3LKQA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1977 strain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lkqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lkqA01
1JRHL 5E8OA 3IXTA 4OBSA 4XPHL 2BFVL 1A2YB 1I9IL 3FQTB 2PNDA 5CD3A 3HZMB 2R9HD 5JW5A 3MLZH 2AXHA 4RFOL 3T1FB 2YC1A 5LCVL 4CVXB 2OXGA 2W65A 2O5ZH 1KN2L 4YAQA 4NRYB 3KPPA 5B22A 4HFWA 1N26A 1AGEB 2UY7A 5T5FL 5IT2L 1S7SA 4D0BA 3D48R 4OI8A 1KC5H 2ZUUA 1RD6A 3R1GH 4TULL 1FFNB 1CDIA 2NY7L 4RAVA 3VXTB 1YYML 4O2CA 5IFJA 2Q76A 4TTDD 4JRYA 2X09A 3QQ3B 1KJ2L 2B8OT 1TCRA 3C09B 2FEEI 2MFNA 5BS0E 3C60C 2DQDL 5C0RH 2BSTB 3BW9B 3ORJA 1QPPA 3MRPA 1S9WB 2BVPB 3MXWH 4RGNC 4BZ2L 3KPSD 4W6WB 1ITBB 1RURL 2ICEB 2HJKB 1OL0A 4MLSA 3U2SB 2IH3A 3BZEB 2YRZA 2NQCA 5ESAB 3PHQB 1Q9WB 1U8PB 1KCVH 3M17A 4OZFG 4ZS7L 3WUWG 1BF8A 4P3CL 4DTGH 3TJEH 2V2TA 5BZWA 1RK1A 3MLXL 2ZCKH 5E6IC 3HCVA 4UTAL 2XN9E 5TQ0H 1E4XH 2Z8VC 1FJ1A 3O45B 4NKDA 5HGBB 5FECA 4TRPH 1N3NB 2BVQA 5DDHB 4XMLL 1T5XA 1KELH 4G6KL 4R2GC 4RMRA 3C08H 2FIKA 5BW7A 3IDNB 3QDMD 5SWZD 4ZSOB 4M02A 2GTWA 1EMTH 4PJXF 1ZT1A 2XWBB 3V0VB 2NW3A 2NY0B 2XZCL 4M1GH 5C0BD 4F37F 2AJSL 4JREB 5KTEL 5LXGH 3SDXF 3SJVE 1IQDA 4I5BA 5F9WC 4M6MH 1OGTB 3W2DL 1TNMA 4AZ8A 1EO5A 1S7VA 2A6DB 2X4UA 3LY6A 1MJ8L 1AO7A 2CJUL 1CGTA 2BDNL 1A21A 2HVKA 4PGZA 2V9QA 1A7QL 1JCKA 1ZA6B 3SE4A 4FTVA 2OXHA 1SY6L 3ETBF 1JYNA 4DK3A 4XP4H 5EO9A 2QQNH 3VDCA 4F7CA 4Y2DD 4LPTA 2ZJSL 4G6ML 2FH6A 3UO1L 3TNMA 4ODWA 4AIOA 1M4KA 1T22A 3D3VA 1MCSA 4HLZG 5IEHA 2ADJA 1A4JB 5DA4A 4XPTH 2ADFL 3NA4A 4BKLA 2KZWA 3ARBB 1UM5L 3MRBB 3TVMC 3CPLB 4B50A 5EZOL 2VDPH 1VACB 4XNUH 5I1HH 1H3WM 4HBQA 3VXRD 4BYHA 2H1PH 4M7LL 5L2KA 3P4OA 5KVEL 2HG5A 1LE5B 4PJBE 1S5HA 1OTTC 4KDVA 4ONGH 4Y16C 1XAUA 2IQAB 2N1KA 1HK6A 3FMGH 5F1OB 2XWJB 2QSTA 4PTTB 4MXWH 5IB3A 4NQVA 4WI8A 2NX5E 2UWEA 4XMKL 4YK4B 1KCSL 5LQBL 5TDPB 4C59B 5IROC 5JXEC 1MCIA 1S9VA 3HC4H 4WFFD 3PWJA 4ZS6D 4A6YA 1KEMH 3EO0A 4UAOB 5ILTH 3QUYC 1TIUA 2VLJD 3U9PL 2YPVH 1E27A 1MHCB 2WUCL 5EU7E 5F93C 2EYTB 5IB5A 4R4FH 2YPLA 3BXNA 3JXAA 5C6WH 3FOMB 1D5XA 3LS4H 2VZTA 1AXTL 5IBUB 1TCRB 2YRPA 3BH8A 3IDYB 1DUYA 1I75A 3RU8L 2VZUA 5L7XL 2A38A 5I16A 3RVUD 5T1KB 5LKNA 2NY2C 3MROA 4HZLA 3QUZC 2ILLA 2IH3B 2BY2A 1PKQB 3I3EA 4KHXH 5FO8B 2BNQA 2P8MA 2YD3A 3CK0L 4LLUB 4OGYH 4BQCA 4N0UB 1B90A 3O9WC 1F58H 3H2WA 5BZWB 3O3EA 3SGDI 3T2QA 1X5YA 2OR9L 4CGTA 1C5DA 2B1AL 3V4UL 3EW3B 1HCVA 1UACL 2DQHL 4CVZB 3HZYA 5CINH 4KWUA 3RTQD 4LCWA 4YHKH 5DURD 3CVIL 2RFXB 1SMOA 1QR1A 2BSED 3C5ZD 3KXFB 2Z91A 4MJ2A 3UYOD 2D7QA 2AJ3B 3QA3A 3CH1A 3QNZA 3TPKA 4KKAD 2NW3B 2CGRH 5T3ZH 2EE6A 5DJCA 5FEBA 4JM2C 5IMKB 4MJ6A 4NJAL 3EYOA 3FONA 1EO7A 4XAWH 1BOGB 4I5BB 1C1EL 4KUZL 1YJDL 3BQUB 1BIHA 3T08A 3L9RB 5TDOB 1I3GL 2VXQH 1FSKB 3D85A 1GGCH 4IJ3B 1NAMH 5HPMA 3T0ED 3KLHC 5GGVL 5DD6B 3GIZL 3GJFA 2BCKA 2Q86A 4D9LL 4FTVB 1F5WA 2HKHH 3RUGB 5F44A 3ARRA 1T0NA 4KI5F 4LFHD 4PB9L 4F7CB 1FRGH 3C2AL 1FG2A 3TP4A 4Z7UA 4K7FB 3O6ML 2BOCB 4YXHH 3HAEH 4Z7WB 3MGOB 1T22B 4M7KH 1BJ1H 4V1DB 5FUCC 1FIEA 3WFBL 5E9DA 2J12B 1I7RB 4XBPB 3L6FB 1QFWL 3R06A 4JFPA 2IH1A 4KU1A 3UYRL 5C70A 3RX5A 1A47A 1EO8L 3FO0H 4QHNA 5J4MA 4OM1L 1QFUL 1W8OA 2WLYA 1OSPH 4PLKD 4XTRD 3D2UD 4HG4K 5KN5A 4D0CA 5MENB 2QHLA 1GSMA 3GMNA 2IALA 3KS0H 5JNYA 1FV1A 4CRPA 1AD9A 1AI1L 3RWEB 3OAUL 3VXMB 1JGEA 3TWCH 3KPOB 3DXAD 4OGXH 1L0QA 1J1OH 2FJFA 3D39E 2EIDA 4LSVH 5ERWB 3QUMA 2CKBA 3JWDH 5CJXA 1U58A 2VDRH 4S0UC 4PJ5E 3V6FA 2NPLX 5FB8A 1F00I 3GO1H 3QDJD 1ZANH 3PL6D 3WN5C 1CFNB 5TH2B 4FQCH 4GW1A 3PWJB 4PJ9D 5BJTA 1MLBA 5IFHH 4JZJC 4M1CC 5J0BA 1CI5A 4RWYH 2AGJH 1E27B 4QRQA 2OL3L 3G5XA 1IAIH 1RZJH 3FQXA 1A9BB 1I8KB 5J1AB 1NAKL 4WHTA 3TF7A 5B39A 4NQED 4PLJD 5ITFB 3SBWC 1P5UA 1EFXB 3MRKB 1D5XB 1BJMA 1TVBB 4I0KA 1BVZA 2F53D 5GS2H 3VXSA 1C12A 3MV8E 4OFPA 2VAAA 3EOBA 4ALAL 1G7JB 5DHYA 3KVQA 4P5MA 1T1ZA 4NM8L 2XTJD 5CBAA 1R5IB 2AW2A 4PJFF 1HXMB 2A6IA 2A83B 2WV3A 4WEUD 1CFSA 4HF5H 4JE4B 4B7IA 5F6HJ 5A2JH 2CMRL 1NGZA 1BJ1J 1NFDA 4MQTB 5HI5C 1UENA 5C09E 5GRYA 3LH2H 3V52L 1X5GA 4X98B 2N56A 4HS8H 3VMNA 3R8BB 3TO2B 2NR6D 1QTYT 4HBCL 5ISZB 1UWGL 1H5BC 1U3HB 4P4KC 3RVVC 2VE6B 4EOWH 4ZNCD 4F7TB 5IK3A 3KS0J 1F4XH 5DJCB 5INDB 1UVQB 2XA3A 4MJ6B 4YHOL 1XIWD 4CN1A 4GAJL 1KTKE 2IWGA 1MRCL 2BY1A 2R2HB 1QSEA 3ARVA 3MUZ1 1IM3B 1HZHH 4NKOA 4N5EC 1LNUA 3MLSL 4LHUG 4OCYL 3L3HA 3LKRA 4TTDC 3ZE0F 3BZFB 1GOFA 4XX1G 5DK0A 5I8OL 2BCKB 1HINH 3RGVC 1AY1H 1BQSA 3D0LB 3HRZA 5FYKD 4U2YA 3QCTL 4GOSA 4YFDB 3RL1B 1P7KA 5HHNB 4I0PD 5EZLB 3MV9B 4Z7UB 1VKXA 4GKSB 3HNSH 3PWVA 1M71A 3WXVH 4KH2A 3QEUA 4KUCD 4JM4L 4PGBA 4S1RH 4RRPG 43CAA 2YD7A 5HGGS 2FECL 3VXPA 4XCFH 1Q0XH 3FB8A 3OAYK 1F3RB 3N50A 3RWIA 1P69B 1K85A 4ZQKB 1JGLL 3D0VA 1D5IL 4EI5A 1ODAA 1OQOA 2G2RB 4KK6C 1U2HA 1CL7I 5I8KH 3HE7D 1KEGH 4JKPH 2PO6D 2NXYB 1CGVA 1GGBL 5D7JD 2VZOA 1TDQA 3UJIL 1FV1B 1IILE 2AQ3A 4TVPL 4NZTH 3ZHLA 4Y1AD 1Q9KB 2OQJB 3RJQB 5DJ8A 2B4CH 4D9QD 3VG9C 4O4YL 3PNWA 5J3HC 1IQWL 4CMHC 3TBWA 5C7XH 5F3BA 3VD4A 4MNGE 3V7MA 5A16B 4FMFA 1J5OL 1U0QA 2VWEC 2ZPKL 3Q48A 4WWKD 2BRRL 4OBRA 5GQBA 4MSWA 4GW1B 2ARJB 4U1GC 3DRTB 3T0XA 5L8LB 1YECH 1HQ4B 2FX7H 3HB3D 4APQB 1N0LA 3NIFE 4J23A 3P11L 2RAMA 1OWWA 2Y7QB 3PG2A 3G6JA 1UT9A 3QHTC 1GIGH 3HPJB 2VLKE 1U93A 4KJPC 4FQQA 1LP9F 3H3PH 2MSPA 4W81A 1AGBB 5FGSA 4QHLA 3FO9B 4U6YA 3NIGE 1P6FA 4OLUL 2RB8A 4X4XA 4EEEA 2OS7A 1I1FA 4XMPL 1W8NA 1XGPB 3LQMA 1IRAY 1GC1H 2K7QA 5JPMB 1F90H 5DFVC 5DMGC 1UJ3A 4RGNE 3X13B 2ZNWA 4DOHE 1JN6A 3MV11 4G43A 5FO7B 1FNHA 5CP3A 2DICA 1Q0YL 4H8WC 4JG0H 4FQLL 5KVGL 3DO7B 2BHZA 5D1ZA 5L2JB 1CZ8H 3LRGA 3RRQA 3VWJD 1S9XA 4MAYD 2H6PB 4HUWB 4JRXD 5SWSE 5F7DA 4DN4H 2RGSA 4J4PA 5IP4A 4MMXC 4MS8A 4ISVA 1LEGB 4KQ3H 1GHFL 2BX5A 4GMTH 2C9AA 4YBLB 1ES0A 4R7NB 3WFHA 1T2JA 4XX1E 4WW2B 4GAYB 3GSVA 4R26H 5AUMA 5K59F 1S7RB 1EJ6A 3MLUL 1S7UA 1XF3B 4PJCA 5ICZB 3QHFH 4TVPE 1HCFX 4M8VA 1PG7H 3DYOA 4S1QH 5DJYA 2HFEA 4X80H 4RZCB 4ZODA 4LCUB 4Y5VC 5I75C 1X7QA 2B1HH 3JV4A 2WK2A 1MNUL 3ZKNC 4FFZL 3DX9A 1ORQB 4FFWC 5K9QI 5L9DL 4JFED 4HGMA 3SE9L 4G9DB 2DN7A 2JJUA 4FXKB 2IPTH 4LARH 3ULVH 1QA9B 4KKLD 1OP3K 4GBXD 4L8CB 4U1HA 1L7TH 3HS0B 4LIQE 3SPVB 3NH7L 3BIAX 4D3CL 3RZCB 3BN9C 4J2XA 3INUL 4HIHB 1J8HD 3RVUC 4U0RB 3IDJB 1DFBL 3Q6GH 1GOGA 5KS9F 1QBMH 2GCYA 2IEPA 3D25A 3QI9B 2EYRB 5GZOC 1AD0B 5DWUL 3BD3A 3GRWL 4LCIL 3MODH 43CAB 1SEQL 1WZ1H 3EZ8A 4OD3L 4X6FA 3ZL4L 1JZ6A 4KVNL 4PJHA 3IDXL 4PBVC 4Z78A 2R4RH 3OPZL 3CFBA 3B8YA 1FGVH 1DANU 4XP9H 5E94A 4JLRB 1ULVA 1ZLWK 1VPOH 4BJLA 1DBMH 2A6JB 4P5KA 1NGPH 1M6OA 4YC2B 4YHNA 1JYWA 2QQKH 1IZJA 1ZT7B 4HPYH 5I73C 1W0VB 5IJVA 1CFVL 2ORBH 1G1YA 3EKCA 1KGCE 4PJDB 3UTZA 4YDVA 2XWTA 5TGBB 1CG9A 1N59A 1AIFB 2HRLA 4LKCA 4NPYB 3O8XC 3SEPA 1VEPA 4Q2ZB 4TN9A 1PZ5A 5KSUB 1BD2B 1A6UH 5CHNA 1FL5A 1X6NA 2GTZA 5KSBB 2ARJQ 3U79A 5CKAA 2G60L 5DVOA 4TUOB 1IGYA 3JBG7 8FABB 1MWAA 1D5ZB 3T0EC 3BGFC 5IQ9B 1LHZA 3UX9B 4ZYKB 5HPOA 1YPZA 4YUEL 5BRZD 4P2OD 1U93B 3IF1A 1ZVSA 4ERSH 3CXHK 2AS5M 1DVFD 5GSVA 2J3SA 3GUTB 4L4VB 1FGNL 5DJAA 4NZRH 5L0QB 5L88L 4H1LH 4LASH 1UJ3B 4QKXB 1CTNA 4YO0A 5GISL 4ZUTB 1VFAB 3HNVH 2GQHA 4XPGL 1UM4L 1S7TA 4L3EE 2CH8A 1G9NH 4I9WE 4KJQD 5C8JA 1GGTA 4M6OH 2VSCA 4TPRL 4GG6A 3S36L 1YA5A 3LHPH 1JK8A 2AQ2A 3LIZH 3MLRL 2LVCA 4ODVH 4KTEH 4LLMB 5T1MA 3SDCC 3K3QA 3RP1A 3HUJE 3QPXL 4UDTB 3O3BA 3EOAB 1ZTXL 5HYJE 3QNXA 2FLRT 1OT1A 5AYUL 1YEIL 3H0TB 4DGIH 3WNPA 3KR3L 2FB4L 4NIKB 3BP5B 4XVUD 1SVZA 1IAKB 3ZE2E 3VRJB 4X6BA 2HFEB 2P5WA 2WLZA 1FO0A 4EDXA 3S7GA 1TZGL 5CSGA 3QIUA 2FX9H 4PJ9C 4Z7QF 4P2RE 1IKFL 4Z7VE 5ALBL 1RAMA 1AJ7H 3EJYD 3CIQA 1LO5A 5JHDE 1LEIA 4UT7H 5I0DA 2JELL 3U0WL 5E99H 1PBYA 5FYLD 3WXWL 1YZZA 3WLBA 1RIUH 5JA8B 5D7IE 3U36B 4MQ7B 4R97C 2YA1A 3MJ8A 3V5KA 1OLZA 1KPUB 3LB6D 1CIDA 2VB5A 1CFBA 1MEXH 4JN2A 5HGDB 5D5MB 4N1HB 2XA8L 2KQMA 2Z93B 4L8SC 3KPQB 3LQZB 2P5EA 1VCAA 1CDBA 7FABH 2XV6B 2ED8A 2LV4A 4YR6B 2A1WH 5FUCE 1R3KB 4L9DA 3OKOA 3PXHA 3VXOA 5GZND 5SX4I 4NKMB 4J6RL 5GGTA 4CAGA 4YGAB 3QFJE 2HTKC 4GXVL 5GS0C 2XY1A 2FHCA 4WTZA 3CCHA 1ZHLA 3BSZL 1FNFA 1M7IB 2ID5A 4HEME 1FZOA 1G9MH 2NR6C 5D72H 4U49A 4YHNB 1FYHB 1IL1A 4RDQG 4C56D 3GBLA 2E7MA 1TMCB 5ADOL 5L8KB 1IC1A 1N5AB 5IM7B 1IFHH 3TZVA 3QEHB 1CG9B 2IFFL 4LKCB 4YQXL 3GMRB 5F7HA 3ARWA 4JGMA 5CZXC 1NCCL 1MH5A 4LGPB 1XIWC 2FZ3A 1KLGB 4UINH 1BFOB 1BREA 4OCWL 2XN9A 3D1MC 3OF6D 4JCMA 4OFVA 4NO3B 4J7RA 3S4SB 5T1DL 2D7PA 3CX5J 4M43H 1HHGB 3MA9L 5CGYD 3C6LB 2HRPH 3VFTB 4FRWA 2J6EL 2J5LB 3NFSH 2J88H 3UTSA 2XRAH 4WO4A 4LDOB 4JO4L 3D9AH 2UVFA 4I0PC 3SCMA 1FPTL 5EPMA 1H15A 4ODTH 5JUEH 3MCKA 1OGAB 1CL7H 4PRID 1F8TH 3L3OA 5JIHA 3SJVA 5ACZB 1SQ2N 5L6YH 3IJYA 3BDBA 2AEPL 1WF5A 4KI5C 1RK0B 3VWKB 3QCVL 4MA7L 3GNML 1NLBH 5TE7H 5B8CC 1LO3H 3ROLA 3GK8L 5D7KE 3Q1SH 3UBXA 1J9CT 3MQIA 2BP3A 5D71H 1IKNA 5DT1H 3UJTL 1EEZA 1IGCL 5DI8B 3IETA 5BZDA 3GM8A 4Z6AT 1F4YH 4EIZC 2I5YL 5F8RC 3HE7C 4OCXH 1WEJL 1KJ2A 3S3SA 1HH9B 3U7YL 3G9AB 3HMXA 3TFKD 2QADB 2I9TA 2EDXA 4DVBA 2CUIA 3F5WA 2Q6WB 4Y4FD 1EH9A 1NSNL 4NCC2 4KROB 4X4ME 2A6KB 3OKDA 5TF1L 1RZKH 2N7AA 3QRGL 1MCOH 4HX1A 4OQTA 2BHUA 2VMFA 2PYEE 1FO0B 4I3RH 3FO1A 5KG9A 1JRHH 2FGWH 2VISA 2W0KA 1CIUA 5I1LB 4L3CA 1DLHA 1YNTB 2CUHA 1CE1H 2BFVH 1OF2B 2YUWA 1EAPB 3RUGF 1NCNA 1LEKB 4JB9L 2BNRD 3KLDA 4NO0A 4G9FE 1R3LB 1Q9OA 4E0RB 4KV5F 2ICWJ 2SEBA 5K9JH 1CR9H 5LCVH 3SY0A 2XTLA 4O9HH 4M6NL 2GFBB 4N0YL 4Z7WF 3RVTD 5GJSL 5DLMH 4XCYA 3W0WA 2MHAB 5EBMA 4ONHA 5T5FH 5IT2H 2YPKA 3LD8C 1XF2A 1FYTA 1KB5H 3DBXA 3KHQA 1KT2A 4H8WL 4FZEH 3WUWA 1BP3B 3OKOB 1A9EB 4M5YL 2EE2A 2IBZX 1ADQL 1U41A 1CXKA 2EO1A 2DLEA 3IS1X 3MBEA 4R7DB 4OFDA 1HXYB 3QEGL 2AJYH 4LAQL 1RURH 3I2CH 1FZOB 3QB7C 3BH9A 1QRND 4G6JL 2H32A 3FN3A 1MCEA 4YDJA 4F58H 5SWZE 4ZS7H 4KZEL 4MA3A 5EO0A 4F15B 5D7SH 5D6CA 1MELA 1PSKL 2MCPH 1V05A 4G8GB 3MLXH 4UTAH 2UYLA 2E7CA 3Q6FB 3MV7A 5H37H 3GMOA 4MCZA 4MZ3A 1EHAA 4DUXA 4F57L 5C0BE 2GY7B 4GRLC 4LSTH 4D8PA 2VLME 2VWEE 2R0KH 5J11C 1T04A 4GW5A 5MP6H 1U8JA 4QXWA 3T3ME 4KKLC 1AXIB 5I8EA 3OB0H 1CGSH 1T66D 4UNUA 3H6JA 1EHXA 2X4QA 2XZCH 4R0LC 3IDIA 2BSSB 1I1YB 2G75B 1RJLA 1PX3A 1FAIL 3P0YH 4JRYD 4Z7OE 2AJXH 4LNVA 1FVEA 5EUOE 5J8OA 3MCKB 1K8IA 1OPGL 3RWCA 3KPTA 4OLYL 3T2OA 2CJUH 3BP4A 3OKYA 1T7YA 2D7TH 2BDNH 2Z8RA 2IAMA 1N8ZB 2P44B 4DVRL 1A7QH 2K1MA 3A67L 4ZXBB 4G7VL 5DR5H 1SY6H 1XEDA 2CLZA 4OLXL 1SBSL 1KV3A 3VXRE 5EC2A 5BZDB 2AJZB 4QRSA 2QR0B 3IGAB 5K9QG 5LGKA 1IEAA 4YHPB 2P45B 4NBYB 4LFHG 4CN6A 1H8NA 1MUJB 3IJHA 5DHXB 3ULSA 5DD5L 5D70L 2YWZA 5SWQB 3GIVB 4D9RD 4NC0B 1UM5H 1G7MB 4HUVA 1TXKA 5IW1B 3PJSB 5EZOH 4YHZH 4LLWB 2E7HA 5DMIH 5EC1A 5SV3A 4FA8A 3CDYA 2FHFA 1RUQH 4FP8L 2ARWA 1H0DB 1QSFB 5KVEH 5H35A 3SDAC 1AGDA 2HP4A 3PQYE 3TA3B 1L6ZA 32C2B 4MJIB 4NHCL 3V5DA 2ADIB 2HVJB 1A6AA 4XP5L 5BV7C 2ZOKB 4UNTA 1VGKA 2ZG1A 1G7QB 4HC1H 2IC2A 3GMPA 3ROOB 3MNWB 1Q9OB 4XMKH 5C08E 1E6JL 1AO7D 4K3DL 5DRXA 1W0YT 4U1JB 4HK3N 1DVFC 1A7NH 3UZEA 5IESL 4Z7UF 3PWNB 3DV4A 4FTVD 4PJ5A 3W0WB 4HQQH 1I9EA 1KIQA 2A2QT 2JKXA 5EBMB 2NXZD 4ZAKB 2YPKB 1XF2B 2X2YA 3DBXB 2OSLA 2G9HB 3U6RB 3G08B 4OB5H 4RMSA 1JWUA 1T80A 3Q0HA 4X0KB 2DKUA 4IDJL 4XPBL 2O61A 2NY4C 4LLYA 1AXTH 3D3VD 1X5AA 5GSRB 1LK3L 1BFVL 1P4BL 2EC8A 2GJZA 2C1OB 5HYSA 3RU8H 2W59A 3S34L 4X6CB 4M7JH 1WTLA 3CGTA 1Z3GL 2QQLH 3MRCA 5LWYL 4PJ8B 4IRZL 4F33B 1KF9B 3MV8A 5TE6L 4HXBL 4QWWD 1JJUA 1T21A 3O4OC 5CGMA 5L2KD 4ETYA 2D03L 5JDSA 5GHWH 1JPSL 3AS2A 1A7RH 1EDQA 3PWPB 5T5NF 1INEH 4BQ9A 5IKCB 1A7BA 3IYLW 4Q9RH 4LRIA 4MA8L 3WYRA 1P53A 1RUKH 2B1AH 1IGMH 3V4UH 3EHBD 4WENB 2Q7YB 2DQHH 4PJXE 5C09A 1J1XL 4L4JA 4PJAB 1QR4A 5I9QC 2WQRA 1FZKA 3P9WB 3L7FB 3VJ6A 4OZIB 2OR8A 3RA7L 3T0EE 1RUML 4XNYH 3SDXE 2ERJC 3B8SA 3KNBA 5E1AA 1BVKA 3DV6A 4K9EH 3ARUA 2B20A 4DW2H 2YPLD 1OAXH 5HHOA 3IDIB 1XR8A 1BEYH 3DI3B 1KNOB 5HDOA 5C0FB 5HXMA 2VLRB 1I9JH 2WANA 1YJDH 1ZLVH 1MCBA 3L3KA 4CBPA 3RDTC 4UILL 1NKOA 1INDL 4JKWA 3CZJA 3BP4B 1F6FB 2PW2A 5C9JB 5GGVH 4ONFL 4ZUUA 3GIZH 4JY4B 4H0GA 1ZWIB 2OL3A 1NGQL 3MOAH 2P8LA 2BNQD 2E9IA 3HLAB 4AIZB 2X4TA 3VH8B 2XZQL 2FL5A 2CIKA 5DEFB 3OKKA 2APBA 5ID0A 4WW2F 3WBDA 3DVGA 1V5JA 3CVHH 4S1SL 2XPGB 3BN3B 3ULSB 3LKQA 5J06A 4O51A 3PGDA 5CKGA 1R3IH 4LCWD 1QFWH 2E6PA 2XFXB 3U46A 1J11A 2BK8A 5EC1B 3UYRH 5DMJB 1EO8H 1QFUH 1I9RH 3BZ4A 3VU2A 5BQ7A 1AGDB 3GKZA 4XRCA 2VDKL 4JO3H 5FV2A 4O5LL 3O6FA 5ALCL 4S1DD 2BXYA 3RPIB 1NAMA 4LHJB 1XF1A 4OF8A 2GSIA 2IANE 2H2SD 1KLUA 5DQ9B 5F7UA 4NQEE 4X5WB 1WSST 3MUGA 5I1GL 3D85D 2HTLC 3BO8A 1I4FB 2EDFA 5C0GB 5JMOC 5FYKL 2F53E 4JFDE 1ZA3A 3ARDA 1RUAL 5I19L 5IVOA 4HIIB 4LEXL 4UUJA 1UWXH 1IT9L 1A1OA 2W60A 5KSVB 1CBVL 5I1JL 2NYYD 4PRNA 3U4EA 3MRDB 2EDYA 1NAKH 4PGEB 1KSRA 1TNNA 4UV4L 3ZKSD 2MQCA 4LGSB 4K8RD 2WP3O 3NACL 3RNKB 5HY9B 1K9TA 3OX8B 4NZJA 1XGRA 4PRHA 5E9DD 4U1KB 2FSEB 4BSJA 4NKIL 2VLKA 4ALAH 1R5VA 1MIEL 4X7SL 2JCCA 4G80A 3VFPA 4NQCB 3C60A 2WBKA 3TNNA 4CW1B 2AKRA 4PUBL 3O2WL 4JJHA 4PJDF 4QF1B 2NXYD 2NW2A 5E2TL 3VD9A 3OSKA 1ZE3C 3BYTA 4LCYB 1I7ZA 4OF3A 2CMRH 3E3QC 3S5LG 4HHAB 1V7ML 4GQ9L 3GI8L 2NY0C 5DFTA 5E6IA 5MERA 1WBYA 1S78C 3OKEA 3QH3B 4OLVH 3SGEH 4HAFA 1FZKB 1OAQH 1VADA 4LHUA 2VSDA 5HVGB 4XP1H 5SX5H 2DDQL 3W39B 1BQHG 2IBZY 1NBZB 1U3YA 2ITDA 3EJZD 4KJWD 4HK0A 3QDHA 3BPNB 1WICA 1XR8B 4YHOH 1MJJB 3B3IA 3FFCB 1XF5B 1MRCH 3BPLB 3I9GH 3T09A 4TSBH 3FKUS 5D7LB 4IOFC 1R3JB 1UWEL 1WC7B 5HI4D 3K4ZA 3VXSD 1QBBA 4KK8C 2R2BB 3W11D 3IDMA 4KAQL 4OCYH 1RJZA 1C16B 1NLDL 3LEVL 2WIMA 2VL4A 4KI5E 3TYFB 5JZ7D 4HS3A 4ZUUB 1JBJA 2OZ4H 3DUSB 1CLOL 1ETZB 2F5AL 3HC0B 3ARBC 2GHWB 4XVJL 3DUUB 3TIDA 2VXUL 3T77A 5C07E 1JGUL 1ZHNA 1CK0L 2FL5B 4NDMA 3SDYL 5CEZH 4OFYA 3C8DA 1QZ1A 3OKKB 1FC1A 3AB0B 4M8QA 5FCUH 5CSZA 2UZIL 2H8PA 2KPNA 5IMLA 3SKNA 1T1WB 4JM4H 3AXLA 3SO5A 3UAJD 2F54B 3X14B 4K07A 4Y1AE 2AXGA 5IVXE 3O6LH 4U2ZA 2W0FB 4JFFA 5HDLA 3LRHA 2CLRB 4YK4C 5JOFB 4IM8A 5HGHA 4WWID 3NCJL 3O6FB 1GGBH 12E8L 3QULA 1T0MB 2HLAB 2CDEB 2Y6SD 4A2LA 2A77H 3VFMA 4X4YB 1RZFL 3REWB 4UAOC 3C6SB 3QZWB 5F1NA 1DLFL 1QSED 4X6EA 1BZ7A 2VC2L 4Y16A 3VGHA 3WEXB 3VE0B 4UZGA 4PDCE 5D5MF 3QJHB 2ZPKH 2C7UA 5I1KH 3ARDB 4FQ1H 3CDGA 2VXSL 4QXTA 3IDYC 3HAEB 4G3YH 2DMBA 2W60B 4FQ2L 2PCPA 3GSWA 2Z8SA 3OJDA 2R0WH 1ZT4B 5DVKA 2R23B 3LEXA 1G6RB 2Q8BL 3QUYA 4O2EA 1CFQB 2VZ3A 3L5XL 3FFDA 3RKPA 1RUPL 1FFPB 5CMAB 5GGSA 5KANI 2RHEA 4WUUB 5DGQA 1PLGL 3HTLX 4N8VB 4PRHB 5MI0B 4OLUH 3BEVA 4PRPA 4ZNEE 4XMPH 3CLFH 4PJFE 3Q5YA 3I3BA 1HHHB 4YBQC 3D18A 4XWGL 3WV0A 4P49A 4EI5D 4HDIB 4NZUL 2EO9A 4FXGA 5DTFB 1Q0YH 4E42A 3MNZA 2Y4SA 4EDWL 4FQLH 1MI5A 1IGFH 3QUZA 4UQ2B 1NUDA 2I24N 4UDUB 4L3EA 3MLVH 1HWGB 1MPAH 2UUDH 2R8SL 4PLNC 1IGTB 2X4PA 3O3DA 5IB1B 4IIQB 1CTOA 1D5BA 5K9OB 4OV5B 5JW4Q 3SKOA 3AC0A 1HQRB 2YN3A 2Y72A 3HFML 4Q6YA 5IG7A 1HOCB 4BZYA 1AE6L 3HG1E 1JUFA 3HUJA 3MUY1 3BQUC 3MLUH 5BV7L 5HYJA 1FSKC 2E7LA 4HK0B 4IJ3C 4BA8A 4TUKH 5D2NB 5CIPH 4JY6A 4WTWA 1QFHA 2LABA 1U8NB 3ME0A 1XZ0A 4F7MA 5F89A 1DQDH 3N1QC 4MB3A 1I3RA 1I85C 5L9DH 5B4MD 1MFDH 3ZE0E 2E5EA 1NBYA 1YEGL 3GBML 4HUUB 4JM2A 2FYYA 5C0DB 1FL3A 5CAYB 2QTEA 3G5YB 3FB5B 3BJ91 4BUGA 4GG6F 5EU6E 3GGWA 5FHAL 4F7EA 3NH7H 2Z9TA 4N0RA 2VYRE 3O81A 4YHIB 3QDGE 2AABH 4BSWB 1V3KA 3PGCA 5H94A 2V9RA 4IOIA 5I1AB 2Q7NA 3PHOA 5D7IA 1P5VA 3WNKA 3SE8H 1ZSDB 2YXMA 5D1ZD 5TFSL 1DFBH 5CCKL 1FZJA 2GT9A 2NY3B 1RZIB 4QWWC 1P1ZA 5EUKA 4XH2B 1MHPH 5DWUH 2XG5A 4J4PD 5CEYA 4DUWA 4MS8D 1KPVA 1IAOA 3KYOB 1J18A 3DRQA 5D1QB 5E2VL 1T5WB 4LCIH 3TH3T 1SEQH 4NQXB 3K2UL 5C0EA 3WIFB 5HHME 4F7PA 4KVNH 3SKMA 3IDXH 4AJ0A 5IQ7L 3K1DA 2DLFL 3EHBC 3HZKA 1U8QB 3IU3B 4FNLL 1ZGLM 2W91A 3QFJA 4NKQB 2V17L 5GPRA 1TJHL 4TSCH 1QNZH 3EYFA 5ANME 4CADA 4J3TA 5J9PB 2VNCA 4H26B 2OJZL 1KB9J 4OF7A 4O02H 4UU9A 3GSXA 5FYLL 3C5SB 1PKOA 3FT2B 5E4IA 1K8DB 1UB6A 1BZ7B 3P77B 4NQDA 1NMAL 4HFUL 4HK3J 5DJ0A 2JIXB 2BERA 5J56B 4NUJB 3EDDA 5JIIA 3KYNA 4DK6A 3V6BR 4ZFOL 4FQJH 3VG0H 2RR3A 5IW6B 2R4SL 1JVKA 2GITA 4XNMA 1A22B 5T1LA 5HDQL 4LSRH 2G60H 5T3XH 5J1TC 2UZXB 3M8OH 1G9EA 3OJDB 4XP6L 1T20A 3DIFA 2V5YA 4P2QE 1LP9E 2DQGH 3I6KB 2GKIA 4MD0A 3U4BL 2BRQA 5TE4L 4P4RB 3TO4A 2NY6D 3FFDB 4GRWF 1R3HA 3X17A 3EUUA 4OQ1A 1X3DA 4L8BB 3SBWA 4HCRL 3TBTA 1KTLA 4Y19B 3NOIA 3RWHB 3MXVL 4KMTL 4M5ZL 5GRVK 1E4JA 1JFQL 5IF0A 3CFKA 2W0PA 1UB5A 1YEEL 4HWEL 4GXUN 2DM2A 1WZMA 4XXCC 5E6YA 1UXSA 1I1AB 3QO0A 4ZFZA 3WJJA 3QXVA 3X3GL 1KCUL 5IMOB 2Q1EA 4LPXA 3WIIL 1JMXA 3GSNL 3LKSA 1U3HC 1DP0A 3GMMB 4LK4A 1HH6B 2RQ8A 3NZHL 5K59E 3BE1H 1G7LA 1U8MB 5IMMB 3F8UB 5ITBL 3QPXH 4IHOB 3VFWA 2X1XR 5ICXB 3V0WL 5KVFL 2IADB 4UTBL 4TNVK 3P2TA 4ACPA 2VXTL 1OVZA 4QOKB 1YEIH 1CDYA 2FB4H 3FOLB 3SO3B 1C7TA 5FYLE 2R0ZL 5DSCA 5B3JF 4HW6A 3GM0A 4X4MA 5LBSH 1TZGH 5C0IB 1J0HA 3QR2A 4M4PA 4P4KA 1TFHA 1PY9A 2PYEA 1VFUA 4XPFH 4ELMA 3PP4L 1YMME 5A3ID 1MLCA 2E9WA 3W9EA 1KJVB 3SGJC 3X12A 2V7HA 3V6OA 3AROA 1MFBL 2JELH 3A0OA 2E27H 3P0VL 4IS6B 5TDNB 4N5EA 4OTXL 4P9HC 4X7TB 5KS9E 4I18B 4XCCL 5JHLL 1KXTB 4IOIB 1QP1A 5C0CA 4G9FA 2XNAB 5I15H 2DF3A 5MEPB 4OZ4B 4P2YA 2XA8H 1J7VR 3RGVA 2QSQA 1FZJB 2KZ1B 1YN7A 4YGVB 5EUKB 4UIKL 2DLGA 5D2LB 2NXYC 3BWUC 4U6VH 3FTGA 1RIHL 1Q9LB 3U1SH 1YNLH 2QSCL 4YFLF 5F7YC 3KLAB 2J8UB 4N68A 2EECA 1FAKT 1P9MC 5FO9A 1C5BL 2DQUH 3QXUA 1YN6B 3VFVB 4GXVH 4RFNB 4LU5L 1UXWA 3S35X 5D9SB 2VOTA 2P5WD 3BD4A 2BOBA 1T2XA 4N8CL 2W92A 4LDEB 3X3FH 3QIUD 1I1RA 3MZGB 4UU9B 1AR1D 4U3HA 1J1PL 3C87A 4APQC 5ID1B 3HC3L 5BVJB 2IFFH 3TF7C 1QEWA 3BKYH 4YQXH 1Z2KA 1NC4B 1NCCH 4P23B 3E1F1 1J05A 2HT2C 2PW1B 2I27N 5F9AC 4EUPH 3RWFB 3S3JA 1FZMA 1EGJA 4X99A 1T2QH 3T04D 4RGMB 1T20B 4WNQA 4P46A 3T0DA 2YZ1A 4AENB 3MA9H 4WI4A 3AS1A 4NHUB 5IIEB 3CC5A 3TO4B 2P5ED 4WU7B 4X6CF 2YD8A 3UTTB 1BECA 1PVHA 5IB4B 2A73A 4JO4H 2EEDA 1NCWH 4WEMB 4E41B 2PR4H 1XF4A 1NCBL 2WUBL 4ZFFB 1RU9H 2FJHB 4PREB 2R1YB 3QJFB 4JAMA 5IF0B 2DJ4A 3C5JB 4UI2A 1PY4A 4OJFH 3JTTA 4X5XA 5I30L 4MA7H 5IBUG 4LPUA 5CJ8A 3LPGA 4PGCB 4YBLC 3HI5H 1N6QL 3QO0B 5MEOA 3GK8H 3UJJL 2YBRA 1MFEH 4NCDA 4WW2C 4PJGB 3SDDB 2DQCH 4ZSOE 3G6AB 2EDRA 5DK2A 3NFPB 3MLPA 1UM6L 1E6OH 3E3QE 2I5YH 1BVLB 1NCDH 3TZVD 3ILPA 1P4IL 2YRLA 5IB2A 1NCAH 4OD2A 3VFWB 5I1IL 2FO4A 4U6XB 1QLFB 5KAQF 5IR1A 4TQEL 2HJFB 3IFNH 3EDFA 2XN9D 2CXGA 1NSNH 4A2MA 4L1HA 1DQJA 1I8IA 2GSGB 1X44A 3AREA 3SKJL 4GUPA 3QRGH 3H7BB 4IOSD 5AZ2H 4JFOA 3CH8A 1LK2B 3VXUB 3MGTA 5CEXA 3RZCC 1BM3H 4CJ0A 3UTSD 4H1LB 3ZYOA 3FHAA 3I6GA 4WO4D 1EXUA 4Q58C 4Y5VA 4Q74A 3WJLC 4K2UL 1MLCB 4U0RC 3SCMD 5HBBA 2ZG2A 4GG8B 3PQYA 5JLZA 4OUOA 4WCYL 4L4TB 5HHQA 4PY8I 3QI9C 2FJGA 3SJVD 3HI6L 2VABB 1BBJA 2YUZA 5GGQL 1Z6JT 3OJ2C 4PD4K 4PP1C 1TTFA 4LDLB 2FBJL 3IVKB 4M6NH 4PY7B 1KN4L 1LO4H 1NUNB 5C08A 3MZTA 5DF0A 1WWWX 1YEJH 3OGCB 4MNQA 1CN4A 1U8HB 5E8PA 1A6ZA 4N5UA 3UYPA 1FDLL 4LLQA 3GJEA 1MCPH 4K94C 4YC2C 1JTTA 5J6HA 4M5YH 5CUSH 1U42A 4DGYL 5FYKU 4PJIA 1AGCB 1ADQH 3BRGC 3LPFA 4S2SB 1OTSD 4HKJA 2V2WB 3QEGH 5DO2D 4IMKC 1IM9A 4R3SB 2JJSC 1TZHA 3FN9A 5DVNA 5I74B 1W2KT 2HT3D 4XBEL 5J1SC 1DBBH 4KZEH 1B0RB 4OI7A 3DGGA 3O41B 1ZHKA 5C0JA 3AAZB 2I07B 1C08B 2EKSB 5ENWA 3WUZA 3THML 5KANG 2WAHA 4EXKA 5DRNA 4OF5A 3IAGC 4F57H 4NO0D 1CVRA 4TOYL 2E3VA 1SYVB 1YEKL 3O8XA 3DVNA 1XGUB 4MX7A 1DEEA 5L8JB 3A6CH 5L0QC 4P46B 3LKPB 1KCRL 5E8DH 3W0WD 1UJ3C 3GMLA 3ECBB 1CT8A 1ZGLP 1FYTD 4PGDA 3HKFA 1KIPA 2VQ1B 4HH9B 5CD5D 1U3JA 4CVUA 1MJ7L 1FAIH 3QEQB 2CLVA 3ZZ1A 2D7MA 5LAXB 3DROA 1UGNA 4N0UE 3NGBB 3EFFA 4LSQL 4MDIB 5CSBA 4DGVL 1PZUB 1FCGA 2BVOB 2J8OA 4MS8C 4OLYH 3TEUA 3P73B 3MBED 3TCLB 4PBXA 3L1OL 3TBYA 4HIEA 2KUTA 1DN0B 1EEYA 2ED7A 2CR3A 2GK2A 4NQSB 2E9BA 4G7VH 4JO1L 2R1WB 4OLXH 5EBLA 1IC4H 2B0SL 1JF6A 4CU7A 4K7PH 1G0XA 4N0CC 3MBXL 3MV7D 4L8DA 1KJMB 3GSQA 2ICWB 4I48A 5DD5H 1GAFL 4A6YL 1WFUA 3GBNH 3VFNA 1XR9A 3SDCA 4DWHA 1NBVH 4JHAL 2CXKA 1OW0C 4EVNB 2VDNH 2ZCHH 5EOCL 2ZOLA 3AREB 2P47B 5BO1L 4OGZA 1A5FL 4L29A 3KPNB 1AO7E 4XBGB 3MRJB 2B2XL 4FP8H 2RIKA 3K80A 4O2FA 2NY5H 4FTVE 3RUGE 1K5NA 5C0AB 2Z8WC 4NHCH 1C5CL 1MRFL 5IEKB 5GGUB 1BAFL 4PV9A 4KV5E 4FQHB 1A02N 4I2XA 5E56A 4HUKB 2NY6C 4Z7WE 2DLHA 3H9SA 2IANA 1E6JH 4K3DH 4V1DE 4PS4H 1F2XK 2IAMD 5GRUL 5FA4A 1B4JL 3V4VL 3VFUA 5KJRH 3BWAB 4OUUB 3FQRB 5DMKA 2A0LC 1F4WL 4JFDA 5DQJA 5J7CC 4MNQB 3O6KL 1AQKH 4KJYA 1KBGH 4CJ1A 1XCQA 4NSKA 2BNUA 5EZJB 4F2MB 2YD5A 3MYJA 4HPOL 3F12A 5FXCH 4L8SA 5IBTL 2X1OA 1LMKA 1IARB 5DK3A 3UPAA 1KYOJ 1BFVH 1N7MH 4JPVL 1VFOA 3HNTL 4FQPA 3S34H 5C1MB 5FDWB 43C9A 3MRFA 2V7NA 1Z9OA 3OR6A 5I8CA 5LWYH 1IM9B 4IRZH 3IDGB 2W38A 3ZDYF 1LD9A 1P7QB 4G6AD 4JY5L 5TE6H 1AXSB 4HXBH 4XZUB 2PKDA 4D0DB 3UROR 25C8L 1B3JA 1T1YB 3O11B 5FAAA 4GRMA 4IRJB 4HC1A 1MREH 1HI6A 3JWOL 1ZHKB 4JGUA 5HYQB 1B9ZA 4NN5B 4LEOB 1KFAL 5J6GA 2DTML 2YPLE 3C6LC 2XZZA 4BSVB 4OCSL 4Z95H 2J5LC 1N2RA 3QNYB 1CF8L 4HKZA 1IC7L 2F8OA 4JPKL 1NGXB 5A3IC 1KB5B 4C4KT 1KULA 4OGAC 3RA7H 2G5RA 4E5XB 3CZFA 1JYXA 3V8OA 2CDGA 1GRWA 1YY8A 4PJ5D 1RUMH 3BKJH 4K8RL 5T5NG 3TBVB 4LNRA 2XG4A 5EORL 3VWKC 4P9HL 4PGDB 4AH2A 1VHPA 3B6SA 2PXYB 2JCCF 1HSAB 4UBDC 3MLTB 1IEBA 4OIIH 1DDHB 2NLJB 4R6UA 5JR1H 1XH3A 3PDOA 3EFFB 3WNMA 1OTUC 2JB6B 3TBYB 2NTFA 3WFCH 4Q9CA 4ONFH 2QADC 3MV8D 4ENED 2X70B 3WL9A 3QHZH 4Y4KB 3DPBA 4NN7B 4Q9QL 3NCEB 4PJBB 4KROC 2DWEA 5ISZE 1EZVY 5B8CA 1IBGH 2XZQH 3QUML 4QRPB 4J8RB 5IV2A 2D31A 4KRPB 3S88L 5C07A 2YN5A 4PRAA 2VN7A 1AR1C 4XHJD 2NX5B 4XNQB 4OIAA 5C09D 1JZ4A 2ZSVB 4NJ9H 5KW9L 2EDEA 4AQOA 3MLWH 2OP4L 4L29B 3OKLA 3HMWL 5KOMC 3DX7A 3NCCB 2GJJA 2H41A 5KOVC 2VDKH 1JPFA 4DCQB 3QQ9D 4O5LH 5HHOD 2E7BA 1JHLL 1K5NB 1M7DA 4JN1L 4FMKA 5GRZA 3BRDA 4MQSB 3MV9E 4I2XB 4QRTB 1UZ6F 4Z7UE 5I17A 5I1GH 1GH7A 3M1BA 1G7IA 1T1XA 3H8NA 5I1EL 5FYKH 1A0QL 5KVMC 5FGRA 5E9DE 5I19H 5FA4B 2EIEA 5I2IA 4LEXH 1KJ3H 4NNPH 1IT9H 3MSPA 1V7NL 5AAMA 4XNZB 4Y5YB 1BLNA 3CVHA 1CBVH 5DQJB 5I1JH 2FBOJ 4BM7A 2H2PD 3MCLH 5DUML 1DQLH 1RV6X 4N8PA 5DRZB 3MCG1 2MQ3A 2HN7A 2BNUB 5EOTA 2EH8H 3MYJB 3EYUL 3HN3A 3OG6B 4JZOA 1ACYH 3G5VA 3L7EA 2AEIT 2YUXA 3QUXA 1QO3B 2HYMA 4F15C 3KAAA 4OFKA 5JO5A 3ISWA 3F6IA 3WS3A 4NKIH 2WBJB 4X7SH 4JQIL 5IHUL 1WZLA 1LGVA 1CFTA 4TSAL 2H3NB 1HYSC 3VI3F 4ZNEA 3MNVB 3N1GC 1GZPB 4PJFA 4PUBH 3KPLB 5FA3A 3O2WH 4F9LA 4HS6A 3IU4L 5H2BA 3RL2A 2BHYA 1BQHA 5EOQL 3O6FD 5LGHL 4Y5XB 5F9OL 3WKMH 1V7MH 3WHXA 1E4KA 3PIQB 1QQDA 4LGRB 3T4AB 3UC0L 2EYSB 4IRSB 3MACH 3ARDD 4HJGB 3QFDA 4OI9A 4GRLA 3BMVA 4QTHA 3LV3B 4O58L 2DDQH 2RCSL 1YY8B 2AEWA 3HG1A 3WO4B 1Z5LA 4P59L 1F6AA 5I1DA 4BFBD 3LN4A 1U6AH 3B6SB 4MAUL 1MCNA 1IEBB 4ZXBC 1UA6H 3H9HB 5CBEA 4OCRH 3DETD 4C83A 4PRHD 1Q94B 2D7NA 4FFYL 4KAQH 4PB0H 2VLKD 4AEEA 2R56L 3C60D 3VD5A 5HJ3A 4X7FC 4Y7MA 2VDML 3P4MA 2PTUA 1ONQA 2V5TA 2F5AH 4PG9B 5EU6A 1SJEA 3LDBB 1ZEAL 1WISA 4RGND 4NWUH 3RAJL 3OQ3B 2VXUH 3ARFA 5DUBA 4U31A 4RX4A 3QDGA 1JWMB 1QVOA 3MRIB 4G42A 1RMFH 3J8F7 2UZIH 1DBKL 4K3JH 1CE6B 3TA3C 1QLEL 1S8DA 5E6ID 4FQXB 1FLRL 2H26B 1QSEE 1CLZL 4QHUA 3RY5A 4H5SB 5F9JB 5INCB 1VENA 4LHUD 4UOW0 1ZLSL 4OLWL 5FOBB 2PUQT 5HHMA 1FFOA 1ZLVK 4OSUL 4KRMB 4YHML 1JNLL 2DLIA 3ARGB 4JDVA 3CFJB 2CRIA 5GS2D 5F1SA 1WAAA 3L3DA 1I3VA 1HILA 1FNEB 4WFEE 5GGRB 3JTSB 3JV6A 1PEZA 4HIXL 3DX8A 5BMFL 3SDAA 1E4XI 2VH5H 5ANMA 4ZAKC 2VC2H 2R1XA 3W9DB 3GMQB 3OKMA 5F97E 4AT6A 2OZ4A 4H25A 2X44D 2OK0L 4KKCC 2CR6A 4ZO7A 1JV5B 3S96A 4MJ5A 3P4NB 1NJ9A 4U1MB 1G7HB 1VERA 4WI9A 4BUHA 4PJ8C 4OFYD 2DQTL 4JFHD 3RWGB 3OXSB 2J8UF 2AV7B 1WCBB 1QBLH 3JZ7A 1P6AB 3G5VB 3L5XH 1QRKA 4P2QA 1LP9A 4JQXA 5DS8A 5DRWA 2ED9A 2E8YA 4WI2A 1FL6B 5D1XB 4PJDE 3ULVF 2P7TA 2K3TA 2W07A 1IZKA 2VIRA 2C4XA 4NYLB 1UKTA 3QWQB 4M48L 4XWGH 4JFFD 1MCHA 5FK9B 4NZUH 4YPGA 4YZFF 1FVCA 1BD2E 4FZ8L 4G8EA 3O3AB 3RL2B 4JFYB 4H0HB 1JHTA 3QCUL 3CAFA 1OWRM 3EFDL 1HHIB 4NWTL 4DZBA 3DSNA 1A3LL 3OGOE 4JANA 4U6TA 2CDFB 5AD0A 5JIPA 3GKWL 4J3OC 2HWZL 1UWXK 2O5YL 3WIHA 5C2BH 1YYLL 1W72A 4Y16D 1A7OL 1SJHB 3F62A 4KTYA 3IAPA 1KGCD 3UPCA 3WFDL 1K2DB 2GIYA 1NGYB 4HKXB 4ODSL 3MRRB 4UQ3A 1DBAL 2YS4A 3BPOB 4ZUVA 1PG7X 4MD4B 2BMKB 3TT3L 3C8KB 2DLTA 3FRUB 3QUYD 3VFSA 1MIMH 1EX0A 2DIJA 3RWDB 5J12B 5DHVH 1YEGH 1C8PA 1QKZL 1KIRA 4G8FB 5CJOL 3QO1A 4NRZA 4PRPD 2DMCA 3BKML 5JW4N 1JWSB 4WGVB 5FHAH 1YMMA 2DYPB 2W9EL 3RDTA 5HJ3B 5AWNL 2JLLA 3AY4C 2ENYA 4LBEA 1YEDA 5DJ2A 3IKCA 3STBA 1X5ZA 2NY2D 1MI5D 4MMZC 3EDJA 3QUZD 2R0LH 3D6GA 1RULH 2R69H 4L3ED 2KDGA 4G6AC 4Z18A 3L3GB 3CMOL 2DQIL 4HCRA 5SX5K 2OTWB 4L5FL 2WZPD 1WV7T 1MWAL 4QHUB 4WJ5A 5K9KA 4HIJA 5IQ7H 1S9YA 4LSPH 2AV1A 4LRNH 3BYYA 3KYMB 5HYJD 1MQKH 5J13B 5ACMA 1OAZL 2PTVA 2V17H 4X4ZA 1A2YA 3NMEA 4FS0A 1PGRB 2OJZH 1IC5L 3HZMA 3DHJA 4LVNB 4Q0XL 4RAHA 5D5ME 3T1FA 3PP3H 4CVXA 1WBZB 5FIEA 1NMAH 3OAZH 4JM2D 4QT5A 3OKMB 4NRYA 1H8SA 1V8HA 4AIXA 1P2CB 1KCGC 1JMZA 2P49B 3AFLA 3BKCH 1AGEA 5E8EB 2XI9A 4EXPX 3ARYA 6CGTA 2XKNB 4DOHB 1UYWL 4V2CB 1FFNA 5CZVL 3VXTA 5HDQH 3KLHD 5KVDL 1WBXB 3QQ3A 4LPWA 3FAXA 5IVNA 1RFDH 3NA9L 2OMBA 2Y07L 2BSTA 3BW9A 3U4BH 2AEQH 4UIMB 5CP7B 1S9WA 4WDIA 1LE9B 2BVPA 5SWSB 2FR4A 1EJOH 1T4KB 2X1WL 3DURB 2ICEA 4GS7B 2HJKA 3PABA 4N1EA 2HFFB 4FXLA 4UOW1 1HWHB 5EBWB 3MXVH 2VQTA 4KMTH 4M5ZH 4AY0A 4XCEB 3BZEA 5ESAA 4R2GB 3PHQA 1FO0L 3U9UA 1Q9WA 4JPWH 2VN4A 1U8PA 4HWEH 5IFAL 4ODHH 4ZO6A 4AEIL 3E8UH 4YPGB 4BK4A 1CU4L 3QFJD 3ZLQC 3X3GH 3O45A 4HLJA 3LQAH 3ULVD 1KCUH 4Y4HA 5HGBA 5DD1H 1N3NA 3TIEB 3WIIH 2EIZB 1BZ9B 5F6HI 4NQDD 3IDNA 3NZHH 3B9KB 3RHWK 3UEZA 4ZSOA 3BPNC 3QQ9C 4UV7H 5ITBH 2RBLA 3E3QA 4HH8A 5C6TH 4UTBH 4POZC 4RMVA 2XWBA 3V0VA 1MFAH 2C3GA 1H3VA 3BPLC 4RISL 1B2WL 1Q1JL 5T1LD 3V4PL 4OT1H 1RVFH 5KSAA 4RMTA 2R0ZH 1RIVL 5FOJA 2QKIB 3MJ9H 1K4DB 4PTUB 1OGTA 2IMMA 4IDLA 1Y6KR 3EO1B 3N85H 4EN3B 3REVA 3VFSB 2GJ6B 2YA2A 2A6DA 4GAGH 3TO4D 1NFKA 1MHHB 4M3KB 4GG6E 1Q72H 4ODBD 3ZE1E 4MQXC 1ZA6A 2WSKA 4M7ZB 2OLDA 1FH5H 5CFHA 2F9BT 3AB0C 2O5XH 3KPRA 5DC0A 3KDMB 1JGVL 2EDLA 4RAUB 3IFOA 3ARZA 1E28B 1EVTC 2UUDK 3IXAB 4K3EL 1CDUA 1MF2H 4XCCH 5FM4A 5JHLH 3IKCB 1H3PL 2DD8L 1SM3L 5C9KA 1IAII 5EN2B 2MKWA 6FABL 1A4JA 5IWLC 3ARBA 3MRBA 3CPLA 2P5WE 5D7KD 1UZ8B 1S7XB 4UIKH 4X83A 2RJMA 1VACA 3MRMB 3WLWC 1OSZA 3ZT5A 3O6FC 2VR9A 1Y6NR 1RIHH 4IMLB 5CIPB 5HI5D 4XT1C 5K9KB 1LE5A 3HE6B 4WU5B 1C5BH 2UY6A 2IQAA 1T7ZA 2LU7A 2XWJA 1J87A 3TN0B 1E0OB 3MLYH 1ND0B 2V5SA 4PTTA 4N8CH 3ARDC 4G6FD 3S35L 3F65A 4P4KD 3RVVD 2V2XB 2PYED 2G5BB 5TDPA 2CD0A 3HC3H 4QT5B 2AJVH 3NIDF 3CXDL 3FQWB 2P5EE 1NDGB 2I60H 3CLEH 3PGFL 4GJTB 4DN3L 1CICB 1MHCA 1GGIL 2EYTA 3DETC 2Y06L 3QXAA 1WT5C 4JHWL 4N5ED 15C8H 1GL4B 3FOMA 2NNAB 1OAKH 5C0CD 4LLAA 2DQEL 4G9FD 4GRWE 4M62H 1A6WL 2YSSB 3NVQA 1FBIL 1YEHH 2HT4D 4OV6F 3RGVD 3HMXL 3V0AC 4PJIF 5GGSY 3O9WB 4WDIB 2CK0L 3NAAL 4MCYB 3SQOH 5T1KA 2FR4B 3W5MA 2DI9A 2VLLB 3PABB 1NCBH 3JWDC 4V3DB 2WUBH 4OQTL 1PKQA 5B38B 4G8GE 3U9UB 5FO8A 3GI9L 1DSFH 3O4LB 1YQVL 4IIQC 4LLUA 4N0UA 2AXFB 1UADC 3LCYA 4NP4H 1RZJC 4MZ2A 4Y4HB 3H9ZA 2D3VA 2C4FT 4P2RB 4CVZA 4KK6D 3MOBH 2CIIB 1BFSA 4NT6B 2DMKA 5D2NC 1FFQA 2RFXA 5F9DC 3VGBA 3KXFA 1P4IH 3AS0A 2AJ3A 3UTSE 2F8VA 5B3JE 4N0FB 3LKNB 4I77L 2BSRB 5J3HD 4PRDB 5IMKA 3WO3B 5GRJL 5KSAB 2VLMD 3UCRA 4QYOB 3ZDZF 1BOGA 3DSFL 5TPWH 3BQUA 4P46D 4F8QA 2MNUA 3L9RA 5TDOA 3REVB 3PWUB 3TM6A 4YIQB 2VZSA 5KAQG 4NFCA 3T8XB 4JGJA 5DD6A 3ALPA 1NC2B 3OG4B 3P40A 1NFIB 1I1CA 2NY3C 3RUGA 1I85A 4KGLA 1EIBA 3KPRB 4HWZB 4KJPD 3MR9B 5K93A 2M26A 3IFOB 2VUOA 5D1QC 3CSGA 4K7FA 5EU3A 2BOCA 4BH7B 4EBQL 4Z7WA 3MLZL 3MGOA 5DFVD 5DMGD 1RZ7L 4V1DA 2O5ZL 4GMSL 1GGUA 1JNHB 4TUJB 3CSBA 2IQ9L 4XBPA 1I7RA 3L6FA 4PGJA 1KTDB 4ESKA 4FFVD 2ESVB 2M1KA 4RQQB 2QLVB 4KZDH 1OSZB 3D5OF 3R1GL 3PV6B 4QHMB 3VH8G 4QRRB 4MJIE 4DGYH 4KK9C 3MRHB 5GIRA 5MENA 3WN5B 3ARED 4JZJB 2A9ML 3RWEA 3VXMA 3K74B 4NOBA 2X4RB 3KJ6L 1MCFA 1MCWW 3MXWL 3KPOA 5AAWA 5FM8A 1E4WH 5ERWA 3L5JA 4QCIB 3CDFA 5EULV 3OJVC 3W0WE 1KCVL 4WY7H 1CFNA 5TH2A 1FYTE 3ZKND 3THMH 3PQYD 4FFWD 3TJEL 5IHBA 4PR5A 2V6HA 5DYOB 1A9BA 1I8KA 5J1AA 3B43A 3QXAB 1CXFA 1X5XA 5FKPB 4TRPL 5ITFA 4YEEA 3OR7A 1EFXA 3MRKA 3TJHC 1ZGLB 1TVBA 2Z4QB 2DQFB 5C08D 1BPVA 3FT4A 4XHQA 3BN9D 4MNQD 2Z31B 4S10A 3HPLB 3L3IB 4ZUWB 1I1AC 1G7JA 1MJ7H 4OCMC 2B4CC 2GK0B 3VI4F 5IGXH 4OAWB 1QFPA 1R5IA 5GZOD 5LXGL 1HXMA 1MY7A 2A83A 4DFHA 4QGYA 4DGVH 3ET9F 3MV7E 4M6ML 1A6TB 3LMJH 4M3JA 1H5BB 3EYSL 3L1OH 1IM9D 4Z7NF 3TBSB 5HYSG 1UCTA 3ES6B 2VITB 4XXCA 4JO1H 4HXAH 2DAVA 4X98A 1BGXL 1ITCA 5EFIB 5HHPB 3SO3C 5DC9B 2E7LC 2B0SH 3TO2A 4EUPB 4XP4L 5KZCD 5ISZA 2DM7A 3P9MB 5EO1B 2EDQA 5DJDB 1U3HA 1RPQA 1GAFH 4A6YH 2VE6A 1GC1C 3RWJA 5HI3C 4F7TA 2X4OB 4MVBC 5DJ6B 1NMBL 5INDA 1UVQA 5F3HB 3O8XD 5EOCH 3ULUH 5BO1H 1A5FH 2A9NH 2R2HA 1TQCB 2VDPL 4GXUM 1IM3A 1JNNL 3KPSB 2I9LB 1S7QB 4ORZC 4JDZA 2H1PL 3B5HA 4U3XA 4LF3B 5F96H 1WITA 2WWMC 2X4NA 3BZFA 4JHZA 4P3DB 1ZHBB 1RZGB 1NEUA 1C5CH 1BAFH 3TV3L 4ONGL 4ORGB 1FN4B 3D0LA 1CGWA 3RL1A 4GKOA 5FUZH 4MXWL 5HHNA 3BRFA 5DZOA 5EZLA 1JP5A 3MV9A 3SGJA 5EU3B 3QG7L 4GKSA 1B4JH 1K6QL 3MRGB 1QOKA 3QDMB 4Q6IB 3HC4L 4RFNC 1G6RH 5ILTL 3JVGC 3VGEA 3U0TA 2YPVL 3ALXA 4KRPD 4HPOH 4ZQKA 4R4FL 1TITA 3ULVC 3BHBB 3K4DA 5IBTH 2R29L 4YX2H 2G2RA 2Y9RT 5C0BB 4Y88A 4HG4J 5GIRB 3SDCD 4JPVH 3LS4L 3NTCL 4GW4B 3SE3A 35C8H 1RHHB 4RWHA 4P23C 1P9MA 1Q9KA 4XNXL 2BY0A 2OQJA 1L6XA 4AYFA 1YC8A 1TVHB 1HHKB 5A16A 4XC1H 4NRXB 5I71B 4KHXL 1GZQB 1WK0A 1XGTB 3JWOH 3QIBA 5FF6B 2ATPB 4RGMC 2ARJA 4Y2DB 3DRTA 1A4KB 4OGYL 1HQ4A 3GJFH 1F58L 4PR5B 3BISA 4APQA 3TO4C 5A2LH 5EOCJ 5JQ6H 3H9SD 1U92B 2IAND 2W9DL 4OKVB 5BXFB 4XVTL 3QZWG 2Y7QA 3BAEL 1NH6A 3OR7B 1DQML 1D7FA 5TJWK 4YHKL 3KGRA 3HPJA 3BD5A 5DZLA 2JE8A 3O2DH 3FT4B 1AGBA 4JFDD 4K8RH 3VXRB 4NQCE 3FO9A 1OB1B 1A8JH 4Q97A 4POUB 1XGPA 1YEFH 3ZDXF 3HAEG 1VEMA 5JPMA 4K23H 1PW3A 5F1IB 3WJJC 5IHZA 3X13A 1T03H 3P9LB 3SDDC 4QY8B 5FO7A 2XQYG 4LLVB 4YXLH 3DO7A 5LVEA 3LPWA 4KXZH 4HMCA 5D6DA 3U0PB 2ATKB 5E2WH 5HGAB 5L2JA 3WFZA 1MSPA 1GGCL 1NAML 1OP9A 3VXNB 2H6PA 3DTXB 4HUWA 3BPCA 1VB9A 1AP2B 4ZUSB 2HTKD 5GS0D 2QL1A 1LEGA 1INQB 1CD0A 3U30B 2XXMB 4R7NA 2CKBH 2VLJB 4HGWB 4WW2A 4GAYA 4RNRB 1OAYH 1S7RA 1HNGA 2FLBT 3S88H 1FRGL 1XF3A 5ICZA 2ITCA 5HHOE 4Z76B 3RWJB 4UOJA 4HUXB 3FFCE 5CGTA 2ZUYA 1R5WB 4RZCA 3L5WB 4LCUA 4M7KL 1A1NA 4Y0GA 2VQUA 5CZXD 4KQ4H 1QYGL 3WE6B 2LFGA 5I0ZA 1ORQA 1WFTA 5F7FA 1G9NC 3V6OC 4F3FB 4W6XB 4J1UB 4G9DA 4HMDA 3BP7B 5FHBH 4FXKA 5DVLA 3VCLB 1QA9A 4L8CA 4JDZB 5IBLC 1OSPL 4WV1B 4JFZH 2X4NB 1KYOK 3IJSB 3HS0A 3L3JB 1FVDB 1FE8H 3SPVA 4FABH 4B5EA 1I8LC 2HT4C 2R2EB 3RZCA 3B9DA 5ETUB 2OMNA 2BJMH 4BFIB 1YUHB 4HIHA 3F7VB 3RKDC 2DKMA 3WJLA 1NPUA 3TWCL 2WMPA 3IDJA 4JFQB 1A0QH 2OX5A 3VFGL 1J1OL 1FHGA 4LSVL 1QFOA 3VGAB 3QI9A 2ICWI 2VDRL 2EYRA 4HGKC 3RTQB 5DURB 1AD0A 2PF6A 2XYCA 5T3ZE 4G8IA 4KI5D 3GO1L 3C5ZB 4LMQI 3GSOB 4NGHH 5IFHL 2GAZB 4RWYL 3U0TB 2AGJL 3RI5F 1IAIL 1RZJL 3N1FC 1CGUA 4PJ7A 5I74C 5C07D 3EYUH 3OHXB 3EOTL 4JLRA 5EZIH 4AL8H 3ZDYE 3ZTJH 3VXQB 2A6JA 4N9OB 3VD7A 1WAAF 1ZT7A 1FC2D 4OZHB 5IHUH 1W0VA 4H88L 3MOQA 3SKUD 3GHBL 2YXFA 4PJDA 5TGBA 5EIIB 2HH0H 1AIFA 3CSYB 3QBTB 5EA0H 4NPYA 4EJ1C 4IMKA 3MFGB 1HEZB 3WNOA 2JJSA 4WHCA 5EOQH 4Q2ZA 4U6HA 3QIBB 5KSUA 1N64H 1BBDH 1BD2A 5JDJA 4P46C 1REIA 4PJEB 5KSBA 3A6OA 4N9GB 3FN0L 4TUOA 8FABA 1RJYB 1DUZB 2VKXA 4HV8B 1D5ZA 4LIQL 5IQ9A 1L7IH 3MRQB 3UC0H 4ZYKA 4WUUE 4PRHE 3IFLL 3S37H 1G9MC 4X8JB 3NGBC 2RCSH 2JCCE 3K8LA 1J0IA 1OCWH 5LJYH 4WEBL 1ORSB 4LHQB 2MCG1 3GUTA 1JRHI 4L4VA 4DZ8A 3D2UB 2GYSA 3BEWB 3MYZA 5DJZB 5IHZB 2XXCB 3VRIB 4ZUTA 1YMHB 4GLRH 1VFAA 4HWBA 4OCLC 1A14L 2FEEL 4ZPVA 5A40E 3E2HB 3QUXD 3B4NA 2QBWA 4NUGL 5FKAB 3BDXA 2VTFA 1BX2B 4FFYH 4FFVC 5CJBA 3DXAB 3M07A 2H9GA 4UT6L 1HZHL 2R56H 2NZ9C 2VDMH 3BPCB 4LLMA 3X11B 3BUTA 4X5LA 4ZD3L 1ZEAH 5BOPA 3QDJB 3PL6B 4UDTA 1NGWB 3RHWF 3EOAA 3AREC 3AU1B 5D2NE 3H0TA 2CRZA 2ITCB 2ZSWB 3BP5A 4NQEB 1IAKA 2OBGA 5CILH 3VRJA 3NBNA 3EIFA 3HNSL 4YDKH 1QLEH 4HT1L 4N0CA 1FLRH 1A1NB 2F53B 3I75B 1CLZH 3ZHKA 3RVXC 4YDLB 4XAKE 4OKDA 4GRLD 1WTGT 3BZDA 4XCFL 4OLWH 1ZLSH 2FATH 2AXJA 4R96B 1OW0A 3ZKXB 4OSUH 3HG1D 4YHMH 2XTJB 4NC2B 1KXVC 4KPHL 5I6XC 1KCLA 2YOCA 1UZ6E 3CFCL 3OZ9H 2NCMA 1KEGL 5GRVL 4JKPL 5BMFH 3U36A 4MQ7A 4UMGA 4JFHE 2Y23A 1KPUA 4NZTL 3GB7B 5HGDA 2OK0H 5D5MA 4UB0L 2EICA 2Z93A 1RZKC 3LN9A 5C7XL 2MPAH 3KPQA 3LQZA 2X9XA 2R39A 1WIUA 4H20L 5EU6D 3TPUB 4G8IB 4U0QB 4YR6A 4UNVA 1R3KA 4JFFE 3EOYG 3ARFD 2DL9A 4RX4D 3QDGD 5DUPH 1F11B 1HNFA 1NL0H 4KI1A 4NKMA 3ALWA 4PJ7B 1I3UA 3QPQD 4JPIB 1T3FB 2WWKT 2BC4B 4YHYB 5C0NC 1M7IA 4IRJC 3VI3E 3H3PL 4NN5C 4M48H 1TMCA 1JZ3A 1UH4A 1GC1L 1U8LB 1N5AA 2F74B 4GAFB 4U1NB 5HHMD 5IM7A 2Y5EA 3QEHA 2P1YA 4FZ8H 3L95B 3E6HB 3GMRA 4J12A 2FGZA 1KLGA 4U6HB 3QCUH 4CMMB 4JG0L 4NWTH 1BFOA 2DKSA 2XY2A 3SDAD 3MO1B 4I0PB 1CZ8L 4NO3A 5EU4B 4WHYH 5EH1A 2EH7H 4AM0B 3S4SA 4DN4L 1HHGA 2PXYC 2ICCA 3C6LA 5CEZD 4DKDC 3VFTA 2BZDA 4PRPE 4LOUC 2M8XA 3LEYL 4R26L 4MXVF 4RIRB 4K3HA 3LKOA 3DYPA 5E4EB 1OGAA 4DZ8B 1PG7L 3HE7B 5ACZA 5DJXB 4Y4KC 1MI5E 4X80L 2PO6B 4NN7C 4WHDA 3T2PA 4P2QD 1RK0A 5D7JB 4ZPVB 2B1HL 3VWKA 1QKZH 4LCCB 1L9MA 4M93B 4Y1AB 5A2IH 3BKMH 2NY4D 5IVXB 4KRPC 1TPXB 2H9GB 4R4NC 1S5IL 5FGBC 1AFVH 3ULVL 5DI8A 2D4FA 4P57B 4YFEA 4JR9L 3A6BL 2ZUSA 4WWKB 5JA9A 4QOKE 3MUHL 3K81A 3KPMA 1HH9A 4S0SD 3LVEA 2E7LE 2X7LA 2Q6WA 4ZOEA 1BWWA 2JJVA 5JORB 1JTPA 2A6KA 3Q6GL 2BVEA 3CMOH 5EBGA 1QBML 2DQIH 2NY1B 1MCLA 3PF2A 1MCCA 4L5FH 4G7YL 2X05A 2Q20A 2Y36H 4PV8A 1MWAH 3Q5TA 3R8QA 1H3GA 2VXVH 3MODL 2EDWA 5CJQH 4BH8B 1T7XA 1YNKH 5I1LA 1OAZH 1RHFA 1YNTA 2QHRL 3TH2T 3U82B 4R8WH 5LGJB 1OF2A 1EAPA 3B9EA 7CGTA 5BCAA 1VPOL 1LEKA 2ZUTA 1A7PL 1DBML 1R3LA 4Q0XH 4E0RA 1NGPL 1CGXA 4Y5YC 2YHGA 3MRLA 2QQKL 1D9KA 3VWJB 3IFPB 4HPYL 1N5YL 3HI1B 4MAYB 2GFBA 2ORBL 4JRXB 3DVFA 2AVGA 4U3CA 1N0XL 4H1LG 2MHAA 1X5JA 2XQBL 1YMMD 1NQBA 4DKFL 3RDTD 3PUCA 4QRUB 2J8UE 1MAMH 3VFOB 3EGSB 1A6UL 1A9EA 4HKBA 2WBJC 5JTWA 1GVIA 3DUHA 4Y2OA 3BP6B 2DBLH 2DJSA 3EYQC 2OI9B 1F3DJ 1F3JB 3F7YB 2EDOA 3FT3B 5AZEL 1I8MB 4KY1H 2Y25A 3ULVE 4R7DA 4DFIA 2YR3A 1N4XH 1HXYA 3G5ZB 3TGXA 1D6EB 2OM5A 4JFEB 2GY5A 4YZFE 4NQDE 2CQVA 3Q3GB 4ERSL 4Y5XC 1MJUH 3WCYA 2GUOB 4Z5RB 4GBXB 2CK2A 5IFAH 3UZVB 4L9LB 4NZRL 4G8GA 1DBJH 4LASL 2MMXA 3H3BC 3Q6FA 3T0BA 1XGQB 5HHXL 3V95A 3P30L 1OT2A 2FIRT 2YA0A 3HR5B 1G9NL 4EKXA 2LVEA 5DEGB 4XVSL 1J8HB 4PP2B 3WO4C 2M2DA 1GYAA 3LIZL 5ECJE 2LU4A 3BT2H 4EZMA 4NHUE 4ODVL 5BVPL 3T4YB 1ZV5A 1TJIL 1QFWI 2FEDC 5ESQB 5AG8A 4JFXB 4E41E 3WD5L 4ODUA 2HTLD 1M05B 1B2WH 2ZKHL 4NBZB 2BSSA 1I1YA 2G75A 4YXKH 3SN6N 3TYGH 1RIVH 4JDTL 4PPTA 4JKMA 4U1IB 3LKOB 3ZTNL 3RZWA 3VFRB 3WFEH 5E08H 1R0AH 3LDBC 5GGTH 5IVZB 1DEDA 1N8ZA 1EA9C 4I4WA 4YEFA 4RGOL 1UJTA 3QUKB 4ZXBA 1RZ8B 4KTDH 4K71B 3T2NH 3WS6C 2AJZA 4K3EH 5E99L 2QR0A 3IGAA 1S7WB 5DZNA 1RIUL 4UT9H 5CWSA 4FQXC 2DD8H 4YHPA 1SHMA 3KPMB 4YNYB 1MUJA 2XZAL 4K9EC 4NBXB 4Y4HD 2X7LB 5SWQA 3GIVA 1WFNA 1AHWB 2EE9A 1G7MA 3OXRA 1XT5A 1XGYH 5IW1A 3PJSA 2K9UA 3BGMB 1YJDC 3LN5B 4LLWA 3ARGC 4GSDL 2VDOH 5DMYA 1T89C 3BDYH 5BRZB 4P2OB 1EGJL 3QG6B 4PV8B 4ELME 1H0DA 1QSFA 2A1WL 5E2UL 2NY0D 1U8IB 1P4LB 1DL7L 3WHE0 4KC3B 5I18H 3FB7B 1BMGA 2I25N 3TA3A 3V6OE 5MEQB 32C2A 4MJIA 5KSAD 1S78D 4F8TA 2ADIA 4XPHH 2HVJA 5DHVB 1MOEA 1I9IH 2ZOKA 3CJJA 5C0CE 1G7QA 3ARTA 3ROOA 3MNWA 1EERB 4RFOH 5E5RB 2ZUWA 3MRLB 1X5IA 4U1JA 1D9KB 1JPTL 3I02B 4IBLT 1KN2H 3PWNA 5JMRA 3CXDH 2OR7A 3QYCA 4HSQA 1IFHL 3PGFH 3EYVB 3KPRD 4ZAKA 4IOFD 3SGEI 4XXDB 4JO2L 2Y06H 4KK8D 3QUXC 5KBNC 2G9HA 4TULH 3U6RA 3G08A 2NY7H 1YYMH 4X0KA 1U8OB 2HKFL 1OARL 5CZKA 5D1XC 4HKBB 4AMKL 3KYKL 3RY6C 1KJ2H 1FBIH 3PWLB 5GSRA 1OHQA 2F8XC 3E6FB 2DQDH 1AC6A 3HMXH 2C1OA 3ARBD 1JF1B 4X6CA 2CK0H 2PYFB 4F9LC 5E5UB 1KENL 4PJ8A 2HRPL 4BZ2H 3T3MF 4F33A 1UCBL 2JB5L 5AG9A 4OQTH 5J57B 4GKZB 1Y0LB 3GI9H 1R24B 1G6VK 3OWEA 3WNNA 4P3CH 4ODTL 5JUEL 1E4KC 1YQVH 3PWPA 1U3ZA 4G59A 4B0MM 1CL7L 4RMUA 2EZ0C 1OQXA 5IKCA 3OAZK 5MHSE 2CRMA 2EXWD 4R4BB 2GW5A 3PHSA 4Y8DC 1U95B 3HZVB 2Q7YA 2Z92B 3NPZB 4XMLH 4ZFOB 1FNGB 5D71L 4G6KH 5DT1L 3BPOC 1ZMYA 2X89A 4PJAA 4OZIA 2YD2A 3L7FA 4OF0A 3FO2B 2FECI 3STLB 1CLYL 4ODUB 2Q8AL 5J12C 1JYVA 3K8KA 4HJ0C 4MXQC 3CU1A 5KTEH 1KNOA 2AJSH 5C0FA 2VLRA 1B88A 5E7FA 5E00B 1PYWB 4OZFH 4LLDB 1LDPL 1MCOL 3W2DH 2OJEA 4Z0BL 4J3WA 4ZFGL 5TF0A 3OB8A 1MJ8H 1FNLA 5T1KD 4NO5B 5C9JA 4URTB 5ESVB 3ARFC 4U1SB 1FNSL 4C56B 4I4WB 4JY4A 1ZWIA 2FGWL 4YHLL 4JVWA 1J86A 2X1QA 3JV5A 3QPQC 3HLAA 3UPRB 2F58L 4AIZA 2H32H 3S6CA 3VH8A 1CE1L 4DAGL 2ZJSH 5DEFA 3GSNB 5AEAA 3S9DB 2YZ8A 4G6MH 4EBQH 3LSOB 1B0GB 5CWSB 4YBQD 3UO1H 4LMQE 5D96B 3K0WA 1RZ7H 1HSBB 2XPGA 3CU7A 4H0IA 5EG6C 5K9JL 1CR9L 3AY4A 4GMSH 4O9HL 2ADFH 2IQ9H 3OXRB 5DLML 5J13C 2FDBP 3AMKA 1LDSA 3KXFD 2XFXA 5H37G 1KB5L 2W9LA 4KHTL 1CXIA 4BFEA 3QXDB 4FZEL 5C0AE 4M7LH 4LVNC 3FQNB 1QPXA 2DOCA 2VL5B 3RPIA 2FWOB 4NM4L 4PRIB 5JW4M 1JPGB 2A9MH 3BQUD 3KJ6H 5DQ9A 4X5WA 2AJYL 3NIDE 3BVNB 4BZ1L 3I2CL 1AQDB 1I4FA 3N06B 5C0GA 1UQSB 2ZWLT 3V5HB 3MJGX 1KCSH 5LQBH 1X9QA 5DEZA 3T65B 4F58L 4HLZH 5D7SL 4HIIA 4MNQE 4EI6B 4GT7A 4D2NA 2E9JA 2OTUB 2MCPL 5KSVA 3U9PH 2WUCH 3MRDA 4JQXC 4PGEA 4CU6A 1SBBA 2IFGA 4GS7C 4LSTL 4PJIE 5JPNA 2R0KL 5B3NA 4Y4FB 5IOPB 5MP6L 3STZB 3BGAA 3EDKA 4I3SL 4OZGB 4X6DA 3RNKA 4V1DD 5HY9A 3OX8A 3NFNB 4FG6C 4U1KA 3NCMA 3U48A 5L7XH 2FSEA 3FCTA 1XCTA 1CGSL 4NQCA 5FYJD 1UG9A 2DTSA 4OZHF 3WHE1 4CW1A 4NO2B 5F88B 4NC1C 4JEGB 1IE5A 3P0YL 3RNQB 4QF1A 1AC0A 1KG0B 2AJXL 5MEND 1XFPA 3SOBL 3CFDB 1CD1B 3B9KC 3CK0H 3EYSH 4LCYA 2BNRB 3VXMD 4HHAA 5M95B 2OR9H 2WM0A 4PJEF 3IS0X 2D7TL 4B41A 5C3TA 1BGXH 1UACH 4LSDA 1F42A 3CVIH 5DR5L 3QH3A 3CFEB 4K7PX 3F7PC 3G04B 1TZIB 4XB7A 4EN3C 3W39A 1PQZB 1NBZA 5F8QC 1U8KB 5E8NB 3ZDZE 4CNIB 2P8PB 1NMBH 1T83C 3RIFK 2F15A 3GSRB 1EFXD 3CNKA 4U4BA 4NJAH 1MJJA 3GHEL 1QHOA 1O5DT 4M7ZC 3FFCA 1XF5A 1TLKA 4KUZH 1C1EH 4YHZL 5D7LA 1R3JA 1WC7A 2P24B 5DMIL 1JNNH 1I3GH 2OJEB 2R2BA 3RGHA 2JK5B 2KBGA 1QRNB 4X7CC 1C16A 1RUQL 1QHPA 3R0MA 3TYFA 4ODXB 4XC3L 2EXYC 3TV3H 4D9LH 3DUSA 1OD7A 1ETZA 3HC0A 5E8OB 4C55A 4QRPE 3IXTB 3IRPX 3DUUA 4PB9H 3TT1L 2IBBA 4ZDHA 5GS0L 4F9PC 3C2AH 5TQ2L 5E70A 5CD3B 3QG7H 3O6MH 4HC1L 1TCMA 5JW5B 5E03A 1K6QH 2YC1B 1T1WA 2W65B 3HE6C 1A7NL 2EDKA 2EDTA 4YAQB 3WFBH 3KPPB 2F54A 3X14A 4HFWB 4HQQL 1JNJA 3TN0C 1S7SB 5ISZD 4D0BB 2W0FA 5IWLA 4LPCA 1NBQA 4OM1H 1EHLL 1OD9A 1U3HD 2R29H 4OB5L 1FG9C 1FNAA 4RAVB 5M94B 1EV2E 4O2CB 5IFJB 2CLRA 2Q76B 2EDJA 4JRYB 5JOFA 2FX8L 3NTCH 1CYGA 4LPVA 1T0MA 2HLAA 4I2XE 2CDEA 2AJUL 4X4YA 3MRPB 1AI1H 3REWA 1DN2A 3OAUH 3C6SA 4M7JL 3H9SE 3QZWA 3ILQC 4PFEA 1CICC 2QQLL 4XNXH 1IAIM 3I50L 3U7AA 3WEXA 3VE0A 3QJHA 3M17B 5GHWL 5AYQA 3H42L 4P5TA 3C09C 1A7RL 2IG2L 3HAEA 2V2TB 1INEL 1RK1B 3F6LA 2OL3H 1X4XA 3HCVB 4Q9RL 1ZT4A 2W9DH 1FJ1B 2R23A 4XVTH 1RUKL 1J0KA 4NKDB 1IGML 3U7WL 5BOZG 3BAEH 3MV9D 5F71A 5FECB 2IPUG 1G6RA 2BVQB 3I84A 1DQMH 5JPNB 1CFQA 4PJ7F 1T5XB 4CDHA 1UC6A 2VZVA 4X6DB 1FFPA 1WT5A 2EKJA 2FIKB 1NEZA 5CMAA 3VI4E 4NN6B 2ZP0T 4WUUA 2PN5A 4N8VA 2GTWB 3FCTB 4XNYL 4WGWB 1XCTB 3WKNA 1ZT1B 1HHHA 2EE3A 2GEEA 1RI8A 5E0QA 4K9EL 4HDIA 4DW2L 4NM8H 4Y4HC 3QWRA 1OAXL 4PRBA 3VMOA 1BEYL 5DTFA 4Z7NE 1IQDB 1I9JL 4UQ2A 5ICYA 5JOEA 4X9BA 4UDUA 2YK1L 1S7VB 2X4UB 3JWNC 1IGTA 1AO7B 2EC9T 5IB1A 5KSBF 4IIQA 3VRLF 1D6VL 3V52H 2HVKB 3LS5L 5K9OA 4OV5A 2YD6A 4JREC 1HQRA 5KSAC 3IKKA 3MOAL 3I6LD 3K8MA 4KUCF 1HOCA 3QIBD 3U83A 3LOWA 2NXZB 4HBCH 5EO9B 4MGXA 1UWGH 5B21A 4K55A 4APQD 5D2NA 3TNMB 3CVHL 4ODWB 3O2DA 1B6DA 2VZ1A 3D3VB 2K7PA 5IEHB 1U8NA 2ADJB 1QYGH 4BKLB 2FCBA 1R3IL 4GAJH 2HT2D 2ZG3A 5C0DA 4HUUA 5EWIL 2NMSA 3G5YA 3FZUC 4LL9A 3MLSH 3FB5A 1I9RL 3PDDA 3RY4A 5L2KB 3P4OB 2HG5B 5ABDE 5IVXF 1S5HB 3UDWA 4JO3L 5I8OH 4M4RA 2I26N 1WWAX 4YHIA 4BSWA 5T33L 2V5RA 5FM5M 5I1AA 1BIIA 3QCTH 3RVWD 4ZDHB 1ZSDA 3VFGH 5IB3B 4NQVB 1RZIA 2UWEB 2EIBA 4I1NB 4XH2A 4JCLA 4XI5D 2R15A 3KYOA 5D1QA 4R90L 5FM5O 4YPJA 1S9VB 1T5WA 4A6YB 2MWCA 4NQXA 3EO0B 1TJGL 3WIFA 4LVOB 2EXWC 4XGZA 1ZAGA 2D2OA 5IB5B 3H3KA 1JGLH 1D5IH 1U8QA 2YPLB 3BXNB 3EOTH 3IU3A 1L0XA 2PETA 3MRNA 1W0WA 1NUFA 3NCYS 5J9PA 4H26A 3BH8B 3UJIH 1DUYB 1DZBA 1KLFA 3C5SA 4TVPH 3FT2A 4H88H 4D94A 5I16B 5DA0B 3GHBH 1K8DA 3GZKA 3P77A 3P0GB 4WFGD 1MRDL 3MROB 4HZLB 2JIXA 4O4YH 1IQWH 1DQQA 3V2AR 4NUJA 1J5OH 2N7BA 5FGCB 2BRRH 4OFIA 4YJZL 2BNQB 5IW6A 2P8MB 4P5TB 3BOVA 1EAJA 5D8JL 1J8KA 1RJCA 3RZCD 1A1MA 4WFED 2Z31C 2LTQB 3FN0H 2XQYK 3O3EB 4LIQH 3P11H 5A2KH 2D9QB 1C5DB 3LRSA 3I6KA 3IFLH 3HZYB 3QI9D 4P4RA 4LCWB 3QISA 3ZDXE 1NEZB 4OLVL 4L8BA 1QR1B 1OAQL 2Z91B 4MD5A 4PP1D 4Y19A 3QA3B 4ETQA 3TJHA 3CH1B 4XP1L 1MY5A 4WEBH 3RWHA 1HKFA 4P2CG 3QNZB 2R9HC 5A43C 3BFOA 1A14H 4PRBB 3KHOA 1UEMA 3EYOB 3FONB 3ZO0A 4RSVA 1I1AA 5KVGH 4NUGH 3I9GL 4TSBL 5ICYB 5IMOA 4RMWA 4ZOCA 3OJMB 4UT6H 3D85B 5HPMB 4BQBA 3GMMA 1HH6A 2DIAA 1DR9A 5HD8D 1U8MA 3GJFK 4ZD3H 5IMMA 1GHFH 2VR5A 3GJFB 4IHOA 4WI7A 5ICXA 2Q86B 2OZ4L 4LSUL 2IADA 1JFMA 1T0NB 1BD2D 4QOKA 1TQCC 3FOLA 5CEZL 4LQ1A 1FG2B 4LVHB 5FCUL 4HT1H 2X9YA 4QEGA 5C0IA 1MNUH 5E9DB 4FFZH 1MAJA 4MVBA 3R06B 4JFPB 2IH1B 3SE9H 2VAJA