3LKQA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1977 strain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lkqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lkqA01
1A21A 2QV2A 3MLRL 3Q0HA 2R69L 1INDL 5IW6B 5KOVC 5DD0H 3SDAA 4U3HA 5ABDE 2Z8WC 3T1WA 1RUQH 1OB1A 4LPUA 3KJ6H 4DGVL 4LLDB 4NWTH 2VLJB 4UQ3A 5F6HI 4G7VL 4M03A 4YWGH 1EEZA 2EDFA 3ARBB 3HE6C 2VZVA 4XGZA 4WW2F 3MLXH 4NQEB 1MHHB 1EEUA 2GAZB 3CSYB 5F1IA 4FQXB 3BZFB 1WCQA 3DX7A 4KRPD 3KDMA 2MCPL 3GBNL 5DK2B 1AY1H 1KB9J 4N0UE 3C6LA 5LXGH 4TSBL 1TQCC 2VL4A 2H8PB 5EU3A 3MRLA 3BP4A 3MV9A 4J3OC 2YN5A 3BUYA 4JPWL 5EFIB 1IAOB 4G42A 4JANB 5GIRB 4F7PB 2APTA 3QIUA 4LHUB 3SE4A 2EIDA 2EH7H 1IGIH 4XXDA 4XP4H 4HG4K 3B6SA 1K9TA 1DQQB 1ZWIA 2P5EB 5C1MB 3CCHB 1LE9B 1QA9B 1IGMH 3ARVA 3SDDB 2HJKB 1OSZA 2EH8H 3VFUA 1CFTA 1OP9A 3B8YA 3ILPA 2HT3C 4ONHA 2VITA 4K2UH 2AJ3B 3MBXH 3L7EB 4U33A 4PJEF 4Z95L 3MMEA 5FV2A 4B5EA 3TPKA 1FNSH 1OP3H 3H9HA 3N1MC 3ZYOA 1KCSL 1XIWB 2NR6C 3NZHH 3V6OE 5FYLE 2MCG1 2PTUA 1P7QA 2DQHL 2GFBB 4QHMA 1B4JH 2YOCA 1D5IH 4BFIB 2YWZA 1FYTA 2HP4A 5AUMB 3QUMH 4S1RL 2PXYC 2ZCLH 5D93B 1CK0H 3QH3A 3OZ9L 2NCMA 5AEAA 1D9KD 1X5JA 3JV6B 1CDYA 1KJ2A 4M4PA 4OGXH 5DI8B 5EU6B 1FYHB 4HCRA 4YBLB 2QSTA 4JY5L 4MJ5A 4XH2B 3QCTH 1CXIA 3AVEA 3BGMB 1J87A 4IDLA 4L4VA 1YYML 2CLZA 3W81A 2NY6B 4DTGH 2BNQA 5D1QC 1S7XB 5AG9A 3PHQA 4LP4A 1G7IB 4V1DB 5KAQF 3VXPA 2ESVD 3RZCC 1WICA 2DQEL 3ROOA 4XMPH 4PP8C 1MCSA 3TYGH 2P4AB 4YNYA 1E28B 1EPFA 4KZEH 2GTZB 2UWEF 3MV8D 2BOBA 3P4NB 4WW2B 1R5IA 5L2KB 1LEIA 5ICYA 2FR4B 1CS6A 1JCKA 1ZS8B 2N7BA 2CKBB 5D1XD 1EERB 5TFSH 4FQIL 4WIQA 4NC1E 3UYRL 2DJUA 4F37K 1OVZA 1CLYL 4I0PD 5KVDL 5I15L 3ARYA 1YEDA 3HE7C 4FFVD 4E42A 5D7JD 3I50L 1TTGA 5DJ2B 2FEEI 1GOFA 2MOVA 1TJHL 4JO4L 3MRCB 3TVMB 4YHZL 3NBNA 5DQ9B 5FA4A 4QOKE 2D03L 3F58H 4GKNA 2E6PA 2X4UB 5SWZE 5JOPE 3CXDL 1RUKH 5CGYC 2WMPA 4M02A 5DJCB 4TUOA 5DS8A 5AYUL 4YHIB 2VXSH 3VG9B 4BK4A 5GXBB 4R4FH 1E4KA 1TJGH 3VFVB 4U1NB 3BKYL 1W0WA 3IU4L 1KG0B 2K9UA 1WWWX 4R0LB 4C54A 4PRDA 3VFOA 3U4AA 4TULH 1YMMA 2AABH 4PJEB 1IGTB 1XF3A 1T5WA 4TSCH 3LHPL 4CW1B 3W82A 2X05A 4D9QD 3P4OA 4NM4L 2ICWI 1K4CB 3QQ9C 2VNCA 3GMRB 1E0OB 2ZJSL 1Q9LA 4CBPA 2UZIH 5EORL 3VCLB 4KRNA 4NNXB 3RDTD 3MNZA 4M93B 4ZUTB 5IMLB 5J8OA 3V52L 1ZEAL 2JCCF 5JIIA 3DVIA 3FO9A 5CEXB 3MRQB 3PQYD 2QHLA 5E8DL 1AE6H 1SEBB 3T0EA 4EUPH 4KJWC 1ZLUH 4KKCC 5EN2A 3DVGB 5CJOL 4JVWA 5HVWA 1J7VR 2F8OA 1OP5K 4ETYA 3HG1A 1T7YA 3KNBB 4MAUH 5DA4A 1Q9KA 2AK4E 5HGAB 1QPPA 1X5FA 4L8DB 1GGUA 2V9RA 3KYNB 5HYJA 4KTYA 3GMMA 3QDJD 1I3UA 2EYTA 4LAQH 4HS3A 3HI5L 2C1PA 3R8BB 4UB0H 3Q6GL 2VQTA 1Q9WB 4OD3H 5CHNA 3GSNH 3MJ9H 4HJ0D 3MLYL 4FFZH 1HQRB 4F58H 4D2NA 3VFWA 2NY2C 3C87A 5IG7B 5EU4B 3QAZB 4BZ2H 5ID1B 3O8XC 5BQ7B 32C2A 3QXAB 4NKMB 3ZKNC 3RGHA 3D85B 4ONFL 4MD4A 1SMOA 2MHAA 3UTSD 2L7UA 3BQUD 4KPHL 2H1PH 3QUYC 4K3HA 4HFWA 5KANI 2MKWA 2ZSVB 2V9QA 5IHBA 3U0TB 3CC5A 2J8OA 4WHDA 2LVCA 5BRZB 4FTVA 2ICWJ 2E7HA 4XVTH 2DD8L 1XF4A 3IDGB 1QP1A 3BH9A 3O6ML 4AMKL 5GZND 2YPVH 5E08L 5KS9F 2G75B 4RMVA 4OLUL 1Z9MA 4OZFH 3C8HA 3S4SB 5FYJH 5EO0B 2BY0A 1XZ0A 2VZTA 4GXVL 5LGJA 2EDEA 1BX2A 4K3EH 4YGAB 1UKTA 1YEIL 3QXDB 3U7YL 5HI3D 2ZUUA 2FHBA 2EE3A 1I4FB 4DN4L 2H9GB 1KULA 2PTVA 1OT2A 1C5BL 4NO0D 3BDXA 3OJDA 4N9GA 1INEL 5E6ZA 4PY7B 1HHJB 1J8HB 1AXTL 4KI5D 4ETQA 1TCRA 4S10A 3G5ZA 4H8WH 4OCWL 4NZJA 5MEPA 3HLAB 1TLKA 2WM0A 1YMHB 3BPOC 2FGWH 4YPGB 4HQQH 1LQVA 2YZ1A 3HCVA 4PJAB 4BH7A 5EOCJ 1IEAA 1Y18B 5FCUL 1A7BA 5GJSL 4UDTA 1QZ1A 1JZ8A 5DZNA 1T2QL 3TO4B 1HWGB 3U2SA 3F12B 5KAQG 3IDMA 2V17L 3MUGA 1A0QL 4X7SH 3MFGB 4X80L 1T03H 3D0VB 4P2RB 1IC7L 3MUJA 4ZAKA 2D9QB 4I3SL 3K46A 3DO7A 4JPKH 3HNSL 1D5ZB 3B5TA 4M7JH 4X0KA 5B38A 3B3IB 4EQ2A 2FGZA 2RCSH 1JRHH 1KPVA 4D0DB 4ZUWB 4Z0XB 4CN6A 3C60B 4KKBD 1JV5A 4UDUB 1XGQB 2GYSA 3RFZC 2DI9A 1WEJL 1HH9B 1G9ML 1HXMA 1A5FL 1BBJA 1GSMA 1E4WH 5D7KE 5J0BA 3KPMB 2FECI 1U8LB 1EDQA 4RQQA 4YBQC 1EAJA 3T04D 5KS9B 5DJ8A 2P5WB 1PLGH 1DBKH 5C6TH 3ARGD 4F7EB 3FL7A 3NAAL 3BFOA 5BVJA 3IFLL 4ZSOA 4YZFF 4G9FB 1AHWB 3IRZA 5E6IA 3FQTB 4F3FA 5EUKA 3IJYB 1DBJH 4MNQD 1H8SA 4ZXBA 4TVPD 3O2VL 3ILQC 1ZT1A 2DMKA 2IANB 3KPPB 3HR5A 4KGLA 4ZYKA 1N8ZB 5C0FA 1JNHB 2R4RH 2KPNA 5DD5L 1HQ4B 4H20H 5C0EB 3WKMH 5IB4A 3SDXA 3MLPA 3ZHKA 2VDRL 3O9WD 4FQCH 4ERSL 3BKJL 5EU5A 3RVVD 4PGCA 2YPLA 5FF6A 1RZ7H 1PZ5B 5CWSB 5DVOA 4PJCA 4YHNA 1J0KA 5DURB 4X6FB 1PAMA 4NBYB 3GSWA 1KACB 3O6KH 4XNQB 4HBCH 3T3PE 1J0YA 1C7TA 4MCYA 3QFDB 1X6LA 2WAHA 3TFKD 5DRZA 2VMFA 5TGBA 3X11B 3BPCB 4UI2A 3U0WH 1IKFH 1FFPB 2EXYC 2Y07H 2ADIB 3MLTB 4APQA 1DQJB 2VH5L 3JTTB 3EOTH 1OW0C 5FO8B 4X6EB 1X5IA 2P24B 3WJJC 2EE2A 4GAGL 4N0YH 3O41B 4JO2H 3GMNB 1S7SB 4WENB 4IJ3C 1MHPH 1B0RB 3G5VA 2Q86B 2IG2L 2XNAA 3FN0L 4PJFB 1F4WL 3MOBH 4QRPB 3IAQA 4PJXB 5C8JA 2BNRD 1MCRA 1EHLH 4Y4KB 3IGAA 3KPRD 4GG6F 3VXUA 2ZUYA 5GS3A 3O3EB 4U1JB 5CD5D 1IKNA 3RY5A 3B9EA 3LY6A 1GC1H 2Z93A 3P77B 3T2QA 2A1WH 1MREL 3QO0B 4K3GA 4M8VA 3WLBA 4MQSB 1F97A 1FGNH 3CVHA 4XMLH 1QLEL 4ZQKA 1WFOA 4KMTL 5GS0C 1TQBB 1CQKA 3KXFD 5EZOL 1S5IL 1QO3B 4QHUA 2MTPA 4UOW0 3QUKB 2XWTB 1AP2A 4NZTH 5DVLA 1CL7L 3QSKB 3PP3H 1FQ9C 2MJWA 4NQVB 4AEFA 1G6RB 2YR3A 2YA2A 1CD8A 3RA7H 2VZ3A 1JPFA 3JXAA 4M6NH 4XI5C 2NYYC 1Q0XL 4KJYB 4JFFD 1R24A 3IDNA 1NAKL 2DTSA 3P9MB 4KAQL 5L2JB 3EAKA 1CTOA 5D2NC 2YRPA 2OZ4A 4UT6L 5KVFH 1QBLH 4G3YH 3A67L 3P0VL 4NKOA 5H37G 4KJPC 4PRIE 5DK0B 4QHNB 3PWUA 4NHUB 5TDOA 2VKXA 2PTTA 1MVUA 1X5GA 4OCYH 3RL1A 5IB2A 3KPQB 4X83A 1MVFA 2CRYA 3UYPA 4OCRL 3WS3A 1J0ZA 2LQRA 1G6RL 1HIMH 2NY5C 4YK4B 5LGKA 3N1QC 5ILTH 1DP0A 3NN8B 4JAMB 4MX7A 4UQ2A 1BIIA 1QVOA 2XTJD 4EDXB 2OL3A 1B3JA 4NQDB 2XTLA 1ZGLB 4X6DE 3VGBA 3O4OC 4LLVB 1D6VH 1R3LA 1T20A 1INQB 3BWAB 5D6DC 1IZJA 3OR6A 1DQDL 3VD3A 4KK6D 2QKIB 4E41A 2P45B 4EBQH 1VENA 4FMKA 4GJTB 3PXJA 1R5VA 3O3DB 1H8NA 4ZO9A 1I1FA 5HHMA 3X14A 1IGCH 1CZ8H 4U0QB 1QPXA 3LQZA 3KVQA 4HH8A 5IP4A 4M1GH 4JZOA 5FYKL 4Z8FL 5E2TH 5HYFA 4FFWC 1WT5A 1WUNT 4M4RA 3SJVE 5J1AB 4ODUA 4NRZB 3E2HB 1RZKC 4WNQB 1MUJA 4LLYB 2J88L 1ZHNA 4Y2OA 3NFSL 3MV8B 5JQHC 1MNUH 4FQLL 5MENA 5BXFB 2APXA 1U8KB 2HVKA 4FP8L 3DUUB 2FYYA 5ALBH 4IMLA 2X5PA 4N5ED 1K4DB 1QFHA 2X9XA 5IEHA 2Z31A 4KK8D 3HC4L 4QT5A 4K94L 1T83A 3EJYC 4DKAA 1KEML 3AAZB 2VLRE 1UZ8A 5A2JH 2HH0L 2R2EB 4L9LC 4XNXL 4C56A 4NT6B 1VGKA 2EZ0C 1KJVA 3LEXA 5HDBE 2ZNXA 3Q6FA 1A1OA 4P2QB 4K8RC 1K3IA 1V7NH 4IHOB 3DSFH 3TWCH 4Y19E 1F8TH 2CO7B 3LS5H 4KQ4L 1F45A 5HGBA 5F7UA 2B20A 4HFUL 4JG0L 1N64L 1MLBB 2I24N 1J05B 3WUWG 4GLRH 5A40E 1K8DB 2W60B 4WCYL 4JQVA 1U6AH 2J8UF 4X9IA 5IVXA 4Z7VB 4NOFA 5CUSH 1MRFH 4EN3C 3G6JF 3RWEB 4IRZH 2ZUWA 5D1ZA 1R6VA 3PQYB 3NCEB 4PJ5A 5DF0A 3L3IA 1F3JB 3NTCH 2Z92B 4PYHA 4LDOB 1UXWA 4UINL 3I02A 5L6YH 1IGFH 1RZ8A 5DRWB 4MLSA 1U3YA 3ARPA 1FFOA 3MBEA 1CE1H 3WHE1 1E4XI 1HHKA 4L5FL 4QRUB 5BVPH 1L6ZA 4JDTL 3QEQB 5IFHH 4MXQA 2PCPB 1RJYB 1XGRB 2DAVA 4IRJC 3DXAB 1OAZL 3QDJB 4HIXL 1JWSA 1AFVL 2AJYH 1IT9L 3MRDB 3TBYB 3BIKB 4U1SA 5JPMB 2XKUA 2XT1B 3FFCE 4RMQA 3GSVA 3VI3F 4Q9BA 2FD6L 3FB6B 1U8JA 4F8QA 5JOFB 2XA8H 3WE6B 1JGDA 3VRJB 1U8NB 3F8UB 3RWCA 1LO3L 4JFPB 3M07A 3S35X 4JFEE 3MLRH 3FTGA 1AO7E 4N0UA 1INDH 2GW5A 1Q9OB 4M5ZL 1KPUB 2F5AL 4D9LL 5C2BL 4JHBA 4AT6B 3WBDA 2VL5A 5GISH 4L3EE 4M6OH 5F3HA 4G7VH 4JHWH 4PD4J 5DMGC 4LCIL 4WV1A 5IV2B 5KSAC 1QFWL 3HI1B 2RR3A 4XCCL 3U30B 1DBBL 3GBNH 4P23B 2JIXB 4GKZA 3WMSA 2X1OA 4TNWK 1UVQA 4KQ3L 4C55A 1UJ3C 3IDYB 4X6CB 5DEGA 3O11B 3JUZA 1HKLL 3BP5B 4JPWH 1YPZF 3LKSB 4DQOL 3V6OA 4F37F 3OAYK 1HEZA 4XHJD 3JV4A 1T89C 4ZUSB 5C0JB 2J8UB 1QR4A 5E2UL 2DQTL 5F1SA 5EB9A 3CSPA 1T1ZB 2VUOA 2X70B 3MGAA 4Z5RA 1P9MC 2EKSB 4MA1C 4XT1C 2IFFL 5IB1A 4L29B 2J4WH 4N8VA 3VXSB 1I9EA 4HPOL 2FJHB 1P6FA 4LRNL 4PJIB 3FRPA 5E9DD 1KB9K 2AV7B 1UYWL 1KCSH 2GSIA 3O6FD 4N8CL 4NKQB 2QSCL 4K3DL 1CBVL 1ZSDA 3QDMB 3QIWD 2DQHH 2DN7A 2NW3A 1DQLH 4FN0A 3AS1A 4P2OA 5J11C 3DURB 1D5BB 1IBGL 4ODWB 2EDKA 1NGWB 2VAAB 4H5SB 4HJJH 1OD7A 3V5HA 4IRSB 4WWKA 3QISA 5FK9B 4EJ1C 1BVKB 1GIGH 3MCG1 5CCKH 2NLJA 2BRQA 4LQ1A 4HS6B 5GS1B 5HDLA 2JB6A 4JY5H 2L7JA 3RVWC 3EYFA 1MWAB 1PJ9A 3IFPA 4U1IB 3LKQA 1GZQA 4KRLB 2NW2B 3SPVA 1YYMH 2XY2A 4JFXB 1WCBA 5D70H 4PTUB 1OF2A 4PPTA 3UJTL 2JJTC 1VFOA 2DQEH 4QXGL 2FJFA 3GM0A 5C0CA 1HE7A 1TVHB 4W4OA 3ZT7A 4QOKA 5F7DB 5SWZA 2IQ9H 3SY0B 2WUCL 2HFTA 2IH1B 2WIIB 3PHOA 2YD4A 1WVZA 3U48A 2X4OB 5I1HL 3DOSA 3GNMH 2XN9D 3ARGB 4FQIH 2P8LB 4RGMB 1MWAL 3TBSA 3UBXI 3UYRH 2W9LA 1NFKA 2BCKA 2FHCA 3V4UL 1EBPA 2FBJL 1RK1B 5CLTA 2ZCHL 4ELKB 3EYUL 3I50H 4F8TA 4JO4H 4L4TB 2X10A 4P3DA 4YHYB 2BVEA 2W0FA 2AQ2A 1PG7H 4O2FA 1F6LL 2D03H 2E7CA 1H5BC 1SHMA 3VRIA 3U9PH 4XWGL 3O45B 2BY2A 3RP1A 3IFOB 3EHBC 2HLFD 5KANG 3GHBL 3TIEB 2WQ8A 3PABB 3RGVA 3IU4H 4OI8A 5F9OH 2YPKB 5BW7A 4WGVB 3VFNB 1N3NA 1P5UA 2BVPB 5JW4N 4R90L 3LHPH 3TA3A 4Z7QF 1A3QA 3MCKB 4NM4H 1S9XB 5EBWA 3MNWA 2D7NA 1OTTC 3VDBA 4KRPC 4WFHE 5EORH 1WC7B 1U8PB 4KDVA 3I84A 3V52H 4U7SA 1ZEAH 1IE5A 5ADOH 4ORGA 4M62L 3BZ4B 1A1NA 4LIQL 1K2DB 3WJLC 3WFCL 3QQ4A 1L7IH 1GGBL 2R29L 5CJOH 2V2TB 1CDHA 5KVMC 2VDLL 3PL6D 3VE0B 2F5BH 3PWNB 5EG6C 4LVOB 5D8JL 4EI5D 3KPRB 2Z91A 3VWJB 4EVNB 2DLIA 3HPLA 3OKDA 3T4AB 1KEGL 3X12B 3QWOB 3GJFA 5KW9H 4OJFL 1PX3A 4JCLA 1J1OL 3QJHB 2YKLH 3HI5H 2VN4A 3OKNB 4YEEA 3Q6GH 2QSQA 3MLYH 4YHKL 1N5AA 2VLJE 1HNGA 5DVMA 3CFJB 5I1CL 4OKVB 4B50A 2L4OA 1UZ6E 4NQEE 1FFNB 4U6HA 1LHZA 4F80A 3FB5B 2IALA 4ONFH 4L8BA 1D9KC 4KPHH 5H35B 3TN0C 1OOAA 4O9HL 5L0QC 4GKSB 3C5ZB 5B21A 3NCJH 3DECA 5C07E 2WANA 4BJLA 1Z6JT 3UZEA 3G6AB 5JNYA 2BY1A 5CIPH 3KG5A 1PZUB 1NSNL 3O6MH 3ARDC 3I6GB 5GRZA 4ZOEA 4AMKH 4BSWA 2PW1B 3QDGB 4OLUH 1JYWA 2P5EE 1XMWA 3QO1A 4XP6H 3LAFA 1RJLB 1QRND 3H9ZA 4H8WC 1YEIH 5DLML 4ZFZA 1WQVT 1I3RA 1LP9E 4DN4H 3BYTA 4I48A 3C5SB 3IYLW 1HINH 1INEH 4JKLA 3BEVA 1BQSA 4PJ8A 1AXTH 4X98B 3QI9D 3N50A 4AENA 3JV5A 2CIIA 3DVFA 1CICA 4NZDA 5D1XC 4U7MA 3WS6C 5I1AB 2DWEB 4IBLT 2A6KB 4WFGE 3GSXB 4R4BA 5JOEA 3FO2A 2OX5A 5IROA 3FQRA 3STZB 2XWBB 1IQWL 4I0PC 4XPFL 1R0AL 4WJ5A 3K4DA 4FFVC 5FGBA 5D7JC 1PKQB 5MERA 2LAGB 3GM8A 4LVNC 1K6QL 3BVNB 4OLZL 3TZVC 1F58H 2VLKB 1A7QL 43CAB 2F58L 2ERJC 5FCUH 5GJSH 3MR9A 3HFML 4X8JA 4D9RD 2GK0B 1X5HA 3I3BA 1LEKA 1MQ8A 2OR8A 1TVBA 3Q5TA 3SDAB 5F9JA 5F7HA 1XGUB 2V17H 5J3HC 2EDXA 2HT4C 3QFJD 3RWGA 1A0QH 4KZDL 3B9KB 3L3KB 1F4XL 5F3BB 1IC7H 1CDIA 2CK0L 1XR8B 1S7QA 4KY1L 4Y1AE 4PG9A 5DZLA 4XGZB 3MA9H 3HNSH 3OXSA 2CDEB 4WO4A 2ZUVA 4HJGA 1BOGB 1ZLSL 4M1CD 1J1PH 1O0VA 3KDMB 4PJ9C 1HCVA 1YN7A 1AXSA 1ERNA 4R97C 3SGDH 5EBLB 3C6LB 3ZYIA 5E70A 2HA1A 1OWRM 5IBUB 4XAKE 3QXTA 3BP4B 2YC1A 3MV9B 2Q8BL 1WEJH 1CR9H 3IDXL 1G9MH 1FCCA 3RZWA 5LG1A 3RUGB 2X7LA 4M43L 2CUHA 4KHTL 2WWMC 4XXDB 1EFXA 3CDYA 2HJLB 3HMWL 1AH1A 2PO6C 1IC5L 3MRBB 1WBZB 5GSVB 3U7WL 1OSZB 3VFUB 4ONHB 3IFLH 3O81A 3DNKA 1BMGA 4P3CL 4G80A 3VXQB 4RISL 3MMEB 4P4RA 3H9HB 5I75B 3ETBF 1KXVC 3O2VH 4KUZH 1FRGL 4QHMB 2IGFL 4RWHA 5LWYH 3V0WL 2LE9A 2EE9A 3C8KA 1FYTB 4ZO7A 4XPGL 5FYKD 1J11A 4NC2B 4POUB 2H2PC 2A83B 4RFNC 4ERSH 3BKJH 5TQ0L 5DC0A 5F44A 3QH3B 1ZA6A 3HAEB 1JPTL 4XNMA 4U1HB 4YR6B 1ACZA 1QBAA 1GHFL 5HHVH 4MJ5B 4CGTA 2PYFA 3Q3GB 1ZANL 2XFXB 4URTB 3V6ZA 3NPSB 4L4VB 2CLZB 1D5XA 1GPOH 1SJHB 4JRYD 3T8XA 4DGIL 5DQJA 4S1DD 2AXHA 4UU9A 5K9QI 4OM0L 2VH5H 4LSVL 1NMCB 2GK2A 5HVGB 4HSQA 1F3RB 4PRHD 5EO1A 4LMQI 1IEBB 4GAGH 1T1WA 3DTXA 2WUBL 4ODXA 2BOBB 1KJ2L 1MAJA 4KI5C 4X4YA 1JGEA 1KLGA 5ICYB 5H37H 5KN5A 4HCRL 1GC1C 3KYKH 1FN4A 2ZUQB 3OV6A 1ROWA 4I1NB 1VDGA 5I6XB 5ICZB 1LE5A 4P5TD 5E94A 1ZE3C 2WZPD 1YEDB 4XP1L 1D6EA 1HH6B 1MH5A 5IMOA 5CJXA 4E42B 1N0LA 2OI9A 1MREH 1Y6MR 3MX0A 5FA4B 1RSFA 1JF6A 3PGCA 4GKNB 2P8PA 4KMTH 2EC9T 3VFTA 3GB7A 5BV7B 4NNPH 1XAUA 3LKNA 4Y5YA 5EZOH 4NZUH 1E6OH 4PJHE 3E6FA 5IB5B 1W0WB 3QHFL 3MV7B 4YLQT 4PRIA 4WI6A 3VFOB 4MVBA 2W38A 4LCWB 2PETA 3L7FB 3DIFA 1CG9A 1GCFA 1XF3B 4OSUL 5IW3A 3MGTA 4JM2C 1F11B 4Y16B 2V2WB 5CBAA 3HZVA 3SHSA 4MWFA 1YNLL 1ODAA 5CJ8A 4KAQH 3S8WA 4UTAL 1KN2H 1CF8L 2BVQA 3SGKA 4B7IA 2CK2A 3RNQA 1R3JB 4X6DA 1HSAB 4MMZC 5GRJH 3T0EB 2NY1B 3A67H 5FUZL 3P0VH 2CSPA 4MA8L 4XAWH 3VRLE 3HG1B 5JXAL 3ZDXE 1YQVL 3GJFK 4LQFL 5F89B 2FX7L 2XQYG 4TSAL 1Q9KB 5EOQH 4XP9L 5CEZL 1U8HA 3BKCL 1G6RH 3V8OA 3DV6B 4GAFB 1JN6B 3GMMB 1MFDL 2A9NH 2GSGA 1AI1L 4HS3B 2C1PB 2A73A 3BX7C 1BBDL 5AWNL 5CHNB 4HULB 3EYOA 1OQXA 4LSPL 1VB9A 4HUUA 3S3PA 3CMGA 1A6WL 1W72A 3SJVA 1J8KA 1BZ7B 4ZOBA 1T0NA 3GIZL 5KZCB 3OX8A 1DQDH 3WKNA 3VFWB 2JF1A 4NN6C 3C9NA 4W6YB 32C2B 1LDPL 5F1OB 5EIIB 2O5ZL 4MD4B 2MHAB 4JQIL 4FXKA 1ORQB 3HI6L 1IQDA 2AP2A 3K74B 4HFWB 5JLZA 1GGCH 3QA3B 4KXZH 5FYKH 4MAYD 4X7TB 4Z8FH 3DVNA 3CC5B 5MI0B 1V3LA 1ZLVK 2HT2D 4FTVB 3MRGB 1JI2A 1N4XL 3SCMA 3DMMB 1XF4B 1EK3A 3VGAB 5L7XL 3BH9B 5D7IB 4RGND 2VLRA 5HVHB 1NCAL 3CXHJ 3TFKC 4CU7A 2J88H 3WEXA 3L95A 3NFSH 2DF3A 1MELA 2BHZA 2E7LC 1S8DA 4Y19A 5LGJB 5CBEA 2C7UA 4DZ8A 2JJSC 1TZGL 2Q7YA 4Z7OE 3QEUA 4K7PL 4FG6D 4LVHB 3OJDB 4P3WA 1I1YB 4ETQB 4G43B 3RTQA 4PGZA 3KAAA 2E9IA 3PJSB 4Q74A 4WI4A 3D18B 4XNXH 3GSUB 1A4KB 3SDXF 1NJ9A 1RD6A 3VD5A 1IZKA 3PWJA 5DHVA 1DEDA 3V6FA 3T0DA 5BO1H 2X44D 1A6AB 1LQSR 2WBJD 4BH7B 4HEPG 4PJCF 1XCTB 4KQ4H 2YUWA 4XWOD 1REIA 4Z7WB 1AC0A 3D39D 4XZUA 1N64H 1FC1A 4QXTA 1VFAA 2VISB 2DYPA 3BAEH 2Y36L 2FATL 2DQJL 3DSNA 3IDMB 1OGTA 2R39A 4DWHA 4TNWF 1DUYA 4HIEA 2XZAL 1Z0MA 1B6UA 1I8IB 3MRKB 3EO9H 2IBBA 4ZAKB 1DE4A 4LL9A 1HDMA 5F7KC 1W0VB 1NFDA 2PF6A 1CXHA 4O2EA 4X0KB 5L8JB 1SBBA 2QQQA 4UINH 5TDPA 4JRWA 3BD3A 25C8L 2OTWA 1NUFA 4PJFE 4PJXE 2VXTH 2VDPL 1KPVB 4N1CA 4L5FH 4JDTH 1JV5B 5CINL 3F5WA 3LB6D 4JFEA 2CMRL 1RJCA 3GO1L 1AO7A 5CAYB 4ZO6A 4RAVA 1AFVH 1FAIL 1YYLH 1CLZH 1AQDB 5C0IB 3WDJA 2QQKL 1U58A 3RHWF 3QWQB 4L3EA 3HMXA 3KLAB 4OBSA 2GJZA 4YHLL 5T1MA 1D5MA 2FD6H 2R1YA 4M61A 4A6YB 3BW9B 4PP1D 4JZNB 1VFMA 2G5RA 1ND0B 3IETA 4F3FB 5EUKB 3T2NL 4K7FA 1LO3H 5IEKB 4YXHL 4ZXBB 2LTQC 2PR4L 4NPYA 1QD0A 4QNPE 4M5ZH 4KK6C 2F5AH 4ZYKB 5C2BH 4U1GC 4GRMA 2EKJA 5IB4B 4OAWA 1EZVX 1J0HA 1YNKH 4HWBH 5EU5B 1V8HA 4LCIH 1G7HB 1MLCA 2VE6A 1XGTA 5FF6B 4LEOA 2F53D 4L8SC 1U3HD 4HUWA 4XCCH 5E5RB 1DBBH 1I1AA 2ARJA 2K1MA 2JTDA 3UPAA 3AREA 1UC6A 4MCYB 1QOKA 4JZJC 1AIFA 4LNVA 3TF7C 1KC5L 2BMKB 1HKLH 4OFYD 5DRZB 5TGBB 4QTIL 3UBXG 1Q8MA 1RUPL 3K4ZA 3NGBC 3CD4A 4PV9B 2KZWA 3MLUL 3BXNA 3PV7A 1U41A 1CE6A 3ULUE 2J3SA 4NQDE 5E2UH 2CIKA 1KJMA 1YEGL 4N5EC 4PD4K 2LU7A 4AEEA 4MZ2A 4KK8C 4RWYL 5IESH 2JELH 3OKOB 5F7MC 1U93A 4LF3B 5BOPA 3G5VB 2IFFH 1HI6B 5B38G 1IL1A 5ID0A 3V7AE 4HPOH 5I66A 4ZPTA 4XCFL 4LRNH 4MSWB 3P4LA 5I18L 3DX8B 5EOCH 3O2DA 3SDCA 5CJ5A 1U95A 3DUHA 3DETC 4N8CH 2QSCH 1LNUA 4K3DH 1CBVH 3MRPA 5C08D 1GAFH 3BEWA 4M7ZC 3S35L 4JO1L 1KIUA 5ACMA 1M7DB 1RULL 4WDIB 3WLBB 2DTML 1TNMA 5HTSA 3SDDC 4CUCA 3ZKXC 2Q8AL 4ZQKB 5IGXL 5TPWL 3WFBL 5E8NA 3IT8D 4Q6IB 3KPSD 4L3AA 4ZOAA 2BERA 2RFXA 2HTLD 2EC9U 1T21A 3TPUB 1XIWC 3B4NA 1AP2B 3MO1A 1JZ2A 1AKJA 3MV8E 1UB5B 3U0PA 1JHLL 1X4ZA 2D7QA 3HRPA 5DJ6A 1CGXA 4RFOH 4WY7L 4YE4L 1MEXH 2SEBA 2EDHA 3H9SD 3UJTH 2P44B 5C6WH 3IDNB 4FHBD 2IPKA 3VMOA 3CVHL 3JVGA 4BSVA 2CDFA 3E6HA 3HZMA 1QLFB 5HDQH 1NCWL 4ELMB 3QIBB 4XBPA 4UNVA 3FO1A 5KOMC 4NKOB 4P2QE 1T4KA 3ARFD 3D9AL 1A1MA 1KELL 3LIZL 1DVFA 1IGYA 1MVUB 2QADD 5IB2B 3V4UH 2NX5D 2W0LA 1EXUB 1JF1A 2FBJH 5ITBL 2R1XB 4NFDA 5K59E 1QG3A 1FZOA 1LO2L 3IAPA 1UH3A 4UQ2B 4D9QE 1QVOB 4TNVK 4WW2C 3D2UB 5D96C 2A74A 4KWUA 5CEYA 4CDGC 4XWGH 4NO5A 5I74B 5IVXF 2CLVA 1IGJA 1R3LB 4Z7VE 2OZ4L 2NY4D 3GHBH 4OZ4A 4N90D 1A7NL 3PQYE 4WI2A 1UH2A 4E41B 1CIDA 3ZSTA 3L9RB 5E2WH 4H1LA 1R5VB 4OIAA 1QFOA 4LSDA 3TIDB 5DA0B 1I1FB 4R90H 4Y4HD 5HHMB 3G5XA 3HUJB 4GBXB 3ULSA 4Z77B 1Q1JL 3MUY1 4P57A 3X14B 2AVGA 3J7HA 3ESVF 1I9JH 1T04A 3RJDA 4HWZA 3DXAE 2Y06L 3VWKC 4X99A 2OL3L 3NFNB 5I73C 1NC2B 5IW6A 3QDJE 4NWUL 3E0GA 4R0LC 4AL8L 1FO0B 2CH8A 1JTTA 4NQCD 4LIQH 3WFCH 4EOWL 1IC4H 2GEEA 1MUJB 1SJVA 1ZHNB 2R29H 2VLJA 4LLDA 3S37L 1RHHA 3IDIB 4YDKL 5LVEA 4XHJC 2VDLH 1PDKA 4NKDB 2CD0A 2HVKB 5T1LA 4PLJC 4NQEA 5DJXB 2GAZA 1UCBH 4S0SD 4FQXA 2CUIA 2FYYB 3BZFA 5D8JH 5DMKA 3FRUB 4OF6A 4ODVL 1SEQL 2IADB 4FA8A 1NKOA 2Z31B 1JYXA 2FZ3A 5F70A 4V3EB 3UTSE 4OJFH 1J1OH 2DI8A 2VQUA 1JJUA 5BS0D 1BPVA 1EAPB 5C07A 5TF0A 1FAKT 1UZ8B 4DW2L 4C56B 5EFIA 4YHKH 2KKQA 2CRIA 3O6FC 3LEXB 3QIUD 3CFCL 4F7PA 1A1OB 4LHUA 3QIWC 3MZTA 1UGNA 3CH1A 5I1CH 3NA4A 3WV0A 1GYAA 5D5ME 1WISA 1DQQA 1LE9A 6CGTA 1QA9A 5JW3L 3ZE1E 5HGBB 1JZ7A 2HJKA 1NEZG 4XCNA 3GJEB 3U4EB 4XBEL 2AJ3A 2GTWB 4O9HH 1LP9A 3L7EA 1RMFL 4X6CE 1OCWL 1OGAD 4ORZC 3LRHA 1P7QD 3RIFK 4KI5E 5FIEA 2GFBA 1OD9A 1UWEH 1I8KA 1MCPL 3FZUC 3QUXD 2XXCB 4GRWB 3NCYP 1PFCA 1YY9D 3WFDL 3VI4E 5D1ZB 4NKIL 3LS4L 3L3IB 4YXLL 3U36B 4IS6B 1OAYH 3JV6A 4XHQA 5DI8A 3VXSE 2DJSA 4JFHE 1FFOB 3MBEB 3QWRA 4PJIE 4WI7A 2AW2A 3SO5A 4PB9L 1M7XA 2D7MA 2ITCB 3MC0A 3BGMA 2M1KA 4HUVB 2BNQD 1YJDL 1XGPB 5JMOC 4HIJA 3ZDZE 4B41A 1JWSB 4LCCA 2DMCA 1OL0A 1JYVA 4U1SB 5JHDD 1IQWH 1JUFA 4XPFH 1R0AH 4P46B 5IBTL 4KVCL 6FABL 2Y4SA 1CGUA 4K3JH 4Y1AA 1JRHI 2VUYA 1QUNA 4OLZH 2ICWB 1E28A 1A7QH 2GTZA 1CDBA 3P4NA 2F58H 2FR4A 1MRCH 3HFMH 5TE6H 3OAZK 1ZS8A 2CKBA 1ITBB 3RWCB 4AIXA 3BH8B 1RZFH 4TTDD 4HK3J 4N0UB 4RX4A 2XXMB 2AJSH 4GMTL 4I18B 1JZ4A 3T09A 3SGEH 4KZDH 4OI7A 4JFQB 5DJ2A 3S34L 5GGSB 1F4XH 3BT2L 1R3KA 3TVMA 2CK0H 5F3HB 3QQ3B 5D7LD 5DQ9A 2PNDA 3OL2A 4KY1H 4RGNB 5ESQA 4AG4L 1KFAL 2X4UA 3UTOA 5K9QG 3RPIB 4Y2DA 1FBIL 4WV1B 1I7ZB 4W4NA 5DJCA 1RZGB 3TO4C 4R2GD 1ZVSB 1G9MC 4GKZB 1TDQA 4TUJA 3THML 1KG0A 1UVQB 2BDNL 1YMMD 5DQDH 4I0KA 3WN5C 3WSQL 1HZHL 5CEZD 1IGTA 4CU8A 1KB5B 3IDXH 4TVPE 3CFDB 4U6XA 5F9AC 3N0PB 4Q9CA 4M43H 1K4CA 3PL6C 3T4YB 3KS0H 1TIUA 4QEGA 3H7BB 3V4VH 4KHTH 5DFTA 2Y23A 4EI5C 1B88A 4NOBA 2ITDA 4Z5RB 1IC5H 3TBWB 2XRAL 1F6AA 3U7WH 5CEXA 3MRQA 2WBJB 2HN7A 4N8VB 2IAMC 4DZBA 1SEBA 2OJZH 2DQFA 2DLHA 1BREA 4RISH 5J9PA 2DQCH 2GSIB 1GRWA 1FRGH 3D39B 3KNBA 2IGFH 3V0WH 1J5OH 1KTKE 5FYLL 3TJHD 3LKPA 1JNNL 4PJBB 4XPGH 4M7KH 5HYJD 4KHXH 1KCGC 5JZ7C 3EZ8A 4R7DA 5FM5M 5TQ0H 3V5HB 2DWDA 1AHWC 4I0CC 5HHNB 2HT3D 4WWKB 1EH9A 1NAMH 2APWA 4NRYA 3VA2C 1WBXA 5H2BA 3K3QA 5DHYA 2RBLA 2NLJB 4I77L 1Q9WA 1FG9C 5IT2L 2NR6D 1JGLL 1CGTA 5CP3H 3LKQB 3PGFL 5IG7A 5ID1A 1HHHB 2J5LB 3QXAA 3O4LD 4NKMA 1WCBB 4J1UB 2PXYD 5DMJB 3KPRE 1PYWB 1OF2B 2ZOKA 3D85A 3RJQB 3PG2A 3TT1L 5SWSD 2P7TA 4RRPA 1MI5B 2D4DA 2VABA 4LSVH 5C0CB 2XICA 2ZSVA 2EDDA 1IM9D 1KIPB 1KT2A 4QOKB 5MP6L 3U0TA 5SWZB 3PHOB 5HYSA 3MXWL 1KJ2H 3KXFE 5GHWL 4S2SA 1OY3B 3P2TA 1YZZA 4O51B 5JIHA 3GI9L 4PJHA 5D1QD 2VSDA 3TBSB 3MOQA 3ZMRA 2BCKB 3MLWL 3S4SA 2RAMA 5EO0A 1E6JL 3RVXD 4HWNA 4IRJA 1DEEA 4XP1H 2B4CH 1E4JA 1I4FA 4QHKJ 2Z8SA 4PUBH 4AQOA 3ARZA 2OJEB 4LLWB 4G6ML 1YC7A 4F7MA 2K3TA 1DSFL 4Y4KC 3UTPD 5JA9A 3SKUD 1A64A 2IMMA 1KLUB 3NPZB 1R3IL 3QHFH 4JR9L 3UO1L 1I3GL 3HE7D 4IIQB 1U3HB 3BN9D 1CXKA 3N1FC 2C1OB 5HJ3B 3FRPG 3O3AB 5KJRL 1N3NB 1Y18A 5DO2C 4AH2B 4OSUH 4BQCA 3LH2L 4MQXD 1A6PA 1ZAGA 4TUKH 4NQXB 2VN7A 4M1CC 3EW3B 1S7WB 3ARSA 5D2LF 1YNLH 1L0XA 3AS0A 1X5AA 4OCSL 1FG2A 1J86A 3LN5B 1D7FA 2XTJE 2OXHA 1E4XH 5KSAA 4PB0H 4UTAH 3DI3B 1CF8H 1P84J 4Y5VA 1WWCA 2GHWB 3SGJA 3BISA 5DC4B 3JTCA 1A1NB 5HHOD 5FUZH 3D0VA 4HXAL 3QQ4B 1OWWA 1MFAL 1PKQE 3OAUH 3MRMA 1FCGA 1YQVH 4LQFH 5CKAA 1D5ZA 2AQ1A 2FX7H 3QQ9D 4R8WL 1L9NA 4TSAH 2FX9L 3TNMA 4XP9H 5CEZH 1CGSL 3BKCH 3B3IA 1MHCB 5EA0L 3ZYJA 2VRAA 4HF5L 1T89A 4CMHB 4D0DA 5AYQA 1MFDH 3GJFB 4ZUWA 1PVHA 4UAOB 4PREA 3C60A 4UDUA 4M48L 2O5XL 5AWNH 2YD3A 5ETUB 4LLQA 1N0XH 1DQTA 5FGRA 3HC0B 1N5AB 2VOTA 3PWLA 4FRWA 2CO6B 1I8LA 3LN4B 5EZIL 5JORA 3GIZH 1U8LA 2E7BA 5EOTB 1ZHKA 2H32H 2OXGA 3BDYH 1ZT4B 4U6HB 4A2LA 4HAGA 5IBLD 1LDPH 1DN0B 3VD7A 1VACB 2X4SB 4FOMA 1S3KH 2DICA 4G8IA 4L8BB 3RWJB 4YFLI 2X4QA 4NJAL 3HI6H 2G5BA 2XWJB 3UDWA 5EC1B 3HRZB 1FNHA 3TJEL 4W68A 3WFZA 2A9ML 1FL6A 1N4XH 3RUGE 2UZYB 4LSRL 5L7XH 3KPPA 1N8ZA 3O8XD 1MCLA 3NACH 4BSWB 2Y7QB 5FUOL 3ZKND 5T5FH 3HN3A 3AS2A 1VFBA 4S1DC 3SKJL 3K8KA 1DR9A 3QO1B 2OTPA 1ZLWK 2YPLD 3OKKA 4PRAA 2JJWA 5IWLA 4M8QB 4ZTPH 1DZBA 3BKML 4ZFZB 4PP2B 1T80A 2HRPL 1I3RB 5IJKA 5K33A 2JJTA 4K7PH 4GLRI 3INUH 3T3PF 5D6CA 4RSVA 3H9YA 4ZUVA 5AZEL 1PY4A 4AENB 2QSVA 3QFDA 2ICEB 1MCWW 1ZT7B 4J4PC 1TMCB 1QSZA 4F2MA 5DDHA 2NXZB 1FFPA 3CFKA 4P5TC 2FCBA 1H3GA 3B43A 2CGRH 4X4ME 3VXTB 4APQD 3MLTA 1UWGH 4P4KB 3TEUA 4NHCH 4WJ5B 1GH7A 1I9RL 3H42L 3CXHK 1NGZA 5FO8A 3OJ2C 3A6BH 4BKLB 4GRLA 2P24A 3GMNA 1RUAH 4P0DA 1S7SA 4LP5A 1B0RA 4LSQH 1GGIL 5J6GB 2Q86A 4X8JB 3T77A 4PJFA 5C0GA 4AYFA 4ZFGL 5K9JL 3PHSA 4PJXA 4MXWL 2QQLH 2Q6WA 5E2VL 4LSUL 5I1IL 3VXUD 2EDYA 2Y36H 2VDKH 2DQJH 2WLZA 3D3VD 3O3EA 4U1JA 4YQXL 5FUCE 3RWGB 2VDNH 3QO0A 1JFMA 2PN5A 3SE8L 3I2CL 4OCXL 2BVYA 1LGVA 1LVEA 3JWNC 5TF1L 3OXSB 4OLVH 2Q1EA 1HSBB 4HC1H 1QO3A 25C8H 3P0GB 3GSOB 1W2KT 2XWTA 1YN7B 1B2WL 5KBNC 5JIPA 4MJID 4EUPA 4D8PA 4PRPB 5CINH 2YC1B 4LNRA 4XNYL 5E4EB 4IOSD 1SJXA 4NQVA 4POYA 3GO1H 2ADGA 3E3QC 1EJOL 1FL3A 4KTEL 3VXRD 2VLLA 1WV7T 1VADB 3ERYA 4IMKC 1NGPL 1BQUA 4EDWL 2F54D 3FN3A 1MCIA 2QQKH 1EFXB 2UUDK 4YHLH 2G60L 1GGTA 5CZXC 3CAFA 3MV7E 3CFEB 1FPTL 3OTTA 3MJ9A 3T2NH 4LCWE 4QHNA 2DI7A 4P4RB 4L1DA 4MJ4A 1JWUA 4YXHH 1YQ2A 2FX8L 1KCUL 3A6OA 4P2YA 5JPNA 2EDJA 4GXUN 5EWIL 3X3GL 3PDDA 1MIML 3QDHA 1OGAB 3I3EA 3BPLB 3W9EA 4J12A 5IHUL 1ZA6B 4XNMB 4M7LH 1CFVL 4X6DF 4NQDA 5C0DA 1QBML 5FO7A 1INQA 1J12A 4X4ZA 5IHLB 3BWAA 2E6QA 1JYNA 3UPCA 3KLDA 3ILQD 2PYFB 3IU3B 2QKIA 4JGJA 4OTXH 2VWEC 1D5XB 4G6AD 4JFZL 3REWA 3SO3C 3GRWA 1KC5H 4OZFA 2VYRE 1HYSC 2WP3T 4QTIH 1N7ML 4WTXA 4UU9B 4HD9A 1RQ5A 2DLFL 2EICA 1FZMB 3P30L 2B5IB 5SX4H 1WWBX 5ISZD 4OQ1A 3MLUH 3FJTA 2ICES 4BQBA 1OLZA 3S5LB 4E5XA 1MJ8L 4Z7NE 1WAAE 1YEGH 4FG6C 3DTXB 4RWYH 4ODXB 4LRIA 3DX9B 4J3SA 5FB8A 4TNVF 1PY9A 5J1AA 4NRZA 1KLGB 3UCRA 5KTEH 5I1EL 43C9A 5KN5B 3E2HA 3JWDL 2LU3A 1FN4B 4WNQA 4XCFH 5I18H 3MV8A 1LE5B 2EXYD 5MEND 4X9BA 5JXEA 2R4SL 2VZ1A 4O4YL 5IR1A 3MRRB 5D1XA 1U8KA 1D6EB 1MH5B 5IMOB 3DUUA 4JO1H 2DTMH 1RFDH 2Q8AH 2IEPA 3QHZL 1NLBL 1ZXQA 4MCZA 5TPWH 2P8PB 3WFBH 4FZEH 4XWOC 1FSKC 4X9HA 3GB7B 4J3XA 5EIQA 5D7IE 5F88A 1X5LA 3NIGE 2R2EA 4MQ7A 1W0YT 3OAYH 1YEHH 5HDBF 1G84A 3JZ7A 4P2QA 4IHOA 1JHLH 1AD0B 3TBVA 2XN9E 2BZDA 4WY7H 1BFOA 1NCCL 2WV3A 1G6VK 4IRSC 3SQOL 3WD5L 3MGTB 5GS0D 5FOBB 4H26B 2DBJA 4GOSA 3LZFL 3ARTA 3HZVB 4NM8L 1MLBA 2RIKA 3CVHH 5GS1C 5D71L 3HE6B 4G8EB 1FIGL 4GAJL 3EFFB 2FEDC 2APFA 1NCWH 3U83A 4X6DB 4TRPL 2PW2B 4ODSL 3RDTA 4Z7VA 3DHJA 3I6KA 5F7FA 5BZDB 5E6YA 4PJ5D 1TQCB 1KELH 3LIZH 3PQYA 4KDWA 2OYPA 1F3JA 2NXYD 1LDSA 2Z92A 1OP3K 4LGPB 2NY7L 1U8HB 3FQXB 4Z7WE 2W92A 3Q2CA 4MXQD 2DL2A 4F57H 5M7QA 4N0CA 2GSGB 1C8PA 1U3JA 2PCPA 1XGRA 4ZDHB 3LD8C 4HWUA 3DXAA 4RGMC 1UM4L 3QDJA 2OZ4H 1YY8A 4GW4B 1QNZL 5HD8C 4P49A 3MRDA 3BIKA 5JPMA 1A7NH 3OX8B 5DEFB 3RIFF 5B8CC 3AY4C 1TJIH 3C9NB 4PJGE 4LHQB 2KDGA 3W0WD 4YIQB 3KLHD 1BVZA 3O3BA 4RDQF 5JOFA 3CUPA 1Q1JH 4XVSH 3O2WL 1BFSA 3WE6A 1C16B 3SDYH 3VRJA 1N2RA 4XPAL 3DVNB 2AXGA 2Y06H 2OL3H 3UTSA 3BQUA 4D0CA 2QQNL 4NWUH 3LEYL 1CIUA 1Q9OA 1KPUA 5CGTA 4AT6A 1KCRH 3KYOB 1W72L 3AB0C 3BO8B 4QRSB 4B0MM 4MD5A 3RWHB 1V5JA 1P1ZA 3S37H 4YEFA 1H3PH 4YDKH 3QUZC 4Y19B 5CBEB 5IV2A 2C7UB 5D5MA 4JPVL 4YHML 3WDIA 3QBTB 1VEMA 4IOIA 4OT1L 4P23A 3RZCB 4FFWD 3EDKA 1YDPB 3RTQB 3MRNB 3UPRA 4X6CA 3O11A 2ZZUT 4NO2B 2EXWC 4NO0A 3BP5A 2O5YL 1QRKA 2XG5A 5LBSL 2O61A 4DW2H 3B2UD 4GSDL 2CQVA 4QXUH 1NMBL 3WNOA 3OJVC 2YD5A 5E00A 3CFCH 3EOYG 4PG2C 3PWJB 4IOFC 1A4JA 4NNYA 5C0JA 1AC6A 4LVOC 4U31A 3B2VL 3LEVL 1JF5A 2ED7A 4BYHA 1EVTC 1N5YL 2X70A 5JW3H 1ZHBB 3EKCA 5I0ZA 1Z2KA 2VERN 4KK9C 4XBEH 4AIOA 1FFRA 1OAXL 2FJHA 4XZUB 4PJIA 1OCWH 2DYPB 2EZ0D 2YWYA 3NH7H 3CX5J 4P2OD 3BRFA 1MCPH 4JKWA 1DE4B 3DURA 3WFDH 1S9YB 1YEJL 4ODWA 4NKIH 5A16A 1MCBA 1HDMB 2VAAA 4H5SA 4J3WA 3UC0L 1NFDB 5A3IC 3VFPA 1ZLUK 2W1NA 4CVXB 5FK9A 1NMAL 5MEQB 3ARQA 5GGSY 2OTWB 2DBLL 3BMWA 5IJVB 3A6CL 4HGWA 1KCVL 3RAJL 1WLHA 5GS0H 4PB9H 5CKGA 4D9RE 2EEDA 3MUHL 3ARFC 3F5WB 4JFEB 4EN3D 1YJDH 1AO7B 2MWCA 3VFMA 3QXWA 1V3MA 4RAVB 2PYED 4P9MH 4YC2C 2QADC 1AGCB 2H3NB 1T22B 1FNAA 3DV4A 5IBTH 4KVCH 1MJUL 1U58B 3GSQA 4L3EB 2EEAA 3G9VA 4ONGH 6FABH 2GJZB 5T1MB 3EO1A 3TPUE 1NH6A 1D5MB 1OPGL 5F7DA 3UMTA 3OKMB 1KN4L 1JK8B 4K55A 3SGDI 3SY0A 2R1YB 2IH1A 3N85L 4NQSB 2AKRA 2X4OA 4EQ3A 3IETB 1P53A 4PJDE 1A02N 1A9BB 5J6HB 3ARGA 4K7FB 2VXVL 1RI8A 5FM5O 2NY4C 2P8LA 4KVNL 3B5GA 2J8HA 4EI6A 4I3RL 1RK1A 4KJQD 3QNYB 3RY6A 1NGQH 3NCFB 3CVIL 4GMTH 5E5UB 4MNQA 1KYOJ 1BQLL 3QNXA 3UZQA 4OD1L 4OAWB 2D31A 4Y4HC 5F7EL 2NY2B 3KPOB 2RHEA 2P47B 3ZSSA 4AG4H 2CJUL 3L5WA 5CS7A 2JE8A 1FBIH 1MLCB 3HMXL 4ELME 4LEOB 2IPTH 3WFEL 4X5LA 3O9WA 3KYMB 3ZTJG 5CP7B 3B9VA 2ARJB 3SDAC 4XX1E 3RGVD 2R0LH 3QUYB 3AREB 3THMH 2BDNH 4NUGL 1HZHH 2MQ0A 4JQXA 2R0KL 1Y6NR 2BVPA 2COQA 2M8XA 3TA3D 2AK4D 3MCKA 2X9WA 1S9XA 3BXNB 4H88H 1YA5A 3TFKA 4TQEL 1WC7A 1U8PA 2CIKB 1KJMB 5I1GL 3LV3B 3C6LC 1NDMB 1MCQA 4DCQB 5C71A 1MPAH 5ID0B 1K2DA 1H15A 5I66B 2IWGA 5C3TA 4RDQG 2GJ6B 3LPGA 3MRJA 4U49A 2V2TA 2R23A 1U95B 1TVDA 3QIUC 3SE4C 1UACH 4X7FC 1LNUB 4OFPA 3M17B 4BZ1L 3BOVA 2IPUK 3HUJE 3IJHB 4DOHB 3BEWB 3BPOB 1NANH 5FYLH 3KPRA 2P8MA 4JRYE 3M8OL 2HJFA 4O5LL 3CH8A 4XNZC 3VWJA 3CU7A 1T7XA 3I9GL 1HOCB 3QWOA 2VDQL 4JJ5B 4D0BB 5HYQB 4AK1A 1DUZB 3QJHA 3BRDA 4Z78B 3CLEL 4XNUH 3TP4A 2A38A 3OKNA 1T21B 4I77H 1A47A 4Q0XL 5IT2H 3MO1B 4HLJA 1AKJB 1JGLH 4KU1A 2NY3D 1RZJL 4U05A 5FKPB 4NUJB 3KXFA 1DCLA 3CFJA 4PGEA 3PGFH 4OKVA 1UZ6F 5HHXL 5DJ6B 3O2DL 1FFNA 2SEBB 4MJIB 3R0MA 5ALCH 3FFDA 2FIKB 2YZ8A 1IAIL 5H35A 2IPKB 3C5ZA 4WTWA 3IXTA 4JFDB 2DM3A 4BSVB 1X5KA 3G6AA 5MP6H 4JHAL 3RVWD 3ALXA 3K7UA 1CL7I 3E6HB 4XBPB 3EOBA 3MXWH 5EU7E 3KGRA 3FO1B 3I6GA 3F6LA 2B4CC 5GHWH 2K7PA 5I8CB 2VO5A 4DUWA 3GI9H 2PW1A 4MNHB 2Z0BA 4BUGA 3HZYA 1IGYB 5E5MB 4R4ND 4KMLB 5CLWA 1JF1B 4X9FA 4J8RA 5GGVY 1RJLA 5DUMH 1G0YR 3LMJL 1LP9F 1HKFA 2YD6A 3IF1A 1KSRA 1NC4B 2A74B 1CXEA 4X98A 2WSKA 3FQNA 2BP3A 1CICD 2KL6A 2ZUQC 4KKAD 1IGJB 3BI9X 3SE3A 2DWEA 3RWIB 2E3VA 4GRWE 5I6XC 5JW4Q 4TTDC 1CWVA 4PRBA 4ODHH 3UO1H 1I3GH 4WI5A 1PKQA 5IM7A 1M1SA 2XZQH 1HHGB 5KJRH 3BVNA 1JBJA 3LH2H 5J13C 4UIKL 43CAA 2D7OA 1JGUH 5DR5H 3F7YB 3C08L 5DWUL 4OCSH 1HWHB 4X99B 1E4KC 1P2CB 1NLDH 4MLIA 1NUDA 1XGUA 4L8SA 3B9KA 4YXKH 1DBAL 3L3KA 1G9NL 4XXCA 5F3BA 4HXAH 1MFAH 4MB4A 1ED3A 2AV1A 1XR8A 1RHHB 4WO4D 1ACYL 2CDEA 1OTTD 4R8WH 5T1LB 1BOGA 3QRGL 1K85A 2FX9H 4KXZI 4UILH 5DMKB 1CGSH 2HRLA 1A7PH 3DUSB 5EA0H 3QG7H 4HF5H 2FZ3B 5EBLA 4M9OA 2P48B 3HC3L 2YEZA 3T0EC 2NY1C 4YO0A 4GMSL 5D7SL 5C07B 2HLAA 5F8RC 1RZIA 4IJ3B 3RUGA 4F7CB 2JKXA 1P84K 3AGVA 3PWPD 2DM4A 4XMKH 4CKVX 1HXYA 3GHEL 4RGNE 5EZIH 3RIAK 3P73A 1KGCD 3CH1B 2W91A 2VWEE 2YA0A 3TJHC 3FONA 2HJLA 1ZOXA 3EIFA 5IMKB 3PP3K 4R7NB 4LPXA 3MRBA 3MRFA 1WBZA 5GSVA 4KRMB 4JGMA 5FDYA 4XCNB 1LP9B 1RIUL 3VXQA 4N1HB 5A2KH 1EEYA 3TJEH 1S9VB 1KTDB 3DWTA 4MNGB 5EULV 4I4WB 4WU5B 2HFFA 5L9DL 4QYOB 4LSRH 3H6JA 1I8KB 2A77L 4FQPA 1UEMA 2X1XR 5B3JE 1NFIA 4KH2A 5DD3L 4X4MA 1ETZA 2A83A 4Y89A 4XTRC 1HN1A 5BZWB 1HNFA 3HAEA 3W5MA 3TN0D 3BGFC 3AU1B 4WI9A 4U1HA 4YR6A 4OUUA 4H1LG 4OZHB 3BKMH 1IC1A 1JMZA 2HRPH 1T2JA 5F6HJ 4GW1B 5CD3A 5L88L 5FYJD 4C83B 3Q3GA 2XFXA 1OSPL 5AZEH 5C0RL 3ARDD 4POZD 3D39E 4OF7A 4S1QL 3L5JA 4HIJB 1SJHA 1YUHB 2BSED 4PR5B 4LCCB 4PJBE 1QKZL 1LK3L 5AG8A 1JUFB 3RVXC 3H42H 5T3ZE 3UAJC 1S9WB 1SBSL 4Y1AB 4LVHC 5E8OA 1IEBA 4Q9QL 4LK4A 1CGYA 3I85A 3TBTB 2EO1A 1GGIH 4KTDL 3CX2A 5GGRB 4ZFGH 2V5RA 4MXWH 3G5YB 5E2VH 4LSUH 4JCMA 5ICZA 1CVRA 5GGQL 5I1IH 3O4OB 2W65B 4YQXH 3MPCA 1HH6A 3BN9C 4YHPB 4MB5A 1MI5E 3ULVE 2ZG2A 5C0CE 1R3KB 1F13A 3TZVD 3WO4B 2C3XA 3SE8H 4MQXC 5ESQB 4LHUG 1ZHLB 1HYRC 1EBAA 4Y2DB 5J89A 4UUJA 2ZKHL 4XPTH 5GZOC 1NQBA 1TETH 1Y6KR 5JMRA 4PJHF 5ADPH 1FHGA 4DUVA 3VD9A 5IB5A 1B2WH 2B39A 4TUJB 3MV7A 4PRID 4EEEA 1LO0L 5J3HD 2CKBL 2HT4D 2DQGH 4LCWA 3L7FA 1CDUA 4ZAKC 1IRAY 4XNYH 3CSGA 1EJOH 4U6XB 5HHPB 4QF1B 3TC9A 5KVGH 4BUHA 2HWZH 3WHXA 1G7JA 4ENED 1F11A 1NGPH 4Y16A 1HILA 3NVQA 3T2PA 4JN2A 2V2WA 4EDWH 1QFWI 5EO9B 2BFVL 2A6JA 5E1HB 1F90L 4PJ9D 4LPCA 2G60H 2ITDB 4YPJA 1F6AB 1TNNA 1R3JA 1HSAA 2HN7B 4JKKA 4DZBB 1FPTH 2R15A 2DQFB 2I5YL 4PJAF 3VRLF 3UP1A 1EZVY 2ENSA 3VJ6B 5J9PB 3MLSH 3ZDXF 1MRDL 5F8QC 2EIZB 5DD1H 2FX8H 1KCUH 5F89A 3JTSA 4RFEA 1SJEB 2WWMD 4L9LB 4GAYB 5EWIH 5IQ7H 1KTLA 1AGFB 1MIMH 3LKPB 5FDWB 2PO6D 2V5MA 3DV6A 5IBLC 3GK8H 1OAUL 1JN6A 2DLEA 1QSED 4MXVE 4R7DB 5TDNB 5DJZA 2DWDB 1XGYH 5E6IC 4EXPX 3L3HB 1UEYA 3TH2T 4NRYB 1WBXB 2KH2B 5H2BB 5DHYB 4GG8B 1QBMH 4P9HH 2D2OA 8FABB 1WAAA 1WFTA 4ZXBC 3O6LL 4PBVC 1JZ6A 3PIQA 3ZHDA 1BZ7A 2G2RB 3KLSA 3UZVB 1R3HA 2C4XA 2ILLA 5C2UB 3KWWA 5EIIA 2H2PD 2ZOKB 4WWID 3O0RL 3VGFA 2DLFH 3H0TA 2P7TB 1CLCA 5C08E 1EO8L 2VABB 1ORQA 1BD2B 1YN6A 3S36H 3QA3A 4QRRD 5DVNA 2CLRA 3V5KB 2X1PA 4X7TA 1FZKA 1KT2B 4Q2ZB 4OIIH 5T1KD 1T2XA 3SCMD 3MRGA 1UM5L 4PV8B 3KPSE 2BSSA 5HYSB 3DMMA 2VLRD 5D7IA 4GFTB 4HK0B 1F2XK 3S98A 3JWDH 4S2SB 4PJHB 5HSFA 4OCLC 2VC2L 4APQC 3GZKA 2A2QT 2R4SH 4O4YH 4ZPVB 1RIHL 4FQQA 4IRJB 2XN9A 1DEEB 5D72L 1B0WA 1F3DH 2Z9TA 4IDJL 3DRQA 4Z7OF 5C7XL 2J12B 1VFUA 1X44A 3QHZH 1NLBH 1NL0L 4F7MB 1RAMA 1I1YA 4G43A 5JW4R 2OSLB 4UT9L 3NA9L 3PJSA 2QBWA 2VZOA 3D18A 3GSUA 5FYJU 1A4KA 4R26L 4G6FD 4WFED 1IKNC 1N6UA 3MCLL 3CK0L 1A6AA 1XCTA 1NBQA 2WIMA 4WTZG 1CXLA 1NCCH 2NX5E 3SQOH 3WD5H 2Y6SD 2DQUH 3W11C 3OMZA 2V7HB 2B8OT 4KUCF 4Z7WA 4QO1A 3LZFH 4UV4L 1T7VA 3WLWC 1FG2B 3P4MB 2VISA 5D71H 1U36A 4DGYL 5KSAB 3NOIA 4P5KB 4Y5VB 3MRKA 1I8IA 4K7PY 4JLRA 2YUZA 3VW3L 4HX1A 4OQTH 2W07A 1RUQL 3FFCD 3MRMB 1UJ3B 1W0VA 4HG4J 4LKXA 3GUTB 3ET9F 4KROD 4JM2D 4PJGA 3U79A 5JR1L 3TNMB 1BGXL 2HKHH 1I85C 2NY7H 4PJFF 4ZFOB 4PJXF 5CJBA 3SE9H 5C0ND 1K3ZA 1UA6H 3IDUA 5DUBB 4PREB 1NBVL 3EYQD 2XG4A 5LXGL 1J18A 4LLQB 3U9UA 4MA1B 1UM4H 2I9TB 1BVLB 3PWLB 5JORB 1AQDA 5I9QB 5C0IA 1XF1A 2HVJB 4NQCE 3QUMB 1ZHKB 4LGSB 3KLAA 2BSTA 5I1LA 3ZKSD 3S4SG 4XP4L 4A6YA 3BW9A 2V7NB 4G8IB 2D4FA 2FJGA 2H45A 3O2WH 1ND0A 4JZNA 5J11B 2X4QB 2G5BB 4PRPE 3D5OF 2VR4A 4NSKA 4EKXA 5IEKA 4XPAH 4K2UL 3MBXL 3X17A 1FL6B 4QNPF 4ALAL 1ZMYA 3ALPA 2DQIL 3LEYH 1FNSL 4JHZA 5FO9A 5BS0E 3NZHL 5AD0B 4G6AC 1W72H 5DZOA 3ROLA 2HG5A 5C09D 1PG7X 1VFBB 5INDB 3FB8A 5C0BD 1QSFB 3HTLX 4ZNEE 3OKKB 4PRAB 1MHEB 1G7HA 1G1YA 2H41A 4JRXD 2UVEA 4JN1H 1CK0L 2DJ4A 1I1AD 1WT5C 5FHBL 2VLMD 4OT1H 3RI5F 3WIIL 5D6CB 3WIHH 4K23L 4ZUVB 3L3OA 3QQNA 4BA8A 3MV01 5BCAA 2BMKA 3L3DA 1A7OH 2O5YH 5LBSH 1AXIB 4FNLL 5FCSH 4F2MB 1OGAE 5DDHB 3CFKB 4NGHL 3QI9A 2AGJL 4J7RA 2EDNA 4PV9A 1HK6A 3ULUF 2Q3AA 4L1HA 1NGZB 4Y88A 3B2VH 3LEVH 4GRLB 2Z31C 2CRZA 3P40A 5CMAA 1N5YH 1NGYA 2VDOL 5JTWA 3OKOA 4LSSL 3BSZL 4LF3A 3D69B 3ZKQD 7CGTA 3PV6B 1T83C 4Y4FD 1EUTA 1HI6A 3T77B 4DAGL 5C0GB 2HKFL 1DFBL 4KZEL 2Q6WB 5IVOA 4FXGB 5BJTA 2CDGA 3SDCD 4MSWA 1H5BB 3DX8A 4O2CB 5TFSL 3VXMD 4OF8A 1M7DA 4WDIA 3OGOE 5IK3B 3VMPA 1YEJH 2XZCL 5JHDE 4BFBD 5GGTH 3QFJA 5DHVH 3REVA 4Q6IA 3T0VA 3UC0H 3ZYZA 4JE4B 3HNVH 1ADQA 1NGXA 1F6FB 1DLFL 3TPUA 1YJDC 3ZTJH 2HMID 5LGHL 4S11A 3A6CH 1KCVH 1UB5A 3RAJH 4WEBH 4EUPB 4NN5C 2IH3B 4D8PB 4KRPB 1Z9SA 4PJDA 2NMSA 3SGEI 1TJGL 4LNRB 5SWQA 4UBDC 5D1ZC 3W2DH 2ADGB 2M2DA 1EHAA 1FL3B 4F9LA 2VLLB 4TULL 2N4IA 2X4RA 2NXYC 3WNPA 3CX5K 3VFSB 1G0DA 1RUML 2ORBL 4KDTA 4YDLB 4Z76B 3PWPB 3N9GH 5D7LE 2EDLA 1KN4H 1NCTA 3ZE0E 1QLFA 3QULA 4MXQC 4F15C 3TGXA 4ELMA 3E1F1 3QIBA 4NO3B 3N85H 1I8MB 3K81A 4WUKL 3UTZA 3RWFB 1DVFD 2VXVH 1JWUB 1KPRA 1PG7W 3AM8A 2F15A 3OR7B 1KLFA 4HV8B 1EXUA 5K59F 5JPNB 2J6EA 2R1XA 4OLXL 4LHJB 4OGYH 2CR3A 3QXUA 3WHE0 1BQLH 3KLHC 4MAUL 1C5CL 3F62A 2N7AA 3W9EB 4HIIA 1X6NA 3T08A 1JTPA 3LVEA 1JHKH 3D2UA 3GMPB 3UTTD 5IQ9A 4WFHD 2CRMA 3HMXH 3QZWB 5C0DB 5FO7B 1JI1A 4Z7VF 3WFEH 3WUWA 3F7VA 3GKWH 4FQ1L 1EMTL 4CADA 5F1NA 1D9KB 5F6IB 1TENA 5L0QB 4PTTA 3MJ9L 4OM1H 2YD9A 4NUGH 3L9RA 1KXTB 3REWB 4OZFB 3TIDA 5DUPL 1NCDL 2DKUA 1JPSL 5KSUB 3HUJA 4GBXA 4WV1C 1P4LB 4Z77A 4RNRA 1KYOK 3ABZA 4JRYA 4TQEH 4G8GD 3U7AA 4E5XB 3G6DL 3LSOA 1XFPA 5I1GH 3NFNA 2ESVB 1NC2A 1UJTA 3ULUL 5FB8B 2W59A 1BZQK 1GGYA 1C1EL 3X13B 3TM6A 3OB0H 1FO0A 3EO0A 43C9B 5ACLA 4XVTL 3V6OC 3HHRB 2VLJD 1C7SA 3B2UC 5B4MD 3EJJX 1JHTA 2XPGB 3ARBD 3IDIA 1MAKA 2JJVA 4NKDA 5IR1B 5D1XB 4NQED 4BZ1H 1QTYT 3GRWL 4F9PA 5DJXA 2FLRT 3RVUD 4JGUA 3O4LE 3FRUA 2IADA 3M8OH 4I0PB 4O5LH 2MMXA 4U1LA 4MCZB 3KS0J 5SWSE 5C92A 4X4XA 5D7JB 1A6ZB 3GFUA 4LKCB 5DD6B 4LVNB 4JG1L 5F88B 1EAPA 2H6PA 3TZVB 2D9CA 2GIYA 4MQ7B 4Q0XH 3WFHB 1FZJA 1RU9L 3DETD 1WGOA 2FHFA 5ITFB 4FZ8H 4MDIB 4G7YH 4P2OC 3TBVB 5D5MF 5HHXH 2P5ED 1BFOB 3SDDD 3F7RA 1BAFL 3MRHB 4OFVA 3LPFA 4AIZB 2ED9A 3WNKA 3GJEA 1IAIH 3U4EA 1JE6A 2GTWA 5IIEA 4X6CF 3L6FA 5IVZB 1XIWD 2MPAH 3HPJB 1T5XA 3VGEA 1BP3B 4NC1C 4PJ9B 3RDTB 3I6KB 4LAJH 5KSBE 3VI4F 4WGWB 4R97B 1MJ7H 2DMBA 1ZGLM 1RVFH 3V7AG 3U36A 4IS6A 5E7BA 4KFZC 3RIAF 5EU6D 5DT1L 4W4OC 2WY3A 4U2YA 4HDIA 4PJIF 4M7JL 4PJ7B 3IKCA 2ITCA 4WHTA 2RCSL 3DYOA 3QDAA 3K1KC 2NY6D 4HUVA 5ICXB 1XGPA 3ZDZF 5DJDB 2D0GA 4WW1B 1YY8B 4V1DD 2DQDH 4KJQC 3RVTD 4P46A 1NFDE 5GRUH 5HHOE 1E4WL 4RBPK 4QHLB 2L0DA 5B39B 3O3BB 4JKPL 4FABL 4HWBA 2ICWA 1N26A 3NZ8A 1U8OB 5L2KD 1ZVHA 3CUPB 4UIKH 1KJ3L 1PLGL 3BIAX 5DSCA 2AEPH 4HGMA 3GDBA 5A2IH 1N2RB 4RFNB 2MQCA 3CLFL 3BH8A 1MCOL 2AXGB 5DWUH 2R69H 4XAKD 3UTSB 3BQUB 3RGVC 4D0CB 4K71C 5I1KL 3VGDA 5LQBL 1QEWA 2IPUG 1DBJL 3PDGA 2N1KA 5BW7C 4I18A 2CKNA 3GSRA 4MAYA 2A6IA 4JFQA 1DBAH 4DGVH 1G9NH 3TVMD 4MD5B 5GGSA 1WFUA 1UWXK 3TA3C 1P1ZB 3L3GA 3QQ3A 5EIVA 3RPIA 3BPNC 1ACYH 1I7ZA 1IAKA 2LVEA 5D5MB 3QRGH 4FQCL 4H1LH 5DRNA 4MS8A 1RZGA 5ELIA 1ZVSA 5KVEL 2Y9RT 3VWKD 2MCPH 4IOIB 3P11L 1RZ7L 3DJ9A 5D4QA 2CUMA 4TSBH 1G9EA 2PUQT 4L4JA 1MF2L 4GMSH 3UPRB 5D7SH 3ZL4L 2EECA 2J1KA 4NO0B 3VH8B 2O61B 1KB5A 1U92A 3CFDA 5E00B 3T4YA 2X4NA 5IVNA 1A4JB 1LEGB 4NNYB 3H7BA 4PLJD 4RMRA 1IKFL 1WBYB 4Y8AA 3L3JB 3KJ4C 4G6FB 3FT2B 4CMHC 1PX4A 3P9LB 5I17A 3TBWA 9CGTA 2WBJA 4NQUA 1RIUH 4S0TD 4Z95H 4M6AA 2VB5A 2EYRA 4QXWA 1OLLA 1WIOA 2NY3C 3RX7A 1II4E 5L9DH 3D39A 3EDDA 4LASL 4R3SA 4CJ1A 5GGRY 1P5VA 1CFSB 1A3RL 4Z0BL 2OR9L 4PJBA 5DD3H 3CJJA 4S1RH 3WXVL 5A16B 2A1WL 3VFPB 5HHNA 3OZ9H 4XMLL 2RQ8A 5CGMA 3JBG7 4G5ZL 2GY7B 4HGWB 4JM2B 5L88H 3RKDC 1C12B 2GJ6E 2YHGA 2NTSP 4CNIA 1QFWM 5F72S 3FZUD 1OSPH 5C0RH 1HHHA 4DOHE 4S1QH 2FB4L 3VFMB 3MODL 4J1UA 2UVFA 3D85D 5T3XE 4JY4B 1PYWA 5I8EB 4R4NC 1LK3H 3D3VE 5IMMB 1MI5A 3TV3L 3DV4B 3GSQB 3KPNB 5DGRA 2C3VB 4QCIA 1KIPA 3EO1B 1HHIB 5DTFB 5BRZD 1KIQB 3R8QA 4PJ8C 1BFTA 5ENWB 1BF8A 2E27L 3U6RA 2AKRB 1CICC 2F19L 5KG9A 5SV4A 4KKAC 4O51A 5KVFL 1QBLL 2NXZC 5IROC 4G3YL 4MJIE 1CLYH 4EI6B 5I15H 5KVDH 1SY6A 3LQAL 5HI5C 4OCYL 4MNQB 3QNXB 1TJHH 3IDJA 3VXRE 3TH3T 4YHZH 1CT8A 2D31B 4JFDE 1J8HD 1HIML 4NN6B 2FRGP 2OJEA 3CIQA 5FGCB 4LLWA 5ILTL 3L5WB 3CXDH 5CSGA 2F54E 2ZKHH 5SX5H 4FQHA 3VDAA 1S7RA 3EOAB 4Q97A 3O9WB 5AYUH 3TT3L 3IB4A 1KLUA 3BKYH 3L1OL 4IIQA 2CKBH 1U3HA 4JREC 4ESKA 2C1OA 5HJ3A 3O3AA 3S96B 2F8XC 4AH2A 4MD0A 4WO4C 4U1KA 1WSST 4ZS6D 1LO4L 5HXMA 2I27N 1PQZA 5DMIL 2X9YA 2AS5M 4OFYA 4TVPL 4NQXA 2ZJSH 4PLNC 1S7WA 3IXAA 3TO4D 2I60L 4PLOB 5I71B 1F90H 1CZ8L 1IGCL 3LN5A 2ID5A 1L7TL 5ACZB 4PGBA 3VG0L 5E2TL 2GCYA 5E8DH 5E4EC 4P2RD 1GJIA 1H15B 2OMNA 5FOJA 4ZTOL 3MRJB 1UM6L 2R23B 1O5DT 5SX4I 3QRFM 2BNRB 4G9DB 1MNUL 2I07B 2D0HA 2VZSA 2P8MB 4P9HC 1MHCA 2HJFB 3TO2B 1OAUH 3OBAA 5C08A 5ALBL 3C60D 5ISZE 1WIUA 2IAMD 1QLRB 1JPGA 5ETUA 4Z7UE 5F7YC 3KPSA 3HC0A 4YGVB 3LN4A 5TE7L 4DKEL 5J4MA 3KXFB 4XPHL 4J3TA 4PGEB 4MA3A 5EOTA 2P5WD 2UUDH 3MOAL 1ZT4A 4JPIB 1IEHA 1D3CA 1DN0A 1V7NL 1VACA 2BY3A 1K8IB 2X4SA 2YS4A 3TWCL 5JZ7D 3PDOB 3O0RH 3FFDB 4G9FD 4HUXB 4XCEB 1EO8H 3RWJA 5AAMA 2XWJA 3JWDC 1A3LL 5EC1A 3HRZA 3IXTB 3LDBC 1PD6A 4BQ6A 3NIDE 4JFFB 2IAND 3RUGF 1UM5H 1GL4B 2DD8H 4AEIL 3EOBB 2R0WL 4POZC 2I9LB 2Y7QA 5E08H 1JGVL 1U6AL 3HZYB 1MFNA 2VR5A 2VC2H 5HY9A 5CUSL 1MRFL 3U1SL 4GXVH 3DGGB 4IRZL 1RIHH 3H3BC 4J8RB 5GSRA 2AXFB 4M8QA 3U7YH 1I9IL 4PP2A 3VXNB 4IDJH 2NY0C 1BWWA 4UMGA 4GS7C 2NX5A 3IF1B 4LMQE 5C7XH 1C5BH 4HKZA 3V9FA 5MEOA 1IGFL 2FO1A 4JKMA 4MJ2A 4MNGE 2X89A 1XF2A 1NL0H 5KSVB 3FQNB 2J7LA 4YH6A 4OCWH 2Q3ZA 2ICEA 4UT9H 1ZT7A 5BVPL 5IFHL 2XTJB 1P7KB 2NZ9D 1TMCA 4GUPA 4LU5L 4R26H 3VXTA 4PRBB 2CXGA 4P4KA 2BHYA 5CJXC 3WUZA 2AJYL 2OI9C 5LAXA 5IM7B 2LTQB 4BKLA 4OZHE 3T0BA 3VU2A 4L3CB 1J10A 4U1GB 5JDSB 5J6GA 4PLKC 4QRPD 3SQBA 4Y5YC 4PDCE 2O26U 4UV4H 2XA8L 2QHRL 2Z8VC 4Y4KD 3BZEB 5D2NE 1T2QH 5HI4C 1JWMA 4DGYH 2E7MA 4L8SB 1Q0YL 2V2XB 5E7FA 4X80H 4I3SH 1ED3B 2AV1B 5DO2D 5EUOB 3VW3H 4DN3L 2EDRA 4U7KA 4PFEA 4HBQA 2F74B 4JZJB 4NQCA 5GISL 4ENEC 3NFPA 4M6OL 1X7QB 5JR1H 1HSBA 4JHWL 1F5WA 1BGXH 4ISVA 3W0WE 5L8LB 4ODTL 3GSOA 3NGBB 3SGKC 2OTUB 3STLA 2YEZB 3J8F7 4YO0B 1NBVH 4PRPA 4YFEA 2FL5B 2NNAB 2FH8A 2HLAB 1RZIB 1A5FH 1FVDA 5CILL 3QP3A 1VADA 5C3LD 3W39B 2FWOB 5BS0A 1HXYB 2A0LD 1NDGA 1L0YA 3MA7A 3P73B 1T1XA 2QJDA 3N06B 3LRGA 3FONB 4NYLB 5F21B 4JVPA 2XZZA 2BOCB 3V79C 4ZNEA 3MRFB 1RY7B 1NAMA 4M7ZB 3NAAH 4XC3L 4LLUB 5E03A 3CFEA 2D3VA 5F97E 5CSBA 3ZKXB 1CD1A 4RMWA 1Q72L 1EEYB 1T3FA 5CP3A 2J4WL 5EZLB 3RL2A 4ALAH 1M6OA 2HFFB 5EC2A 2DQIH 1UB6B 3MFFB 4X5XB 4HKBB 1NFIB 3FN9A 5DD5H 1OGAA 1ETZB 3FAXA 1DQLL 1QHPA 2VDRH 4L9DA 3ULUD 1CU4L 3QUXA 4NQDD 4Y5XC 2NZIA 2R1WB 4WVRA 1XEDA 1JIBA 4OUUB 4QKXB 4HJJL 2VIRA 1CDGA 4MMXC 1KXQE 5CD3B 1GIGL 5FHBH 3SCMC 4E0RA 5CCKL 3WIIH 2VAJA 3IU3A 4K23H 5ANMB 4PBWD 4JDVA 3MJ8A 2V6HA 1MSPA 4FNLH 3PUCA 4CMMB 5J56B 2AI0L 4NGHH 4NJ9L 2AGJH 1KV3A 1FZMA 1NUGA 4GW5B 5AZ2L 5D70L 5EZJB 3QHTC 5GRVK 3S5LA 4Z7NF 5E8OB 1ZA3B 1WAAF 5JHDA 1X5ZA 3GIVB 1XCQB 4OF3A 3DX9A 2VDOH 4LSSH 3BSZH 3RTQC 1RHFA 2IG2H 2IQ9L 3FN0H 4DAGH 1F4WH 4ZFFB 4J4PD 2HKFH 1DFBH 5LCVL 5D96B 4B53A 5JXED 2ZG1A 2DLTA 3GNML 4ACPA 5IBUG 3FOMB 3MRRA 3SKMB 2NTFB 1BD2E 5J12C 3ZDYE 1V3JA 4MA7L 2ZWLT 1EHNA 5FHAL 2PYEE 1QLEH 2XZCH 3MYJA 2Y6SC 4UUJB 5D7IF 3NIGF 3MZGB 1PG7L 3OQ3B 2XV6B 1DLFH 1JFQL 2DM2A 1S5IH 5D7LA 4RMSA 5LGHH 3U9PL 4JVUA 1CL7H 4P2QD 1U3ZA 1AD0A 4DK3A 3VWKB 5I73B 4HUNB 2AJUL 5F9OL 3MGOA 5JW5A 3WHXB 1G7JB 1Q0XH 3FKUS 4HZLA 4KROC 5FOBA 3RPKA 4H26A 1HILB 4U6YA 4F33B 4JN2B 3RWDA 1RUMH 3P0YL 5I76A 2ORBH 2FO4A 1MQKL 3IVKB 1NAKH 2A6JB 4IM8A 4V2BA 3HE6A 5C0NC 4FFYL 4G8EA 4UT6H 3EFFA 2UY7A 3HAEG 4OI9A 5BV7L 1DTUA 3MROB 5L8KB 2PW2A 3EYQC 5T1DL 4WUKH 5BZDA 1FJ1B 3S88L 5ADOL 2D7TL 2B0SL 2UV3A 2YD8A 2VQ1A 1U91A 4OKDA 1RV6X 2YXMA 1L7IL 2ADJA 3JTSB 2AK1L 2H32A 2P43B 4RFEB 4OLXH 4OCRH 5E9DB 5F7LB 1KTLB 4Z7WF 4I5BB 3FQXA 1FVEB 2F5BL 3O6FB 1C5CH 3QIWB 2WQRA 5CZXD 1W8NA 3V0VA 4N0CD 1L4IA 3QEQD 3KPLA 1T0MA 5DJZB 1BOYA 3TJHA 4WHCA 4ZDHA 3DXAD 3NIFE 3DYPA 5KW9L 1EEQA 2R0ZL 4DEPC 4QLRA 5CIPB 1LD9B 4GW4A 2YKLL 3PIQB 3NCCB 4FQ1H 1EMTH 4YFDB 5DEFA 12E8L 3MJGX 4YAQA 1EO5A 4GQPH 4PJGF 1NANI 1R3HB 2UWEB 1LO5B 4YIQA 3KWWB 3QPQD 5DUPH 1I7TB 1NCDH 5EH1A 1JPSH 4JY6B 3H0TB 1FL5A 2DIBA 5JO5A 3O4LA 1C16A 1YN6B 2PXYA 3MJ6A 3BP7B 2CLRB 1I1AC 1L8JA 4JO3L 1FZKB 3G6DH 5SWSA 3WNMA 1IVLA 3AREC 3ULUH 2BSSB 3NCJL 2WLYA 1X9QA 1C1EH 1IM9A 3KYOA 4NRXB 3CDGA 2YMXL 3BO8A 4QRSA 2EYSA 4X7DC 1HYSD 3RWHA 1BJ8A 1BJMA 3ZE2E 4FQLH 4FQQB 2XN9B 2YD1A 3DI2B 3I75A 4FP8H 5MHSD 3GRWH 4LBEB 5D1QA 3MRIB 5FYKU 4MDJB 3DRQB 1B4RA 4P23D 1PW3A 1TZHA 2JIXD 3CFBA 4XP6L 1TCMA 4MJ6B 3RZCA 2BSRB 1ZV5A 2BJML 3HC4H 1RZJC 4K94H 1YDPA 4Y4FC 3MRNA 4JG1H 1RIVL 2E8ZA 1HINL 4NO2A 1KEMH 2X2YA 3W9DA 2HH0H 1B90A 3SDCC 1GZPA 5C70A 5DMYA 1RU9H 1T1YA 3WL9B 4OFDA 2GT9A 2YUVA 1BJ1H 1QSFE 5JHLL 3SN6N 5KSBA 1F4HA 2JCCB 2B2XL 1BAFH 3HE7A 1ZHBA 3VXSD 4HFUH 4R6UA 1M7IA 4HC1A 1F58L 4JG0H 4BK5A 4JFHD 3T65B 1AGEB 5JDJA 2HMIC 5LKNA 3QNZB 1KUMA 2EEBA 2F8VA 1FDLL 3HR6A 3QDMD 2R2HB 4WCYH 5D2LE 4YX2L 1NBZB 3FQWB 2M26A 4JLRB 5SV3A 3UBXA 2GUOB 4HX1B 3ARRA 3EBAA 1S9YA 3WN5B 4IRSD 5HHOA 4LKXB 4F7TA 2LAAA 2GITA 4CVXA 1OAKL 4PJGB 5E1AB 2RB8A 1SYSB 5MEQA 5DT1H 3JVGC 3MA9L 5IJVA 4UNTA 3PL6B 3NABL 5E24E 4I2XB 2E5EA 1J1PL 1OQOA 1NBYA 2FEDD 1Q38A 5F1KC 4W6XB 4EI5B 5I2IA 1V7ML 5DVKA 4HGKC 2WWKT 4ZUUB 1OAZH 3CSBA 1DVFC 3U9UB 4HIXH 2Y5TA 3WCYA 1AGCA 5DXWA 1IT9H 2IAMB 3L5XL 2H3NA 1T22A 2P46B 1CR9L 4I3GA 1NKRA 2E9JA 2XYCA 1S7VA 4RAUB 4OZGE 2R2BA 2BSTB 5I1LB 2F9BT 1IARB 4JKPH 1ZGLP 4FABH 3OKMA 1JK8A 1IM3B 1X4YA 4H0IA 1IJ9A 4NQSA 2FJGB 1KJ3H 4PJDF 1LK2A 1S7TB 1A9BA 5J6HA 4NSKB 1G9NC 5FA3A 3CLFH 8CGTA 3D0LA 1MCOH 4U0RB 5E2JA 5HD8D 3EJZC 1AQKL 4N0RA 5I1KH 1QQDB 1Y0LB 5LQBH 3EDFA 3QNYA 4D9LH 5FO9B 5DJYB 4KUZL 4L4TD 3ROLB 1EFQA 2HG5B 5LWYL 3STBA 5ECJE 3AUVA 3KPOA 1T6VN 3FB8B 3PWPE 3O8XA 1NUNB 4QRTB 4N0FB 4ELMF 1KGCE 2D7PA 1QFWH 1X4XA 4YDVA 3KYMA 5CP7A 2XQYK 1DANT 5KVEH 4A6YL 4S1SL 3HNTL 3P11H 1QRNB 2BRRL 3FHAA 3QUYA 5HHVL 3L3OB 4KQ3H 3FCTA 4WUUD 3RY4A 1MF2H 5B3NA 3MNVB 3ZL4H 3L3DB 1UQSB 4DQOH 5B4MC 5HGDA 3B9DA 3QI9B 3ARBC 2OP4L 5TH2A 1GPOL 3QUZD 3I3DA 1ONQA 3IJSA 4FQXC 1MOEA 3RVUC 2DQTH 5A1AA 2B7DT