1XH3A

Conformational restraints and flexibility of 14-meric peptides in complex with hla-b*3501
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational restraints and flexibility of 14-meric peptides in complex with HLA-B*3501.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xh3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1xh3A01
2VDLL 4Q58C 3C09B 4CL7A 4XNXL 5GS0L 5LGHH 4DK6A 1PY9A 5DMKB 1N4XL 4YPGA 2QQNH 4G6FD 4QXTA 1MVFA 4JQVA 1F4YL 1QFWM 3WUZA 1AHWB 3SCMC 2RGSA 4KJPD 2Q8BH 1HH9B 2K7PA 2VB5A 4PJBB 2GQHA 4JDZB 1Q9LB 2R69H 5DI8A 1Q0YH 3DI3B 4GMSL 3C60A 3VXTA 3ULUE 5D72L 3LS4L 4O51A 4ZG1A 4P3DB 5MEOB 4QXWA 3MV8E 4HBQA 3HI6H 3QUXC 1XGTA 5H94B 5MP6H 2EEBA 3DVFA 3MUJA 3VCLB 1TIUA 4J2XA 2Y1VA 3EO0A 2HJKA 3IS1X 4J7RA 5EOQH 4MJ6B 3ISWA 2FJHA 1BZ7A 2HP4A 3TYGH 2KH2B 1IM9D 4YHLH 4OUUB 2DYPB 4Y4HC 2FYYA 4EI6B 3QR2A 1LMKA 3M1BA 4BH8A 4K3GA 3UTQB 4F57H 3BEWB 3U48A 3P30L 4X99A 4GG6B 4HH8A 4XP4L 5C6WH 1LEKA 4KDTC 1DSFL 3M45A 3LDBC 1NGPH 1BEYH 5F9WC 4OF5A 1L0YA 2J88L 4JM2F 4FZ8H 3DSFH 5IT2L 3DX7A 3X3GH 4CNIB 2PCPB 3X3FH 4NQSA 1WUNT 4F15B 4YDLC 1V8HA 4X5XB 3MRRB 2H1PL 3FMGL 3H9SE 3NA9L 4Z7UB 1LGVA 1XF4A 5C07A 1A4KB 1TVBB 5HHMD 1UG9A 2AJVH 1GH7A 4XWOD 2H9GB 3MJ8B 5I71C 1A7QH 2APXA 4YDJB 3EGSA 4F9PA 5EB9A 2MQ0A 5E00B 3FONA 4Y1AD 4MS8C 1HEZB 2RFXB 3E6HA 5EWIL 5TF0A 3D6GA 2XZCH 4M7ZC 4NZJA 4CMMA 5HXMA 1IAKA 4GMSH 2Z9TA 3MNVB 1E28B 1HKLL 2JB5H 3JWOC 3U1SH 3WIHL 1CICC 2WWKT 2GITB 3O6KL 2ATKA 5AD0A 1CBVH 1NC2A 1QPPA 4FZEL 2C5DC 5TH2B 1J11A 2QR0B 4JFFD 5E08L 4PJCB 3HG1D 2DMBA 4NFCA 2JELH 3IETB 3O3AA 2OP4L 4QHUB 5IV2A 5EU4B 1FAIH 1OSZB 4PRDB 2NY1C 4WI2A 4X7TA 4YDIL 4YGVA 5KTEH 1KTLA 2IG2H 4LCWB 4KDVA 3JUZA 3LRGA 1FFOB 3W11C 3VDCA 1SY6L 4JJHA 1H15A 4LHUD 4QRSA 5DR5H 1PSKH 5DUMH 5DUML 2F54A 4YFLI 4YJZL 1TQBB 1SJEB 3TIEB 4WEBH 4ZNEA 4JB9H 4JHZA 3MLSL 4L4TB 3N50A 1N64H 4TULL 5DXWA 1MWAA 3NFPB 4L1HA 5DD1H 2I24N 3R1GH 4NQVB 2IG2L 1AO7D 2XZAL 3MXWL 4QHUA 4J6RL 5IV2B 2AJ3A 4XMKH 4ODWB 3Q5TA 4M7KH 1TQCC 2NXZD 4NKMB 5AEAA 4OZGF 4G9FE 3BKCH 1NANH 4LNVA 1JMXA 2C3VB 3DVNA 4X4MA 1F45A 2ESVD 4KZEL 1H0DA 3HE6A 3Q3GB 4ODVL 5GRYA 2MKWA 1RZKH 3IFNH 1U92B 1Z0MA 3F62A 3B9DA 4YAQB 1K5NA 3RWJA 5DLML 4G9DA 4MD5B 1YECL 5FGSA 5EG6C 3UROR 2XIDA 3BMWA 1XGUA 2A77L 1JNNH 3LEYL 4CU6A 4NHUB 3TZVA 5IWLA 2EH8L 3KDMA 3SCMB 5K33A 4ALAL 4I18B 1EHLL 4QHMB 1CD1B 4NUGL 1EJOH 4KK5D 1SVZA 4FQCH 5DJ6B 4UIMB 2UV3A 2VLLA 4MNQA 5E8OB 4UILL 2ZCLH 4WENB 4O02H 4M43H 4MJ6A 4K71C 3VFWB 5CGYD 3PWNA 4ZAKC 5IB4B 2NZ9C 1NBZA 2A73A 4K7FA 4AL8H 3VFVA 1KJ2H 4MDIA 4OLUH 1HSBA 4J8RA 5ESQA 2X70A 3TPUE 3D39A 1GGTA 5HYJE 1YMME 4LGPB 5I1HH 4P2QB 4CDGC 4AEIL 5T33L 1L7TH 4JRXA 1I7ZB 6FABL 4G43B 5TPWL 2CH8A 1S5IL 4K23L 2LV4A 4M7LT 3IDIB 5CIPH 2JIXD 4MS8D 2X4TA 3PV7A 3QQ9D 3IDMB 1Q1JH 3EOBA 3QUYC 2HT2D 4K7PY 5CGYC 1QVOB 1HEZA 4Z7NF 4QY8A 4HX1B 1R5VA 2ICWA 1C5DB 1Q94A 1HHJB 2EO9A 4L5FL 5HI4D 1FNGA 3WNMA 1WZ1H 4K2UH 3QCUH 3SGJA 1BBJA 5CKGA 4YZFF 5ISZA 3TN0A 4NGHL 5IF0A 4J1UB 1DCLA 1WQVT 3PGFH 6FABH 5HYSG 1U58B 4EN3B 1NCWH 5FO9A 3FTGB 2P8MA 3BZFB 3RGVB 1ZTXH 1EERB 4M93B 2FBJL 3LY6A 1D6VH 4XI5C 5HY9B 3ULVH 3BRGC 5D7JB 2HVJA 1E27B 1IBGH 1QNZL 4LPTA 5C0AE 4FQLL 4HLZH 5BV7H 2A38A 3DMMA 4PJHF 1V3MA 5ICZB 1RZ8A 3IFOB 3Q6FA 4I2XA 4IJ3C 1F11B 1YJDL 1YN6A 3TNNA 4OZIA 2DQUL 3VFNA 1T5XA 4NNXB 4UIKH 1FL5B 5I15L 1A0QL 4PRHB 2IANE 1EHLH 4EN3A 2LAGB 3AROA 1ONQB 5EH1A 1Q9OA 3AXLB 5FUZH 4JY6A 5T3ZL 5EZJB 1CFVL 1S5HB 3I6LE 2NW3A 3LEYH 4GAYA 3SEPA 1BREA 1IAMA 4ELME 3O6ML 4APQC 1AGCA 4KTEH 3K8LA 1ZT1B 1TENA 4LCIH 3QDMB 3LKQB 5MERB 2Y23A 4XVJH 4Q97A 1OAUH 1G7MB 1AGBB 1S7VB 5EUOB 5I75B 4NKMA 3SGJC 4RAHA 5IVXF 5B38G 5HTSA 1MJUL 3DVNB 4PJ9B 1VFBA 2BY1A 5TQ2H 4KMQA 3QDJA 4PGBB 3V6BR 4QRTA 5DMKA 4X9FA 3V95A 1JRHI 1T5WB 1WITA 4F7EA 2G5RA 4XC1H 3KPMA 1WCBA 2MOVA 5E95B 2NTFB 1JIBA 2ZJSH 2VXSH 4PJ9C 5C0IB 3AUVA 12E8H 3R06B 1N64L 4HWBL 1PDKA 1JL8A 5DJ2A 4EDWH 2UYLB 1NGWA 3ZYZA 4ELMA 4PG2C 1T21B 3RY6A 2RCSL 5I8CB 4GRLC 4PJHA 5EORL 3MOQA 4FG6C 3H9HB 3TFKD 1F4AA 5DUBB 3BPCB 3EYQC 2H32A 3KR3L 4J3UA 4XPHH 5E5UB 5FM4A 3V0VA 2DQGH 4GRWF 4DN3L 2MNUA 3V8OA 4ZPVA 5D1ZA 4P4KA 2YUVA 1RZGA 2LTQB 4HBCH 3VXMB 5E2WH 4LSRH 4HUWB 1AR2A 4X6FB 3ILPB 3C2SA 4RA3A 3VI4E 4N5EA 4ELKB 3STLA 2FL5B 3G9VA 1DVFB 3FHQA 3QUYB 3NCBB 5E9DB 4PUBH 1I9RL 4ZODA 4IRJB 4YBLC 2VAJA 2J8UF 5DD3H 3WFEL 5DHVB 1PG7W 4RFEA 1P7QA 5I18H 4ELMB 4OZ4B 4JFHD 3QDGA 1AXSB 1CK0L 3BP5B 3T0DA 4NBXB 2FX9H 4JO2L 1KJVB 1OSPL 5GGUA 4NRZB 3RWHB 2R4RL 3FB5A 4W6WB 2HN7B 3BD3A 3LRSB 4XCYA 5IMKB 4H1LG 1RIVL 4EJ1C 5D1ZB 3DX7B 4PY7B 4KPHL 2F5BH 4NKIH 2NY4B 3V7MA 4YR6B 1OGAB 3HB3D 5D7SL 1FZKA 5FOBA 5EU5B 1FGNL 3HRPA 1KLGB 4R90L 1KXQE 4Z9KB 3IVKB 4PGZA 5LQBL 4KUZH 2FO4A 1CLYH 3RVXC 1C16B 2Y06L 1J0JA 3DHJA 1S8DA 2W9DH 3DGGA 4PRHD 3QDGE 5D1XB 3CFDB 2B1AL 4XPAL 5H35A 4XNZB 4BQ6A 1J0ZA 4KKLD 2D0HA 2HJKB 4WHYG 4OQTA 1U8KB 5BVPL 1T5XB 1H3PL 3CVIH 3B8SA 1VEPA 5E2UH 3VXME 1QHOA 4PRPB 4NO0A 1KIQA 4UDTB 2R8SH 3VGFA 1CFTB 5LXGH 1DLHB 1TZHA 4GT7A 1AGFB 3HHRB 5MEQA 3WXVH 4JDZA 1D5BA 4ZFOL 3MRKB 2ARJB 5I30H 5AUMB 4RZCA 4V1DD 4NNXA 3E3QC 1T0MB 3WS3A 1JYXA 1EJ6A 2OJZH 3RFZC 3BFOA 3RRQA 5HBBA 3MPCA 1Q0YL 3WJJC 1HHGA 2JIXA 4MS8A 3ULVL 3MTRA 1A64A 3SE9H 1VGEH 4C55A 2IF7A 2MTPA 2BVPA 4QXGL 5IB2A 1UA6H 1HYSD 4WWKB 1CU4H 2R2EB 4M7KL 1MHEB 4OQ1A 3MXVL 1BECA 1JGVH 3SDAB 4P3DA 5MEOA 3QQNA 4EZMA 5FYJE 4OKVA 4DJMA 1Q9WA 4LEXL 5F9OH 1TZGL 5DMYA 1MCWM 4G6JH 1CK0H 5F1IB 4LBEA 3WD5H 3B6SA 4Y4KA 3BXNA 5D7IF 5F6HI 5IQ7L 1KC5H 3HI1A 3QI9C 2AKRA 1CDIA 2JCCA 3FT4B 4PGEB 3KJ4C 4JGJA 1II4E 2GKIA 1NEZG 2O5ZH 4PP2B 4WFGD 2FBOJ 5KSAC 1HNFA 4G8GE 3L3OB 4Y4HA 2R2HA 2ITCB 1I8IA 4IRJA 4TVPE 2XQYG 2AJZB 3BIBX 4Q9RL 5ITFB 3HUJE 3RWGA 5A3IC 4O51B 1KXVC 5DD6A 4Y2DB 5F71A 2E9WA 1ZA6A 3WUWB 2Z0BA 2WWMD 2DIAA 4P4KB 5FM8A 35C8H 3G5ZB 3TO2B 5K93A 4HW6A 4KI5F 4PTUA 2C3VA 5J4MA 4OI9A 1U95B 3Q48A 1OD7A 1QLRB 3IJHB 3MRNB 1MWAB 12E8L 4I3RL 5C0FB 5CAYB 5EWIH 4GAGH 2BX5A 4UNVA 3EDDA 5CLTA 1OGAA 4W81A 1Q38A 3PJSA 2DKSA 3NZHH 5DEFA 4AYFA 5C1MB 2X4RB 4I8DA 5DURB 3O45A 3KDMB 4G8GA 3SCMA 5TQ2L 1OW0A 5E6ID 8FABA 1E6JL 5D1QD 5E08H 4JQVC 2C1PB 5DRWA 4P3WA 1IZKA 4UZGA 1OLZA 3MV9B 4LGSB 1FO0L 3LSOA 2W0KA 3DX8A 4OZHA 2P5EA 3WL9A 4K55A 1IGTB 1K5NB 4WUUD 5CEYB 5IW1A 1BIIA 2G9HA 1AKJD 4PJ5B 4XNYH 3MLXH 2DM2A 2AI0L 1XZ0A 4IHOB 3IJHA 3DUUA 3SQOH 2YPLD 1KLGA 5GGSA 4Z7UA 1O7VA 5JA8B 5EO0B 5HI5C 1VENA 3UBXB 1F02I 4HF5L 2QQKL 3ZHLA 2X40A 1DEDA 3GHEH 1WLHA 1X5YA 3B43A 4G3YL 2J8OA 3G5XA 1GVIA 2EH7H 4Z7QF 4PP8C 2OL3L 1KB5H 2GAZB 5T1DH 5GRJH 1PLGL 1RUAL 2W60A 4PJHE 3S34L 1HWGB 2DM3A 2O5ZL 3ZTNL 3HZVB 3KLHD 4NQDA 2W1NA 3LKOA 5DK0B 3OGCB 4HC1L 3SGDI 1JHTB 5I1IH 3ULVD 3RUGB 5FYLL 4R4NC 5F8QC 1T03L 3OG4B 3GUTB 1JV5B 3F58H 1F3JB 3VFSA 2QSCH 4YHOH 1ZT7A 4YHZL 2XWBA 1XZ0B 2DTSA 4HSQA 4IHOA 1FVCB 2XT1B 1S7WB 3TA3B 3D87B 3MRLB 1E4WH 4XP4H 4JY6B 4I4WB 3C8DA 5LQBH 5EU4A 4WWKA 3S88H 1JWUA 5DJ8B 3WYRA 2YZ8A 1DBJH 1OWWA 4URTB 5ESAB 1WBXA 1CIDA 1QEWB 5KSVB 4PREA 4H88H 1IAIH 4FFVC 4KRPD 4JZJA 3MCLH 3QIBD 2EDEA 1PKQE 1DZBA 2LVCA 2IBZX 3U4BH 4HXBL 3OAYH 3KJ6L 3TCLA 5D7LD 2C1OA 4KKBD 5I1CH 4RNRB 3UMTA 4PJ9A 1G7HB 2IANB 2Z92B 4P2QE 1N4XH 1NFIA 2BNQB 5FO9B 4RRPA 1OP3H 1IRAY 1NLBL 4HGMA 3HZYB 5A40E 4JHWH 5JPMA 3RNQA 3Q0HA 4YNYA 1TJGL 4W4OC 5CS7A 4HIXL 1Q9OB 1T20B 4PJ7B 1JZ6A 3QWQB 1MHCA 1HCFX 5F1IA 4HWZB 5KJRL 5F7FA 1MCSA 4Z76A 3U46B 1RZ8B 1YEHL 2Q76B 5CEZL 1MY7A 2VLJB 3KJ4B 3U9UB 3LCYA 4NO0D 1HNGA 2R0KH 4BA8A 1VGKA 3EOBB 4QTIH 1RZJH 1UB6B 1MF2H 4JO4H 3N9GH 1Q94B 5BW7C 3RWIA 1U8LB 1KENL 5J6GA 4ZUUA 1UM5L 3QIUD 2GJ6D 2IEPA 5IKCB 1MELA 4LPYA 3TYGL 2YPKA 2H2PD 1KIUA 4DFIA 3MV9D 4M5YH 3I6KA 4YNYB 3BAEL 3L1OH 4PJ8D 4FQXD 1WBZB 3HA0A 1IGIL 5KVGL 1MHCB 5GS1B 4NQCB 2HT3D 4TSBH 5FOJA 4X6CA 1J88A 3E2HC 4QY8B 4KFZC 5SWQA 4LKCA 3BKML 4PLKC 3S36H 1X7QB 4LSTH 4F7CA 1CFBA 3P4NA 1S9WB 2FECI 3BIKB 1M1SA 5GGUB 3KLHC 2VDNL 1CGYA 3H3BC 3QNXA 3PABA 2X89A 3FTGA 1GAFL 5ID0A 2DQEH 1JYNA 2L7JA 1NEUA 2GY5A 3MRHB 3W9DB 4KHXH 1IC5H 4PY7A 2R4RH 5CZVH 4OAWA 4OFKA 2LU3A 5IKCA 3U79A 3EDFA 1RFDH 4LNRB 2GJJA 3M1BB 4LCUA 4BH8B 4GRMA 4X7SL 4MX7B 1EGJA 2BSTA 1NMBH 3ILQC 3HS0A 4NDMA 4H0IA 5HYIA 4JFEA 3ZT5A 5CP7A 4LLVB 4FHBD 2CLVA 3DARA 2FO4B 1C16A 2BHUA 1K4CB 4NHCH 2V9TA 3P4LA 4XHJC 3UC0L 4N90D 2HG5A 3IXAB 4WGWB 5DMIL 5B8CC 4F2MA 4ZOBA 5BXFA 3JVGC 2XPGB 2F8VA 1EGJL 5EBLA 4XVSH 1P6AB 4R7NB 4G6KH 2DKUA 2Y07H 4PB9L 5IQ9A 5GS2D 5FXCH 5C2BH 2DQDH 3QIWC 1U8MB 5KSAD 1BQUA 1NEZA 3EKCA 1P7QB 5GZND 1I7RB 1RZ7L 3GHEL 2HJLB 1D5IH 2E27H 3VD9A 4EQ2A 4OLVL 3BZ4A 2QTEA 2YRZA 4BELD 3KYKL 1BFOA 2FJFA 3PXHA 4I0PA 3MLUH 2DLHA 3H42L 2DF3A 4XCYB 1KCKA 5EOCJ 3VFSB 3LMJL 3W82A 2DKMA 5KVEL 1C1EH 4JKKA 3I6GB 2AK1L 3BD5A 1UWEH 2QSVA 3WXWH 4HFWA 4ACPA 3VXSA 5C0IA 5J89A 4LCYA 3H2WA 5DJ2B 2D0FA 5I6XC 3KPSB 3F5WB 3HPJB 3QA3A 4BZ1H 3RKPA 3ZYJA 4YDVB 4JO4L 1E4XL 3CK0L 5SX5K 3X17A 4TN9A 5GS0D 1G7IB 5DWUH 5HHVL 3QI9D 5HPMA 4U1KA 2NR6C 5E2JA 2M8XA 1NFDA 4FFYL 3TBSB 4KGJA 4B7LA 2NY0B 3WLBB 3L5HA 1S7SB 4RMQA 3P0VL 3DETD 4PJGB 4U7SA 3ELAT 1OAXH 3BH9A 4Y4HD 2AV1A 4KZDH 1WBYB 4YEFA 1JPTH 5I8EB 4ETQA 4UIKL 1B2WL 2W0LA 4LASH 3HTLX 1FYTB 3GJFA 4KKCD 3CGTA 3MRMA 4D0DB 4OGZA 5DK2A 2C4XA 3D85B 4M9PA 3G6JA 1MAMH 1GAFH 1WFNA 1KBGH 5CJ8A 5DTFA 3CNKA 4NQCE 4YBQD 4RMWA 5HHXH 1M7DB 1L9NA 3ARYA 1U8QB 1W0VA 3X12A 4YGAB 5KG9A 2FWOB 5SWQB 4PRIB 1GOGA 1CGUA 1A3QA 3IFPB 3EIFA 2CDFA 4G8GD 4I2XE 3VG9C 4XP5H 4KK6D 4XBPB 2YRLA 4ODHL 5TDNA 2EDLA 4IJ3B 4LPCA 4WVRA 1ZE3C 3GMPB 4Y89A 2CKBH 1CFQA 5C0FA 3LN5A 3AU1A 4XVUC 2VZOA 3BGFB 3QZWB 3REWB 3IJYB 4P3CL 5CJBA 1Q9WB 3G5YA 4IM8A 2BVYA 5EBWB 3LH2H 3SGKA 1A1MB 2EZ0C 4KI1A 4LLVA 3BISA 1L7IL 2MFNA 6CGTA 4KKLC 2Z93B 2YD3A 1T1ZB 2BNUA 3B6SB 3RWGB 1CN4A 4YHYB 1SBSL 4LAQL 2FZ3B 2HT4C 2CLZB 4W4NA 3BE1H 5F3BB 3MFFA 5HGBA 4YHKH 2AKRB 4EBQH 4QXUH 1CXIA 2X70B 5JHDB 1ETZA 4ERSL 3FQNB 3K80A 3U30C 4ONOA 5JXED 1EDQA 4L3EE 1I1FB 5GJTH 4KQ4H 3TH3T 1AGFA 4JLRA 5J12B 4IMKC 1X5HA 3BO8B 4FNLL 3BT2L 3MBXL 3VWJC 4X6CF 2C3XA 1QTYT 3QEQD 3MGOB 3MLWH 3WIIH 3DUHA 3TN0C 4QHLB 4KDTA 4TSCH 2HKHH 1ZS8A 3OXSB 1H5BC 4MA7L 2GJ6A 3EOTL 1OT1A 4XI5D 3JV6A 5IHZB 2MPAL 2VIRB 1I4FA 3MLXL 2BVEA 5BQ7B 4NM4L 3C8HA 1U8KA 3Q6GL 5F3BA 3TN0B 5HGBB 2E7BA 4HULB 2AEIT 1KCVH 2VDPH 5IEHA 5ALBH 2ZUVA 3WLWD 1U3HD 1IAII 3U9PL 2GW5A 4B41A 5FCSH 2AGJH 4E5XB 2VL4A 4JFOA 1D5BB 2XG5A 4H20L 5FYJU 3MOAL 5DC9B 1UQSA 3PWUA 4X9IA 3BP6A 1KN4H 2AVGA 5ESAA 3C60C 4RZCB 5C70A 1KOAA 4UNUA 5IJVA 1RJYA 1VFAB 4YH6A 3OF6D 3QISA 2ZCKH 1FYTD 2PKDA 3BH8B 2FSEB 3EYOA 5KS9E 5ANMB 5IQ7H 1Z5LA 3C09C 2ICWJ 4G5ZH 1WT5C 1P5UA 3K8KA 3BIAX 1V3JA 3TVMC 1XH3B 4Y16C 3G5XB 1S7WA 4R0LB 4ODXB 3G6DH 3GO1H 4OI7A 3RZCC 1UACH 3VRJB 4HPOH 2W60B 3A6OA 5HPOA 4F9LC 2ZCKL 2F74A 3QIUA 4X4XA 4Z78B 3D2UA 3HZMB 4XCCH 3VMOA 3LV3B 1SHMA 3BPLB 2OK0H 2X4QA 2VR5A 1CFNA 1N0XH 4FQXA 5DZNA 1VSCA 4MZ2A 2J6EL 1I7UB 4X6EA 3LB6C 2D9CA 4P46A 2BERA 4Y5VA 1IFHH 3WIHA 2BVTA 3PDDA 4BZ1L 2F9BT 2Z92A 3MJGX 3N85L 4U0RB 5F9OL 1KPUB 4MXWL 4PJ7E 2NY3D 1DQJA 1A4KA 2UYLA 1FAKT 4IRSC 2BXZA 2R69L 3N1QC 2J6EA 1RJLA 2E9IA 2VZVA 3OXRA 4LDEB 1MIEH 1JBJA 3GMQA 4R4BA 3LQZB 3H3KA 2OXHA 2GAZA 1MCFA 2HKHL 3CPLB 4XCEB 4Z8FL 2EEDA 3TBWB 2H32B 4X6DE 2R9HC 3BGFC 1NGYA 2NY0C 2VXUL 3MNVA 4JFED 4NZRH 4WV1C 5J12C 3T65A 5ISZE 3GRWH 4OT1H 4HC1A 5EO0A 1WFOA 2BC4B 5IT2H 5EUKB 4MLSA 1FIGL 1T2JA 2XKSA 4M7ZB 3RWFA 1IGYA 1FG2B 5DHVA 1INQB 2D4FA 1RD6A 2J12B 4BZ2L 3C5ZA 3L7FB 1SEQH 5BRZA 3D25B 4YHML 4LSQH 2R0ZH 3V5HB 4BFBD 3U7AA 3SN6N 2NY5H 4ZTOL 4DOHE 3BN9C 3MJ6A 3P2TA 5IBUG 2Y06H 2H26A 4RDQF 5KSAA 5L2JA 2R1YB 2ADIB 4ZAKD 1ZGLP 1BD2D 5GGRB 2A74A 4V3EB 4XHJD 2F5BL 3PWPA 4FQQB 1U3HB 5C9KA 1V05A 1KLUB 2MQ3A 4Z0XB 3W39B 1T04A 1J0HA 2XPGA 3MBED 3O0RH 4QYOB 4BSWA 1YPZB 1EZVY 1T7WA 5FGBC 1CICD 2A1WL 3EDKA 4LSVL 3F6IA 4WO4D 5F7DA 4RGMB 5FYLE 3FO1B 4NKIL 4PJAF 2OS7A 1TFHA 3WBDA 2VLMD 5K59E 2JJTA 4GO6B 4OGXH 5I66A 4JANB 4LKXB 3QQ3A 3VXSD 4OCYH 2X4TB 3JV6B 3BESR 4Y2OA 2ZNXA 4DW2L 1C7TA 1KIRA 3FOLA 5CP7B 1KACB 1PD6A 1BZQK 5I30L 4NQTA 2CLRB 1HQRB 4K2UL 4L8BB 3SDXB 1NFDF 1F8TL 5DRXB 5JOEA 1KG0A 4PJ7F 3OKYA 5HHQA 5ISZB 2EYSB 4XCCL 5E99L 4MYWB 4GXVL 5D2NA 3MV8D 3HN3A 4ZUUB 1O5DT 2B7DT 2LQRA 1TZHB 3O3UN 3C5JB 4C56A 1UWXK 4PGDB 4P57A 3UTTA 2IWGA 4OLZH 3L95A 5I1LB 5JOPD 1G0YR 1V7NH 4UT6L 4ODSH 3TO4D 3T2NH 4KTDL 5F72S 2F15A 3JBG7 4DZBB 3I6KB 1FZMB 4ONGH 2IADB 4K8RH 3H9YA 3UJIL 3R8QA 1WCQA 4HF5H 1U3YA 4S1QH 1T0MA 3MODH 2CGRL 4L9DA 1OGTB 1KCSL 4MDJA 5AZ2H 3PWNB 4R26L 3RWIB 4UV7H 3W2DH 4P5KA 5FO7B 3U2SA 4YHNA 4NNPH 4PJIB 2ZSWA 2A73B 3HC0A 3HC4L 5C7XL 1W72H 3QEQA 4EXPX 5E8PA 4JQXC 1IEAB 4QRRB 3WHE0 4JPWL 1PVHA 2OR9H 2FEDC 3FO2A 1X3DA 3T1WA 2J3SA 2FEEI 1I7ZA 4XVJL 5E0QA 1J7VR 2FLRT 2UZIL 1SEBB 1DL7L 3T4AA 2OTPA 5MENE 3KJ6H 3ARGB 4OV5A 4BQCA 1YDPA 1T2QL 2Q76A 4WU5A 1CL7H 5CEXA 4H88L 3HRZA 5D1XC 4Y5YB 5FKAA 3MREB 3ZKQD 1RIHL 5FECA 2FB4H 3NTCL 1IARB 4GKZB 4U1JA 4UDUB 4MD5A 3OB8A 4OM1H 43CAA 4PGJA 1KFAH 3C6SA 5GISH 1G9MH 5I8EA 3FQWA 1OQOA 2CXKA 5KVDH 4S1RL 1I8MB 4RBPK 4YDKL 2D4DA 1FVDA 1F8TH 5D6CA 1EGJH 2XWJB 4JRXB 1NFDB 3L5WB 2P5WE 1GGCH 3WDJA 2QQQA 1QO3B 3TBTA 4ZTPL 1ZLSH 4GW1B 3NIFF 4K7FB 2D03L 3H9HA 4Q0XH 4PLJD 3INUH 3INUL 3QXDB 1A6PA 2ICES 5CINH 3KPSE 5L7XH 2W91A 1G7LB 3WDIA 2QQLL 4EDWL 2HFFB 5CILL 4PY8I 1UH3A 3VXMA 3CC5A 3OHXA 2WINB 2FDBP 1NBQA 5ERWB 5CBEB 3ES6A 1TJIH 3HPLA 4LCYB 3D85A 3QUMH 5JW4R 4EXKA 4M03A 1MHPL 4MCYB 1MSPA 1ITBB 3IT8D 3NPSC 1IJ9A 2R0WH 1FAIL 5I19H 1W0YT 2Z8WC 1CDJA 4KWUA 3KXFE 1D6VL 3MR9A 4XX1G 2J8UA 2BRRL 3T0BA 3FFCA 4K7PH 1ZLWH 1NL0H 2R2BB 4H0GA 3I6GA 3HG1A 5F6IB 3CD4A 4YC2B 2V5SA 1BIIB 1WZ1L 2CDEA 2G9HB 4PJ5A 1U93B 1JI2A 3U7YL 1F11A 1YN6B 1KCLA 3IKCA 4JFQA 3MV7D 1YY8B 3U0TA 3NIGF 4XWGL 3TJEL 1CFVH 2BCKB 1T0NB 2Z31C 3GBNH 1JWSB 4KU1A 4RISH 4YUEL 3WN5B 2VKXA 1FFNA 5E1AB 4JY4B 1KV3A 1WISA 3W11D 3UJTL 3SE4A 3SQBA 2OL3H 4DN4L 3MLWL 2F58L 2EDTA 5DVMA 5H37G 4GAYB 2Y7QA 5T1MA 4PS4L 1HXMA 3V5KB 3X11A 5ACZA 3SKNB 4R0LC 3BDYH 3MLVH 1CS6A 2YS4A 5GRZA 1K8DA 2X4OB 4M61B 1QKZL 3GGWA 5GGTA 4PLOB 2DJ4A 4QRRD 2IJ0C 3L3JA 3PV6B 3ULSA 4JEGB 1QFWH 1G9NL 4WDIA 3CLEL 1ONQA 2K9UA 5FO7A 3E2HA 1RVFL 4QRQA 5EBGA 4FQIH 1Z3GH 1FNSL 5H94A 2VLME 2ZCLL 5T3XE 3RVVD 1AQKH 5FEBA 2W9DL 1L7IH 5IVXA 5FYJD 2F19H 5C2UB 1HQ4A 1CGSL 2H9GA 1YEGL 3VXTB 2YKLL 1NAKH 4XBEL 2DQFA 4ODXA 3JV5A 4HFUL 3CVHB 4MJ4A 3ROOB 1T1WA 1JF1A 1J9CT 3K3QA 4KJQC 3KXFB 4MA8H 4JFOB 4PJIA 3QWRA 3TVMB 5J0BA 2WLZA 5K9KB 1KELH 3I3BA 4LVHB 5FAAA 4EVNB 4Z7OE 2AXJA 5H37H 4PJGF 3UYRH 1FNLA 3VGGA 1C08A 4MAYB 3DROB 1OCWH 4V2BA 4E0RA 1IC7H 5JLZA 4PJEA 4CN1A 4OGYL 1S3KH 3BEWA 3IDYC 1XCTB 3FQNA 4RFOH 1YDPB 2E5EA 1NUDA 2DLIA 4DVBA 1NGQL 1U91A 1RMFH 5C07B 4YX2H 4HWZA 1IM3B 5EBMA 5A1AA 5I8OH 3VFUA 4PUBL 1XT5A 5J8OA 4WTZA 3MGOA 3RJDA 2VLJA 2FATL 2E8YA 3ARPA 1ZHNB 3KPPB 3PGCB 4NFBA 3TVMA 3BHBA 1JF6A 1MJJA 4F33A 1CT8B 3S5LA 5BRZD 4EOWH 3VFWA 3RVUD 5EOTB 4JHAH 3L6FA 5IHBA 4Z5RA 2WP3T 3QO1A 1ZOXA 1KIPB 2OYPA 4JE4B 5CUSL 4PJEB 2YPKB 2I9TA 3DX6A 4XWGH 2Z31D 1LEGB 5B38A 3Q6GH 3HFMH 1M4KA 1JFMA 4ZFOB 1FFPA 4OBRA 1S9VB 1OAXL 3KYMB 2GJ6B 4JR9L 4KVNH 4DFHA 4NT6A 1D5XB 4N0YL 2NXYD 1X7QA 2QADD 3QPXL 4XMLH 2IPTH 3VGHA 1NUFA 2ZNWA 3ETBF 4JPWH 4LARL 4QOKA 3V7AE 3KPPA 1BFSA 3WFBL 2R1YA 1U92A 3SE3C 3S37L 4RGMC 3LHPL 3VGBA 1NCDL 4WHTA 2JIXB 1JPGA 5F9AC 1F2XK 1QBBA 4FQ2H 2VQTA 3QUZD 4P46C 3ZE1F 4EKXA 2P45B 4Y16B 5I2IB 3K2UL 3EYVA 3ZKMC 3S4SG 4FQHB 3FO1A 3DV4A 5HDQH 1AR1D 1MCKA 2NY5C 4K07A 3RWDA 3OXRB 2AJUH 4LSPL 3RAJH 5IMMB 5IROA 1IKFL 1AGEA 5CHNB 3HB3C 2DOCA 4Q0XL 1KPRA 5ICXB 2A6KA 4GRWB 5DJYA 3VWJA 5J1AA 1NUNB 5E70A 3O4OB 4UU9B 1YNTB 1QHPA 3QQ9C 1ZLUK 3UDWC 2E7HA 3TO4A 1R6VA 3FO0L 2ICCA 2V5TA 4QHNB 1WT5A 5L2JB 5DD3L 5JUEH 1N0XL 3KHQA 4C83A 2I07B 3CZJA 4OZGB 4PTTB 5CEZH 4L4JA 2ARWA 1UVQB 3GHBL 4OQTH 3BQUA 1OAYL 2ZCHL 4NQVA 1JN6B 4P5MB 2DQIH 1HI6A 4NN7B 4KUZL 2M26A 3I50H 2YOCA 3KXFD 3O2WH 3U36A 1CXKA 1OARH 4DKEL 4PJFE 1M6OA 4UOW1 2GTWB 5JIPA 5JZ7D 3WMSA 3TCXA 2NNAA 1ED3B 1F6LL 2DMCA 2IC2A 1CD1A 1VACB 1MRCH 5INDA 3SDXE 4MVBC 4PRBA 4LRIA 4J4PD 4Y19B 4CGTA 3D9AL 5SWZE 1FL6A 1RIUL 4QHNA 2AS5M 1LO3H 3CFJB 5EU6B 2X4NA 3MQIA 2OQJB 3QDJB 4PGBA 4LQ1A 1OSPH 5IOPA 1UA6L 3PIQA 3PDGA 1KN4L 1WCBB 5EIQA 2W92A 2HRPL 2DRUA 4XAKD 5IW6B 1PAMA 2BSED 2AEWA 1I3GH 1AO7E 1S7SA 2CGRH 2Y4SA 3VH8A 3KPQB 5M7QA 2CQVA 5DA4A 5JDJA 5HYSA 4JM2C 4Y4KB 1AQDB 1KCVL 1K3ZA 4HJJL 4IOFC 3G5ZA 2GTZB 3VFRA 1A9EB 1X6NA 1MFAL 1KPVA 3WFHB 4ZPVB 4X4ME 4K8RC 4PP2A 3FB7A 3HR5A 4J12A 5EOTA 4NWTH 4NWTL 3RTQD 1MAJA 5JW4M 3O6FA 4KK9D 3FQWB 5B8CB 4U7KA 3ZKMD 1HK6A 1NDGA 1YQ2A 4XNZC 4G6FB 4QRRA 5TE6L 4EDXB 5J56B 4QCIB 3B8YA 1HYRC 5EU3B 4JFEE 1MLBA 4H1LA 2F5AL 3LQAL 2W9EL 5GS2H 2EXWC 4ZXBB 3H42H 1NCCL 3KYMA 1YEHH 5IVZB 4OCSL 3WJJA 2G75B 4NT6B 5HHPB 1Z6JT 4MNGE 5CP3A 4LLUB 5C0NC 2BFVL 3BVNB 3KPRE 4HWNA 1GC1C 2K7QA 2XWTA 5FB8A 2A6DA 4HIXH 2O61B 2PW1A 3T77A 4N8VG 5DQ9A 5LKNA 1KIPA 2I9TB 4KI5E 2P8MB 4AIOA 1DP0A 2CDGA 4JJ5B 3VFNB 1QA9B 2LTQC 1K3IA 4J4PC 1Q0XL 4WY7H 3O3EA 3VDBA 4GG6F 3QQ3B 5DSCB 4XVSL 1SEBA 3SDDD 4KKAD 5I1EL 1WF5A 1AGDB 1ZA3B 2D7OA 1C12A 2VLKE 2KL6A 4XNUH 5E56A 1TTUA 5BO1L 2BNRB 4L29B 4AT6A 3RHWK 4JB9L 3ET9F 4FQQA 5D1XA 2VUOA 1MRFH 4G8FA 1L9MA 4YHPB 5TE7H 2OZ4A 4Q6IC 2PNDA 5TQ0H 5HHOE 1MFBH 3CCHB 4O2FA 5IFAH 4OM0H 3UXFA 5HVHC 3VMPA 5LGJB 4R97C 5DJCA 4WHCA 2EE9A 3LN4A 1A7RL 1Z9LA 4FA8A 3RGVC 1QPXA 1SJVA 2VL5B 5T1KB 2DQGL 2VLRE 3PHQA 3R0MA 5GZOC 2B0SH 3OKNB 4S2SA 2Y36L 2A83A 3T4AB 2ERJC 4HK3J 4FTVA 3V5KA 3X11B 4KQ3L 4MDJB 1KIRB 3FAWA 1ORQA 1E0OB 1KC5L 2X05A 4TVSa 3QEGL 2UY6A 4MMXC 2VIRA 4PS4H 4RFNB 4OFYA 4B5EA 4M6AA 4L8BA 5DC0A 2W0PA 1KTDA 3OKMA 2MPAH 4HWEL 3GJEA 4I4WA 4WEMB 4LPVA 4NKQB 1DQLH 2PYEA 1ZHKA 4HKJB 2DB8A 4R4ND 2RHEA 2P8PB 2RIKA 5CJQH 4Q6IB 1T0NA 3REVB 4D9RE 1N7ML 4ELKA 3GK8H 4GBXC 5JOPE 4C56E 3CVHA 4JPVL 1SYVA 2VZSA 2X9YA 3HG1B 1J8KA 1PZ5B 1HXMB 3QJFB 3CSBA 5AAWA 4LCIL 4PJDB 4NCC2 5SWSB 2KQMA 3OGOE 4QXUL 5IFHL 1AXTL 2Z91B 5ABDE 3GB7B 3HI5L 1JZ3A 1SQ2N 4XNMB 4G9DB 3V4PH 3H7LA 1CD9B 1I3RB 3DECA 2C7UA 3STLB 4OI8A 1DTUA 4NOFA 5HHOB 1KJMB 4R7DA 5FK9A 4M6OL 3D0VB 2QQLH 3LAFA 4LF3A 4PFEA 3WXVL 4AJ0A 5B8CA 3ES6B 2Y7QB 5T1MB 5A2LH 1D5MB 4JG1L 5EU5A 3UYOD 4JFYA 3RWEA 1T80A 5KBNC 4HS6A 1HQ4B 3LVEA 4BSVB 3TJEH 4ZUWB 4HS8H 1A9EA 4UMGA 1LK2A 1ZA6B 1N59B 5D4QA 4YE4H 4TTDD 4N0UA 3E2HB 2DI8A 1YEDB 1BWMA 5JR1H 4KJYB 4X4ZA 3EW3B 3QDHA 5IFAL 2ESVB 5CGTA 1CIUA 4PJCE 5DFVC 2FR4B 1A6UH 2R1WB 4GBXB 3DRTB 3F58L 3QCUL 4PJFA 5J3HD 4Z18A 4WW1B 4WUUA 3FB8A 5B4MD 5FV2A 4YO0A 5ID1A 2HJLA 1WTLA 5I1IL 5T1LD 4C4KT 3QUKA 4NWUH 2P48B 8FABB 3N1GC 3VGAC 3DXAE 2BNRE 1RK1B 1IM9A 5GSRA 2VITB 1NCCH 1OTUD 1FJ1B 4LASL 3VRLF 4D0BA 3QHFH 1DBBH 4GUPA 3QXDA 4WI5A 1T1YB 4HPYH 4WI9A 5FGCB 5JIIA 4HLJA 1J8HA 4OCXL 5F7HA 5J13C 5L6YL 3GSRB 5CBAA 4P9HH 1HIML 5FYKL 2WP3O 1S7XB 4KVCH 3CH8A 5D7IE 1HSAB 3LQAH 4MB3A 1GC1L 4HJJH 3J7HA 2IAMA 2ZUYA 3PDOA 3TA3C 1LK3L 3SE8L 1C5CL 3KPRD 2XNAA 2FNBA 3PWVB 4XC3H 2IPKA 4JFXB 4KROC 4UU9A 1FDLL 3KG5A 3OKLB 5DJZB 3ME0A 4KROD 1ZAGA 4ENEC 5IP4A 3EO9H 3L3GB 1NGZA 3SOBL 5GHWL 2VKWA 1J0YA 4RX4A 4U3CA 1RJCA 3QFJA 4JZOB 5E8DH 4HUVB 3HMXH 4F9LA 2FGWL 4GOSA 4NCC1 5IB2B 3RGHA 3OKMB 1XGRA 4PJBF 1Z9OA 3U4EB 4AIZA 1FIEA 3LN9A 1GGBL 1I7RA 3TH4T 1FZJA 2NY6B 4LSPH 5DEZA 3RAJL 1C1EL 5L2KD 3QHZL 4UINH 4GRWE 1T1WB 2Q8AL 5D7IA 2VXQH 4YXHL 4LLQA 3AB0B 3QNYB 5J11C 1CXEA 1JHLH 1NLBH 2WQRA 4WCYL 1UEYA 5D8JL 3Q1SH 1AD0B 5FUOL 4G80B 5HHOD 2ZP0T 2ITDA 4QHKI 1TMCB 4MAYA 1I4FB 1W72A 5AZ2L 2PYEB 4HCRL 3MRIB 3MLTB 4JZOA 4HUVA 3QUML 4MXQD 3EO1B 4P48A 4POYA 4F7TA 5L8JB 3HMWH 5D2NB 2X1XR 2J88H 5HYQA 3DVGA 4F58L 1PG7H 1L6ZA 3E1F1 2EDYA 3LN5B 2H32H 4NZUH 4KKCC 2CO7B 3V6ZB 3GEWB 4DZBA 1KTKE 5D7IB 3ZE2F 5JTWA 4FQJL 3MV8B 1U8HA 4X9GA 2JCCF 1WJ3A 3V52H 1NAMA 3P73A 3GSQA 4P2YA 2WIIA 2DQCH 1VFUA 2P5WD 2UUDH 3NA4A 5ILTL 1JV5A 1NCBL 4JPKH 5T3XL 3QDMD 1FNEB 3ZSTA 4Y2DC 4GBXD 3MLTA 5IIEA 3ORJA 2J4WL 3RPIB 3WFHA 3TA3A 4LSSL 4D0DA 4IOFD 4AEHL 4KHXL 5GISL 4Y4FC 3UPCA 3GMPA 1UWXH 3O6FB 3T09A 3GRWL 5F9DC 4C57C 4DVBB 2X6MA 3CSGA 1WV7T 2EIEA 5FO8A 3SJVD 4G6MH 4GG6E 2UWEF 3RDTD 3MBEC 1I1RA 4ZUTB 3SDCA 4AMKH 4UI2A 4FTVE 3T3PF 1AXSA 1FRGH 3MRCB 3NH7L 1KJVA 2XKNB 4N8CH 3RNKA 1AFVL 2G75A 4GKSB 2Q8AH 4I1NB 1DN0A 1QRNB 2ADJA 1FL6B 2Q6WA 5I71B 3BX7C 3VXPB 2BNQA 4KRLB 3I9GL 3SOBH 1JYVA 3HC3L 3CVHH 2EYTA 5C0BA 1WZKA 2MCPH 4PJFB 4ZFFB 4DQOH 1IGML 1OAZH 2Q3ZA 4XP6L 3BQUB 3DURA 5HD8D 3FT3B 3FB7B 2CKBA 3WV0A 4RGNE 3GSNH 2NX5B 1A1MA 4OB5L 2Y6SC 4OZFH 2IBZY 1QLEL 3MODL 1U6AL 2AEPH 1DQDH 3IRPX 2AERT 4KHTL 5HGAB 2ZUSA 1MLBB 3RUGA 3ZE0E 1LO2H 5BVJA 1FV1A 1FG9C 3SE4C 4AL8L 5FHAL 4D0CB 1NGYB 1V7NL 4LU5L 1JPFB 1G1CA 1E6OL 1CGVA 3IETA 3QQ4A 5GRUH 4LLWB 2QHLA 4MWFB 4U1IB 3AB0C 1P53A 4DGYH 2OQJA 4I0PD 4KMTH 3IDGB 3O41B 1MIEL 3NFPA 2E7MA 1KGCD 2GSIA 4ODUB 1JCKA 5GS3A 2X9WA 3OMZA 5JXAL 2ATPB 1U8MA 4GFTB 4OD3L 3UJTH 5E00A 2QLVB 2R23B 1VACA 4FQ1L 2F74B 3VWJB 3DV6B 2WUBH 3OKOB 1JNNL 2PYED 4LVHC 2D7MA 3OJ2C 1MWAL 2FJFB 1F4XH 1EH9A 1CG9A 4XBEH 4N0UE 1B9ZA 2YHGA 3P9WB 3BP7B 3WJLC 2NXZC 4ELMF 4HQQH 3AC0A 3I75A 5TGBA 2J1KA 1I9RH 4C83B 5BS0B 5F88A 5GPRA 5DQJA 1JWSA 4LSVH 3WN5A 5ALBL 1BVZA 4TUKL 2FHBA 3ZDZF 2DBLH 1NCNA 5EC2A 1X5JA 4IEFB 2WUCL 1UM4H 2UZYB 5DRNB 3HNSH 5F6HJ 1G7JA 4HKXB 2VH5H 5TDPB 4EQ3A 2CD0A 1RJLB 3WNNA 4RGNB 5IJVB 1EEUA 1RJYB 1T22A 3IDXL 3ZE0F 1YY9C 1RUAH 1T66D 5I1HL 3NABL 3QUXA 2D7QA 3VXNB 5C9JA 5L7XL 2B8OT 1RVFH 4K23H 1RV6X 1WZLA 5C0EA 1JGLL 4F7CB 3NPSB 4HKZB 1B4JH 2DDQH 3EOAB 3MRPB 1EXUA 3ARVA 1CWVA 3RDTB 4FRWA 3V6ZA 1T83A 3QFDB 3CFBB 3RTQC 5E24E 3L3OA 4Y4HB 5I75C 1MPAH 3AMLA 4CDHA 5I1LA 1ZHKB 1FCGA 2IH3A 4WJ5B 4LCUB 3BZ4B 1WWWX 4KRNA 3QAZC 4RMUA 4K7PL 1MVUA 3REVA 3P4NB 2P5EE 5KN5A 2EDWA 3LKRA 1NCAL 3D48R 1E6JH 2ZUWA 2IBBA 4XCFL 3PABB 3QNXB 2VLLB 5DVLA 3OBAA 4XHQA 1FFRA 4JQXA 2E7LA 2VQ1A 5JPNA 1UKQA 3HC0B 3EOTH 1DANU 3CH1A 2XICA 3LD8B 2MMXA 3OJMB 5L8LB 1C5BH 1HSBB 4ZMAT 2DQHL 3QFDA 3MMEA 1YMMB 3TJHD 2YA2A 3K4DA 2PO6A 2BSSB 4A2LA 2LU4A 3OKKB 2LFGA 2NMSA 4MAYD 1KSRA 4PBVC 1G9EA 1P84J 9CGTA 1QFHA 4P23D 1NC2D 1A7RH 3V5DB 3BKCL 1GPOH 3QIWB 2J7LA 1ZHNA 2WUBL 3PGCA 3KYNB 4LLYB 4FQLH 4X80L 4GW4A 5D5MF 1ORQB 4AQ1B 4MD4A 5EUKA 3FQUA 2FZ3A 1TETH 2AP2A 3BDBA 3H9SA 2BP3A 4S1RH 3UEZA 3LKNA 4Y2DD 1QA9A 1AR1C 1F3DH 1H3VA 5D1ZC 8CGTA 4K71B 3GSRA 3SJVE 4LHUA 4LIQL 5BRZB 3C5JA 4LEXH 1KXTB 3IDGA 3ZT6A 1N8ZB 4NGHH 4C56B 3VXRD 1FSKC 5C08D 3OKEB 5MI0B 3P30H 4RX4D 4UT9H 2C3HA 2BHYA 4P5TC 1F4HA 5GRVL 2NQCA 5FF6B 1BZ9B 4JANA 1ORSA 2YUZA 3CAFA 3ULUH 4EUPH 2VDKH 3QEUB 1U6AH 2VXTL 3LKOB 1VADB 1KFAL 1QYGL 1T66C 1LQSR 4I48B 4NRZA 2AGJL 4F80A 5FGCE 1RK1A 1MH5A 4YBQC 4JM4L 4WHDA 4YC2C 3I84A 2EDHA 1OAZL 1BWWA 1NC4B 1KF9B 1S7UA 5E5MA 3SDCD 4PJBE 1BJ1J 4G9FD 5EORH 5C0ND 4HJ0C 2EYSA 3NCEB 2R1WA 3O6KH 1BVKA 3QXVA 2BMKB 2ORBL 2VR4A 4M62L 2DLEA 2G5BA 3K74B 5IG7A 4XXCA 4V1DE 5DRNA 3TN0D 4JQIL 3THMH 1WBXB 5CJXC 1KULA 3KPNB 3GKWL 3O11B 3BP7A 3O9WD 3IU3A 1ADQH 2VLRA 1GZQB 4JZJC 5DS8A 3T3MF 5T3XD 3EJYC 3CFDA 1I1YB 1OM3H 1PEZA 4UUJA 4ZNEE 5F44A 2VISA 2YEZA 2ESVE 2X1QA 3WKML 4D2NA 1LK2B 1VEOA 1MH5B 1NMAL 4GG8B 5C71A 3BP4A 1HINL 1VFBB 3E6FA 4PV9B 1P69B 1A6VL 4LF3B 4PJXB 4RISL 3CFIC 4YUEH 3U0TB 4HKBA 3MCKB 3PNWB 1DQDL 1KJ3H 3PQYE 3HC4H 4KJYA 5C7XH 3DTXB 1ZLVH 2BVOA 4JFYB 4AG4H 2FL5A 5TE7L 1ZT1A 5MERA 4HZLA 2DYPD 2FX8L 3T2NL 4FQPA 1M6OB 1XH3A 2GTWA 3DSFL 4L9LA 1CLOL 3BQUC 4NCDA 3N0PB 1PZUB 3MO1A 3L3HA 4RGNC 2JJUA 4CJ1A 3FB8B 1MWAH 3U0PA 1KEGH 2OMNA 1N59A 1A6WL 1I3GL 2ZSVB 1RZGB 4IRSA 2FX7L 1OTSC 1WIUA 3RVWC 3VU2A 4KPHH 1CFNB 3IRZA 3VD3A 4WFFE 3KPMB 3NOIA 1NJ9B 2ADFH 4MJ5B 1FNEA 1A7PH 4L4TE 4MVBD 1CU4L 1WAAE 1KJMA 2NXZB 4P23B 4EI6A 5D2LE 1BQLH 5L0QC 3QIWD 3STBA 3HCVA 4Z6AT 1J18A 2G60L 5CEXB 2J5LB 3OKKA 3GSWA 2X9XA 4YBHA 1SMAA 5B4MC 1OAQH 1XF5A 3WSQH 3O3DA 1MREL 2AK4A 3MROB 4NP4H 4G80A 3SE3A 1LO0H 3SPVB 3TIDA 1PQZA 2BSRA 4IMLA 3EYOB 3RNKB 3GBML 5LWYH 5JUEL 4EUPB 4UINL 2APBA 5D6DA 5JHDA 1OGAE 2QQNL 2XA3A 4X5XA 3EJZD 3MRRA 2YR3A 3KR3H 4XPHL 5JHLL 4U1HA 4F7PA 3T8XA 4RAUA 1A8JH 2D7NA 1MRDL 3KNBB 2NY7H 2Z35B 1WAAA 4RAVA 1UACL 3IF1B 1T83C 3S6CA 5HYEA 4HJ0D 3CFKA 2WBJB 2VDLH 2VDML 5DJXA 5E7FA 3RTQB 2DQTL 5ITFA 3OTTA 4E41E 2D7PA 5CMAB 4MD4B 3KPOB 4N5ED 3V4PL 5BQ7A 4JKPL 3T2OA 4OB5H 3GJFK 4Y5XC 1S9YB 3FQRA 3G9AB 4G42B 4DKFL 4OFPA 2NPLX 3OB0H 3RPIA 4U49A 5FUOH 3Q1SL 1GIGL 1U8PB 1IGMH 4DGVH 1U95A 3L7EB 2XRAH 3D69A 4S0TD 4WTWA 2Y72A 1ND0A 5DSCA 3T3ME 4JR9H 4KVNL 4CMHB 1WSST 1CD0A 1BGXH 1U8JB 3JTSA 5FKPA 3V4UL 4LARH 4FZ8L 5D7JA 5JMOC 1NMCC 1LILA 2IPKB 2ENYA 4JM2B 3MLUL 4Y4KC 4JO2H 1NGPL 3OKLA 3KPOA 2P8LA 2VRAA 2X4PB 3O6FC 3RGVD 2ILLA 4QOKB 3V6FB 1GHFH 3OAUL 1UB5B 4P5TB 4MJ2A 3QHTC 3E3QE 1EUTA 1WC7A 3BZDA 1JI1A 3IDNA 5E1AA 4U2ZA 1XGRB 2DWDA 4X8XA 2V17L 5C6PB 1CFTA 4HUMB 3D69B 1MJ8L 5I1DA 1R3KB 1MY5A 3X13A 1MEXH 1A6AA 1RY7B 1RAMA 2VDOL 1H3TA 2BVPB 3V0WH 3C5ZB 3L7FA 2JKXA 5JW5B 3GIZH 4ODWA 3SKNA 4WTXA 1GJIA 2Q1EA 2E9BA 3S96B 1R0AL 3RP1A 1M7IA 1CL7I 2C3WA 1DQQA 4P9HL 2X42A 1FZMA 5E2VL 5BZDA 5DUPH 3PV6A 3U0PB 3ROOA 2ADIA 1Q9KA 1A6TA 5I8KL 3LS5L 3L3IB 1QSZA 3B5GA 4WW2B 2HMID 3NPZB 4MQTB 4XPFL 4P59H 3SKUD 4LRIC 3FN3A 5J1TC 4QT5B 4JRYA 4OLWH 1I1AC 2GK0A 4ZOCA 2OLDA 2VH5L 1MHHA 4FP8H 5F1NA 5T3ZD 5I0ZA 5IR1B 4JPIA 5E8DL 3RWFB 4EIGB 4NJ9H 1VCAA 3W0WA 2YKLH 3LKSB 3QDME 3LQZA 2XI9A 1QBAA 2CKBL 2E9JA 4AEIH 4F9PC 2YD1A 4ZFZA 3HUJB 4ODTL 2OM5A 1ZKAA 2ED9A 4L4VE 3TJHA 1KB9J 1I7TA 4IOIB 2PO6D 3DX8B 5HGHA 2VN4A 3PWLB 5K9OB 1Y6NR 4PJHB 4H5SB 3B4NA 2CPCA 4WIQA 2EYTB 3QZWG 1FV1B 4FNLH 3QI9B 4YE4L 5C9JB 4HIHB 5IW1B 3B9KB 5E5RB 4PPTA 4U6XA 1U9KA 3LPFA 3ARGD 4BZYA 4YLQT 3CMOH 5K9QI 3TO4C 4KY1L 4ZSOE 3O9WA 4PRAA 2NX5A 5SWSD 3ARDA 2XTLA 1UJ3C 3ILPA 1MAML 1J86A 3WEXB 5IB3A 1DLFH 2E6QA 5EIIB 1K85A 1HXYA 2VERN 1QSEE 3L3DA 3F65A 3EZJB 2P5EB 4Y2DA 3WL9B 2IQ9L 1CLCA 5IROC 3MCG1 3WS6A 5T5NG 3FAXA 3VXMD 3NA9H 4GQ9L 3DWTA 4NWUL 1RURL 3BKYH 1MFAH 5BS0E 3D85D 4H8WL 5C0RH 4QRUB 2NY2B 1QNZH 2XTJE 4IRJD 4NM8H 3UBXA 3IFNL 1BQSA 4ALAH 1CDBA 2H2SD 3MGTA 4RFOL 3O41A 4JO3L 3OX8B 5E03A 5F7KC 3S3SA 4NOBA 5SV3A 3VFOA 3RX5A 4JM2D 1KTRL 1KNOA 5C0BE 2HVJB 3ALWA 3EYVB 3HPLB 4WW1A 3GI9L 1UYWL 1MCBA 3RIFF 1NKOA 3IJSA 4X98B 1HHKA 5F9WB 5GGVL 2LU7A 4QLRA 4P5TD 3MCLL 1J1OH 3UJJL 5GGSY 4M1GH 4TULH 2IADA 4D3CL 5J1AB 5FECB 4CN4A 4TPRH 1OGAD 3ALXA 2Q7YA 3TNNB 1YNTA 3NCCB 4ZUSB 3B9KC 3QIWA 4QF1A 3G6DL 2XZAH 4JKPH 3C8KB 4I0KA 2IH1A 3BJLA 5IJKA 1E28A 1QACA 2PYFB 5KW9L 2HH0H 1BD2E 2H6PA 2KQNA 4NO3A 1K2DA 2Y6SD 4P5KB 2MWCA 4G6AD 3BOVA 1IC4H 2R0LH 2APTA 2VLRD 5EZJA 5I6XB 3VXQB 4G6ML 5IMMA 4WO4C 4JREB 5HHXL 1AGCB 2EDKA 4HZAA 4QKXB 5IFHH 5JW5A 1YY9D 2L0DA 3ROLB 4JGMA 1S7VA 2NZ9D 2OP4H 2EECA 3ARUA 4Q9CA 4ZOEA 5JZ7C 1S7QA 3HE7B 1M7IB 4IIQC 4P4RA 4XB8A 1OGTA 1YZZA 4OV5B 1LP9E 4UAOB 5GRJL 3RU8L 4AT6B 2YPVH 5LGKA 5HHMB 3LKRB 4NYLB 4ZPTA 3G5VB 2WM0A 4TTGA 3QEQB 2O5XH 3QFJB 1R3JA 5J7CC 3OAUH 2F53A 1MCJA 3OL2A 4RNRA 4EI5D 5IBLD 3CCHA 3ARXA 4KROB 1FC2D 1TNMA 5H8DA 1KLFA 4O4YH 3RPKA 4YHIB 1UADC 3WIHH 3OAZH 4TQEH 3V4UH 1DQQB 3SKJL 3S9DB 3VI3F 4I9WD 5E9DD 3RNQB 2BRQA 1QSFE 5T1KA 5IGXL 1J1PL 5E6IC 5HGGS 4CAGA 3VJ6B 1TPXB 3HE7A 1DR9A 4L4VB 3U82B 5IEKB 5L2KB 5CFHA 1G7HA 2IANA 5HHMA 2HA1A 3MV11 3U9UA 1K4DA 3NACH 1RU9H 3AS3A 2OZ4L 3U0WL 4AM0B 4LCWD 2IPTL 4BUGA 5BW7A 1YMMA 2GTZA 4Y1AA 4ONHB 1OF2B 2P5ED 3CFBA 2J4WH 5KSBE 3KWWB 1YUHA 4NQCA 4RBPH 1DSFH 2X4SB 4BYHA 4KK9C 2EIDA 4WEBL 4I18A 2JE8A 4WUUE 3S3PA 5C8JA 1XCTA 2DLFL 3FN0H 4Z76B 2DAVA 3QEGH 2APFA 2YPLA 1QZ1A 3QDGB 1MVUB 2NY4C 5DJ0B 4DEPC 3S98A 5F7UA 4Y0GA 1XF5B 2DQDL 2ZUTA 2GT9B 4MNQB 5E8OA 3FB5B 3L3JB 1CGWA 5MENA 3VFRB 2Z31A 5C0GA 5DK3A 1UM6H 5IB4A 3LKPA 3C6LA 4CBPA 5JQ6L 3A6BL 4PRPE 4YPGB 2IFFL 3PP3H 3QWOB 1FZKB 2NCMA 5C86A 2CDEB 4R3SB 4I18C 2OCFD 4JDVB 4GS7C 4P2QA 1UCBH 2YZ1A 4EEEA 4F8TA 2JB5L 5JORA 1AY1H 3FRPA 3MRDB 1KGCE 2ICEA 1QSFB 4O9HH 1IC4L 2R0LL 1P4IL 5EA0H 3LOWA 4OCYL 3UZVB 3T2QA 2PTVA 4OGXL 5KS9B 1HYSC 4PJGE 1ODAA 3LIZL 4BSWB 4U0RC 2NY6C 4HMDA 1WICA 1MRCL 5C09A 4LVOC 4WDIB 4GG8A 5LBSH 4LRNL 2QADB 5JDSB 3KPSA 3F5WA 3HPJA 1U2CA 1IGIH 3GSWB 5KVGH 2DN7A 4NNPL 3O2WL 2CR6A 4WUUB 1FC1A 5HPMB 3VD4A 4M1CD 1M05A 4TUOB 3MA7A 5HDOA 1KJ3L 3HKFA 3LEVL 3BQUD 5LJYH 4N8VB 4R2GD 1FIGH 3ARDD 4NM8L 4CVWA 4ZNCD 4D0BB 4KTDH 5IMOB 1JRHH 2GUOA 3WKMH 4NKDA 4JFDE 3QA3B 2AEQH 2HRPH 3B2UD 4GKOA 4LIQE 3N1FC 3SGDH 4HFWB 2XN9D 4MA1B 4Z7VF 2EICA 5DYOA 5EZLB 3CXDH 1MFCH 3X13B 4P5MA 4BUHA 4M7JL 3MO1B 5IG7B 1EBAA 1RIUH 3MBEB 4X7DC 4Q6IA 2V2XB 5KSUA 3DV6A 1N5YL 1CICB 3WKNA 3ZE1E 5BZWB 3ILQD 4O58H 3HAEB 2CJUH 1G7MA 4JRYD 3O2DL 4O2EB 4Y4FB 3TYFA 3FN9A 4X4YA 1YYMH 3MSPA 5DF0A 1NCDH 2V7HA 3W0WD 3RVVC 1EVUA 1DBJL 4GSDL 3GJEB 2NW3B 2OX5A 2APVA 1JF5A 2EIBA 1ES0B 2BDNH 2Z91A 4JZNB 3U4BL 1FGNH 1UB5A 4ZO6A 4M4RA 5C2BL 3GSNB 1QOKA 3FO2B 4RQQA 4OQTL 4YHZH 1CXHA 4K9EC 4WI7A 4Z5RB 2X89D 3QIBB 4NJAL 3HAEH 4KTEL 1PY4A 1LHZA 2I9LA 3D0VA 4WFFD 4FP8L 3MV9E 1NGWB 1YA5A 1TJHH 3QNZB 4HIJA 3S88L 5C0DB 3BUTA 2FH8A 4OLWL 2VAAA 5DO2D 2PR4H 4Z7WF 2V2TA 4H0HB 2WV3A 4TRPH 3HRZB 4R9HA 4UB0L 1S9VA 2CRMA 5EC1A 3TO2A 3STZA 1B0RB 5D2NC 1HKFA 4GKZA 1OHQA 4YK4C 4IIQB 1OQXA 4NQED 3QJHA 2A0LC 43CAB 3QO1B 1EMTL 4PJIE 4DUVA 3RHWF 4WWID 3MRIA 2DQIL 1XIWB 5ENWA 5AWNL 3P9LA 2H8PA 2FEEL 4O5LH 5DJDA 1DJSA 4PJBA 5TDNB 5D5MA 5E9DE 3EYQD 3S34H 5HYQB 1QSFD 4ZXBC 2YPLB 3UPRB 4XNYL 4OT1L 3MV01 1NGQH 2E7CA 1MJ7L 2DQJL 2R15A 1IQWL 1ND0B 1N6QH 3WNKA 3H8NA 3NFSL 4FQHA 1RURH 4EDXA 1G84A 1S3KL 1W0VB 3X12B 4YDJA 1OL0A 3FFCE 4GLRI 2QQKH 5KN5B 3MLVL 2P42B 1DBKH 2FLBT 2ZOKA 3G5YB 3VXUB 4PJAA 2XZQH 3GSXA 5DJZA 3ZLQC 4IMLB 4HQQL 1XCQA 4OD2B 3STZB 2EH7L 5CEZD 1YEFH 4OSUL 3VCLA 2F58H 3SKJH 4Z95L 5JPNB 3QJHB 5F93C 5B3JE 4F3FB 2VSCA 5GZOD 3WE6A 2RBLA 5ANME 2XA8L 3CLFH 4AIZB 1J8HB 1XF3A 4I3SH 5D5MB 4DVRL 2GK2A 2ID5A 3MRGB 4YO0B 5CBAB 1I1AA 1WEJL 3UPRA 4F8QA 1BGXL 1ZS8B 4R2GB 5EBWA 3EZ8A 3BW9A 3F7RA 5IW6A 3ZKNC 1REIA 3IVKA 4PGCA 3VA6A 1EO5A 3QNYA 2Z93A 2P8LB 4M00A 1FL3B 3BKJL 1QBLL 1YMMD 4LOUC 5DK0A 2H1PH 4M8VA 5F3HB 3MRFA 4E42B 4U6VL 3JXAA 1DVFD 1Q72H 2OI9A 2UWEA 3RIFK 3TBWA 3FRPG 1ETZB 1IC1A 4JO1L 5H2BA 5EZIH 3G08B 1SBSH 2YWYA 4LAQH 3ZTJG 2PYFA 4Y1AE 4YWGH 3MRLA 5L6YH 4OGYH 3EHBD 3RX7A 3C9NA 2EDQA 1IQDA 2R1XA 1FG2A 3DI2B 5D1ZD 5LXGL 4WFED 4YZFE 3RA7L 3MBEA 3SDCC 1ZGLM 2NY4D 2YD4A 1RUQL 3P4MB 4J3SA 3TT1L 4JFFE 1KCGC 4ZFZB 4Y4FA 5JIKA 2XWTB 3RZWA 5SX4H 3KLSA 4XMPL 4NFDA 2V2WA 3RWCB 1JNLL 2R56H 1P7QD 2EE3A 1DLHA 4YPJA 4KJWC 1INEH 1KEML 2VE6B 3ZHDA 1HN1A 3SDDC 5DMGC 4NNYB 1CBVL 1QFWI 3NFSH 3UAJD 4FQ1H 1RULL 3JTTA 1K8IA 4L8DA 4X7TB 5FYJL 4LPWA 3QIUC 4LDLB 2CUHA 4L5FH 3KGRA 1LO4H 4LCWA 1MCOH 4FQXB 1I7TB 4IOIA 2XXMB 4NQCD 3UTSA 4P46B 1HHIA 1R5IB 5IBTH 1X4ZA 3TPUB 3VDAA 2IQ9H 1YMHB 1DE4B 5FHBL 1BM3L 1MNUL 4XXDB 4PJGA 4NN6C 2HTLD 2X44D 1F6AB 2FIKA 1A6ZB 4KZDL 5C0BB 2X41A 4ETQB 1IL1A 3WEXA 1KCRH 4Y8DC 4DK3A 5MEND 2NY0D 3NN8B 1ZWIA 2AJYH 3UO1L 1RUKL 4RGOH 1CLOH 4YDIH 4YQXH 2H45A 4NZTH 1KPUA 1A5FH 1IE5A 1XF2B 4WU7A 4Q6YA 5A2FA 1M71A 4NKOB 1JZ4A 4LKCB 2X4QB 3BDYL 4PIRF 1X5AA 1MI5A 1JPST 3JWOH 3HI1B 1I7UA 1LO5A 4R4BB 1ROWA 3H0TA 5EUOF 4D9QE 3RKDC 1MQ8A 1QRNA 2ADJB 2Q6WB 3LKPB 4U4BA 3EFDH 4QRTB 1G9MC 1FBIH 1I8IB 3NH7H 3WIFA 5GGVY 2YWZA 1Y0LB 3RI5K 5DLMH 1JUFA 3T0EE 3VW3L 3P3YA 4YFEA 3LMJH 3DX9A 4XPAH 2VZ1A 1YJDC 3RKDD 5CSGA 1E27A 2EXWD 2XQBH 3MX0A 1FRGL 1IKNA 2C1PA 2FIRT 1AJ7H 5DRWB 1PKOA 1X5FA 1CTOA 2ZKHH 1EFXB 1I1CA 3RZCD 1VFOA 4I77L 4NQEE 5LAXB 3W81A 5BXFB 3FOLB 4G8FB 4FTVB 2R0WL 2CK2A 1IT9L 1AIFB 1T1ZA 2BNUB 4PJFF 1SMOA 4WHTB 5T5FH 1ZHLB 4U33A 2VQUA 4L3EA 4XC3L 3MFFB 4LAJH 4S1QL 4XPBL 3SO3B 4BFEA 3GSUA 4M6NL 4Y8AA 4M9OA 5CSBA 3UP1A 3FO9A 1HE7A 3DBXA 3CMGA 2DQCL 4O4YL 1FPTL 3QH3A 4P4RB 1UGNA 4HXAL 3DUSA 1PG7L 4LEOB 5FYLD 1V3LA 4JHAL 1AGBA 4QHLA 2V5MA 3UTOA 5JOFA 5HVGB 1D7FA 5L2KA 3ARBB 1AIFA 1DUZB 4NZUL 1FYTE 4HKZA 5CJXA 1U8PA 3GNML 3C2AH 4QO1A 5HHNB 1FVCA 3T0XA 1BHGA 5FCUH 4YFLF 2YD7A 4P46D 5GRWA 4PJ5D 3W2DL 4PRNA 2A6IA 2X1PA 4HEPG 4E9LA 3S36L 1VHPA 4YFDB 1G7JB 1INDL 3TBYB 1A02N 1JMZA 4RWYH 5ICZA 1QEWA 4N0CC 4YXLH 5I1KL 3NFNB 4O2EA 2WWMC 4NYLA 4ZPTB 2NXYC 2YD6A 3G04A 5BS0A 3SBWA 4XPGL 1P4BH 2P43B 5FCUL 4M1GL 1ZEAH 4APQB 3ERYA 5EPMA 3ESUF 1KCUL 5E2UL 1UJTA 2QJDA 3DVIA 5TDPA 4C58B 1S78C 4N0CA 1LK3H 2WANA 4U1SA 1T20A 5CP3H 3R8BB 1UWGL 4M6OH 4RGOL 3DRTA 4GBXA 1EAJA 3PWVA 1BOGA 1TDQA 2SEBA 4DW2H 2EDXA 1MQKL 4JAMA 4K3HA 3IFPA 4H1LH 3BP5A 1RZKC 2VYRE 5HYSB 3L3GA 2L7UA 4L4TD 3LV3A 2X4OA 3TZVC 5A3ID 5JHDE 2DM7A 2RB8A 3TC9A 5KAQF 1TZIB 5AG9A 1C7SA 3VGDA 2YC1B 3R06A 4Z77A 2XTJC 1YC8A 4JQIH 3LIZH 3D3VB 4MJIB 2D31B 5ID1B 2P5WB 5CJQL 4GRLD 5IBTL 3GIVB 1IAIM 3DO7A 2BNQD 1HWHB 1NANI 5I8CA 1NH6A 2FX7H 2EKJA 1TXKA 3DOSA 5FO8B 2EC8A 3FB6B 1P4IH 3MRJB 5DDHA 4BQ8A 4NN5C 4X4YB 2JK5A 5KVMC 1M05B 3B9VA 2R2BA 5C0GB 3S7GA 2XKNA 5E6IA 1ERNA 3CC5B 2NY3B 5I73C 1CQYA 1GL4B 3U9PH 3QHZH 1ADQA 1AD9A 4KZEH 4HUWA 4X6FA 2CUIA 3NZ8B 5ACLA 1MCPL 1CF8H 4NKDB 2HT4D 3T65B 3KS0J 4L3CB 1DVFA 4M8QA 2VLJD 4JDVA 3GMRA 4N0FB 4XBGB 1GGIL 4HBCL 3D3VA 4MJIA 5EIIA 1RHHA 4P99A 3L5WA 5ERWA 5CBEA 1QFWL 3L3DB 3DURB 32C2A 3KLAA 2BOCB 1OP3K 5ESVA 4JFEB 1JTOA 1SBBA 2HRLA 3JWOL 4PGCB 1R24B 5HJ3B 2N56A 2NLJB 5C0JA 4TSCL 5ID0B 4WI3A 2PXYC 1KUMA 1EO8L 4YHMH 2G2RA 4OZFG 1EIBA 1IKFH 3MNWB 1SEQL 5BVJB 3SKMB 1NLDH 2W0FA 1I9JH 4CW1B 2D9QB 5ADPH 5H2BB 4LHUB 3GBLA 4L3AA 4G7VH 2K1MA 2HFEA 3ESVF 4R4FL 3L6FB 3MRNA 4BQBA 2Y5TA 3C5SB 2Q87A 4F7MB 4MCZB 3V0AC 4A6YH 4KMLB 4E5XA 2BJMH 3D3VE 4MJIE 3QG7L 3ZKND 1WFTA 1ORSB 2QEJA 2D3VA 4ZS7H 2I26N 3KYAA 1IQDB 2R1XB 3PJSB 2AV7B 4FXLA 1AO7B 3QBTB 3WJLA 3BYYA 2N7BA 1CLZL 1U8HB 1DN0B 1OPGH 4WO4B 3SDDB 4OZIE 1D3CA 5GS1C 2RJMA 4ENED 3HNSL 3NTCH 4HS3B 4Q74A 3BRFA 1NAMB 3P73B 3GO1L 2R4SH 3W5NA 2VZTA 1NCAH 4NRYB 3VWJD 1JPGB 2OR8A 2OSLA 4JRYE 1UJ3B 3FT4A 1JJUA 5D7LA 1BQHB 2GYSA 1Q9LA 4OSUH 2DIJA 4EOWL 1V7ML 2XN9E 3O4LB 1CR9H 2D03H 3L95B 1IM3A 3MRKA 5EBMB 4KY1H 3U30B 3F8UB 3R1GL 2YMXH 3OQ3B 3G04B 3W9EA 4RCAA 5E8NA 4OLYL 1KYOK 3TFKC 3KXFA 4P9HC 3ARZA 1HHGB 1BOYA 2J8UE 2YK1H 2FJHB 5T3ZE 5DJDB 5EFIA 3C5ZC 1ZTXL 1Y6KR 3ARBC 2ITCA 1D9KD 4PG9B 3QUMB 5IMLB 1CGXA 4XNUL 1PSKL 1R3IH 2ADGA 1RUMH 4UT6H 2WUCH 2FD6H 1G1YA 3MXVH 4OKVB 4EI5B 3ARFD 5C0DA 4JVWA 1MJJB 4F33B 4YHLL 3WO4B 4OF6A 1CXLA 4WV1A 1IILE 4OFDA 3P0VH 1O0VA 3DJ9A 5K9KA 4Z7VB 2VDRH 5KTEL 1ACYL 2PXYD 3W9EB 3QXAB 4HFUH 1DUYB 4XPFH 2AW2A 1D5ZB 1JZ2A 1QLFA 1KT2A 4ZS7L 5MHSD 3HNVH 4TVPD 2CDFB 2AJVL 4OZFB 4RIRB 1MCWW 1XIWA 4AEFA 3GRWA 4XVUD 5DI8B 4YXKH 4N9GA 3HC3H 1INQA 4LHUG 3UDWA 1KJ2L 4MWFA 3WNOA 5D2LF 1RHHB 3X3GL 3TV3L 5KG9B 3MV7A 2FWOA 4J3OC 1FCCA 1FP5A 4OF3A 3VG0L 1BMGA 4Q9QH 3UZEA 1TLKA 1J87A 2GJ6E 4OCNC 1LWRA 2FGWH 3ARRA 2NLJA 5C0JB 3OKOA 4XXDA 5F1SA 4ORGB 5BVPH 2DMKA 3VXRA 5HGHB 1F6AA 25C8H 2FIKB 4L3CA 3QUYD 4YBLB 4OLZL 4P3CH 4QRPA 1H3XA 1TCRA 4CRPA 3T08A 2R8SL 1MQKH 3EJJX 3QRGH 2I07A 1MRDH 4L3EB 5GS0C 3ZDZE 2GSIB 4ODUA 4JFDD 2KBGA 3HMXA 5CD5C 1YEJH 5E4IA 3JWDH 3JWDL 2FHFA 5DWUL 1XR8A 2O5YL 4PRDA 1ZGLA 4X6BA 3QB7C 2GCYA 4UQ2A 1JHTA 1IEBA 1MI5B 1VPOL 4P4KC 1SY6A 3E0GA 4OZHB 1ED3A 2CMRH 4U3XA 3IS0X 4MAYC 3DIFB 1BFTA 2V2WB 4PREB 5ETUB 4LGRB 3I75B 5TGBB 4UT7H 1A1NA 1JN6A 1X5IA 4Y19A 2HFEB 3ARED 3MXWH 1H8SA 5MP6L 3CSYB 3CXHK 3CFJA 1L4IA 2Q8BL 1TVBA 2ATKB 3PXJA 4QT5A 1K8IB 4L8DB 5EOQL 1A4JB 3SE9L 2NNAB 4EI5C 1MHHB 4JKLA 5IR1A 1OTTD 3WO4C 4KAQL 5D1XD 5DR5L 2W59A 4X6BB 3VA2C 2H2SC 5EU7C 2G5BB 1CE6B 5HI4C 3HS0B 2R39A 3HUJA 3OGCA 1FN4B 1B0GA 4N0CD 1WK0A 5FIEA 5IOPB 4YHNB 3KVQA 4H5SA 5EOCL 4M02A 3I6LD 4JY5L 1UCTA 5D71H 2EKSA 1Z5LB 3NIFE 4HC1H 2ZUUA 1IEHA 3UTQA 4NP4L 4QOKE 1A6AB 5KOMC 5T5NF 4NNYA 4DQOL 5KSBF 1NAMH 4WW2F 4APQA 3DVGB 3O9WB 3ULVC 4U1GC 3PWUB 2I60L 5SWZD 1P7KB 3N1MC 1N5AB 4NPYB 1NBYB 1H8OA 1FLRL 1T7YA 4CNIA 1JNJA 1UB6A 4X6CB 4DKAA 5KW9H 3LRHA 3GSQB 4LCWE 4AMKL 3L3KB 5EFIB 1ZANL 2XACC 1ZVHA 2UWEE 2X7LB 3U7WL 4HWBH 4TNVK 1V5JA 3M8OL 2F53B 2ZKHL 2JB6B 3BKJH 4U1MA 2DM4A 1CDGA 5F1NB 3MRHA 3DYPA 4OIBA 1IFHL 4Z7UE 2Y07L 3E3QA 4ZQKB 4Q2ZB 1TVHA 1CGSH 2DD8H 1WVZA 4D9QD 2ICWI 3QNZA 4HIJB 2DQHH 2Z4QB 3TBYA 2PUQT 3QXAA 3MFGB 3BPLC 4QCIA 3V52L 2A9NH 4I3RH 4MGXA 3NCYP 3B3IA 3GMLA 1CTNA 1YNKH 4RIRA 1FPTH 4HPOL 4LEOA 3I85A 1G6RA 2D7TL 3QEUA 1OARL 1YEFL 4DKEH 1RZJL 1BBJB 3DYOA 5IF0B 2DQUH 2IALB 3VG9B 1EEYA 1CT8A 4L9LC 5C3TA 2R0KL 4OF0A 2H6PB 3IAPA 4QWWC 3B5TA 3BSZL 4HT1L 4HK3N 4I5BB 4LSUL 4XPBH 4XRCB 1AGDA 1ZA3A 1C12B 5DJCB 1TETL 4GXUN 3OR6B 5DRZA 1N6QL 2W38A 1ZSDA 5FA3B 1YNLH 4RAVB 4UIMA 1G6RL 1RMFL 3DUSB 4ZSOB 3O3EB 1RPQA 1T2XA 4M3JA 1R3LA 3T0WA 3BN3B 1KCRL 4HJGB 5JXEA 5HHPA 1OTTC 3IJSB 4X98A 1EFXA 2A6IB 3ZTJH 1URLA 3QCVL 2KZ1B 3B3IB 1I9JL 1XCQB 4OD2A 4NN6B 5DQ9B 4FFVD 1J05A 5ESQB 1NGXB 2VMFA 1B6UA 5HHNA 4X5LA 3CJJA 4XXCC 3JWNC 4QYOA 3ULVE 4F37K 5TE4L 5D2NE 3MACH 1OP5K 3E8UL 2BVQA 4YIQA 2VR9A 1S9XA 3OZ9L 4YEEA 3IDIA 1X6LA 1D9KC 5F6IC 4KV5E 5HYJB 5IWLC 3VRIA 1KELL 5CKAA 1BAFL 5BMFH 1NCTA 5KAQG 4QTIL 4LSTL 4KKBC 1J8HD 4B7IA 3ROLA 3MROA 1RZJC 2AK4B 3QPXH 4NQDE 4PR5A 4XMLL 1FNGB 2BOCA 3TH2T 1AQKL 5IBUB 4H25B 2OBGA 3PUCA 4LLAA 3QRFM 4UUJB 5GSRB 1P2CB 5HJ3A 1PGRB 3IXTA 3FOMB 2ZSVA 5F7DB 3MUZ1 3N06B 3MNWA 3ZYOA 3LB6D 4GAGL 4ZO9A 1NQBA 4Z7WA 4GW5A 2BHZA 2D2OA 3DTXA 4OCSH 1IGCL 1TTFA 4WNQB 4C54A 2GY7B 4R7DB 4OD3H 1FO0B 1K6QL 4NC1C 4KJWD 2O5XL 3N9GL 1BJ8A 2VNCA 3LZFL 3RY6C 1HOCA 1NKRA 1VDGA 3EJZC 4NQXB 3HLAA 5E6YA 2NY1D 4IRSB 1NBZB 2HLFD 5C07D 4X6CE 3EYSL 1M7DA 5FUCE 5KJRH 1CI5A 3CUPB 4G7YL 5FHAH 5E2TL 3O4OC 4YX2L 5ITBL 4F37F 2YC1A 3WHXA 5D1QC 2KUTA 4P2OD 4WW2A 3AS1A 3DPBA 1MFNA 4MCZA 2HTKD 5SX4I 1GXEA 2ESVA 4NSKB 5JR1L 1GCFA 1Z0NA 4R2GC 4KK8C 5HHOA 2KPNA 4Y5YC 4ZUWA 4U1KB 3RY4A 4JPIB 3PQYD 4Y19D 3RL1B 4R6UA 3AREA 2BRRH 5F96L 5C8JB 1BOGB 3CLFL 4K7PX 2BY2A 5EU6D 3ULUL 2DWEB 5GRVK 4K3DH 4PJDA 5E6IB 1LEKB 5SV4A 1XGYH 4IDJL 1VESA 3GMNB 4ZS6D 1KYOJ 1AD9B 3TWCH 1KBGL 3D5OF 4AH2A 4UV7L 1DUYA 2CIIA 2JJWA 3WLWC 1BLNA 3BPCA 2CRIA 3K46A 3PWLA 3SDYH 4LVOB 2HFGL 1EO8H 1GRWA 2XZQL 2F8OA 2APWA 2OMBA 5ANMA 3QSKB 5DZOA 3B9KA 3B9EA 5ICYB 1D5IL 2E27L 2XFXB 4JRWA 1LEGA 5JDSA 2D31A 1EHNA 4FXGA 3RWEB 2OTUA 4JRXE 1PBYA 2XWJA 3HNTH 3CFCH 5DUPL 4YDKH 1QKZH 1G6RB 5I74C 4TUOA 4Q9BA 4RMTA 1J1XH 4LLDB 3MV8A 5F1KC 3T0AA 3KYNA 4LLYA 4OIAA 2ICEB 3CDYA 5B3JF 5E7BA 1NCBH 4JPKL 4FQCL 1JGUH 1AXIB 4JM2A 1E4KC 4NUGH 4W70A 3U1SL 5IHZA 1N7MH 5M94B 4OKDA 3I02B 2V7NA 2EC9U 5HVWA 5JW4Q 3L7EA 4DTGH 4PBWD 2AJSH 2BZDA 1ZSDB 2XZCL 4PG9A 3H7BB 4NC1E 1WC7B 2H8PB 5GZNC 2E3VA 5JORB 4JJ5A 1QO3A 3TBTB 2X1WL 4A6YA 1T1XA 3LKSA 1M7XA 2OR7A 3U4AA 5CZXD 3T4YB 2A9NL 4X0KB 4LFHD 2ARJA 1DBKL 1RZFL 2OZ4H 4MNGB 1VGEL 2IQAB 4S1DC 2CLZA 3ZZ1A 2N7AA 4L29A 2BVQB 2DQJH 1P2CA 4I77H 5D8JH 1W72B 5TDOB 3MA9H 3SY0B 2F8XC 2B5IB 3QCTH 2HTKC 1BVLB 2NY1B 4PRPA 1VERA 1A5FL 3S96A 5ILTH 3U4EA 4TQEL 2VLKB 4JVUA 3D39D 1DBAH 1Y6MR 3G6JE 4OZHE 1LEIB 4XP9H 3QG6B 4K3EL 3T0VA 1T7VA 5TFSL 4ZS6C 3D25A 3UTTD 3GSOB 3Q5YA 2IQAA 5FDYA 4HUKB 5C08B 3EO1A 1SJXA 1BFVL 1W8NA 3ARBA 4R8WL 2BCKA 1LD9A 1JYWA 1JGDB 1FDLH 4NO0B 1GGIH 2WQ8A 1UKSA 3BPNC 4UDTA 3PHOA 3GFUA 5T1KD 3F6LA 3L9RA 5IW3A 5J6HA 2PYEE 1EEZB 4OD1L 5ENWB 1SM3H 1U2HA 2OSLB 4P2RB 2E6JA 1T04B 5KVDL 3K7UA 3HE7D 4FQXC 4CUCA 3MNZB 1RJZA 4WEUD 3GBMH 5LWYL 4GAJH 4GAJL 3KYOA 1LO0L 4POZC 3QFJD 1I85C 2FB4L 2LE9A 3BUYB 5D7LE 4G9FB 4MZ3A 5IMKA 3OB0K 4OCXH 1IC7L 1QQDB 1PFCA 5DVNA 4HPYL 2G60H 3WO3B 1TMCA 3FHAA 3GSVA 2R56L 4IDLA 1AH1A 1KB9K 3WNPA 1CE6A 4ORZC 4OZIF 2F5AH 4ZO7A 3QHFL 4HXBH 3VW3H 5FOBB 1J5OH 4IDJH 3QAZB 5ELIA 1X4XA 1FVEA 3EFFB 4W6YB 5JLZB 5GSVB 1AY1L 2HVKA 1DEEB 1N26A 1HXYB 5JMRA 5ICYA 5GIRA 5EN2A 3FT3A 3GM8A 4UOW0 3DGGB 5C07E 5DJ6A 1C8PA 3EO9L 4EN3D 7FABL 4E41A 3CPLA 3AGVA 2B1AH 5DGRA 43C9A 4PLJC 1FE8H 4ORGA 1BLNB 5EDXA 2E6PA 3OPZL 3V5HA 4HS6B 2UUDK 3ZDXE 4QRUA 4JG0H 4U6HA 3UTSB 4LQFH 5FYKU 1P4LB 3AY4A 3VXOA 4HGWA 4MQ7B 1LP9F 4TOYH 1IMHC 3BZEA 3BKYL 3AY4C 4KDWA 2ZUQB 1K9TA 4N0UB 1A6VH 4UILH 3QDGD 1JHLL 3CSYA 3VMNA 1KNOB 4U1IA 4H20H 3THML 4W68A 2VXUH 3I9GH 2OL3A 3NN8A 2P5WA 3SHSA 2DJUA 1NCUA 5CD3B 1PJ9A 3MUGA 3AVEA 4I3SL 2WBWB 4G8GB 1FNHA 1JZ5A 3U6RA 4Y7MA 4DAGL 2UZXB 4IMKA 3C87A 3QPQC 1CD8A 1R3HB 4Y88A 1RU9L 3NACL 1QLRA 2V6HA 2B2XH 5I18L 5FKAB 2VITA 4YK4B 1UFUA 4U6VH 3CXHJ 5AYUL 5D6DC 3VGEA 2VXTH 4D0CA 3G08A 4DTGL 1J1PH 2X4RA 3GMRB 4N0YH 3DUUB 2VXVH 4PRHA 3OKDA 4QRPE 3F7PC 1T89C 3GZKA 1ACZA 3CFCL 1GOHA 1RIVH 3O0RL 5F9JB 3NAAH 3JTTB 4AK1A 5FYLH 1I8MA 4OFVA 1UH2A 4K94C 3EAKA 4UQ2B 5D5ME 3AM8A 3ZDXF 2V9QA 5LGHL 4U05A 2HKFH 4UV4H 3TT1H 2ATPA 3E6HB 3Q6FB 2UWEB 4PJDE 4LSDA 1OAKL 2IGFL 4ZD3H 5IESL 4Z95H 2P7TB 4H26A 3RA7H 1HHIB 1JGLH 1NLDL 5HYFA 7CGTA 4H25A 4LSQL 1RUML 5L8KB 4TNVF 2VZUA 3NMEA 5C08A 1YEGH 4UTAH