 2MPAL 3HAEG 3NCEB 2COQA 4JPWH 4LCUA 1HH6A 3CFKA 1CVRA 1FRGH 1UM5H 5AUMB 1HQRB 2CIKB 3EOBB 2LU3A 3BD5A 4TUOB 3GSXB 5T1KD 1J1PL 5BQ7A 3RX5A 5D2LF 5I1HL 4POZC 3O4LA 2AEPH 5DVMA 4H8WL 2AGJH 1FJ1A 1NCDL 4HG4K 2WV3A 3PG2A 1LK2A 2PO6C 3IVKB 3FKUS 1CGTA 3LIZL 1N6QH 2NLJA 5F3HA 4P48A 1G7IA 1DLFH 1HWHB 2DQIL 3GFUA 4YC2B 3M17A 4CRPA 2W9EH 4P9ML 1H3TA 4S0UC 2WBKA 1ZHKB 3FT3A 3BH8B 4C83A 3O8XB 4MNGE 2OP4H 4PUBH 1MJJA 1HWGB 3DI2B 4ALAL 3RUGB 5IF0A 2VQUA 4ZFOB 4PJFE 1INQB 2BHZA 5BJTB 2EO9A 3NIDE 2AXHA 5KVMC 1HNGA 4JFXB 2EDYA 3DPBA 3EYVB 1WFNA 1UVQA 4U0QB 4Z78B 5L2JB 1AXSB 1MLBB 4PD4K 4MS8D 5IJVB 3CLFH 3IXAB 3GJEA 2X89D 1KCKA 4TUOA 5TH2A 2RFXA 4XNMB 5DA4A 4DN3L 1BD2D 1MVFA 4HFWA 4LSRL 1U6AL 1W0WB 1HQ4A 1LK2B 2B0SH 4WDIB 1IAII 4ZUUB 5FGBA 4Q6IC 3UYRH 4KKLC 3MJ8A 3RWGB 1HHGA 1CFTB 5FHBL 1IC5H 4Y19B 1BQLL 1UXWA 2KQMA 4YHKL 4MQ7B 4LLYA 4MNQB 2FO4A 5L0QB 3HCVB 3MRNB 1N5AA 1TVHA 4LIQH 1HHJA 4P2QE 2PW2B 3BIKA 2PYEA 5JW3H 2IG2L 4GKOA 4F37K 4PJ5D 3EOTL 1VFBB 5DRZA 1IEAA 1GHFL 4NQDE 1OCWH 4L8DA 5T1MA 1I75A 3FQWA 4DUXA 3RQ3A 2BNUA 1AR1C 3ELAT 3P3YA 5MENB 4L8SB 3U0WH 3OGCA 1JUFA 2DKMA 1FBIH 4DOHB 2VDQL 3ZYIA 1ONQB 2VDQH 2CKBA 5BXFB 3U7YH 2JF1A 3U9UA 5JNYB 2VXUL 3CZFA 4PJDB 5ICZA 2AK4A 3AAZA 5HYJA 3LEVH 4YHNA 3H9SD 4JLRA 1DEDA 2FEDC 1I8LA 1VDGA 4KROB 5AZ2H 3U6RA 3ZKND 3QIUA 1V3MA 3VWKD 1HHIA 4QHKJ 4HCRA 4K3EH 2C3GA 1EMTH 1EJOH 3RVTD 1HH9A 1VGEH 4YC2C 3MNZA 3RI5K 2EDBA 1GIGL 1NGXA 4D3CL 1UCBL 3PWNB 5EU7E 2UV3A 2CDEB 3QDGA 5CEYA 4N8VG 4M43L 2NY0D 3VJ6B 1T2QL 3ZMRA 5BV7C 1JFMA 3QWQB 5JPNB 3SGKA 3E2HC 3L7EA 1F2QA 3IKCB 1OB1A 5GQBA 4CJ0A 3P9WB 4HW6A 3DURA 2R9HC 2EYSB 2IQAA 4NKMA 5CD5C 4G6FD 2C3VB 4JG1L 3VCLB 3VFMB 6CGTA 1NGWB 2BNRB 3QT2A 1KCVL 4KK9C 3FN0H 4XPFL 3FFDB 5T1KB 1A4KB 3BD3A 3N85L 2I27N 3WIHA 5JQ6H 3I50H 1DTUA 1N3NB 2XNAA 3NCJL 1Q9LB 1XGYH 4NN6C 5MEOA 1JHTB 1T89A 4Y16C 5I1KL 3QFJB 4YBQD 5F7NC 3QEQA 1K8IA 2IH3A 1PLGH 1ES0A 3FHAA 1FC2D 5DVNA 3VD9A 5I30L 3L1OL 3NZHL 4HPYH 4N9OB 4OKVB 5I66B 1T0NB 3DVFA 3K8LA 1AQKH 5JPMB 4O9HH 1MF2L 1OGAA 2W60B 3MV8B 3E8UL 2DQIH 3FB6A 4LOUD 1WTLA 5IEKA 4QWWC 4C55A 5D8JL 5IB2B 5BMFH 4P9MH 4GRWB 2PN5A 2FRGP 3GSNA 4PRBA 1IZJA 1NLBL 1U3HD 1A4JB 2ZUYA 3BN9C 3LPGA 4HD9A 3MLRL 4V1DE 5E2UL 2J2ZA 3GO1H 3T65A 4WDIA 3MUZ1 3PDOA 3BIBX 4OZIF 4P5TB 3L5HA 4APQA 3HNVH 5DEZA 5CSBA 1BBDL 2VDRL 4XCFL 1G7MB 1HI6B 4FQXB 1VSCA 1OY3B 3EZ8A 3MA7A 5F71A 4P2CG 4WU7B 2DJSA 3BRGC 1JTOA 3LOWA 4WRLA 3SKMA 2GAZB 4RAUB 1OB1B 2NNAA 5I8CB 2GITA 1N8ZA 2QADD 2C1OB 1RK0A 4JHWH 3VD4A 2ITCB 3PHQA 1YECH 2IEPA 3O4LD 4YXHL 3RVVC 3PWVB 3S88H 1H9VA 1FYTD 2VDPH 2BSRB 4PV9A 4U1IB 1LHZA 4M6OH 2VDPL 4NJAH 3MRCA 4YXLL 5BV7B 1XIWA 4V1DD 2IFFL 2YD3A 3CFKB 3DV6B 3RWCA 4DFHA 2OR9L 4JY4A 4M1GH 1A14L 2IPKB 4S11A 1CK0L 3ET9F 3GSQA 4JFFA 2XZQL 2OJEA 4ELME 5IMMA 5C70A 1F3DH 2BVTA 5IBUG 1C16B 5C71A 1P2CA 1MCKA 1MCBA 5TFSH 2FECL 4U1HA 2HTKD 1J05B 4PY7B 3RWFA 4JKLA 3INUH 1QKZL 3MYJA 4MCYA 3GBNH 4GAYB 2VNCA 1YEFH 2HT2D 3T0DA 2AEWA 4QXTA 3X13B 3SE9L 4O2EA 2BOBB 3MRDA 1INDH 1RK1B 1NC2D 3QUZA 1JF1A 5FO9B 5ENWA 2PO6D 3QULA 4EBQH 3RKPA 4ONGH 3QEQD 1EGJH 4NQSB 1IILE 3S5LB 4MD4A 4ERSH 3MV7D 1RIUH 1DR9A 1C7TA 4XP1L 1KEMH 1JNLH 3UP1A 3WEXB 4Y4HD 1CZ8H 4G8GD 1QO3B 2GAZA 3ARDD 3MO1B 2W0FA 1TDQA 5GXBB 1N0XL 3BP6A 5LGHL 1BQHG 3TPUA 2DI9A 4JJ5A 2OL3H 2HFFA 2EIZA 4XP4L 1NAKH 5I76B 2F74A 2XWJB 3QH3B 1RHFA 1T89C 1JPGB 4YX2L 3MFGB 3W2DH 2OK0H 4ONOA 3MLUH 1KB5A 4NPYB 3O2VL 3ILPB 3H42L 5D7LB 1ZVSB 2VH5H 3MX0A 4JKWA 1OGTB 3AMLA 3H42H 1HZHH 1PW3A 2GJ6E 1AP2B 1DE4A 3PABB 1AKJD 5BVPH 4FTVE 1M4KA 4HIJA 2XA8L 3VWKA 4JRXB 5I6XC 2IADB 2VIRA 3QDJE 2XZCL 5KTEL 1MWAL 5I74B 4J3XA 1ZT1B 3EBAA 4O5LL 3CDYA 1BZ7A 1B9ZA 2ZSVA 1U3YA 3ARPA 2Z35A 1OGAB 3BH9A 1IGFL 5CEZH 1EVTC 4JPWL 1E4KC 1F4YH 3LD8B 4ZOEA 1OPGH 2VISB 5TE6H 2PR4H 3MOQA 1KIRA 4QGYA 3IXTA 2X4TB 1WBZB 1JPFA 2W65A 1R24A 5E8DH 3E3QC 5ILTH 1TETL 2FWOA 5IBTH 4LCCA 4MDJB 4N5EC 2QSTA 4GMTH 5I15L 3P0GB 3T0EE 2AXGA 4WI3A 5B39A 2ZOLA 5F9JA 2UUDK 4PJ5A 3GMLB 4JHAH 2VXTH 3DSFH 4O02L 2DLTA 3VGDA 4J8RB 1ZVSA 3HNVL 1DP0A 5I1JL 3CZFB 3DX9A 4PLOB 4YQXL 4LQFL 4YZFE 4HLJA 4DAGH 4JFFE 4PRIA 2VDNL 2A9ML 2GIYA 2EDOA 2A38A 3Q2CA 4K7PY 3V6FB 4AIZB 3UYOD 5EO9A 1II4E 1FV1A 1Y18A 2NY4C 2FEEI 4UT7L 4FQCL 5C2BL 4JZJC 3N1GC 3WNMA 3ARQA 3G5VB 1ZGLA 1F3RB 4LLWA 1WUNT 3EOAA 1RAMA 3TBWB 2F8VA 3VGFA 2OYPA 3ZHLA 4U1HB 2MTPA 2AEPL 3BP4A 1C5CL 1MI5B 5JIKA 5ACZB 3H0TB 5GGVL 2J8UF 4W6XB 4EI5D 3L1OH 4L1DA 4L29B 3B9DA 1UACL 1MAML 4NBYB 5TDPB 4I0PC 2XKUA 4JRXD 3RHWK 2NXZB 3AMKA 4F2MB 3VXRA 1YNLL 1KN4L 1LO3L 4IOFD 3CK0L 4U6TA 3OHXB 3QI9A 1AR2A 5HI3C 2KUTA 5BRZB 3MXVL 2VDML 3PWUA 4OIBA 4P3CL 4PGBA 3CD4A 1B2WH 4R90L 4AT6B 5F8RC 4NWTL 2XWBB 1ADQL 4X6DA 5IFHL 1NPUA 1HQ4B 4DW2H 2E5EA 3PGDA 4TSCL 3RVWD 4M48H 5FUZH 4KK9D 4HUVA 1KYOJ 4LKXA 5I16A 1NFIB 1A0QH 5K33A 4MJIE 3UAJD 1MRFH 2OCFD 1A0QL 4LVHC 4JRYA 2VDLH 5CWSB 5D6CB 1MCEA 1DUYA 1JRHL 1IGCL 1CGUA 1CE6A 1NUFA 3LB6D 3EOTH 4R7DB 4KPH