3LKQA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1977 strain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lkqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lkqA01
4XVTH 3SKOA 3QULB 4G5ZH 2AV7A 1U41A 2Y07H 3LEVL 2F5AH 1JWSB 1BIHA 3B2VL 4QWWC 1OT1A 4ODXB 1KXTB 1KJVA 1M4KA 2GY7B 5DJZB 3OKMB 4JN1H 1G0DA 1QFUH 4JM2A 4OZ4B 4H26B 3GM0A 3MOAH 2X41A 4BQ8A 3NA4A 1MREH 3V8CA 4RQQA 5D2NA 4MJID 2MSPA 3SDCC 4IRSB 1CE6B 4TNWF 1GH7A 1QLRB 1JUFA 5TE7H 4R7NB 3FO0L 4U3XA 1ZLUK 4P2RD 3ZT5A 4M8QB 3HNTH 5ICZB 4XXCC 1NANI 2AQ2A 3DUSA 4UU9A 1HILA 1DCLA 2O5YH 3SKJL 5DHVB 3MOQA 4U1MB 4M61B 1U8JB 1B6DA 2VXUL 4X6CA 3H9YA 2EE9A 4NRYA 2Y9RT 4JN1L 1CFTB 4JDZA 2CDFA 5D7JB 4PRID 4QNPE 3C8KA 4ZNCD 5JPNB 2BSTB 1MREL 3CLFH 1E28B 3EJZD 3JBG7 4NKDB 2BJML 1JZ6A 5ITFB 4EVNB 4OF3A 2E27L 2X4TB 1IBGH 4JFDE 1CZ8L 3SO5A 1IARB 1I9RH 5E24E 3KLAB 4X5XB 4PR5B 4YBLC 4Q6IB 4L8BA 2YD9A 2FDBP 3CXDL 5F7WC 2EZ0C 4MMZC 5F8QC 4JY6B 3UZVB 5JXEA 1DTUA 3EDFA 3ZDZE 5H94B 1A2YA 2FYYB 1SHMA 2EO1A 1E4JA 4L3EB 5IJVB 2F74B 3LS4L 5I76B 1CU4H 4IOIB 3IDJA 3KXFA 5J9PB 3LY6A 4AMKL 3ZYOA 1WUNT 4C54A 2NR6C 3KR3H 5DEFA 2OQJB 3CFDA 5DD5L 4WU7A 1UCTA 1J8HA 1I9IL 1BJMA 1T2JA 1T2XA 4F7EA 3RZCA 2D03L 2BNRB 4NQDD 3L3GB 4V2BA 2ZNWA 1MJJB 2O5ZL 2DQEH 1I3UA 5MP6L 1KLGA 4PJFE 3BH9B 3ZZ1A 2FO4B 1YY8B 3MFFB 3LEYL 3K4AA 4OQTH 2W9EL 43CAA 3F62A 1MVFA 2X4QB 3ILQC 4OCWL 1YEDA 2M26A 4MJIB 1PKQA 4L5FH 1NFIA 3ETBF 5HYFA 2JIXA 4YO0B 2OP4L 4TQEH 3B9AA 1KB5L 1ZA6B 4TUOA 3VXUE 4QRPD 1CDGA 5EOCJ 4TUJA 3MCKB 1NC4B 5GQBA 4L8SA 2XA3A 4BFIA 3O3AB 1RJYB 1XF2B 5K9QG 3H9SA 4D0DB 2BVTA 1FPTH 1NCCH 4GAFB 1U8IA 3SOBH 1MUJA 3QDME 4IDJL 5DEZA 3S36L 1S7XB 1JF1B 4LLQB 5D1QC 3QUXB 3GFUA 4FTVA 5GRXG 3VXRD 2F8XC 5HJ3A 5IVXA 5C0ND 1NGQH 5ALBH 1G7IB 3CXHK 5J6HA 4XHQA 4P46C 4OZFB 2BVUA 3UZQA 1VEPA 3UPAA 5HYJE 2Z92B 3GJEB 2BVQA 5INCB 4L4VE 1NFDA 4IS6B 4N0FA 4Y16B 1REIA 3W11C 4DEPB 3BDBA 4XCNA 3ZYJA 3N9GH 3GSRB 2V2XB 5T3XE 4Q9BA 2WIIB 3MA7A 4NCDA 1BIIB 1S78C 4YUEH 1E6OH 4OCNC 5HDQL 5CEZE 4Y2DA 1G7JA 1FN4B 1KCRL 5KSVA 2Y72A 3HZYB 4I18A 3TC9A 3OJMB 2N56A 4F57L 2CKBH 3FQXB 3VFMA 1LILA 3S4SB 1U9KA 1E4KA 4NYLB 3QFDA 1HHKB 1CXKA 2Y6SD 1CDJA 1R24B 4XMPL 4WUUE 1OD9A 4C59B 1ZK9A 3TT3L 4HLZH 3KPRE 4FQCL 4CUCA 3PL6B 5E2UL 1EFXD 4K7PH 2PW2A 3KDMA 4HXAL 4JJ5B 1B6UA 5I73B 5IR1A 4LOUC 3LV3B 1PEZA 4XC1L 5I66B 5E8NA 1QBLL 3GSNH 1ZT4B 4U6YB 5IK3A 3NZ8A 2D0FA 4PJDB 5GGQH 1P4IL 43C9A 2P5EE 4LDLB 2XA8H 3SDDA 5CFHA 5FECB 5FYJD 1UEMA 5GGSY 2C3XA 3FB8A 3K4DA 2ZCHL 5I2IB 1BZ9B 5DHYB 1JPGB 3DX6A 1KJ2L 5KW9H 3TJHA 4JFFA 5TE6L 1FV1A 5T3XH 5E2WH 4BKLB 5DQ9A 3PHQA 3QXAA 1S9VB 4IDJH 5DVMA 1UA6L 2W0LA 4E9LA 4UILL 2ZZUT 3P9LB 2JJVA 7FABH 1TVBB 2R9HD 1B0RA 2AK4E 3HC3L 2IPKB 1CFQB 3QUMA 4KUCF 3SDCA 2E7LE 4JR9L 4XP9L 4DTGH 4RGNE 4NO3B 4DN4L 3CFCL 4QOKB 5D7IA 1GRWA 1MI5B 5C0IA 5CD5C 1KIRB 1NGWB 3HLAA 1DQJB 2Y06H 4JFFE 5I1LB 3MSPA 2P44B 2WW8A 2BSRB 3RWEB 2XWJA 4GQ9L 4EOWH 4HG4K 3ARFD 3HE6C 1GAFL 4PJ5A 1N5YH 3V6FA 1EMTL 2BERA 5JW5A 4AH2A 3QXDB 3FN0H 3UJIH 3B5TA 3TT1H 2AK4A 2D4FA 1B88A 2X9YA 1QRNA 1ED3A 3P9MA 5D7LB 1RIUH 3OKOA 3QUYC 1ORQB 2F8OA 3DVNB 5C0EA 1JPFA 1KELH 1X9QA 4OF0A 5JR1L 2IPTL 1DQMH 3L3HB 4JN2B 3KPLA 2NW3A 2CLRA 5DZOA 2H8PB 1JNNH 2I9TB 1P4BL 2GSIB 1FNHA 4TUKL 4XBEL 4WEBH 2HJFB 5CD3B 1PZ5B 4UQ2B 4JQIL 5GPRA 5IBTH 3C8HA 5F7DB 3TZVC 3GMPB 5HYSA 1CGVA 2QQKL 1G7QB 3CZFB 4ZOAA 3NFSL 3HTLX 4R0LB 3ARXA 5LAXA 2GJZB 4NUGL 1QRNE 4H8WH 2CUIA 5EA0L 5I73C 3RVXC 1NCCL 4BYHA 1ITCA 2CIIB 1KB5A 2I60L 1YNLL 1EHLH 1FNGA 1ZLVH 4P23D 2SEBA 1RIUL 4WHYG 5I1JL 1RPQA 1GPOH 1T4KB 2OL3H 4FMFA 3GIVA 1O7VA 4Y4FA 3OSKA 3RKDC 1XIWD 2X4RA 3LH2H 3FL7A 4X7TB 2EXYD 3L7EA 4QHLB 1T03H 1UZ6E 2OTPA 4PJCB 1WZ1L 4H0HB 4NO2B 2IMMA 2VO5A 3QQNA 3VI3F 4EBQL 4I3SL 4I4WA 3D0VB 3DLQR 5KSUA 3U0WH 2NW2B 3I9GH 1AY1H 4HAFA 2VSCA 5I74C 2GQHA 2DKSA 1C08A 2VAAB 8FABB 5H35A 2QQKH 4ZUWA 4QRRA 4OLVL 1MJ8L 3CFKB 4JRXE 5DRZA 4ZG1A 3MC0A 3O8XA 5ACZB 3RWDB 4F15B 4XNMA 1RZKC 3BP6A 5ABDE 5I8OL 1JHLH 2E8YA 1NMCC 1YYMH 4LLVB 3X13A 3DX7A 4JHBA 4W81A 1YN7B 1F58H 1JGEA 3RU8H 5D8JH 3E6FA 4M5YH 1NAKL 2JJWA 1OAYL 1S8DA 2VZOA 5SWZA 1IBGL 4EN3B 4WW2F 1PAMA 4OLWH 1UWXH 2GTZA 4G9FE 32C2B 3LKQA 4OD2A 1CFVL 1FGVH 1QOKA 2Q76B 2JCCB 3BH8B 5CJ8A 3QO0B 1RHHB 5LQBH 2NY3D 3UTSB 2VITB 4WW2B 1YUHB 3IETA 1RIHL 2NY4D 2X05A 1GSMA 2A1WL 2VLKA 3TN0A 1W0VB 1VPOH 5CSZB 5IVZA 4PD4J 2AK1H 3VWKB 3MRHA 4UIKH 3EYFA 3RGVC 2X4SA 3I75A 4W68A 3BD5A 1AIFB 2FLBT 5DI8B 1AGEB 2R23B 1MNUL 4NO5B 2ADJB 1IQWH 2VAJA 2YPLA 2ZCKH 3DI2B 2V2TA 4K94L 3HR6A 3C5JB 4QF1B 5JPMB 2C3WA 4M43H 1RIVL 3FB5B 1YEJH 2AXGA 1YMHA 5E6IA 1XF4A 4LKXB 2B7DT 5AZEL 5CKAA 5EZIH 2R0WH 1GPOL 9CGTA 5CIPH 1A6ZB 3FQNA 3MRJA 3VXUB 3W0WD 2XFXA 5DRNB 3SY0B 5KJRH 5DD0L 2NY5H 1UZ6F 3RIFK 3W81A 4I9WE 3TA3B 1S7VA 5FYKE 1CDHA 3OXSB 3RWJB 4KHTL 4MNQB 4JPIB 4QT5B 2ITDA 4A6YH 1F45A 2NYYC 2HKFH 4PGBB 4U1KA 3UTPE 2P8PB 1RURH 1BFTA 5IQ7L 1JJUA 4HS8L 4ZAKC 4FQJH 3L3DB 2EIZB 4PFEA 4AENB 5IMOB 3LPWA 3ET9F 3NPZB 1HKLH 5F3BB 1FFPB 3IGAA 2EYRA 3CMOL 1T66C 5IBLC 4PGCA 4KK5C 3FRPG 4CJ0A 2VLMD 2AABH 5CMAB 2BZDA 4G80B 3WSQH 4MA7H 3VGBA 4KRLB 1IKNA 4ONOA 3TWCH 5CJXA 1NCWL 4QO1A 4MJIE 3STLB 5HHNB 1FFOA 4ONFH 1V7NL 5D7JC 3JV6A 1WT5A 1F3DH 3GMLA 2B0SL 3TBVB 5JHDE 4LNRB 1RU9H 4NKQB 2FX8L 35C8L 5FFLA 1JV5A 1PG7X 5TJWK 5KZCD 4UT9L 3N9GL 4GG6E 1NGPL 1D5IH 4P57A 4P3DB 2C3GA 5E8OA 4HGWB 1DN0B 1FC2D 2PO6C 2XT1B 2OTUB 4V2CB 3SPVB 4F2MA 5IFJA 3HAEH 4PRPE 4GRMB 1ZEAH 4N9GA 2LFGA 2VDKL 4GAJL 4WUUA 3PP3H 2FHCA 4LGRB 1XCQB 4ELMF 1LWRA 1UXSA 4U05A 5TDPB 1H5BB 1VGEL 1A7RH 2OI9C 4GMSL 4P5KB 5FKPB 1YEIH 1FVEB 5FDWA 3QNXA 1H3UA 3B3IB 2BOCA 3ZTJG 3RWHB 1HDMB 3MUGB 4XH2A 4MXWH 5F7YC 1JWUB 1EAPA 4KDWA 5DJCA 4KZDL 1M05B 1AY1L 1TZHA 1A9EA 3QR2A 4NNXB 4PLOB 3E2HA 1YMMD 3OJ2C 4YBQC 35C8H 3DXAD 3GK8L 5E6ZA 3MLXL 3U7YL 1KB9K 4MNGB 1OW0C 5KJRL 5L8LB 5GGTA 4MS8D 1JI2A 1P4IH 3KS0J 4JG0L 1FL6B 3VGHA 2G75B 2VLRE 3MRBB 4YHLL 3TV3H 3ULUL 1MLBA 4R7DA 1JVKA 4U6HA 1X5FA 4X9GA 4WI4A 5EBWA 5DVLA 5I8KH 4IRSA 1WJ3A 3KWWA 3D85D 3QUML 2VL4A 2YEZA 4H5SA 5HHOB 2X40A 1QLRA 1KG0B 4OM1H 2Z31C 5L7XH 4FQLH 1NAKH 1QSEB 4GAYB 1VGEH 4LLAA 4PYHA 3C2AL 1A6VH 3IXTA 3MACH 2PCPB 3FHAA 5IG7B 2XXMB 4HUVA 1NCAH 2AGJL 1X7QA 4U1MA 1U8JA 4X6CB 1M71A 2NR6D 4NIKB 2VLRA 1INQA 2HLAA 3FO1A 5K59E 3L1OL 5BS0D 5I1DB 2CH8A 4DTGL 1MWAH 1NCWH 3BKCH 5AG8A 3BE1H 5JPNA 4S1DD 5D5MF 4X6CF 4RRPG 2KPNA 4NKDA 3BMWA 5C8JA 1AFVL 1BX2A 4QRSA 5GGTH 3SQBA 3TEUA 2F5BH 1I9JL 5TE6H 5GJTL 2EYTA 3F58H 1BBJB 1CL7H 1VHPA 5DZLA 1C1EH 4XP5L 4Q7DA 3TH4T 1I1CA 4LP4A 3U36B 1MRFH 3VXSA 3SE9L 1G6RL 3PWVB 3BISA 5H94A 2XWTA 5F89B 2BP3A 5EO0B 1F3JB 5H37G 4NQCA 1GC1L 2IWGA 4UV4H 3AVEA 4PY7A 3V7MA 3JWNC 1KACB 1H9VA 3CFDB 4N8CH 2X1XR 1HHHA 2QHLA 1XEDA 2IADA 4X80H 2NTSP 2PW1B 3ARVA 3WLBB 2FGWL 2P24A 3L3GA 5TF1H 5J1SC 3LRSA 3MCLH 1WCBB 3C08H 4K9EC 2XIDA 1VFUA 3LIZH 3PQYB 3H3PL 1LD9A 4FOMA 3PWNB 1U93B 3LKOA 2HLFD 4KQ3H 3RL1B 3DETD 1YEGL 4M6NL 4RMUA 3RIFF 3T0EC 3MXVH 4EIGB 3QWRD 1T7XA 2JIXB 3BZFA 3G6JF 3QJHB 1LK2B 2CDGB 5E8PA 5INDA 2AJSL 5DVOA 4YAQA 4P48A 25C8H 4OBSA 4CMHC 1UB5B 4DKEH 2WWKO 4XVUC 3O6LL 5CIPB 1AXTH 1A4JA 4JO1H 4Z9KB 2MKLC 3QBTB 3TZVB 4PBXA 4ONHB 4BFIB 2X5PA 3BZEA 2H2SD 3EOAB 3H9SB 4D0DA 2VDNH 2YSSB 1K3IA 2I24N 2AEQL 5ESQA 3OHXB 3BESR 5GRJL 3GMRA 1NANH 3GIZL 5HHPB 5DK0A 1Y6NR 2CK0L 3HG1B 5IM7A 3ARBD 2NTFB 5HJ3B 3I50L 4G7YH 4M1CD 4X4YA 2CRYA 1E27B 1HYSD 1QFPA 3QEQA 4BK4A 2A83A 3IU3A 4PB0L 3TVMA 2ZNXA 4DOHB 4CL7A 3OBAA 4JO1L 1UG9A 5GZND 1DLHB 1JPTL 4QRPE 3RHWK 4FP8H 4N1EA 1P69B 3MREA 1OF2A 2WINB 5JDSA 1ZHBA 5JORA 2V2XA 3C9NA 2A6JB 1HH6B 4L8CA 1T7VA 4F7PA 1E6JH 4DKFH 1RZFL 1SBSL 3WMSA 2R8SH 1A1MA 3KYNA 3WJJA 3D18B 3T3PE 4PJHF 2E3VA 3QWQB 5C07E 3T1FA 2C1OA 2W9DL 1AR1D 2CDEA 1KEGH 3MNWA 4N5ED 4KTYA 1EHNA 5IMKA 5C92A 4MJ2A 2GTWA 1HHIB 2R2HA 4Z7VB 3ECBB 4LPCA 4PGDB 3LMJH 3CMGA 3QEUB 4G6MH 5T1DH 5HGGS 5C86A 3JV5A 1ZT1A 5DMJB 4GRLC 4Q6YA 1O7SA 3HKFA 4LEOA 3RY6A 4YR6A 1KJMA 2VDLH 3HRPA 5B3NA 5HHXH 5J3HC 3NN8B 2CK2A 1I7TA 2J4WL 4XVUD 4KZEH 2VJXA 3GSXA 4KJWC 3QEQE 5EN2B 1INDL 2OI9B 3V5DA 4G42B 2XZQL 3C5SB 3MA9L 3QEGL 1Q9LB 4YHZH 3KPSB 1PKOA 1JN6A 3BWAB 3ZE1E 1W0WA 5T5FL 4P5TB 4W6YB 3Q1SH 5CGMA 1E4WL 3CFJA 3QUYB 2IH1A 1SEBA 3P4LA 4Z0BL 4HK0A 5ISZA 4KGLA 2OSLB 4F7MA 5HYSG 1RZGB 5D2LB 1JHTA 2CLVB 2WWMC 4TSCH 5HHME 3OR7A 1RUAH 3BP4B 2ARJA 4RWHA 3MOAL 2GFBA 2AEPL 5D7IB 4X6DA 3QDMB 1J1OH 2X4NA 2A74A 4M93C 1K4DB 3HZKB 2R0LL 1KIRA 1DQJA 4QXTB 2H32B 3BO8B 5IROC 3WXVL 4GW4A 2VL5B 1FFNA 4DCQA 1LEKB 2I5YL 1JWMB 4RFOL 3HZMB 5JW5B 2FH8A 3QXDA 3T09A 2AK4B 1A7NL 1LO3H 3CDYA 1LVEA 3B8SA 5T3ZL 3HA0A 4NFCA 2HVJA 4GG8A 3ULSB 1NMAL 1N7ML 1QKZH 1OP5H 5J06A 5L9DH 3BVNA 5GRUL 4HK3J 5ESAA 2RQ8A 3HB3D 5BRZE 2AEPH 3CAFA 3K4ZA 5IHZA 5FGBC 1I8LC 5L88L 4YHKH 1QNZL 1Y6KR 1PGRB 3DX9A 2HJLA 2GK0A 3OF6D 1V05A 5JHLL 4NHCL 3HE7B 5HYSB 5IV2A 2J6EL 3KYKL 1FC1A 5F1IB 3HPJB 2ENSA 2F54A 2Q20A 1G9NH 4RDQG 3DX8B 1AD9B 5C0DB 4IIQA 5DQJB 2V7HA 3P0GB 4NNPL 1QFUL 2OL3B 3PGDA 3PP4H 2ERJB 4HUWB 5I8EB 4ZUVA 1UKTA 4ETQB 1K8IA 1U8NA 4OJFH 1J1XH 1N5AA 1QO3B 1S7RB 2X1PA 2X89A 4OBRA 3QWOA 4UT7L 4JHWL 3QHZL 1CD1A 1HQRA 4IJ3B 5EUKB 4FP8L 1BEYL 4O2CA 3KHOA 2YKLH 3ZDYF 4ZFFB 5DYOA 4RA0C 1BOGB 3W0WA 3BD3A 3CDCA 3OKNA 4DEPC 4MS8A 3HE7D 2E9BA 3VH8B 4LLMA 2D31A 1UXWA 3OZ9L 1J0JA 3MV8D 4DN4H 4PG9A 1T5XB 1EX0A 1WGOA 2EE2A 1F8TH 1DBMH 4D94A 4QKXB 2Z0BA 3LPGA 1UACH 2VLLB 2EH8H 4PJBE 3MLUL 4EI5C 4WWKD 1YQVL 2LVEA 4OSUL 4GW1A 3MQIA 2GTZB 5GJTH 4M5ZL 1NMBL 5DGQA 3VG9B 5HYEA 3ULUD 1EIBA 3MLTB 3DNKA 4RWYH 2NXZB 2YRZA 2QQLL 5CBEB 3MROA 3EYOB 5E2UH 4UT6L 4WW2A 5L0QC 4Q2ZA 3HUJA 4ZPTB 5IVXE 5CGYC 2YUWA 3LVEA 2WSKA 4R4FL 3OKEB 1P9MA 1XIWC 1BVLA 4XC3H 1RZ7H 2EH7L 2ZP0T 5IMLB 4NKIL 5C6TL 4HUXA 1T1WB 4FQXA 3L9RA 5C6WH 5HYIA 3DHMA 5IBLD 5DSCA 2EIDA 5CCKH 2BRQA 4LSQL 3UJTL 5EU3A 3QB7C 1R3KA 4U1HA 2XN9E 3QQ4B 5GGVH 4I13B 4MAYA 3BDYH 3O4LB 1T89C 3N85L 4OD3H 1SJEB 3IDXH 1I8MB 4Y89A 1MAKA 5TDNB 1UA6H 2RB8A 3TO4B 4XBPB 1I3GL 2VQ1A 2ARWA 5JOEA 2NY6D 1MCIA 4M6NH 2X42A 3LEYH 3UTTE 5E2VH 2R29L 3U9UA 3PWUA 3CDGA 1UM6H 1T1ZB 4H26A 1NJ9B 3SE8H 4FFVD 4L4VA 2P5WD 2I27N 1DSFL 2A9NH 3ARGA 4L4TA 5DC4B 5I1EH 3P11H 5EUOB 1HXMA 5F9WB 4KY1L 2V9RA 2YXFA 4ZQKB 4U1IB 2ADGB 5JHDD 2H26B 3VXPB 4PRNA 4P2QA 1A7PH 1YEKL 5D1XC 2OR7A 1D5IL 1UQSB 5GGRA 3B2UD 3LIZL 3UTTD 5I1HL 3X14A 5CMAA 4JANB 2P5EA 4KU1A 2GEEA 4G80A 1Y0LB 2CSPA 3DYPA 4KI1A 2X6MA 5DJAA 2E7MA 1TVHB 5KSAD 4W6WB 4NQEA 1KCUH 3CXHJ 3CH1B 3AY4A 3EZ8A 4MD0A 1CVRA 5D7JA 1J8HD 3L3OB 5KVDL 4LEXL 4QHMB 1PX4A 2FZ3A 3GSUB 4KUCD 4QRUB 2DBLH 2AERT 2ZG2A 4XWGH 5EIIA 5DUPH 3VGGA 4Q6IA 1NAMB 1MOEA 3RX5A 3NAAH 4FQ2H 3LKPA 5BW7A 1ZHKA 4DFIA 1U6AH 2RIKA 4KJPD 4RX4A 3U9PL 3CFEA 4D0BA 1K4CA 5BZDA 3MNVB 1QLFA 4C56D 5I75B 4OZHB 1YJDH 2Y06L 4MA1C 5JIIA 4OIBA 1WEJH 2BCKA 5DFWH 2AJ3B 3TYGL 4KKNA 3MXWL 4GG6B 1CGWA 3NBNA 1KN4H 2P1YA 1J8HB 4GMTH 3QT2A 1YEJL 5BOZG 4X6BB 1N3NB 1IC4L 1RZ8B 1BQHA 1RJLB 5KVFL 5EOTA 5GHWL 5IB5B 1U3HB 1A6WL 5TFSL 4PGZA 4D8PA 4YHOH 3MV9A 1M6OA 3VW3L 5MI0C 1FG2B 4RGNB 5F44A 3CSYA 4R96A 2QV2A 3EO9L 5EBWB 1D6VL 1PLGL 3QHFL 1A7OL 3QDGD 1JMXA 4H5SB 3RDTA 3QEHA 4PB9H 5AYUL 2CLZB 4WHTB 3GSNA 4Z78B 4YO0A 4GKNA 3OAUL 4XGZB 5DFVD 4GW5A 4PJIA 5JZ7C 3QPQD 4NFBA 4Y5YB 4NHUE 3JWOL 1YC8A 5BO1H 2KUTA 4L8SB 3F58L 2BFVL 2O61B 2VLJA 2ZUUA 1SM3L 4PJAB 1H3GA 3BKMH 5SWSB 3QIBB 4ZXBB 4G59A 3QCVH 3S34L 1N4XL 4Z76B 4S1SH 4UOW1 3VWJD 3WIFB 4XPHH 2H41A 4NZTL 5F7FA 4Z77A 2FCBA 1H3WM 1FQ9C 2FJFA 4PJ9C 5J6HB 3MRQB 4B7LA 4XMKL 3ZSSA 1CLYL 4Y2OA 5C07A 2EDOA 3T65B 3UYRH 3PE9A 5GS0H 5JTWA 2B0SH 1FZOA 2IH3B 4JKWA 4UTAH 1SMAA 1HHJB 3I2CL 2OZ4H 1TJHH 4BUHA 2DWDB 3VXSB 4FZEL 1XF3B 3ARBA 3PWPD 4IRJC 1NFDF 1JFQH 1HEZA 1FRGL 2E8ZA 5D1ZA 4EI5A 4S0TD 1V7MH 5EORL 2IBGA 1T2QL 2ZOKB 2LAGB 3LSOA 2FO1A 1D5MA 3TVMD 2GJ6D 3DOSA 4C56A 3PWPE 2E6QA 2B4CC 5SWZE 1BP3B 3P0VH 1A14L 3DGGA 4I8DA 4XNYH 5C0CA 4PRPB 4XZUA 2Y7QB 2V5SA 2PYEB 3MJ7A 3SJVD 1HHKA 3WN5C 5L2JB 1U92B 4GMTL 1JK8A 1DZBA 3A6BH 4JRYE 1GZQA 4OCRL 5C0BE 2EIBA 5DD6A 4OZIA 2JK5A 4LHUB 3I6KB 4JJ5A 4RAUB 3S4SG 3GZKA 1OD7A 5HDBE 3DURB 4NN6B 3X12B 2OXHA 1OAQL 4PJDA 2G9HA 3QDJB 1S9KC 3EOBB 4V1DD 1VPOL 3F7YA 2X1OA 1BQSA 3D39A 4E42A 3L3KA 1HHGA 3QO1B 4NNPH 5INDB 4U31A 4OZIF 2PUQT 3PJSB 2X09A 1D5BB 3EGSA 4F57H 2B2XL 1QBAA 1A6TA 4JZOB 4R97C 5HY9B 1VEMA 5C0NC 4GKZA 3WFHB 3VI3E 4P46D 1G9MC 2OZ4A 3WE6B 4BH8B 2ARJQ 3OHXA 2D3VA 4O4YH 3VD7A 4MB3A 1T7YA 1DL7H 5CUSH 4X4ME 4NJ9L 4M7KH 4EXPX 4NZUH 3C60C 3LB6D 5DEGA 2VDPL 1PW3A 4GT7A 1TXKA 4JFOB 1R3JA 1EHAA 1FYTA 4PLKD 4Q9RL 4XPAL 4MA3A 5I1GH 1FO0H 3GSOB 1A9BA 5DS8B 3C6SA 4Y8DC 1HIML 4JRYA 3UYRL 4ZO8A 3QRGL 4K7PX 3B6SB 3I6GB 3NIDF 2RR3A 3IU3B 3TVMB 1MEXL 2AS5M 4MXQA 5IQ9A 2CGRH 3PV7A 2QSTA 4JO2L 1IGTA 3FZUC 4LHUG 4AG4H 4RISL 2FH6A 2FEEI 1FVDB 5B38B 2GT9A 1BD2D 1BZ7A 2V7NA 1CT8B 1SVZA 3JV4A 5C0RL 1AGFA 5D9SB 5EU6B 4G8GD 5BZWA 4EI5D 4NQVB 1NUDA 1JPFB 2GAZB 1H3XA 3MRRB 4YHNA 4JGMA 4ZPVB 3MNWB 1S9WA 3L7FA 2YN5A 3NCJH 4O02H 1DJSA 2BY0A 2FB4H 4IRSC 4Z7VA 2E7BA 4PGDA 4XNXH 3RL2A 5IF0A 3EYVA 4N9OB 4OSUH 3RUGB 4WFHE 4JO2H 3X11B 4UQ2A 2M2DA 2P8LB 4TSBL 4KQ4L 1U42A 4DW2H 4YHMH 3GMPA 3UO1L 2X1QA 1KJMB 3KNBB 3P73A 3QDAA 1I1FA 1BPVA 5F6IC 1MIMH 1I7TB 2P8MB 5FYJE 1UJTA 3SGJC 1X5JA 3HNVL 1OAKH 2IGFH 3V6ZA 3IDGB 3FONB 2SEBB 2VRAA 1T4KA 2ZJSL 3I84A 3LQZA 3T4YB 3CVHL 1FZKA 1BLNA 4LOUD 4DUXA 5SWZD 3VH8G 2R0LH 4P2RA 3IF1B 3PQYD 2R4RL 3EJYD 1XR8A 3H9SD 4X9IA 1NDMB 2P5WB 3S5LG 3VFUA 1U8MB 4I4WB 3ZE2F 4M48H 3R06A 1Z9OA 1K2DA 2V17H 4QCIB 5CEZD 4FS0A 4XCYA 2BXZA 2VAAA 1CICA 2J8UE 4FRWA 3OX8A 3VMPA 3VXTB 4YX2H 1EAJA 5FA4A 2ARJB 5T33L 3WFBH 1B9ZA 2DKMA 1FL3B 1MCPL 2VR9A 2IGFL 1H8NA 4JFHD 1JHKH 2DYPB 2G5BB 2VZ3A 1SJHA 4G6JH 4MB4A 2NQCA 3CD4A 5MEND 3UPRB 1UH4A 4PG2A 2R2EA 4UIMB 1FYTE 5GS0D 4X6DF 1UKSA 2MOVA 3CK0L 5EBMB 4Z5RB 1Y6MR 3MZGB 5K9KA 4JE4B 4OIAA 1A6PA 1BD2B 3O3EB 1KTKE 2NX5B 1MAMH 4GOSA 4CN4A 3BIKB 32C2A 5EO9B 4MZ2A 2VNCA 4K3HA 3CIQA 4M00A 5GRVL 4GXVH 3MV8A 3MBEA 3SDAD 1CWVA 4CJ1A 2E5EA 1ONQB 2FIKA 5ESAB 4Y4HD 2YC1B 1IZKA 5LVEA 1JZ4A 3ZKNC 4KK9C 4XCCL 4HJGA 2LTQB 3QPXL 4MNHA 4D0CB 4IHOB 1KIQA 4P23B 3U30C 5GJSH 4HFWB 1R5WA 5C0JB 5F9JB 4PRHE 1LO0H 3WBDA 3EW3B 3IJHB 3PHOB 4I3RH 2XG5A 1XGTB 1ZS8B 2BY1A 3UO1H 4JDVA 3LKSB 4NZDA 4JHAH 1WAAA 3SDDD 4ELKB 3DMMB 4Z95L 5DQDL 4WFFE 4D3CH 5FGSA 1YY9C 2AEIT 3RKPA 4YHOL 5D1QB 4X4ZA 4X4XB 1K6QH 2F53B 4ODUA 1UM5H 5SX5H 4DZ8A 5ICXA 15C8L 5DQJA 1Q0XL 4Q9RH 3Q6GL 1RZIB 4RBPK 1AHWC 2JTDA 1F8TL 3JTTB 1MFEH 1CU4L 3AC0A 3MRFB 4Z7QE 4POZD 2D4DA 3BN9D 3ZDZF 2ITDB 1RZJC 2H2PC 1IMHC 3BHBB 1P7KB 2VTFA 3LQAL 4P23C 1CFNA 3RVWC 1HQRB 1WC7A 3BPNB 2Y1VA 3H9HA 1EO8H 1M7IA 3H42L 3CLEL 1RHFA 1ZAGA 2EDQA 4CKVX 5C9KA 3KG5A 3MV9D 5DXWA 2KZWA 2EC9T 1QSFA 4UU9B 2IFGA 2VC2H 4OQTL 4WUUD 1V3MA 1IRAY 4HWBA 5E1AB 1LO5A 3DMMD 5DHVA 3ARGD 4HWEL 1G7PB 2BMKA 5I9QB 4AQOA 4UZGA 5FCSH 2IANB 2DLIA 2VLJE 4XNZB 1DVFD 4S10A 1YMMB 4Y0GA 2NMSA 5HHNA 4GKOA 1JNNL 3SKOB 5DUMH 2AV7B 4JY5L 3ZHLA 1QRKA 4C58B 3PL6C 1EGJH 4OV5B 4K8RH 1L0XA 2F8VA 2C7UA 4EVNA 2AEQH 2NNAA 3S37H 5JXED 4LVNB 1TZIA 4ISVA 4RA3A 4X98A 5FXCH 4YNYB 1IFHL 4AEHH 1FNFA 2AI0H 3K81A 3HI5L 5D96B 1QPPA 2IJ0C 3GJFK 2BY3A 5EULV 1FDLL 4C56E 5ID0B 1RUMH 1ADQA 1X5AA 3TP4A 3CXDH 3VDBA 3MUJA 3WSQL 3OKYA 4LPUA 3CVHA 4GRLB 5IMLA 3HE6A 2DM2A 5SV4A 2X1WL 2YD4A 2D7MA 2L7UA 5KANI 4OB5H 1XCQA 2DQHH 3CC5A 3NMEA 3GSVA 2YPVH 5F7LB 3ZYIA 2NY2C 1HOCB 1Z9MA 5GS0L 3F7RA 1MI5E 5F6HJ 3CFBA 2AJZB 4LSTL 4M4RA 1JIBA 2WUBH 1EO5A 2OR9H 5HHQA 4ELMA 1F02I 5JLZB 5TDNA 3UJJL 4YIQB 2NY1D 2YD2A 1G9MH 2XQBL 4NQEE 5L2KA 5MHSE 3AB0B 1E28A 5EU7C 1IM9B 4Y7MA 4MYWB 1GIGH 1CXIA 4P59L 3EUUA 1CL7I 4QHKI 1PKQB 1P4LB 4PGJA 5ADPL 3MRKB 5FK9B 4AIXA 1WWWX 2ADGA 1EEYA 1WBXB 1ZA6A 3B5HA 4AT6A 3BRGC 5DGRA 1MCLA 4LLWB 5SWQA 3X3FH 3H7BB 1WVZA 3G6JE 3O9WC 3BXNA 2BRRL 4PJEF 5DJ0A 5GGRB 4PJXF 3GMNB 5KSAC 1FL5B 4TTGA 2ZPKL 1EXUA 3REVB 2K7PA 1F2QA 4L3EA 1H8SA 1YEHH 3KXFB 4X9BA 5J9PA 1ZT7B 3PGCB 5FOJA 5C2UB 3UP1A 5MEPA 1GC1C 1IC5L 3CH1A 3QP3A 4H1LH 5CJQH 1MJUH 4LASL 3MA9H 2NX5D 4PJEA 2R69L 4JY5H 2DQJL 4PV8B 5EU7E 3EYUL 1A0QL 3UXFA 3V6OA 3GB7B 1S7TB 3QUKA 3FFCE 3TF7C 1H3PL 4JFEE 1M7DB 1X6NA 3MV7D 2YZ1A 3UC0L 4XNQB 2C3VA 5E2WL 3GM8A 2DYPD 1F4YL 3QJFA 2FO4A 4X4MA 5D5MA 5F1SA 1IEBB 2D03H 1IFHH 4AEHL 4FXGA 3FO0H 4Y16A 1IGFL 4PJ9A 4CU8A 4HX1A 4CDHA 2NY2B 4F15C 4PUBH 3FKUS 3NIFF 2DRUA 4NZUL 4YDLB 3I6LD 3BEWB 3MMEA 1KJ3L 2DTMH 4AY0A 5IB1B 1A7OH 1QSEE 1ROWA 1FH5L 1FJ1A 4DVBA 3BGMA 4FQHA 3I02B 3HZVB 5TE4L 1E4KC 3AXLA 5F6HI 3OPZH 4XVTL 2N7AA 3G5XA 5FYKD 3T0VA 1GGYA 4ZFOL 5JHDB 5IB5A 5JIPA 4D8PB 3PGFL 3V4VL 1BEYH 2EKSA 4P9HC 5FYKU 1NLBH 4WRLA 3ISWA 1CBVH 4R90L 3RJDA 5LGHL 3NGBC 4ZUSB 4WI9A 5EBLB 3V2AR 4DK6A 1QACA 1OWWA 2XI9A 2Z92A 3GJEA 2P7TA 4JFYB 5INCA 3RNKB 3RWFB 3WO4B 1QBMH 5DFVC 4HIJA 1A4JB 1CGYA 3FB8B 3GSRA 3IS0X 4WI2A 4I2XB 4ZOBA 1XZ0B 3G6JB 2RJMA 4DGVL 4KROB 2XTLA 3KPTA 2VLJB 5IBTL 3EDDA 2BOBB 4DVRH 3Q1SL 1KJ2H 4GSDH 1FN4A 12E8L 1J86A 2VXVL 4ZUUA 3QIBA 1VFOA 5IEKB 4RWYL 1CVSC 4TN9A 4XVSL 3N1PC 5A2FA 5D6DC 4LSRL 3SEPA 5MP6H 3T04D 1PD6A 4ORGB 2CKBB 2IG2H 1WBYA 3BPLB 3U0TA 3VRLE 3P0YH 2NX5E 4WDIA 1VKXA 2ZG1A 4JFXB 4GS7C 4DQOH 3MRQA 2QEJA 3F5WB 4XWOD 3IDMB 3WKNA 4LL9A 3C5ZC 4UT7H 5C0IB 1WZ1H 2CRMA 4MD5A 4LCUB 5CZXD 5E5RB 2VXSL 5I66A 1OP5K 1DLHA 1R5VB 4PJ8D 1UZ8B 2CJUH 4R3SB 1CICD 4HF5H 1B4JH 3LQAC 2XWJB 4QY8B 5JORB 4FFEX 1HINL 3RI5F 3QIBC 3OAZK 3FT4B 2DQDL 1AGDA 3MNZB 3BYTA 2VR5A 3TNMA 2DJ4A 1R0AH 3VRLF 3DI3B 4L1DA 4AIZB 3OB0H 2FR4B 1N7MH 3D48R 1Z0MA 3TV3L 5DHYA 4RZCA 1JPST 1HK6A 2Z4QB 1FV1B 5FM5O 2C1OB 3GO1L 3NOIA 5DQ9B 3BPOB 1YNKH 2HJKB 1Q38A 1AQKH 1X4ZA 3FHQA 3L3HA 3MV8E 5L2JA 1ETZA 4NPYB 5DK3A 1F4AA 3EDJA 1J5OH 4MCZB 1WWCA 3M8OH 3SE3C 5D2NC 3LN4A 4O4YL 1NH6A 1G7MB 1FGVL 3BUYB 2GCYB 4ENEC 1B4JL 3WUWA 1DN2A 5IOPA 1NBVH 2G9HB 3QDJA 4FQQB 3EOBA 1EJ6A 3EO1A 3EKCA 3WNLA 1IC1A 3ULUE 1U91B 3DUHA 1WFUA 2DMCA 2VDOL 1KB5B 4X7DC 2A0LD 4HBCL 4H20H 4HMEA 1U8OB 3E2HC 5JW4N 4U6XA 2AJUH 3MRPB 4LU5L 5HY9A 4CMMA 2ICCA 4POYA 2XNAB 3H8NA 5AAMA 3UYPA 1YNKL 3FQTB 4PRHB 5I30L 1PQZB 4M1GH 2R56H 3B9VA 5E9DA 2LV4A 3DVNA 3RTQA 5K9JL 3VRJA 2OSLA 4F7MB 5IFHL 5GRWA 3GSOA 4KMQA 1MH5A 4DOHE 3VDAA 3ZKXC 3DUUB 5JIHA 5EIQA 3EFFB 4MNGE 4KJQD 1KIUA 4OGYL 4WJ5B 3S9DB 2WNGA 5EG6C 4X8JB 4ZUTA 4PRIE 4XBEH 4P2OC 1AFVH 2PXYD 5LCVL 5F6IB 2EXWD 1FVDA 4OCLC 5J1AB 4FQJL 3O11B 2GT9B 2V7NB 3RKDD 2IALA 1A6AB 4RGMC 3MLRH 3TN0D 1KIPB 5M94B 1T1XA 5I1HH 4MXVE 5J0BA 3UTQB 5GZNC 2PETA 3MRRA 1MSPA 5D7LD 4XMLL 1NUNB 4ZPVA 4LPTA 2VITA 4HWNA 2X89D 1FO0B 3IETB 4D9QE 4XP9H 4BA8A 5EU5A 5T3ZD 3MLWH 5DR5H 3GHEH 2BY2A 3WHE0 4OFVA 1C08B 5FYLL 1P2CB 4OCSH 3MJ9L 3X11A 3GBNH 3VFNB 4OFYA 4WTZA 3T08A 2R23A 3MBED 4LSPH 3SDAA 4DGIH 4NKOA 4OCMC 1AR1C 4JAMB 2OR9L 3VWKC 4JFPB 3B43A 3MGTA 3F65A 4JGJA 2FNBA 2AVGA 4OCXL 3X13B 4ZTOL 1YN7A 3B9EA 3FO2B 1G9ML 2CK0H 2XQBH 3DRTA 4OM0H 4XTRD 3NZHH 3T0EE 2W0KA 1A6ZA 1R3LA 2VDMH 2X4UA 1JFMA 4YDJA 4MVBD 1KJVB 5DK2A 1RUPL 5C08E 3WIHL 1F4XL 1UEYA 3QIUD 5DJZA 3S6CA 1U8LA 4UOJA 4FNLL 4Y4FC 4MWFB 1X6LA 3S35H 1U8MA 5GGUB 5HHMB 5ADOL 4QT5A 2HT3C 3Q5OA 4V1DB 1CLYH 1HSBB 3QO0A 5E99H 4F37K 5MEOB 2P8PA 2PR4H 5FYKH 4XCYB 5EUKA 4AZ8A 1NCTA 1CICC 2A6DA 5TFSH 3VE0B 4ESKA 4GKSB 3RNQB 2ADFL 4E41A 1NMCB 4RX4D 3TIEB 3V52L 2M1KA 4M8QA 5JW4Q 5L2KD 5D70L 5H37H 4Z7UB 4Q6IC 3G9AB 1UXWB 4M7LT 3I3EA 4LIQH 4PP1C 2VDQL 3D9AL 4QY8A 3P77B 3ZKSD 4KK5D 2YPLB 2DIJA 1EFQA 4B50A 1Q9KB 4Y5VA 1EHXA 3GI8H 4MZ3A 1IKNC 4EEEA 2P46B 4OF6A 5EIVA 1WTLA 3F7QA 1Q1JH 2DICA 4L9LC 1CFTA 3BT2L 4OLYL 3BIKA 3E1F1 3M8OL 3GMLB 5LWYL 3PABB 4O9HH 5F88A 3AUVA 3RI5K 4AM0B 2XFXB 5DRNA 5C9JA 2GIYA 1UH3A 5CBEA 3EYOA 3FOMB 3IU4H 4N0CD 1NCDL 2N1KA 3OXSA 3RWJA 3H9SE 3KLAA 4X5XA 4JPIA 1GYAA 1YEHL 4RQQB 5D2NB 2PF6A 4NSKB 4MNHB 4HJJH 3P4NA 5F72S 3PWLB 2ORBH 4GO6B 2PO6B 5HPMA 4I1NB 4BZ1L 3D2UD 2AK4D 5GS3A 2AJVH 1BD2E 4AMKH 1A2YB 3QDHA 3GI8L 3S37X 4PREB 1FFPA 3KJ4C 4J3VA 3SGJA 3I2CH 4D2NA 3QPQC 3WNPA 3DO3A 2L0DA 3KJ6L 3HC4H 4PTTA 3GRWL 3S98A 4UI2A 4NBXB 4RMTA 3QWRA 4YDKL 2X4PA 5B38G 2FSEA 5GSVB 3E6HA 3HC3H 1FFOB 1CDBA 1UH2A 4DGYL 4DAGL 5CAYB 3P30L 3RJQB 3U7WL 2R1WA 1SJXA 4MNQD 1MLBB 4R7DB 2FEDC 3MLZH 3TA3D 4KRPC 2JELH 3D25B 1BQUA 4L4TB 1DANU 3BZDA 3N50A 3WV0A 3SKNA 2W1NA 4X7FC 1LP9E 2APVA 3VFVA 4U1IA 4DVRL 3TESA 1U8KB 2Y23A 4HLJA 3O3BA 2VERN 3BDYL 3ULVL 3WUZA 3QIWB 1SEQH 3SOBL 2KL6A 3V4UL 4KMTL 4O5LL 3X14B 5I1AB 2QSCL 1Y0LA 1VFAB 4HT1L 5IESH 5FUZL 2J8HA 5BMFL 1U8IB 1ZE3C 5DMIH 1JHKL 1PBYA 3QNXB 1W72B 1JF1A 2XN9D 2XQYK 3DBXB 5DTFB 2OQJA 4K94C 1G1CA 1J10A 4QRRD 4NZTH 4HZLB 1A9EB 5I6XC 3GSUA 1CDUA 4NC0B 1IAIH 5IVXB 2EDJA 1AP2B 4JY4B 5IJKC 4OGAD 4HF5L 4L3ED 1U8HA 5FCUL 3DVIA 2IF7A 2HRPH 5CINH 4EUPB 1QR4A 2X4QA 2VMFA 4KTDL 1SEQL 2WM0A 1E6OL 4XCNB 3UDWC 4YE4L 3GJFA 2ATKA 3SE9H 2IQ9H 3QG7H 3QHTC 2FL5B 1DUZB 3MNVA 1QRND 5CP3A 2W59A 3HMXL 4OFDA 3S35X 2VLJD 1MCSA 5F96L 4Q0XL 1HOCA 4XNUH 4U1NB 2UZIH 1KYOK 3FQXA 3GRWH 5DA0B 2VLRB 3DIFA 3ARDB 4CNIB 3HNTL 4Z8FH 2PN5A 4KV5F 4YIQA 5D93B 1VADB 3MJGX 1WIPA 5I1KH 3NCEB 1L9MA 5B4MC 3V52H 2WLYA 1FLRL 3QUXC 1AC0A 3TA3C 1EUTA 5C8JB 1XGYH 2V5MA 1AXSB 3NCJL 1KCRH 1IC5H 4U7KA 4YXKH 4QRSB 4OZGF 3FFCA 5E03A 4K3GA 1S7QA 3EIFA 4PJAF 2EYTB 2NY7H 4ZS6C 3SDDB 3CX2A 3CLFL 1NEUA 2R2BB 5BRZB 3SGEI 4P2QE 1Q8MA 3VFGL 3H7BA 5ECJE 1F4HA 5HTSA 3M17B 4ALAH 5GXBB 1BZ9A 3GI9L 3OAYK 3ZYZA 5DJ6A 5JUEL 1RUQL 4PJAA 5BV7C 5IT2H 5JOPE 4PJIF 1SQ2N 1FAIL 1MCOH 5TH2B 3U1SL 4CADA 2Q8BL 3O41B 4WV1B 1HSAA 2YUVA 1INDH 4RCAA 4WO4C 2A1WH 3WIFA 2VN4A 3F6IA 2BNQE 5C6TH 4NO3A 2AJUL 1UACL 3OAUH 4D9RD 5E9DE 5KN5B 4KDVA 4K2UH 3PL6A 2W07A 3PIQB 5F70A 3LV3A 5E94A 1NGWA 4M1GL 4JPWL 2Y25A 2HRPL 4MJ5B 4OGZA 5BOPA 5GISL 5I1LA 2DQGL 2GY5A 3PGFH 3V4VH 1IEHA 3DGCR 4WCYH 7FABL 4CRPA 1RUAL 4KK8C 4WEMB 1HH6A 4JZNA 4OLXL 3VFWB 4F7CA 5FKAB 3TJHC 4PJCE 1MIEH 1PSKH 1C16B 5HVWA 1A02N 1UVQB 1D5MB 4HIHB 4C56B 4XNUL 1V3LA 3DGGB 1DFBL 5FAAA 1L6XA 4XZUB 2VR4A 3V0VA 4BKLA 3FQWB 5EOQL 3KPOA 5AD0A 1F90L 1RVFH 3MLVH 2Z8RA 1QEWB 1IAKB 5FB8A 1FFRA 4HUUA 1FYTD 2FECL 4KVCL 2OJZH 2NTFA 3N85H 1C5BL 1FIGH 1TPXC 4HEME 4XVSH 2V5YA 3S36X 1LO4L 5FV1L 1S7SA 4G43A 1T0NB 1XH3B 2ITCB 2P7TB 4F8TA 1HE7A 3R8QA 2HN7B 1G9NC 1MIEL 1PSKL 1U95B 1J11A 1FNGB 4KJWD 4I2XA 4QXUL 4G8EA 1BBDH 3QA3A 2NY1C 2C1PA 4AH2B 1JN6B 3BWAA 1YZZA 1NEZG 2MCG1 1KFAL 5HI5D 3WE6A 2ZPKH 4QLRA 3UBXA 4LFHG 1EH9A 2O5XL 1X5ZA 3ARGC 4PP2A 1MF2H 3NCBB 4D9LL 3GHBL 4K8RC 4F9LC 3Q6FA 4TSCL 1I4FB 2NW3B 3BP4A 1VACB 2H8PA 4X6DB 5JW4M 2GSIA 1MI5D 5AZ2H 3E8UL 3RGHA 4N90D 2VDRL 5GGVY 4Z7WF 5SWSD 5L0QB 5HGBA 4HPYH 4NWTL 1G7QA 2DQGH 4JZJA 4R3SA 2IAND 2HH0L 2JCCF 2FX9H 3PDDA 4ZMAT 3Q2CA 3WFEH 1WBZA 3TBWA 1MCEA 2NPLX 5T1MA 5SWZB 1P7QA 3ARFC 4I5BB 2OI9A 2ESVE 5D9SA 2ZUXA 4XBGB 1R3IL 3LKQB 3IJSA 2GJ6B 2DDQH 2EDFA 2VXQH 5K33A 4QRTB 3F7PC 2JCCA 1NMAH 2YA0A 3K7UA 4OI8A 3CDFA 4J23A 3V5HB 1I85A 5KOMC 1JYNA 2APBA 3QNYB 3K2MC 4XHJC 3OJDA 3K74B 4HK0B 2AXFB 4LF3A 5I1IH 3NFNB 1KXQE 2IPUG 1L0YA 4X5WA 3C5ZD 4OZIE 3DO7B 4RGNC 2HJLB 2X4SB 3I75B 5A2LH 3LOWA 4OUOA 2NZ9C 1RK1A 2I07B 4G6KL 1GL4B 4RIRB 5IV2B 1RIVH 4Z7VF 3B83A 5F1IA 4X83A 2Z31A 3BIBX 2Z93A 4BH7A 3KNBA 3ZKMD 2ENYA 3KYMB 3IDUA 4NBZB 3VMNA 4KHXH 3QUYD 3X3GH 4I0PA 4YXHH 3FB5A 4YHYB 2YPLD 4CVXB 3B9KB 1UM5L 5B39B 1JGEB 2D7TH 5EWIH 3VXOB 1UJ3C 1FIEA 3ARRA 3IJYA 1QR1B 1JWMA 5HDLA 3JUZA 1BQLH 3EDKA 3KJ4B 3ARBC 4KKAD 2BVYA 2R69H 1KEGL 2J5LB 3DVGB 5GGTL 1N5AB 4YBQD 2D9QB 3QWOB 3BH8A 2P5ED 3GKWL 4I2XE 4NRXA 4ZFZA 5C0FA 3VXNB 3FN0L 5CP7A 3OX8B 5GSRA 3K0WA 4JO3L 5CGTA 4Z18A 1C5CH 4HC1H 1H0DB 1JYXA 4I77H 1TJIL 5CEZL 2XTJE 3GBMH 3QIUA 4C57C 3EFFA 1ORSA 4QTHB 4LLMB 4G9FA 4LCYA 2ZJSH 5F7UA 3W5NA 2J4WH 4KZEL 3T2QA 3UTOA 2Z8SA 1I7UB 3MLWL 1N6QH 4PB0H 1OAXL 4PRDB 3OXRA 1OCWL 1S9YB 3L5IA 3KXFE 2WBWB 2EDEA 3H9ZA 5C71A 1CQKA 4ZO7A 4TUKH 1TETL 3STLA 2JJTA 3P4OA 5KSBB 5HYJD 4NGHH 3GMOB 4PLJC 5DRWB 1OTSD 4ZS6D 2N4IA 2W92A 4KVCH 3MRJB 3VXUA 4FZEH 3AMKA 4L3EE 4LHQB 5C09B 5IB3A 4G7VH 1P1ZA 4ZUVB 1JV5B 1YN6A 5DO2C 3CMOH 4OZ4A 1KN2H 1RULH 4P3DA 5E2TH 3WKMH 2V5TA 5FUZH 4TNWK 1UM4H 1ADQL 3PG2A 3UAJD 4PGBA 3T0DA 1T03L 4YDLC 3U4EA 5KVDH 3BEVB 1MCRA 1QQDB 4Q0XH 3L3DA 4JFZL 1J5OL 4JVPA 4QXWA 4G6KH 2H9GA 1T0PB 1IGIH 4ZNEE 4YQXH 1KEMH 4LLYB 2FX7L 4QXGH 5HPOA 1PYWA 4BK5A 4GBXC 1X3DA 3DMMA 4U1HB 4YGAB 4KHXL 5DUPL 4L4VD 2OK0H 1KSRA 2QKIB 1T5XA 3O4LA 1M05A 5CINL 1LO3L 3ERYA 3MRNA 3WFDH 1TMCA 3ARFA 1LEIB 1ZSDB 3N1GC 1J0KA 4OZHE 1KT2B 5EBGA 4OGXL 4GW1B 5DD3L 4HFUH 4X6FA 1ADQH 5I1CL 3RHWF 4UQ3B 1ZVSA 3TGXA 3ARGB 4EJ1C 3S88H 5ITBH 3KWWB 1EZVX 4TSAH 1WC7B 4J6RL 2R1XA 3T3PF 3TNNB 4PY8I 1JYWA 5FF6B 1M7IB 4G8GE 1MFBL 3RVTD 3O2DL 2WV3A 4YWGH 4YQXL 5JUEH 4POUB 4NRZA 3VGAC 1A7QH 4F2MB 4JG1H 3SDXE 1QSFB 5DMKB 3L1OH 1PEWA 4JY6A 2O5YL 4FQXB 4MLIA 4LNVA 5KVMC 5IEHB 3EO9H 3H7LA 1TCRA 3NFPA 3TH3T 1OGAE 4K9EL 1GHFL 1INQB 3AM8C 3HUJE 5FKPA 1K5NA 1XGUB 5ISZD 4U1JB 4LVOC 3HB3C 3FTGA 1VGKA 3U6RB 3KLDA 3U48A 4W70A 3L6FB 3C8DA 3L5WA 2R0ZL 4JQXA 5IMMB 2NNAB 2WQRA 4XX1G 5GS0C 4M1DL 3FOMA 3BH9A 4P0DA 3MRBA 1KC5L 5KVEH 1EDQA 2H2PD 3VXQA 1OB1B 4UNUA 5EIIB 4XWGL 3U79A 3O0RH 5E2VL 2XN9A 1OGAA 5F1OB 5D1XB 3SJVA 2NY5L 5EUOA 4ZYKB 1VCAA 5CEXB 3CVHB 2RGSA 4GRLA 1U6AL 4KI5D 5F93C 4BUGA 4LRNH 1Q9OA 2I25N 1CXHA 1CLOL 1U8QA 3CVIL 3MGOB 4JM4L 1GGCL 4JREC 1ZV5A 3C6LD 1UQSA 3VRIA 4M48L 3CFBB 2F5BL 4ZFOB 5B8CB 5EUOF 1RJYA 1XF2A 5CHNB 5BVPL 2P5EB 4NZRH 3BQUB 1HHHB 4NP4L 5HHQB 3REWA 4OLEA 1TVHA 2FD6L 1BQHB 1L7TH 4WCYL 5ETUB 2NYYD 5IHBA 4X0KA 4LGSB 5DJYA 4CGTA 1NBZA 3WN5A 1KCUL 5B21A 4WO4B 4WW1B 1AHWB 3O2WH 3OB8A 5IHUH 2YK1H 4WV1C 4OJFL 4OI9A 3D85B 1JF6A 4U0RB 1NCUA 3RPIB 4KDTA 1JPSL 4WHTA 4M7JH 3OR6A 4GLRI 4NJAL 3MLYH 4R4BA 1T66D 5C0BB 3A6BL 4W6XB 1U8KA 1EEYB 1WBXA 3RA7H 5CIPA 3VFSB 5I15L 3T77A 3BXNB 2JLLA 5IVXF 3VWJA 4CU7A 4KXZI 5KSBE 1KENL 5I1AA 2YWZA 3LKRA 4JRXD 5DO2D 2YSSA 4P3CH 2YA2A 5E8EB 4RBPH 3VG0L 4L8SC 5JNYA 2YR3A 5HHPA 1GIGL 3H3BC 2R29H 5FO9A 4HQQL 1QSED 4PV8A 1MVUA 4DQOL 4FFWC 2UWEE 2Z9TA 3NACL 2PW1A 1OAYH 1AP2A 4M5ZH 3UCRA 4OLYH 2P24B 4KDTC 2A38A 2A73A 3LRSB 1HQ4B 3G08B 1CG9B 3WXWH 1FFQA 2IBZX 4PJDF 3U2SB 3IDYC 4XPTH 3M07A 1KPVB 2XTJD 2FX9L 5K59F 4FFZH 5I71C 2VLME 4FXGB 2R4SH 3BPLC 3CSYB 4R96B 3LPFA 1BWWA 3T0ED 1ZT4A 2OK0L 1NLDL 4LCWB 3O45B 5C0CD 5SX4H 3MREB 3VW3H 4P4RA 2KDGA 1LE5A 2CLZA 4OCXH 4ZTOH 1CIUA 3MLSL 4JKMA 2ZUVA 1I8KB 3W9DA 4XC3L 5I1GL 3KAAA 5E8PB 3IXAA 4GW5B 4L3AA 5HVGB 3HC0B 4GRLD 4LSUL 4XCCH 5CLWA 4WU5A 4KH2A 1RY7B 3ZTNH 2QADC 1NBQA 2IBBA 3TFKC 3UAJC 1JPGA 2NY4C 4M9OA 5I1IL 4OFIA 4LHJB 5F3HA 5ESQB 4LQ1A 2ESVA 1R6VA 4Z76A 1B0RB 2HAZA 2EKSB 4QGTA 1A5FL 1IGYA 1KJ2B 1QYGL 2JCCE 2MWCA 2YD3A 1GVIA 3MO1B 2ZG3A 3RZWA 2FWOA 3CH8A 1S7QB 3GHEL 4Z7WE 1OAQH 1MFAL 3LEXB 5BQ7B 2A83B 2FGZA 2LE9A 3G04A 3DETC 1AKJB 3PWJA 4Q9QH 5FDYA 5HGAA 4ELME 3QQ3B 1LDPL 5JO5A 4GUPA 1OF2B 1JMZA 3KPNA 4NCC2 4PPTA 1EGJL 3FAXA 4ODHL 3QIWC 3C9NB 4PJ5B 1A7PL 1YEKH 5DUBB 4L8CB 5D2LF 1G7HA 4ZSOB 3CZJA 5AUMB 4ZUUB 4XPBL 4P5TA 2W60A 5D7LA 4XAWH 3KLSA 4XXDA 4M02A 4NOFA 2IH1B 1CBVL 4MD4B 3MOBH 4LCWD 5C0CB 5EORH 1HSAB 3T1FB 4GBXD 4Z7WA 2C4FT 3EJJX 1RZGA 5D2LA 1AE6L 4RAVA 4MA3B 3PDOB 2KKQA 1AQDB 1RSFA 1U3HC 4ONFL 2GFBB 5DS8A 3SE4A 3S97C 4HDIB 3D3VA 5DD6B 2DMBA 4C83B 4LMQI 2A74B 1JZ2A 3HZKA 1UC6A 4ZFGH 4G6AD 5LXGL 3DURA 4NGHL 3UTSE 2VSDA 4QXTA 2APWA 1CXLA 1WFNA 1ACYL 1TIUA 4NQED 4YHPB 3T0WA 8CGTA 3T0EA 3G5ZA 3HE6D 3OMZA 2CIIA 3PWPB 1CT8A 3VWJC 5EN2A 3MRIA 3QUXD 3TBTA 4JZJC 1BGXH 3GIVB 1QVOB 3UYOD 1UVQA 1TJIH 2DWEA 5CEZH 2F58L 1MHHA 3KPSA 1YECL 4PP8C 2H6PA 2OYPA 4XI5C 4IMLB 1YEEL 3WNKA 4MDIA 1CD9B 1OY3B 1S9WB 1T6VN 4BH8A 4G6FD 5E4IA 1OCWH 3B8YA 5KSUB 1TTUA 4TYUA 3V95A 2GSGB 5CILL 3QFJD 4G8FB 1WLHA 2GCYA 2J12B 3OGCA 2LQRA 3QQ9D 5GRJH 1RAMA 1NDGB 3RIAK 3NA9L 3EO1B 5FOBB 4N8PA 1ZVHA 5JMRA 4LLVA 5CS7A 5IQ9B 4D9QD 3DX7B 2R2CA 1HIMH 4MAYD 1U95A 2H32A 1I8IA 4HT1H 3VXMB 3SDDC 4BM7A 3LQZB 4G8EB 2CUMA 2HG5B 4DCQB 3WIHH 4MS8C 1H3PH 4LIQE 4UDTB 1XGRA 4N5UA 4NM8L 3JWOH 1S9XB 2X4OB 1X5XA 4ETQA 5KS9B 4EI6A 1K8IB 1N0XH 4NQSA 2P5WA 1IM3A 2VZTA 4U6VL 5EC2A 4MDJA 4PP2B 3W82A 3SQOL 4JFDA 2WP3O 3L7FB 1T0MA 5KAQF 1IL1B 3TBYA 1UCBH 1YNTA 3TN0B 2OXGA 2NZ9D 2YZ8A 3OKNB 2CIKB 4PJ7B 3TO4C 4F33B 4WFHD 2GK0B 3B4NA 3HE7A 5IGXL 1AGBA 1SJHB 3P3YA 2B20A 4GRWE 4PJ8B 3UPRA 3DYMA 3C09B 4JZJB 1N8ZA 3KS0H 1DP0A 3P73B 5I17B 1CXEA 2V2TB 3S88L 4XRCB 4HWBL 1Z2KA 3HI1B 2BVOB 5T1DL 2VISB 3BSZH 3V6ZB 1C1EL 2BHZA 1AD9A 1MRFL 4RAHA 4HIXL 4WWKA 5EO9A 5GHWH 1BLNB 2MQ0A 1ZLWH 5L8JB 4Z8FL 3MLTA 3EO0A 2AABL 2W9EH 3KPPB 3WD5H 3TA3A 2D7TL 4UINL 3MODL 2ZUQC 1U8NB 4OTXL 1KTLB 1L8JA 5FYLD 3BYYA 4H0GA 4Q9QL 1CE6A 1KIQB 4W4OC 2EDHA 3SGEH 5H8DA 5D72H 1LP9B 5FA4B 2EIZA 4AENA 3TIDA 1IKFH 4MX7B 3B9KC 1NGPH 2Z93B 2YOCA 4XPFL 5IB2A 5DSCB 1MHCA 1QSVA 3BSZL 1KPUB 4Y5YC 2OJEB 3HI5H 1R3KB 2VKWA 3IAQA 4LSRH 2B1AL 4I0KA 3ARDC 5HDBF 5LGHH 5EZIL 5F8RC 1MCOL 5TQ2H 3EFDL 3N1QC 4HULB 5K9KB 15C8H 3B9DA 4BSJA 4AIOA 3VXRA 3QISA 3CDGB 2Q3AA 1Q72H 1AO7B 5F21B 1F42A 4NQCD 1TETH 4IM8A 4OUUA 2Q8AH 4KY1H 3QZWB 2EEAA 3RA7L 1HH9B 5D72L 2DQUH 5CLTA 5DMGD 3P40A 2J88H 3T2NH 3BDXA 4GS7B 12E8H 4U1SA 4DW2L 4Q9CA 5EU6E 3U7AA 1KPRA 2EEBA 3QUZC 4ZS7L 4NM4H 1EO7A 1BVLB 3DPBA 2UZYB 4XP5H 4HXBL 4S1RL 5DDHA 4Y4KA 1M7XA 3RGVD 1LP9F 3WS3A 1F97A 4P46A 3IJHA 3PHOA 1XGTA 2F58H 4NOBA 2BDNL 3W2DH 1X5KA 3CSPA 2UZXB 1MPAH 3OAYH 1H5BA 1C5DA 1GC1H 5BW7C 5KSBA 1BM3L 2VXSH 2CRIA 4A2LA 1Z5LA 1I8MA 4EIZC 3BQUC 3ULVE 5IT2L 1ZANL 4M7LH 4MNGA 2YD1A 5ACLA 2RBLA 2PTTB 2NY5C 1OL0A 3BRFA 1YY8A 1WT5C 2IAMB 4YH6A 5MENB 4L4VB 4OTXH 4RMVA 5HDQH 3BHBA 4G6FB 1IGCH 1YYML 3PWLA 3KPMB 1MCPH 5CP3H 5HHOA 3KLHC 4LKCA 4JB9H 5DVNA 4WFGE 2H26A 3VXPA 4G8GA 4PDCE 1BECA 3FO9A 4C4KT 1Q1JL 3STBA 4OCYH 3NVQA 2HYMA 2FHFA 3QHZH 4U1GC 1YEIL 3MRLB 4JFFD 4ZD3L 2BK8A 1AH1A 4N5EC 4PJBB 4Z7UE 5C09E 6CGTA 1OTSC 3DSFL 5D7KD 1XF5B 3AROA 2BMKB 1QD0A 3RIAF 4ELMB 1A4KB 2I9LA 3ARFB 2DLFH 3BGAA 4TULH 5I19H 1P84K 2HMID 1ZSDA 5KTEL 3MLXH 1CD0A 2NY3C 4MGXA 4M3KB 2O5XH 5FM4A 3U7YH 1NQBA 1CK0L 2B1HH 3RVVD 4O2EA 4P9HH 5DD1H 3SDCD 4OT1H 1MFAH 1PY9A 3FFDA 2NY0C 1PVHA 1R5IB 2C7UB 4TNVK 1BX2B 4PD4K 1MLCA 2NY7L 1A6UL 3QIBD 1SYVB 2BNRE 4WGVB 2V17L 3G6AB 2BSED 2G2RB 4ZDHB 2R1YA 4BQBA 2BX5A 5JIKA 1NGZB 3VFRB 4S11A 3BAEL 3RAJH 3L3JA 2BNRD 4NQDB 3QIWA 3OV6A 4HIXH 1K4CB 5BZDB 2BC4A 2E9IA 2XACC 1FNEA 2EZ0D 3TJEH 2QADD 2AV1A 4UV7H 5F89A 4G6JL 1DE4B 2F54D 3GSVB 3D5OF 1XGUA 1J0IA 5KSAB 2AJZA 4QTIL 3F8UB 4GBXB 5BJTB 3VFMB 3MCG1 1BFSA 3KYOB 1KCSL 5GGSA 3GGWB 1T1YA 3OKKB 1FNAA 1A1OB 4P4KC 5AEAA 1R24A 3HRZB 4RFOH 3L5WB 1RJLA 1M7DA 5IQ7H 1DBAL 1QPXA 4NT6B 4OF8A 5E70A 1QSFE 5HDOA 1V5JA 2C3VB 4HH9B 2VZ1A 3QJFB 1RK0A 5GGVL 1TJHL 3TN0C 3BAEH 5B3JE 5T3ZH 2IH3A 1UWXK 3ARUA 1KB9J 3GHBH 4EUPA 1IGFH 3VD4A 3MRGA 1OGAB 1I1RA 2DWDA 4MLSA 4HAGA 2IFFH 1HYSC 2IQAA 3BEWA 3MMEB 3E8UH 3O2WL 3R1GL 5EU4A 1MJ7H 1F4XH 3D69A 5D6CB 4HHAB 1YEEH 3QCTH 3W9EB 5IROA 4DKDC 4FQPA 2VQTA 1IQDB 4HCRH 1IE5A 3TZVA 3LSOB 5DJ0B 5E6IC 1GZPA 3P11L 4ONHA 2GJ6E 5SV3A 3H0TB 5IWLA 1A8JH 1OSPL 3KYKH 3HZVA 2EDTA 5I8CB 4J3TA 3QXAB 1KCVH 4XXCA 4F37F 5EPMB 4MVBA 4HKJB 5D71H 5DK0B 3Q3GB 1PKQE 2DDQL 2VXQL 4OT1L 4OZIB 1L4IA 5T33H 3WN5B 1YNLH 5ELIA 2HFGL 1G0XA 1AI1L 4OM0L 1KBGH 3VGEA 5E95B 4OGXH 2WAHA 2QTEA 1ZVYA 3MV9E 5CZVH 4HIIA 2YD7A 3FCTB 1G9EA 1DLFL 4HQQH 3K46A 2B4CH 3FQRA 4YZFE 4BSWA 2XKUA 4HLZG 1L9NA 2GUOB 5GIRB 1D9KB 1D5BA 4G6ML 1Z6JT 4L29B 5T1LA 1FNSH 2YPVL 1ZHBB 2VH5H 4JFHE 4B41A 3AREC 3AAZA 3ARBB 4JCMA 5LJYH 2Z35B 2VDNL 5EH1A 3UTZB 2PYFA 1S7WA 2HT4D 4GRWB 1CE1H 4KJYB 4HJJL 3HFML 2VDQH 3I02A 3WEXA 5DEGB 3ULUH 4UDUA 1CGSL 1EK3A 1PZUB 3CUPA 1BVKA 4MQXD 3KLHD 3AM8A 3H2WA 3VA6A 2JE8A 4JN2A 3P0YL 4JKPH 2GKIA 4E5XB 2CLRB 5AZ2L 3ECBA 4EKXA 3GMMB 4HKXB 4KKBC 5L7XL 4MJ6A 5FM5M 4BZ2L 5GS1C 3I6GA 5BS0E 2C9AA 1F4WL 2VLKE 4HGMA 1JF5A 1TNNA 4DZBA 3RZCC 4KJQC 4LCWA 2OS7A 1RUQH 1LE5B 3BQUD 3ARQA 2DN7A 4NC2B 1HHGB 1BZ7B 3RWFA 3HI6H 2XICA 4JR9H 1CGXA 3VFWA 4EDWL 4F7CB 4P2QD 4DKFL 2F54E 3P30H 1IGML 4XP6H 4RMQA 5BZWB 4LMQE 3ULVD 3WFHA 3V0VB 1O0VA 4O58H 2ID5A 3BIAX 3KPOB 1IGJB 3WJJC 1QSZA 4QHUA 5J11B 4LVEA 3RWCB 4LVNC 4HUUB 5GS1B 3JZ7A 3B2VH 4M6ML 2Y36L 1R3JB 4A6YA 2JB6B 1A47A 4HJ0D 3RPKA 3WO3B 4LPVA 4JFXA 3S8WA 1S5HA 3MO1A 3F7VB 4JRYB 4JG1L 2ITCA 1J12A 4DJMA 3LHPL 2DL9A 1OHQA 3SKUD 1MQ8A 2VLRD 1MELA 5BS0A 3RTQD 5JO5B 3BO8A 2VZVA 1MHPL 4PJ8C 1U8OA 3E6FB 5JHLH 2D2OA 4U6XB 4HH8A 2YBRA 3QEGH 3PV6B 4N0CC 1WFTA 2NY1B 3MLUH 5EZLA 3IF1A 3KHQA 1XR8B 1G7LA 4QHKJ 5E8DL 1E4WH 2JJTC 2ICWB 5FV2A 1G0YR 3JVGA 1TZGH 3AGVA 3VFUB 1T5WA 3JUYA 1XGPB 4FQIL 3DXAE 3E0GA 2HJKA 1ETZB 2HVKA 4NPYA 4WI5A 4Y5XB 4WY7H 1OM3H 2DQJH 1ZEAL 3THML 2FRGP 1FL3A 4OCWH 5FM8A 2ZWLT 4G3YL 1WAAF 2E7LC 4AJ0A 1MFBH 5MENE 4PTUB 2DQCH 5ICYB 5C0GA 3KVQA 4L4TD 2DQUL 3VJ6A 5EBMA 1H5BC 2O26U 1RU9L 1TVDA 4LSSH 1SY6A 3MRCB 5E6IB 3EOTL 3TBTB 5A2IH 1NGXA 1HXYA 2OMNA 2VE6B 4OLVH 1EMTH 1T1XB 2R0KL 1FZKB 5SX4I 3FN3A 4LCWE 3S36H 4FTVE 4LSUH 4OFYD 4RSVA 2JB5L 1F13A 2XTJC 3DV4B 5I8EA 3LS4H 1ONQA 2FIKB 4P59H 3WHXA 3THMH 5EU5B 3KXFD 5A16B 1G6RB 3R06B 3FB6B 1CGUA 1U3ZA 4HWZB 4YFDB 1NFDE 1NEZA 3DROB 4HFWA 4O2CB 2WWMD 2DLTA 2FJHB 1YPZA 5F9OL 2I07A 3LD8B 4OKDA 1CDCA 4RIRA 1BOGA 3W0WB 3RGVB 5F3BA 4Y19B 4JDVB 5IFHH 3FRUB 1A5FH 3LKSA 4JDTH 3BP5A 4HKZA 4HUMB 2LAAA 5KTEH 1LNUB 1OP9A 3OB0K 1Z3GH 2QBWA 1EBPA 4CMHB 1I8IB 3B9KA 3HS0B 2R0KH 1YPZF 4X4XA 2CRZA 3VXOA 5HVFB 4ODUB 1BFOB 1NL0H 1CGSH 2JB5H 5HYJA 1KB5H 2VLLA 1VEOA 1X5HA 1LK3H 3ORJA 4I48B 4OM1L 2DTSA 4G6AC 3EHBD 5KOVC 3QNZB 5LBSH 3MV01 5GGUA 3UTQA 3KPRA 3H42H 4V3DB 3QEQD 4M43L 1CFNB 5MERB 1FNLA 1CZ8H 3G5VA 4I3SH 3V6OC 3QULA 4N0UE 1CIDA 2JKXA 5GSRB 1UENA 3QCVL 3QRFM 4R9HA 1YNTB 1JGUH 5C0AE 4JDTL 2J3SA 3NH7H 5FUOH 2NY0B 2OTUA 4U49A 1JRHI 1MWAL 3VFNA 1NC2D 3LZFH 1EBAA 1MWAA 4KHTH 4P5MA 4NKOB 3SE4C 1N26A 4JFPA 5FYLH 3HR5B 4WHCA 1G7PA 2APTA 4ZO6A 5EOQH 1RZJH 2ATPB 4LCCB 4UUJA 5DRXA 4NQTA 3AU1A 5TDPA 5FO7B 2R9HC 1DR9A 1K85A 4JKKA 5J4MA 4LDOB 3B3IA 1I9JH 1HDMA 3QQ4A 2VABA 2FGWH 4YHIB 3S37L 1XGQA 1SJEA 3CLEH 1ZXQA 2WANA 2VQ1B 5GRZA 1MIML 2V2WA 1JFQL 1HILB 4UILH 1KF9B 1RZIA 1KNOB 1Y18A 1FL6A 1JGUL 1IEAA 3G5YA 5HHMA 3QI9C 2BHUA 4HWEH 4NRYB 1HSBA 5F71A 1WWBX 2IAMC 1R3HB 4XX1E 3U4EB 4HMDA 1I8LA 2OP4H 2XPGA 3CVIH 2WUCH 4HW6A 2GW5A 5ITFA 1DDHB 2R4SL 4PREA 1KFAH 1RJCA 5FHAL 3FT3A 4HUVB 5DMYA 2Q7YB 5KAQG 4FQ1H 5HHVH 4UNTA 2FD6H 3H3PH 1TMCB 2X4PB 4LDEB 2FSEB 1A1NB 2EDDA 5GSVA 1KN2L 4G8IB 4V1DE 1VFBB 1TENA 5TQ0L 1I1AC 5D1ZD 3IAGC 3R0MA 4NKMA 5MHSD 4GLRH 3QCTL 1G6VK 4H1LA 2F74A 5I76A 4DUWA 3MPCA 5F88B 4AM0A 1ZLSH 1YQ2A 4G3YH 2AEWA 4J3UA 4OI7A 3WUWG 1UFUA 1GGBH 5DJ2B 2EE3A 3F12B 4A6YL 4U6VH 1SYSB 2DQTH 2Q3ZA 2A2QT 5CUSL 4ZODA 4JQIH 5C70A 3BI9X 4NRZB 3RZCB 4AT6B 4LLWA 1MJJA 3TF7A 2PO6A 4LVHC 1T21A 1KENH 1WCQA 5DMKA 1F3RB 5BV7H 4D0BB 1KULA 4Z0XA 3QAZB 1RZKL 1NC2A 3CC5B 4BJLA 2DB8A 1KUMA 5I8KL 2W9DH 4PRPD 5DJDB 2YPKA 1PX3A 4U1JA 4PJFF 3LH2L 3FTGB 2D7QA 3EDEA 3A6OA 1Z9LA 3MJ8A 4U1LA 4TUOB 4GG6A 4AQ1B 3WS6C 4HPYL 1WWAX 3S35L 3BMVA 1GGBL 4X6CE 3C2AH 4GRWH 1QA9B 4LSDA 2YPLE 1MHEA 1KLUA 1M6OB 3BKJL 2R1WB 4PUBL 1IM9A 4OZFG 1MUJB 2A6IB 4XC1H 5MI0B 1S7XA 3VCLB 4ODWB 2ZUQB 1Z3GL 1J0YA 3FOLB 4HCRA 3SJVB 3HFMH 1NBYB 1IZJA 1MQKH 3BZFB 3ARWA 3ARPA 2ATKB 5FK9A 1D6EB 3L3IB 1WTGT 3U0PB 2FL5A 1UB5A 4UBDC 1G7IA 4O58L 5K93A 4Y5YA 3PNWB 3JTSB 1JTOA 1BFVH 4YHYC 4OAWB 4M7ZB 4YXLH 3O6KL 4PJBA 4JRXA 2WLZA 3BT2H 3GKWH 5J1TC 1LMKA 4TVSa 4FQHB 2R0ZH 2Q86B 1UJ3B 1ODAA 1QP1A 3VFOB 4KK9D 1ZT7A 2I26N 4KMTH 4O5LH 3U82B 5A40E 4R90H 5TGBB 2WIIA 2F15A 1VADA 3S5LA 4PJHB 1T2QH 1Q0YH 2YN3A 4PJBF 5DJYB 3U4BH 4HIEB 5EFIB 5IVOA 4YLQT 3RTQC 5CEYA 3D3VD 1S7TA 3QUKB 3WFZA 4Z77B 4JY4A 5L2KE 4LRNL 3FFCB 1AD0A 1UB6B 3WIIH 1JBJA 4JFYA 1ZGLA 2G2RA 4R4BB 4I0CC 2PR4L 5KG9A 4ODVH 3MUHL 4ZAKB 3L3JB 3T77B 5JDSB 4XWOC 4NZRL 3M17A 1P6FA 2HTLD 3C08L 3C5ZB 1N59A 4LBEA 3ZT7A 2A6JA 1HEZB 4G7VL 5DJ6B 1DUZA 3WFBL 1NLBL 3IDIB 5KS9E 4U6YA 1ZKAA 5IKCA 3NZ8B 4KK8D 2ZOKA 43C9B 5JNYB 1PY4A 2VIRB 1JP5A 4QRRE 3O41A 3T2OA 4PRPA 5CSGA 3WL9B 3ZL4H 5C3LD 4TTDC 5TDOA 5IMKB 3GGWA 4OB5L 4YGVA 3PXJA 4YFEA 4HZAA 4JJHA 1W0YT 3AS0A 4XNXL 3ILPA 4N0RA 4OKVA 3I6KA 4GQPH 1DL7L 1P53A 4X99A 3S96A 4U0QB 1Z9SA 1OVZA 1S9VA 3ZDXF 5EBLA 5LQBL 1U8PA 3NFSH 2EICA 5M7QA 4FMKA 4MCYA 3TCLA 1GXEA 4FG6C 2B5IC 2ZOLA 4APQB 4E42B 4NQXA 4B5EA 3MBXH 3HNSH 2GJJA 3ARZA 4I3GA 3MNZA 4HIJB 3CU7A 4HC1A 3NCFB 4QRPB 5MEQB 4JZOA 1GZPB 3O6KH 2XY2A 4YHKL 3S3JA 1GOGA 2ZKHH 3A6CH 3LRGA 3FQUA 3G6DH 1LEGA 5AD0B 1EZVY 2HH0H 4EBQH 4HG4J 3CFJB 3QUYA 3JXAA 3MBEC 4E0RA 5IUSA 4ZAKD 4K7PL 3MR9A 3QCUH 3Q3GA 5BVJB 3ZT6A 1KOAA 2J88L 4QHNB 2DM3A 1WBYB 4DGYH 5TF1L 1IGYB 1KJ2A 2XZZA 2K9UA 1G9NL 3Q6GH 2CXGA 2UVFA 2FWOB 3U9PH 4K71C 4HXBH 4S1RH 5IIEA 4FQQA 4UAOB 4LASH 4KQ3L 5DD3H 1DBBL 4JQVA 4X7EC 2DD8H 2Y4SA 2AXJA 2E6PA 3QDJD 4B53A 1D9KA 1UZ8A 2GK2A 4L29A 5T1LB 3FZUD 4TSBH 4XPGH 2AJSH 4QWWD 5KW9L 5D7JD 4R0LC 2BNQA 3DARA 2UZIL 4HUKB 2HJFA 2ZKHL 3A6CL 5CD3A 4KPHL 4P2YA 1KN4L 3FQTA 5FKAA 4M7ZC 2YKLL 1FHGA 3CZFA 4G9FD 1IVLA 2FR4A 4TPRL 4XTRC 3LKNB 4HPOL 1T22A 4YXHL 1WICA 1EEQA 1CGTA 4PJ7F 3SKMA 3ROOA 4NDMB 2D0GA 4NN5B 4I9WD 2C3HA 1XGYL 3BPCB 4RAVB 3EJYC 4JLRB 2J5LC 1MH5B 3O6FD 1JRHH 4LLDA 3BPNC 1CLOH 4N8CL 1DBBH 3V7AE 4LU5H 3W11D 3QUMH 5GJSL 4APQC 1OLZA 3KPRD 1G7MA 2EDYA 4WW2C 1BAFL 3D0VA 5JA8B 4ZUTB 3AS2A 4YX2L 1WSST 1DUYB 4M6MH 3T0EB 5J1AA 1U91A 3MFGB 1KC5H 1WZLA 5T1MB 2X9WA 3FONA 4P2OB 3DSFH 4TPRH 2VXTL 3L5XL 4I77L 1NCNA 3QG7L 1T20B 4XBGA 3ALPA 3W2DL 1QVOA 3QA3B 3L95B 4CMMB 5JR1H 2BXYA 5JDJA 3HMXH 4IMLA 2EH7H 1NDMA 2MFNA 1X5LA 3TO2B 4MDIB 2WBJC 3BJLA 3MLYL 5DJXB 4K7FA 4QHUB 3BW9A 6FABL 3RTQB 4F3FB 4ODVL 1CD1B 4L4TE 1DQQB 3IFPB 3UJTH 3SGDI 5HSFA 2OM5A 4EOWL 4A6YB 3SO3C 1A7NH 4G8FA 1FLRH 3WDHA 1JTPA 2UV3A 3DXAA 1FPTL 4XCFH 1WK0A 1CDYA 2HFGH 5HHMD 3Q5TA 3QPXH 4IRZH 3WKML 4I0PC 1OM3L 5HGBB 1JNJA 4N8VA 3EFDH 1W0VA 3AREA 4Z5RA 2CMRH 3MRHB 5ESVA 1D9KD 4I3RL 1QR1A 4YDJB 1YEFL 2J2ZA 3VFPA 4UDTA 2QHRH 5DK2B 4J3SA 5C0CE 5CBAB 1G7LB 5IFAH 5M95B 4Z95H 4Y88A 4CVZB 5I15H 3MV8B 3U46A 1DBAH 3P2TA 2AXGB 4UT9H 5MEOA 2HTLC 4NUGH 1T04B 2D7OA 3OJVC 5HI4D 1Q94B 3QG6A 1JWSA 2AI0L 4U4BA 4AL8L 2ZUSA 4F33A 2VB5A 5F9JA 4LGPB 2X9XA 3TJHD 2B2XH 5HI5C 1ZS8A 4JAMA 2EO9A 3D0LB 1ZGLP 1D9KC 3SBWA 1Q9KA 4IRJA 1F11B 1KTDA 4F7TB 1V3JA 1INEL 2VISA 3QXTA 4FXKB 4JCLA 3FO2A 4R7NA 4ZXBC 2VXTH 1NGYB 3IJYB 5LGJA 4UV7L 3EO0B 1JNLL 5GGRY 4IIQC 5IB3B 5D70H 1CF8H 5EWIL 2QJDA 3DRQA 4ODSH 2EYSA 4QGYA 4ERSH 4JVWA 4KUZH 4MWFA 4UBDD 1RULL 1ZWIA 2BNUB 4V1DA 1F6LL 4OQTA 1U3JA 3VXNA 4B7IA 1QQDA 5DHVH 4KRPB 1MNUH 2FJHA 3QFJB 4XVJH 4J8RB 5E2JA 5F1NA 1AR2A 3TIEA 2H9GB 3RGVA 1BJ1J 4P2QB 1ES0B 3D2UA 5CSBA 4LLYA 2UUDH 5IB2B 5KVFH 2HTKC 5FYJU 3O0RL 1DBJH 2FEEL 1DN0A 5FUOL 4CBPA 1Q0YL 2E9JA 2XKSA 4Y5VB 4M93B 1BFOA 5DD0H 1FZMB 2QSVA 3MODH 4MD0B 5DRWA 4MA1B 4I48A 3VXRB 2AK1L 3L3OA 4KFZC 2LABA 1I7ZB 1AO7A 5JQHC 3IDJB 3KPRB 4HGKC 4ZFGL 3QZWA 4YC2B 5C07D 1BFVL 2HMIC 1HCFX 4YK4C 1A22B 4BELD 1I7RB 1ZMYA 1TQBC 3TNNA 3KJ6H 4YNYA 4MQSB 3JVGC 4YHML 1CQYA 4NHUA 4OF7A 1WZMA 1NAMA 1QFWM 1OTUC 2FECI 3P4NB 4NN7C 3IFOA 5D2NE 2DLHA 3BEVA 4Y4KB 4DFHA 4G9DA 1DBJL 2X7LA 4GG6F 1MWAB 4MA7L 5IHUL 3NFPB 1QLFB 2RHEA 3HR5A 3QIUC 3SGDH 4LCCA 4UUJB 2A9MH 2RFXB 4PLKC 3J8F7 2BCKB 1KG0A 4Y4HC 3DBXA 4QNPF 4GAYA 1F90H 4MSWB 1MCHA 1JGLL 4LSPL 2IEPA 2C26A 2GHWB 4TUJB 5I16A 1R3IH 1NC4A 5IMMA 3RWIA 4FQ1L 5HHVL 1U3HA 5CZXC 2LVCA 1FSKB 2LU3A 3RBSA 1X7QB 1N64L 2XWBB 5DT1H 1ITBB 2WMPA 1OTTD 2HLAB 3FO1B 3NPSB 4Q74A 5IB4A 5D96C 2KZ1B 3T8XB 4HKBA 4Y5XC 4XCEA 4JEGB 5JQ6H 4QYOB 2R1XB 5KANG 3D39D 4LLQA 2F53E 4FTVB 4ZYKA 2ZUYA 3DTXA 1DBKH 4BFBD 4Z78A 3UC0H 4Y4KC 1K9TA 1BZQK 2XKNA 1TJGL 4WFED 3FO9B 3WCYA 5J13B 1H15A 3NABH 4J4PA 3SDYL 2A6KA 5D7LE 5F7HA 1FL5A 3O9WB 4LPWA 1A7QL 1MRDH 3OKDA 4IS6A 4N0FB 3REVA 4QRQB 4YEFA 2B5IB 4Y4HB 4TRPH 3MGAA 4GSDL 4ZXBA 1MJ8H 1LQSR 1A1NA 3OZ9H 3PGCA 3W0WE 3RQ3A 1A21A 1DANT 3PWVA 4FQIH 1ZHLB 5CZKA 4NWUH 1A7BA 3D9AH 1BIIA 5HYQB 4L9LA 4PRAA 4R2GC 1NBZB 3QH3B 1G7JB 3SDXA 5CZVL 5KSVB 4EN3C 3HZYA 5DJ8A 3MLPA 1AHWA 4JRYD 1AO7D 4PV9A 1PFCA 4FQLL 1F6AA 4AG4L 3IRPX 1FVCB 2Y6SC 5DURD 3VXQB 3G6AA 1DEEB 3C60A 3B2UC 4YK4B 4OLWL 1EEZB 3HG1D 1YYLH 4LAQL 4LP5A 2QQLH 3RX8A 4L4JA 5KVEL 3VWJB 1QYGH 3KDMB 2DM7A 2MKWA 5JXAL 1U8QB 3LKRB 1Q0XH 3MGOA 3TZVD 1N6QL 1CF8L 3CSGA 5EO1B 3KGRA 5TH2A 5KSAA 2YPKB 1OT2A 1EJOH 4CADB 5EZJB 2AQ3A 3MJ8B 5D7KE 4PJ5E 1MRCH 5C7XL 4MXVF 1JK8B 4RNRB 2YMXH 5B4MD 5FYLE 4PJFA 1TZGL 4L8DA