3VXSA

The complex between h27-14 tcr and hla-a24 bound to hiv-1 nef134-10(6l) peptide
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxsA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxsA01
4JZJC 3N1GC 3EDJA 2FR4A 4O58H 4PGCA 5D1XA 3RUGB 2Y23A 3QEQE 2IALB 3ARDB 2OZ4A 1YN7A 4LSTH 3ECBB 3VWKC 4DQOH 4YE4H 1G7PB 1B0WA 3BESR 4UTBH 4AIZA 4G9FA 4L9LB 1ORSB 4XI5C 2VRAA 1FVEA 1I9RL 3BKCL 1DANT 4IRJA 5E9DB 5I1AA 1OM3H 4HDIA 4LFHG 3QJFA 4QRTB 5L2KA 5F88A 3VFGH 5IUSA 1NCTA 4NWUH 4OZFH 5EZJA 3EZJB 2ICWA 3FB6A 4E41A 3HFMH 1KJ2H 1FPTH 5L2JA 1FNEA 4J23A 4YAQB 3W9DA 4NO0D 4ORZC 2HT3C 1M05A 1Y18A 2P49B 5TPWH 3QXVA 2O5XL 4OCWH 4RISL 1YYML 1H3PH 3PGFH 3DETC 3PWPB 2BC4B 5K33A 4GRLD 2EH7H 4L8CB 2XIDA 1WAAE 5EU5B 2OS7A 1HHKB 5EORH 4HG4J 3L3OA 3N1QC 1ZGLB 1NC4B 4K7FB 3TT3L 1T89C 5BZWA 1GAFH 1YMME 1RFDH 3F65A 4I2XA 4P3DB 5FGBC 4M6ML 4DZ8A 5MEOB 4JY4A 3TO4C 1RIVH 5TF1L 2EDBA 2O26U 4FXKB 4ERSL 2PTTA 3VD4A 5M7QA 5F9JA 4P2OD 2WLYA 4LDLB 3G5VA 1Q1JH 3VWJD 5I9QC 4LOUD 1FNHA 1DQMH 4LCIH 4UT9H 5MP6L 3ARGA 1UYWH 3MA7B 4FFZH 3B9AA 1FVCB 3HNVH 1P5VA 3OXRB 1D5ZA 3EYUL 3MV8A 4MB3A 1A3RH 3W2DH 4DKDC 4TRPH 3T4YB 2VR5A 4P4KC 1M6OB 3HZMA 3VG0H 5IEHA 3MV9D 1N4XH 1DUZA 3TBTB 3OKKB 4M9PA 1KTDA 3F5WA 1DFBH 3PGCB 3QIWC 4K7PL 3WN5B 1QHPA 2AJSL 5CJOL 1Q94B 4YX2L 5F7LB 3JVGA 4WWKC 1QSFA 1RUMH 3MO1A 2JF1A 5B3JF 4A6YH 1YUHA 4JO2L 4YNYA 1ZLSL 1QD0A 3GI8L 4H8WH 4KUZL 4LNVA 2F54D 4R0LB 3IT8D 3IDIA 9CGTA 4HEPG 3SE8L 2ZSVB 2CGRH 1A3LH 2D4DA 3G6AB 1IGJB 1TCRB 3WEXA 2XXCB 4JFZH 3SPVA 3DIFA 1CFTB 1C12B 1CFNB 1RZIA 4JG0H 1RZJH 4NNXA 3QDMA 5T3ZH 4EIGB 1AGEA 3L7EB 1E4XL 2BHYA 2VDOL 3X14B 2I5YL 5GS0D 2AJXH 4JJ5A 1KLFA 4PJCF 1F8TL 2GFBA 2MSPA 4OFYD 3KJ4C 4HPOL 1SBSL 1KB5A 3WLBB 3MJ9L 3RWHB 5CHNA 1I1RA 3NN8A 4BH7B 1FBIH 1HXYB 1X5JA 1XGTA 2CXKA 4FXGB 4TNVK 3P9MA 3AB0B 5HTSA 1PGRB 2BNRA 5JW4M 5KVFL 1CIUA 1AC0A 3IXTB 1QR4A 3VRIB 4C58B 4U7SA 5ALCH 4R4FH 2KL6A 5ANME 3L3GB 3SDAC 2YA1A 4N5ED 1WCQA 4UT7L 3VFWA 1MAJA 3WKML 1I7TB 1RK0B 4PLOB 3LPFA 2MCPH 1QBLL 4Z78A 5C92A 3H2WA 3SQBA 3HCVB 5L9DL 1FIGH 4GW5B 3X13B 5KS9E 2CMRH 1T1WB 3VWKD 4ZAKB 1IKNA 5C7XL 3MV9E 4MD0A 1K4CB 1WVZA 4XX1E 1FG2B 5J1TC 4XI5D 5D1QD 3WNOA 2DJSA 4HS8L 2WINA 1I8KB 3SCMD 1K5NB 4EI6A 1JGLH 2ERJB 3KWWA 1U3ZA 4P2QD 1R3LB 4G8IB 3P0VL 3LIZH 3DSNA 4TNWF 3WLWC 2HMID 4RFNC 4Y4KA 4BJLA 2HT3D 2F54E 2JK5A 4LSSH 2GUOB 2BSTB 4QHUB 4TPRL 3WV0A 3V8CA 1HHGA 1HSAB 5FB8B 3W0WA 5LGHH 4F37K 5FGCE 3VRJA 1K4DA 4OD2B 1MJ7L 2VMFA 2FB4H 5E2VH 1G6RA 1MFNA 5C0AB 2WBKA 5E6ZA 3OKNB 3DETD 1XH3A 1QYGL 1Q0YL 4Z7VB 4KKCC 1HNFA 1UM4H 4NQXB 4UV4L 5CEZL 2ADIA 4MXQD 1OWWA 1KCSH 4WWID 1JRHL 5HHPB 2AABL 5DK0A 1XCTA 5DO2D 4E0RB 3KAAA 4JZNB 3H42H 3TO4D 2GJ6B 4AH2B 3BZDA 2AJZA 2YD4A 5F71A 5C0NC 1L7IH 1MY5A 3QEQA 4WCYL 3MRHA 1DBAL 1VEMA 2IF7A 5DS8A 2DL2A 3ZDZF 1ZLVH 3FQUB 4NRZA 3A6CL 4LKCB 2VNCA 4OCMC 3ESUF 1BEYL 4NZRL 5GGQL 1NGXA 1QLFA 4M7KL 3PXJA 1P2CA 4KVCL 3K2UH 5I75C 3MFFA 3H9YA 4P4KD 3HAEG 2XRAL 1QTYT 2NR6C 1TIUA 3WS3A 4NQEB 2DRUA 4YHPA 4HMCA 1XFPA 4P2QE 4H26A 5GIRB 3QIWD 1GGBL 2APVA 5IT2H 3DXAE 3TA3A 1KXTB 5I19H 4S2SA 4NHUB 4WWKD 1U58B 5EOCJ 5LXGL 5TFSL 2YN5A 4P46C 5KAQG 4TUJA 3MROA 2OP4L 2NY2D 1AR1C 2R1YA 5B22A 3MRBA 1WAAA 3QNXB 3CAFA 3IU3A 1LD9A 1BBJB 4MWFB 2V5SA 1JTPA 4QXGL 2Z35A 2BVPB 1YMMA 3NACL 2Q7YB 3V0VA 3VXQA 4OZHB 2OJZH 2WK2A 5DC4B 1CDUA 5EOCH 3MNWB 1DVFB 2WSKA 2C1PB 4ZUUA 1FG9C 4LSDA 1Q0XL 1ZS8A 3RI5F 3U9PH 5A2FA 3BP7B 5DWUL 3E8UH 1F3DJ 3ORJA 2OI9A 4M43L 3X12A 3B83A 5DEFA 1YEFH 4GRWH 1MIEL 4ELME 1QFUH 5KJRH 1D5IH 5HHNB 3VI4E 2FSEB 3MOAL 4KVNL 4GT7A 1EUUA 5DURB 5FYKH 3WIIL 4KMTH 4L1DA 2E7HA 2FJGB 4LSUL 1H8SA 5IF0B 1E4JA 5DJ2A 3JV0A 3VD7A 1AHWA 2EICA 3BAEH 3QQ3A 5GJTL 5TDPA 5INCA 1OAUL 3ULVC 4OF3A 3LEVH 4J6RH 3VW3H 4NP4H 4X5XA 1JMXA 1O5DT 3KG5A 5IK3A 4DEPB 1WSST 1ADQA 1JWSB 1FSKB 1V5JA 2YRPA 1S7SB 2APXA 1N6UA 4NO0A 5D1ZB 5IMMB 1MWAH 3F7RA 2R0WL 3HC4L 5IB3A 2J4WH 2WIIB 2XWTA 4CU6A 1JZ7A 1UZ8A 5C6TL 3MRGB 4OCXL 4UBDD 4WO4C 2VKXA 4GOSA 4Z0BH 3V8OA 3NA9L 4Z5RB 5IQ9A 1OQXA 2EDFA 4GRLA 4DAGL 3IFOB 3WLWD 4EBQH 3T8XA 1XGUA 4X6FA 5HYQB 3BD5A 5TQ2H 4GAYB 3CVHH 1I8IA 3FMGL 3QDJD 4P2YA 2AK4B 4WENB 2X1QA 1ZHKA 2P8PB 2VQ1A 4IMKA 4ONOA 3GSXA 1F11B 1EO7A 1DTUA 3HG1E 3ME0A 4PP8C 4P2OA 3VWJA 4G6FB 4LEXL 2IAMB 4KKCD 3VD5A 1F3JA 5KSUB 1KTRL 5BV7C 4NQDD 1P6FA 2CD0A 3O45A 4UAOC 5T1LB 1NFDF 5ANMA 2V17H 1K85A 1NMBH 1KCVH 4B7LA 4RIRB 4BH8A 3QFJD 4S1QL 3H7BA 4Z7NE 3Q5TA 1G9NC 1ACYL 5E1AA 2OR9H 2O5ZL 4GAJH 1CR9H 3MV9A 1BP3B 5F9OL 3FQRB 1YEGL 2JJSA 5EU7C 1LQVA 4DUXA 3CMOH 5FAAA 4ETYA 1CFVL 3ETBF 3SO3B 3NGBC 1LO5A 4FQHA 1J87A 2EKJA 4X98B 4LFHD 1N5YH 2VLJB 4YH6A 4JPVL 5BJTB 3NCYP 1X5KA 3B5TA 2NR6D 3S96A 5FV1L 5H35A 2VDMH 2F54A 4YHYC 5E94A 2VL4A 1UC6A 4X7DC 5F72S 1JHKL 1IGYB 2ZG1A 4IRSC 3C60A 4NO5A 3MSPA 2D31B 5GISH 2DQDL 2HWZH 4L8BB 1T6WA 2XA3A 3QDHA 3RVUC 3X17A 4ZFGL 4P46D 5JOPD 4EI5B 3GSQA 3HUJF 1VFAB 1AR1D 1MCCA 4OFYA 1I8MA 1OP3H 4LLAA 1RHFA 3QDJE 5D7JB 1HQ4B 3NCFB 2DMKA 2L4OA 1HHIB 4PY8J 1F58L 5C8JA 2R69L 4FP8L 1F4YL 2FZ3B 1AIFB 3L3KB 4JFPA 5E8NA 4ZPVB 4IS6B 5KSBF 4PRPD 3KYKH 5J1SC 4LGRB 4Y4FC 4OD1H 3S5LB 4DGYH 4JEGB 4NQDE 4BFGA 2XY2A 2DQTL 1CGVA 3VFRA 2HFEA 1A14L 4CRPA 4JE4B 3LKQA 4JZJA 2IG2L 3BEWB 1D9KB 5EC1B 1MNUL 1FFOA 5CGMA 3ZTNH 1OOAA 2UZXB 3VWKA 4I5BA 4X5LA 2DWEB 2X89D 1AR2A 2OX5A 5D1QA 5JXAL 4PJGA 1BZQK 3ULVD 4FTVD 4L9LC 1QLRA 2OXHA 3SCMA 2VERN 1HOCB 4P2QA 1PYWA 2P8MB 1Q9OA 1WISA 3JV6A 1G0DA 3LRSB 1A7PL 2EYTB 3GBLA 3QDGD 4G9DB 1R5VA 4U6YA 4N8VG 1AKJB 2M8XA 1U93B 4YHOL 4P2CG 1KIPB 1Q9LA 3PQYB 3SO5A 5HYIA 3LKNB 4X8XA 4X7SH 2G75B 5JOPE 1CFSB 4RAVA 2N4IA 3RWFB 3WNPA 4TYUA 2Z92B 4S0UC 4NKIL 3K8MA 4Z7UE 1ZT4A 4CNIA 4MQ7B 4MXQA 5CIPA 4CN1A 3ZE2F 1N2RA 1RUAH 1T89A 1MCWM 4XRCB 5FGBA 4D3CH 4MAYB 4ELMA 3TO4A 3DX8A 3SE9H 2HJKA 4PRPE 4JHWH 1JCKA 3IDMA 1ZXQA 5TDNB 3EO1A 3GSRA 4PTUA 4ZUVA 1EH9A 1NCBH 4XVUC 4R7DB 2EC8A 2NY5L 3O41B 2FHBA 1YY8B 1UWGH 4FQIL 2EIZA 2MQ0A 3QNZA 1LE9B 1F4WH 4GLRI 2IQ9L 1WEJL 1SJEB 5BVPH 1IKFH 4OGYH 1MFBL 4JO1H 5MEQA 3BD3A 5KVDL 1UH4A 5BXFA 1AD9B 1NBYA 1BJMA 4P4KA 1K9TA 3G5ZB 4CMHB 3HNSH 1MRDH 1KACB 3ULVE 4FTVE 2LAGB 3QO1A 4XMKL 1A4KA 5AZEL 1F6AA 3I2CL 3MGOB 4QXTA 2PO6B 1IAOA 3VGGA 1QFWI 3FO9B 3QIWA 4LHUB 4JQVC 3P0GB 4WWKA 3WN5C 4HS3B 2BDNL 1EVUA 4OIIH 3QDGE 2J8OA 4KK6C 4Y2DB 2H9GA 1FH5L 1QRKA 1CLOH 4ZD3L 1AFVL 3DHJA 3FFCD 2UV3A 2IGFL 1H3VA 5I1DA 4EDWH 2HRPH 4IRSD 1CLYL 5HVFB 2XZQL 1MHEA 4ETQB 3WIHL 4R0LC 3DLQR 3W5NA 1OT1A 4Z0XB 4KJWC 3OJMB 1N7ML 3C6SB 1XF3B 1B3JA 5IR1B 1WLHA 4OAWA 5BVJB 1IM3A 4NKDB 1Y6KR 2HKFL 4A2MA 4F7EA 1IGIH 2DKSA 4NBYB 4MJ2A 2Y36H 3X11A 4RA3A 1KEGH 3ZE0F 5K59E 4KQ3H 4OV5A 3JV4A 1HEZA 2XA8L 1OLLA 1SHMA 4Y4FD 4LP5A 4DN3L 1YEKH 4M8VA 4LLWB 5HYFA 1G7JA 5IB5A 2DKMA 3AB0C 4K7PY 4LCWB 4PBXA 2LQRA 1OAZL 2AGJL 1EAPA 2FX9H 4ODSL 4GG6E 2MJWA 5ABDE 5IWLC 1KIRB 1RHHB 3QHZL 4CU8A 3QA3A 3VFPB 3A67L 1YPZF 4LARL 2ORBH 1WFOA 2W1NA 4Z7WB 1IEHA 1EO5A 3BI9X 4ONHA 4NCC1 2IFGA 1NAMH 5EU7E 1DBBL 4ZAKC 2VC2L 2ZCLH 3ZHKA 1LK2A 4GKOA 1MUJA 5AUMA 4G6AC 1QHOA 4N0YH 5FCUL 4D9RD 1RURL 2XTLA 1JPSH 2PW1A 5DUBB 4XNMA 2IJ0C 1A6TB 5T33L 3DPBA 2DQFA 3LS5H 1F5WA 3FRUB 1PDKA 2ERJC 5JO5B 4GS7B 1VKXB 3FFCE 1EBPA 4YIQA 1A6AA 1J8HB 2W9DH 5IP4A 1IJ9A 4XCFL 3CZFA 4MX7A 1HH6B 4XXDB 3GI9L 3MOQA 1BMGA 3QDJA 1MFEH 3CXDH 3AS0A 1EX0A 3MCG1 4PJAF 1A21A 5F3HA 4DKAA 4WGVB 2FECI 1UXSB 3ALWA 4ODBD 2WMPA 4PJHE 3KDMA 5DRWB 4XMLL 1FO0H 3PWPD 4RGOL 5HHXL 2BVQA 4NQDA 5DJ0A 2X4SB 3MJGX 2CRIA 1A6UL 5JQHC 3OKMA 3QFJA 1S78C 1NC4D 3FO1B 2JLLA 1ACZA 2IH1B 1G1CA 3CU7A 3L9RA 3MV7B 4XVUD 5FA3A 5J89A 1Z5LB 2F8XC 3KXFB 1FRGH 3GMLB 3RQ3A 2VXVL 3WNKA 4KH2A 1U3HB 3O3BA 4XPAL 2R2EB 4JFHD 3FQWB 3QRGH 1XZ0A 3UAJC 4U1MB 3IGAA 1E4XI 6FABH 15C8H 5I71B 3IVKA 4YDKH 5KN5B 5IB2B 1G7QB 3QUMH 3QG7H 2IMMA 4LGPB 3DVGA 3OAYK 3QUXB 1E4WH 2AW2A 2KZ1B 3UMTA 3O3EA 4NQSA 1EUTA 3ZL4H 5ITFA 4QRSA 1DEEA 4Y16B 3WS6C 2X41A 3TFKD 2GEEA 3EDEA 1P5UA 5EBGA 4D9RE 3TIDA 4R7NA 5F7HA 4GSDL 4NDMB 5I1EL 1YNKL 5I8KL 2QV2A 2W60B 5CSBA 4EUPH 4HUXB 4GUPA 1REIA 4KTEH 1QBBA 4KK6D 4X99B 4M3JA 3GMQB 1XF4B 4P46A 4M62H 5DHYB 1SY6A 3MBEC 4QKXB 2VISA 1UG9A 4OUUA 3I85A 4ODUA 2OL3L 3RWCB 3HN3A 4Z7UA 1EFXB 1A7OH 2ZOKB 1XCQA 3F12A 3U7YL 3GSVA 1U3YA 1CGWA 5F7YC 2W65A 3PWNA 3AC0A 2ADFL 3GFUA 3U0PB 2FATL 3QCUH 4PRPA 2ARJQ 4P9ML 35C8H 2VL5A 4KJWD 1GYAA 3PWPE 3SGKA 1VESA 3NABL 3LKSA 3STBA 3IDJA 2IFFL 1TZGL 2FO1A 2XYCA 5HD8C 4V2BA 5ACMA 3CLEL 1T1XA 1U8HB 2P7TB 4PJIF 2ADJB 3VGBA 1C16A 4POUB 5JNYA 1U8KB 1EDQA 3MRCB 3S37H 5JIIA 1K8DA 5I2IA 3B9KB 4JFHE 1C08A 2X89A 5I73C 3ULUH 3EOBB 5HSFA 2GCYA 4FTVA 5LKNA 4Z7QE 4C59B 4WW2A 4K8RC 3QCTH 4YDJB 3FOLA 2YWYA 4KAQH 3GDBA 4MDJA 1JRHI 4ZYKB 1T20B 5H37H 2DS4A 2VB5A 2DQEL 4DEPC 3QDGA 4YHIB 1FSKC 4NBXB 2YBRB 2MTPA 3U30B 1DL7H 4HG4K 4PB9H 2B8OT 4ZAKD 5BQ7B 1U8OA 1YECL 1NUGA 5D1ZC 5IESH 2GHWB 3GSUA 4G6AD 1BF2A 4LHUG 5DT1L 4C4KT 4POZC 3WJLA 3HPJA 5HJ3B 4WHYH 1KPRB 1OP9A 1U8MB 1KN2H 4F7MA 4WY7H 4OLYH 4EVNA 4HWBA 5ICZA 1LMKA 4M61A 4I9WD 4D9QE 1OQOA 5E00A 3BZFA 4HIXL 5LGJB 3T2NH 4YHLL 1S7QA 1RULL 2VABB 4KMLB 3MLWL 2HG5A 1A9BB 1UM5H 2EDYA 5FO9A 4QCIB 3MJ8A 2H3NA 1BGXL 3QAZB 2R1WA 3IAGC 2EIBA 2FX8L 4M7LL 1NCAL 4TNVF 4U49A 1FAIL 1MAKA 3MFGB 3P2TA 5F7DB 4U33A 3ARTA 1E6JH 5I17A 4Y88A 5DTFA 3V7MA 3LQMA 2IAMC 1G7IA 5JPNA 1A9EA 4AMKL 4CVXB 3DX9B 1S78D 3UPCA 3B9VA 4GG6A 1VACB 5FYJL 1U8JA 1KLGB 2GJ6D 1JGEB 4U6TA 1INQA 1WBYA 4BSVB 1X4XA 1MCNA 2FJHA 3DRTA 2AP2A 3LEYL 3TYGL 2BOBB 1IQDA 5FHAH 5ESVB 1EJOH 4CW1B 3FCTA 5TDOB 3SO3C 1L6XA 3PABA 3LH2H 3D9AL 1I7ZA 4MD5B 4I48B 3N1MC 3BQUB 3FFCA 1WFTA 2FH8A 2NX5B 1S7UA 2OZ4H 5A2JH 1HI6A 4IRSA 2ICWJ 1Z3GH 4NQED 4OZGA 4QTHA 3WDHA 4ZG1A 2DYPB 2HLFC 2COQA 4PGEB 3THML 3JWDH 4I9WE 3E6HA 3U7WH 2RQ8A 3MBED 3D25B 3SE3C 1OTSC 4PJHA 5B3JE 5JMRA 1VCAA 3Q5OA 5TGBA 1HNGA 3CFJA 5DYOA 1BFOA 2NY0C 3QEUA 2NZ9C 1S7VA 4JGJA 1J05A 3G04A 1LQSR 1CK0H 1AQKL 2FLRT 5D7JC 4XCNB 3FT3B 3LMJH 5AG8A 4L29B 2R4RH 4MLIA 4N0FA 4Y4FA 5C0AE 5IHZA 4S1DC 4K2UH 3MGTB 1UACH 5DJDA 1ZAGA 1W0WB 3E2HB 4Z7VE 4RMVA 1KJVA 3ZT5A 3AMKA 2CXGA 1BF8A 4OCNC 1FNGA 5HD8D 1NGZB 2EO1A 3SGEI 4JPIB 2GJ6E 3VE0B 5DK2B 4U6HB 1XIWB 1D9KC 4RMWA 2CDFB 5KSAD 5DURD 2YEZA 1QRNB 1GVIA 2R0ZH 4LCUB 5HDLA 5CEYB 1P69B 1MH5B 3I6GB 3LOWA 1KBGL 3ECBA 2FYYB 3HAEA 4UILL 3ZYJA 5EC2B 5E8OA 4OCSH 1G7PA 4O2EB 2VDKH 4MLSA 3GMNB 4AK1A 4PJFF 5FHBH 1B88A 1ORSA 4UTAH 5ISZB 2R2HA 3CD4A 3T0VA 3ZZ1A 2ARJB 4ELKA 4OIAA 3CH8A 1F00I 5AYUL 4QRTA 2Y25A 1LDSA 1ORQB 1CU4H 5F7EL 4P59H 3B2UC 4QNPF 3BH8A 3QNYB 1OL0A 4YAQA 5D1ZD 1ZLVK 1YYLH 4NQEE 4O2CB 4XTRC 5T1MB 5D5MF 7FABL 2A9ML 2WUBL 3MLZL 4BZ2L 2CKNA 4NHUE 1C7SA 3GKWL 1JL8A 2GY7B 3PWPA 2BC4A 1J5OH 3VFUB 5DD1L 1W72H 4L8CA 2V6HA 5EU5A 1HHKA 3MLXL 2R8SL 4LSRH 3ABZA 3DURB 1ZGLA 1DANU 1NC4A 4K7FA 3SOBH 1AJ7L 1JP5A 3ZDXE 1BFVL 1JGUL 4OZHE 4MAYC 5MEOA 5KTEL 3RFZC 1UFUA 2AK4D 3VDCA 3IS0X 3BO8B 4FXKA 4KZEL 3MLSH 2YZ8A 2IBGA 5EU6B 1NUFA 3KR3L 5AYQA 3X3GH 4G6FD 4JHAH 2IAMD 3ARZA 5DUPL 3BYTA 3HE6B 1MFAH 4FQJL 5C0CB 2DWDA 2VXUL 3MA7A 5T1LD 2JCCB 4U6VH 5FYLH 3TN0B 3IDXH 3T0WA 3LQAL 3RIFK 4YGVB 3WIFA 3T4YA 1J12A 3O3UN 3WFHB 3NZ8A 4KTDL 4JG1L 4CMHC 4GKNB 2NW3B 2DQHL 3KPNB 4XWGL 3TFKA 3CUPA 4OCYH 5LVEA 3ZDZE 5DJZB 4MA8L 4PJFB 3SKOB 8FABB 4XPFL 3OKKA 2AQ1A 4Z77B 1ZV5A 4M02A 3PGCA 3L5JA 4GAGH 1BOYA 4YDLB 1OTUC 5D8JH 5CZVH 1M7DB 1A7NH 4Y2DC 3OKOB 4O58L 3QUKB 5LBSH 3CFEA 4HLZH 5FOBB 4YGAB 5HI5D 4TVPD 4LSTL 4B0MM 4LF3B 3CLFH 2ZSVA 3P30H 1IGJA 1LO0H 4KI1A 3QULA 2VAJA 3TBYA 4B50A 1C12A 4XHJC 5BRZB 1CFNA 3FB8B 4JDTH 5DR5H 1N0XH 1OTSD 3T1FA 3L7EA 2NY0D 5HHVL 3HE7B 3T65A 2NZ9D 4RQQB 2QQNH 3HR6A 4QRPB 1KJ2L 1BVLA 4WFED 4TQEH 3ZKMC 4LSPL 4RMTA 3WLBA 2AK4E 4AM0B 3RWHA 4PYHA 2WQRA 5DI8B 4BH7A 5E24E 4S1DD 5MHSD 2O61B 1R0AH 4PD4K 5JW4R 4OKVB 4OCWL 4XBPB 3RZWA 4KRPB 2HKHH 3FTGB 3FZUC 4BZ1L 4Y1AB 2Z4QB 1X4ZA 3IXTA 4L8DB 3VRIA 2G5BA 2CQVA 3L3GA 3IKCA 3UTQB 4I0PC 5IWLA 4OZIB 3CX5K 5C0BB 2EH7L 2FL5B 1ZLWH 1EO8H 1I7TA 1RK0A 1JF1B 1D9KD 2YRZA 1IBGL 4NZTL 2QQQA 2HVJB 2IWGA 4HC1A 1RFDL 4YPGB 2A77H 4PLJC 4UNUA 4GW5A 1RIVL 4ZAKA 1UWEL 1JJUA 1K4CA 2Z31B 3V6ZB 1FG2A 3MRMA 4YBHA 3CIQA 2JJVA 4HWUA 3ARWA 3TPKA 2Y6SC 1DQML 1WC7B 4FRWA 1MRFL 4OB5H 5IEKB 2O93L 4PP1C 3S35X 3TH2T 1P1ZB 1AXTH 1R3LA 4G8IA 5E2UH 1RZ8B 3FAWA 4FFZL 5F89A 4CGTA 2RIKA 4XGZB 4AT6B 3B2UD 4GS7C 5K9KB 1KB5L 1S7XA 3V4PH 2N1KA 4QRRB 4ODVL 4CKVX 3ZMRA 2B39A 2J7LA 1JYVA 4TRPL 4DOHB 2HT4C 4TVPE 4WV1B 1Q72H 2GUOA 2BSTA 3P4NB 4QHUA 3EDDA 3PQYD 1HSAA 3GIZH 4XTRD 3TJEL 3VG0L 2MQCA 3HC0B 4OD2A 4NO2B 4PGZA 5JUEH 4X6CF 1CXLA 1LGVA 2DQCL 3OKNA 2VZOA 4S1SH 3BVNB 1TENA 3D69A 2APBA 2AXHA 3TNNB 4NQXA 5EWIL 3STLB 4WFEE 3P0YL 1RUML 5GRJL 4PJCA 4L3CA 5I1IL 4E0RA 4MAYD 5CUSH 4JZNA 4MXWH 5MHSE 2GJ6A 1WTGT 4QHKJ 4AH2A 1R3KA 1B0RB 3BDYL 1RZGA 1ZT1B 1B90A 3G6DL 2LAAA 1XGRB 2VDLH 1OP3K 1U3HC 3NA4A 3QEHA 1RZJL 1I4FA 3ROOB 3ARXA 4LKCA 3G5XA 3DYOA 3VFVB 4APQC 5I71C 3BWUC 4WU7B 2AJXL 1A7QL 2X09A 3BXNB 4OFVA 3BW9B 4GG8B 1MVUB 5DMJB 1JUFB 1Q8MA 1FBIL 3QUXC 3WS6A 5I0DA 5F1NA 1OSZA 4LLVB 1ZT7B 2YSSB 3SGDH 1XMWA 2DLEA 4O51B 5AZ2H 1LDPH 4NQEA 4N8VA 4Y16C 4WW1A 1T0MB 4ZO7A 5IQ7L 1H3UA 2ZCHH 4ZNCD 2VDQH 2OL3B 4LHUD 3UTPD 3NCCB 1HHJB 3QJHA 2YUXA 1OTUD 2F5BH 3MBEA 4Y2DD 4BK5A 4RGND 3TESA 1ADQH 4U3HA 1N6QL 4HUMB 5HVGB 1R6VA 1QSVA 4FFVC 2HJFB 2WP3T 5IFJA 3DWTA 1FIGL 3PQYE 5CILH 2BFVL 2OM5A 4MWFA 2PXYB 3T2OA 1FNFA 1IILE 2Q7YA 4OZHA 3NH7L 2X9YA 4U2ZA 2EDEA 1UM6H 3DTXB 3MNWA 2NYYC 4K9EH 1TTGA 1WF5A 1IEAB 2C1PA 2YPKB 4ZODA 3FN9A 5JTWA 3HUJE 4Y4HD 2MFNA 1OAKH 3BGMA 1LEKB 3LIZL 1T7WA 4HX1B 1ZTXL 4XP6L 2AVGA 5HHNA 3VA2C 2FSEA 4BQ6A 1PX3A 3PNWA 3JUYA 2D7PA 1GRWA 5KSAA 3S4SB 1QVOA 1PEZA 2EXYC 4LPTA 4PJ7F 3SDCB 2QKIA 5IF0A 3FZUD 4ODWB 3MREB 4YHZL 5D72H 2J8UB 1RZKH 1PZUB 4I0PD 4NJ9L 2YC1B 4TOYL 3D0LB 2UVEA 1H3WM 2JJTC 1NANI 3G08B 2KH2B 4S0SD 2YA0A 2AJVH 3A0OA 2QEJA 2BHUA 1JWSA 1C5BH 4PB0L 1G9EA 4PLJD 1S7SA 2DMBA 2EO9A 3EOTH 2DQJL 1JN6B 4M6OL 3CFKB 5D1ZA 5IMMA 3U30C 2WIIA 1L7IL 3MRDB 1RIHH 5GXBB 5GGTL 2GYSA 3I75B 2F58H 3UTPE 3B8SA 2C3GA 5C6PB 4PP1D 5SX4H 3VDBA 2I60H 3CPLB 1SEQH 3MRGA 3REVB 3SDYL 4RGNE 4O5LL 1EVTC 3IFOA 5FO8B 1LHZA 4HMEA 3IKKA 4ZUSB 2HH0L 1J8HD 2HT4D 3GEWB 5IJKC 4I77H 3KLAB 4GAYA 5DSCA 3CSYB 1TZIB 5FEBA 4MB5A 2LVEA 1GIGH 4YBQC 3VFTA 1DN2A 1VPOH 2AK4A 3ARFB 4K3HA 2P8PA 2EC9U 1KIQA 1F11A 5ICYB 3B3IB 4R26L 5CEZD 3QAZC 1DUYB 3L5WA 4M93B 1DP0A 2IAMA 5IT2L 1NCDL 3RKPA 5T3XD 3FAXA 5T1LA 3EJYC 3U0TA 1S5IL 3L1OH 4RMUA 2BERA 3LEXB 1IT9H 5E5MB 3MUGB 2DIAA 4PREB 4NM8L 1BOGB 3BYYA 2BVTA 4XB8A 1FL3B 3TBVA 1NDMA 2MKLC 3T0EB 3KXFD 1MHCB 4PG9B 5F9WB 3GBMH 4DGVH 1U3HD 3D39B 4LCWE 3FQRA 1J1OH 4RFOH 1RMFH 4APQD 2XKNB 5IM7B 2ZKHL 1S9WB 3E8UL 4HUVA 5DD0H 2X40A 5HY9B 4OZ4B 1QFUL 4X98A 5I8OH 5KJRL 1TJHH 5IBTL 3B4NA 2YPLB 1PX4A 4MXVF 3BQUC 2H1PH 4LSQH 4F57L 3DMMD 5JXEC 2IANB 1IGYA 1J11A 2AJYH 2D31A 1HXMA 1XAUA 3BAEL 1JIBA 4L8BA 1VEOA 4MZ2A 1N6VA 2B4CC 2GJZB 3LEVL 4IRZH 5BZDB 1BVKB 4NP4L 5I18L 1A4JB 4R3SB 1BZ9B 4H1LB 1J8HE 4JKMA 3V9FA 1VFAA 2HJLB 1FFPB 3MQIA 2X4TB 3ARVA 5I66A 1C5CH 1T2QH 3P9LB 3M1BB 1KUMA 3U0WL 4I4WB 1HHIA 4O00A 4MD4B 3WFEH 5CEZE 1IE5A 1Y0LB 4X8JB 2FZ3A 3L3KA 4AY0A 2A6KB 1L0YA 2ATPB 6CGTA 4W4OC 5E2TL 4PRHB 1CLZL 2H6PA 1T03H 1ZK9A 4R8WH 5T3XE 4HZLB 4O02H 3E2HC 1ES0A 4Z0BL 3S36X 5GSVA 5J4MA 4YO0B 4V1DB 4Q9RH 4EZMA 5GGUB 4EBQL 2J88H 3IAPA 4ZNEA 3BEWA 4XVJH 3LQZB 1PD6A 4OSUL 1D9KA 3ZE0E 1FYTB 3CVHL 4PLKC 4AG4H 2QSCL 1U42A 3MV7E 4Q9QL 2HTKC 1XIWC 3KXFE 3VMOA 4MCZB 2EXYD 4G6JH 4HF5L 5DVKA 2F53B 3MUZ1 2FD6H 1MY7A 3S97C 2GK0B 3WE6B 1HOCA 3PHSA 2NW2A 2B2XL 5F6HJ 4V3EB 4M6AA 5E8PA 2P8MA 1K2DB 2V17L 5D2LF 1KCVL 3LRSA 3UJIL 2EYTA 4G9DA 5C0GB 3Q5YA 4QWWC 1A7RH 5I76B 1RZFH 4G3YL 2EE2A 3L5IA 1U93A 1A6WL 5JLZB 3PQYA 1X4YA 3CGTA 3T0XA 1CR9L 3GRWA 5L8LB 4ZO6A 3SKMA 3DGGB 2VLRD 4P3CH 1KC5L 3NTCL 4NNPL 4Q0XL 3L3IB 4KHTL 3ZYZA 5JMOC 2VLMD 3CMOL 1HYSC 1YEDB 3RWFA 4HWNA 4F15C 1JNNL 1LP9F 1T0NB 2DBJA 4MS8D 3MLPA 3S34L 4Z9KB 1N5YL 3HUJA 4MQ7A 3PHOB 5F6IC 4FA8A 4ZQKB 1A6PA 3K0WA 4WI3A 3V4UL 1A5FL 3OR6A 4BZYA 1GGIH 1PLGH 4MAYA 4YBQD 4GXVH 1N59B 2NY5C 4POYA 5C0RH 3QXWA 5DMIL 5TDNA 2IH3B 2CH8A 4CVUA 5AWNL 1DBML 5I1KH 1JTOA 3TT1H 1YY8A 2OMBA 5CSZB 3SDDB 1HCVA 4YZFF 2KPNA 4NUGH 1LE9A 3O2DA 1B2WH 5DRXA 3BSZL 1N64H 2DDQH 3EJYD 1SJEA 3HE6C 3NAAH 3CFDB 5IGXL 3TN0C 3S4SG 1RJCA 1DE4A 4P57B 5IFHH 5IJVA 4JR9H 2ICEB 3VD3A 1CIDA 2E9IA 1GZQB 4LBEB 1TNNA 4Z6AT 3MGOA 1Q9WB 1P4LB 4L3AA 3RNQB 1BHGA 3OAUH 4LHUA 3FO9A 2W0LA 3M8OH 4WJ5B 4NN7B 1G6VK 3JZ7A 5I1HH 2OK0L 3QIBD 4G8EB 3MNZA 4TSBL 1NLDH 4HS3A 4Y2DA 2GTZB 5E6IB 2X1WL 3ZKXB 5CJBA 2Q86B 1J0YA 1YA5A 3VJ6B 3TCLB 5DA0B 5JXED 3IF1B 5E2WL 2R4SL 1S8DB 1JHLL 1NGYB 2MHAB 4ETQA 3UZVB 3K4ZA 2VLME 2GK2A 4OZFB 3MUY1 2Y9RT 4Z0XA 1KJ2B 5DQJA 4JKKA 2JIXB 1XF3A 3C6SA 3MJ9A 3ULSB 3O9WB 4Y4HA 5BVJA 4X9IA 4NKDA 4WTXA 1LVEA 2H32A 3HE7C 5HYJB 3NZHH 5LCVL 4M48L 5ERWA 5EBMA 3P11H 3BGAA 5C2UB 5FUZH 4JJHA 2D4FA 4O2FA 3PP4L 1IFHH 2AEQH 3LB6C 2IBZY 3RKDD 2R0KH 1T1YB 3W11C 2F74B 1EEQA 2VLLA 1CVRA 4KRPC 3KPPB 4I0PA 5IHUL 2AK1H 4PJ5B 1RHHA 4PJIE 2Y07H 1RUAL 4PLKD 3VFPA 4D3CL 1XIWD 2GTWA 4P5KB 1EEZB 1G7HB 2LU4A 1QRND 5EFIB 3D2UB 4X83A 5FM5O 1CF8L 1UH3A 5IW6B 1JNLH 1SBBA 4RNRB 2A74B 5A3IC 3OGCA 2Z31C 3EAKA 4AENB 5ISZD 1P7HL 3LS4H 2FGWH 1CL7L 5DUBA 1A6TA 4HLJA 4KXZH 5BVPL 2ZNWA 3FRUA 3WUZA 3PHQB 3U48A 5IROC 2I24N 4CUCA 1VKXA 1MFDL 3AS1A 4ALAH 5F1SA 2VZSA 4QWWD 1J8HA 2NX5E 4MAUL 4NBZB 1HH6A 3HNSL 4XXDA 1IQWL 4WV1C 2QADB 4YUEH 1QFHA 3MC0A 1IAKB 4FOMA 4JFDD 4NIKB 5CP7A 2F19H 4OCRH 1HYSD 5SWZD 4A6YB 4TSAL 1UXSA 4H1LG 2GSGB 5DRWA 3QHTC 5JW4N 2E9WA 1M71B 2L0DA 4LU5H 2X4SA 43C9B 1A1MB 4YFEA 3OXSB 1SY6H 1MJJB 2ZUUA 3LV3A 5KW9H 1OTTC 4YXLL 5GHWH 1B4RA 3FO1A 1HHHB 4XB7A 2IH1A 2ED8A 1DBKL 3QO0B 2UWEF 4EDWL 1U41A 1Z5LA 5FUCC 3KXFA 5K9JL 3IDUA 1WFNA 2CLRB 1U3HA 5EU6D 4I3RH 1YNTB 2R2EA 1C7TA 3QCVH 3Q2CA 5LQBH 1TPXC 5HGDB 4APQA 4U1MA 4JFOB 4MMXC 5KN5A 3U36B 5EBLB 4E42B 5IB2A 1G7QA 3TN0D 3LKOB 3QISA 4JKLA 2C3WA 1IGIL 3ILPA 3SKNA 1M7IB 2KQMA 1QRNE 2FEDC 1RY7B 1YPZA 3PWJB 4KQ3L 2APTA 1NBZA 1CS6A 3OX8B 1OGTB 3DMMA 3ET9F 3DV6B 4FQ1H 4D0BB 5ISZE 1NBVH 4NDMA 2Q6WA 4RRPG 2FO4B 2W60A 2A2QT 3ULVH 1BQUA 1HIMH 2ZSWB 4HFWB 4WIQA 4XWOD 4MA7H 4X99A 3GMQA 1XF4A 5EIIB 1DQLL 2V2XA 5DHYA 5EBWB 4MA3A 3GKZA 3OKLB 4Y19B 2IPTH 1H0DB 4F7CB 3RWCA 3MLYH 3HI1B 1J0ZA 1EERB 2ZOKA 4ZTPL 3VH8B 5LG1A 4LLUB 5D7SH 4XNZB 1JGVH 4GXUM 2PXYC 3U0PA 4JFDE 1EHLL 1B0GA 2DTSA 3KYNB 4YXHL 4PJAA 4N0YL 1TJGH 4FABL 1J0KA 5BRZD 3WSQL 2YD2A 5GS2D 1PY4A 2EDLA 3QZWA 4HWBH 5IMLA 1ZHLB 3RA7H 4CMMA 4NQCD 1VADA 4LKXB 2WY3A 1MCLA 2W9DL 5E08L 3QFDA 1U8HA 2V5TA 4WHTB 5F3BB 4N0UE 2BY2A 2ADJA 1BQLL 1MFEL 2VXQH 1U8KA 3MRCA 3LB6D 3ARSA 4RAUB 5EU6E 2JTDA 4Q2ZA 1V3LA 4IM8A 4ONGH 2IC2A 3G9VA 3W11D 4G8FB 1IARB 4KRPD 3MLRH 1I1FB 2RFXB 4NWTL 4PTTB 4UZGA 4Y1AD 5DMKB 2YMXH 3VRLE 4YHNB 2JCCE 2JJTA 5T5NG 4OQTH 2VUYA 1MCRA 4PFEA 5C0BD 1JPST 2BCKA 4ZYKA 1IC5L 3WFZA 1H9VA 3O11B 2H26A 1TDQA 2EDNA 2YBRA 5JHDB 5DC9B 4G43B 2OSLA 4GW4B 3VXMB 4WI8A 1P4BH 5A3ID 4PJFE 2Z31D 4K3DL 1X7QA 1U8IB 2QSVA 4JKPL 1KPRA 2P24B 2EDOA 4OI7A 2C3XA 3ZKSD 1FGVH 1FV1A 3FN0H 6FABL 4OF0A 2AS5M 5JQ6H 3I3EA 2WW8A 3V6BR 5HDQH 4YDKL 1QPXA 4HHAA 1W2KT 3PDGA 4MS8A 4QNPE 5KS9F 2EECA 5IJKA 3QG7L 2DD8L 1HILA 3KLHD 4QRRD 1NDGA 4UB0L 5KVGH 2KKQA 2VABA 3EGSB 4LPXA 4MA1B 4XP4H 2I9LB 3ZL4L 1UT9A 1URLA 3IXAB 5GGSB 4DUVA 5IMOB 4K71B 4KK9C 4OZFG 4UUJA 4WHCA 5D5ME 3ARFC 5BRZE 1CBVH 1E27B 3WFBH 5FECB 5TQ0H 3BFOA 3D18B 5F7DA 1A64A 3BP5B 3L6FB 4KTEL 2B0SL 3L5XH 3Q6FB 4TTDC 1L4IA 1V7ML 4M93C 5B8CA 1U8PB 4M62L 4WU5B 4QRPE 3IDNB 4U6XB 3UXFA 1OTTD 3DX9A 3M07A 1LO2H 1DCLA 3P73A 2YKLL 2DTMH 1VACA 1I9IH 1RIUL 5J6HB 1A22B 1A7OL 5IVZB 1JWMB 1KLGA 4PJIA 3S6CA 4Y8DC 1RAMA 2NLJB 2FCBA 3P77B 4NKQB 35C8L 4Y1AE 2E9BA 3T0EC 4GRWB 1J0IA 5D7LB 5F9WC 4B5EA 1ZA6A 2CIKB 2CLZB 3KS0H 5C0BE 3CXHJ 4C56B 2BOBA 3NOIA 5ESVA 3QIBA 4CW1A 3MRJB 4MD5A 4I48A 1B6DA 4LSVL 5FO7B 4MQXC 2OTUB 1ED3B 3HMXA 3L95B 2NX5A 5JXEA 2BX5A 2B5IB 2PYFB 4X80H 3HAEH 3EYOA 3ULUL 1ZLWK 4HUNB 4FHBD 4PGEA 5GGSY 5IMKB 4AEHH 2YUVA 1GOFA 3MYJB 1WQVT 1GOGA 1MWAB 3WXVL 1OAQL 3BKML 2QLVB 4QRRE 2BJMH 4Q7DA 4DOHE 1U6AL 1G9NL 3C5SB 12E8H 4PP2B 1NGPH 3U1SL 3PL6B 2FDBP 4PB9L 3GSOA 4XCNA 3FT3A 1OARL 2GY5A 3MOBL 2BNQD 5B3NA 5CD5D 4W4OA 1SM3L 2EE3A 4L29A 3FHAA 1NL0L 3V5HB 3MGTA 1UH2A 1KN2L 2OTWB 2BRQA 1W0WA 3E2HA 4CVWA 4N8CL 5E7FA 1UVQB 3CVHB 3TVMD 1W0VB 3QIUB 5HHOD 1IL1A 4YXKH 4UDTA 5CMAA 4WUUB 2Z8WC 2ZUSA 1DSFH 4U6HA 1XIWA 5FUCE 3U9UA 4QOKB 1QRNA 3BP6B 3MRNB 4LCUA 5CEYA 1MH5A 1D5BB 3I6GA 5MENB 2FYYA 5EC2A 3KYOB 3SE4C 4L4JA 1F4XH 4TSCL 1AGDB 2M2DA 4MNQB 1A0QH 3NIDF 1E6JL 3WCYA 2XTJC 4PG2C 5ISZA 4XPGH 4WEUD 3JWOH 4AJ0A 3VI4F 2X4PB 5JORB 2GKIA 4NRXA 2ILLA 2VAAB 3UTSB 3ARBB 1ORQA 3E6FB 3ZDYF 4OM0H 1JV5B 5IBUB 4X6EB 1MIML 4K3EL 1IVLA 1U91B 3QNYA 2ADGB 4NC0B 4MQSB 4O2CA 1OVZA 1KYOJ 5CS7A 2MCG1 5HYSG 2CUHA 4HBCL 3EO0A 4NFBA 5L8JB 1HN1A 1V8HA 3O2VL 4JFDA 3ZT6A 5SWZA 2Y72A 4YHMH 5B38B 2VR4A 1D7FA 1YJDH 1ND0B 4JFXB 5J11B 3JBG7 4X6BB 4PRIB 2EDWA 2SEBB 3VFUA 4NPYB 3U4BH 2RJMA 1TVDA 3IFNH 3RVVD 3LH2L 3LAFA 5JA8B 5HHMB 5IKCB 3DURA 3GMMB 2BNQE 4U1JA 4KK9D 4XNUH 1NFKA 2HFGH 4EOWH 3BO8A 4LPYA 4N0UA 1XF1A 4FFWC 4TTDD 5EU6A 4FZ8L 1NEZB 3F7YA 4ORGB 2PR4H 5FYJD 3SDDC 2NY1B 1AGBB 3LQAC 1JK8B 3R0MA 5EO9B 5HHOE 3TWCH 5ETUA 1EGJH 2JCCA 4KJYB 3TN0A 1KCGC 3MXWL 4PR5B 3N85H 4J7RA 4YGVA 2V7HB 5GRWA 5I8EA 3WFHA 1TITA 3T0ED 4GKNA 1PKQA 2NW3A 3KPNA 3OMZA 2J8UE 3WO4B 1UACL 3D39D 1J8KA 5DJZA 1KPVA 4PJFA 3SKOA 8FABA 2EEDA 5EOTB 2D0HA 4KC3B 4Z77A 3WO3B 2R2CA 4CAGA 5JPMB 3JTTB 4Z7NF 1T7XA 2Z8RA 4NN7C 1M7DA 4LEOB 2XFXA 1JZ4A 3WIHA 5E6IC 5CP3A 3ZKXC 4OFDA 4MQXD 2Q8BL 4PUBH 2OYPA 3C08L 3ZHLA 4LLDB 5FOBA 5L7XL 4WEBL 3T2PA 3EW3B 1S7RA 2CDGB 1X5LA 3KPSB 3Q6GL 3DECA 4LF3A 3CH1B 2VDKL 4OGXH 4YDIH 1ROWA 3Q0HA 3S35H 2FBJL 5FDWA 2G60H 3HKFA 5D5MA 1NMCB 3MODL 5BRZA 3FB8A 1I85A 32C2B 4UOW1 5K9OB 4HKXA 3AU1A 4NQCA 3O9WC 1CU4L 3R06B 3TBWB 3B43A 3TO2A 4HKJB 2WWKT 2RCSH 4RQQA 5H2BA 4XC1L 1YZZA 3L3DA 4ZTOH 4AM0A 4QHLB 5C0FA 3J8F7 5D96B 2DQIH 4XBEL 1RV6X 5BW7C 5A40E 2VE6B 3RHWK 4UOW0 1RUQH 4QRQA 4PRHD 4XBPA 3OR7B 4ENEC 4LCYA 3FTGA 4Y1AA 2Z4QA 4L8DA 1FC2D 4ZOBA 4XP5H 5ACZB 3UTQA 4V1DD 4OCLC 4ZFFA 1R3IH 4KUCF 5C0BA 3O81A 1W72L 2A1WH 1OSPH 4JDVA 4GFTB 4O4YH 1E6OH 2DIJA 2HTLC 1JF1A 2R23A 3DSFH 2IPUG 3VXRB 3V4VL 5L88H 3UO1L 2HVJA 4HGKC 4YPGA 1M1SA 5TH2B 3T0EE 1RUKH 5ILTH 4HIEA 2IBBA 2J12B 1CD8A 1RUPH 1JPFB 1LO4H 2E5EA 3D39E 1BD2B 4HCRL 2F53D 2VDNH 2Z31A 3V6ZA 2XTJD 2J8HA 4JZOB 4OQ1A 5JW3L 2JJUA 4P99A 3EYSL 4JHAL 2XQBL 4CVZB 2EDQA 1BWMA 4CN4A 5FA4A 4JANB 5IROA 3UYPA 1YC8A 3HLAA 3PJSA 1RZ8A 1ZKAA 3PV6B 4G5ZL 4XGZA 4AT6A 4Y0GA 5C0EB 1QA9B 4HK0B 4QRRA 2HFFA 1CLCA 4QT5B 2IANE 2E8YA 3WFDL 4Q9CA 4NM4H 4ZOCA 5DJ6A 4XBGB 2QADC 4LL9A 4DK3A 4NO2A 4U1SA 1MLBB 3V5DB 1L7TH 4YWGH 4JFEB 5IHBA 3BVNA 4JCLA 4GAGL 4QO1A 2W07A 1ZHNB 1XGPB 1FE8H 4H8WC 2LFGA 4XPHH 3O3DB 3STLA 1GC1H 3QUZB 5JOFB 4BFEA 4HC1L 4BQCA 4JM2B 2V9TA 2R56H 4OD3H 5DXWA 4YLQT 2E27L 3N1FC 3O6FB 4MNHA 1MCSA 3CLFL 1B0RA 4PRHE 4Z7OF 1RZJC 1RSFA 1LO0L 4BSWB 4W81A 3WD5L 2VXTL 5F7WC 4LHJB 4WGWB 3SDDD 4V1DE 4NYLB 5DR5L 3SQOL 5E8DH 1U36A 1YQVH 3VFVA 1GCFA 1IAIM 4WU7A 5CCKL 2VLKB 3L7FA 5FOJA 1FYTE 3BXNA 3K74B 1J1PL 2VIRB 1RPQA 3BW9A 1CYGA 2RB8A 4OI8A 3BE1H 5D2NB 5HYEA 4P9HH 2F53E 3AREB 3RZCB 4X6DF 1C1EH 2XTJE 4LLVA 4LDOB 4R2GD 1CGSL 2OQJB 2YSSA 4PJEB 1R0AL 5H8DA 1AH1A 1CICB 3D85B 4OLZH 1UKSA 3EYFA 1T0MA 5KOVC 4MJ6A 3RWEA 2BMKB 2OL3A 4PPTA 3CFCL 1HHJA 3PWLB 3F58L 3I50L 1F45A 3BX7C 3GMPA 1EO8L 5E6ID 1VGKB 1F97A 4MXVE 1BLNB 4S0TD 3AXLB 2HJFA 3TEUA 4P5TD 2XZCH 3I6LD 2ZJSL 3ARGD 2BNQA 4QF1B 2M1KA 5B38G 3C8KB 4XNZC 1AY1H 3IFLH 4HULB 3CSBA 3BPLB 1CL7I 1X5XA 3DTXA 5DZNA 4DGIH 4AEIH 2JIXD 3A6BH 4XC3H 3LSOA 3VXUD 3TVMA 4JPKH 1LEKA 3TBSB 1AO7B 5IVNA 5I30L 5HHOA 4HX1A 4JFQA 3V4PL 4X4ZA 3CSGA 3MMEB 5E2JA 5HYJD 4HK3N 1IGCL 5DJYB 2B1HH 1TJIH 2XPGB 1CD0A 4XNQB 4LLMB 2B1AH 4MYWB 1FO0B 2XN9D 3BKJH 3GIZL 4GMSL 5D4QA 4YDVB 4XCCL 1UA6H 3FQNA 1RJLA 3QXAA 3MRRB 2PCPB 3MREA 4TN9A 3UYRH 5J13C 3WNMA 3KNBA 1EV2E 4KK8C 1S7WA 3D0LA 3MCLL 2AEIT 2DN7A 1II4E 5K59F 4UIKH 4PJ5D 4R96B 4FQXB 3ULUF 1KJMB 5ELIA 5IW3A 5CFHA 1JN6A 2VZUA 3CFKA 5KZCD 5GRXG 3D2UD 4ODTH 1N8ZB 5DGRA 5CINH 3GJEA 3QHFL 2DM3A 4OT1H 1HSBA 4JLRB 4Z8FH 1NCWH 3QUMB 4GKSB 4GG6F 3F8UB 2EKSA 1FNSH 2WUCL 3H3PH 3CPLA 4NHCL 3REVA 1FGNH 3VFMB 3QI9B 5D2LE 1OAXL 4XPTH 1UJ3A 5FO8A 1INDH 4U1GB 4HPYH 3I6LE 3KLAA 2OBGA 3CSYA 4EUPB 4ONFL 5ICXB 1TZIA 4MA1C 5J57B 1TXKA 5IB1B 3FQXA 5DUMH 5GGRB 2QADD 3GSWB 1RVFL 1LDPL 2J6EH 5ICYA 4I3SH 4K71C 4GLRH 3BWAB 4K8RL 2ZCHL 3VXUE 4XCEA 4X7TA 4YBLB 3CK0H 5I16A 1MHHB 4M1CC 4NSKA 4XAWH 3HPLA 4UOJA 5HYJE 3BKYH 3DOSA 2NTFB 3HHRB 3LEXA 4Q6IB 1H3GA 1ZE3C 3G9AB 2XN9E 1QKZL 4PREA 5CILL 5TE6H 3ZKNC 1BOGA 4QEGA 1IGMH 3BIKB 4XAKD 1KELL 4NUJB 5I1JH 3L3HB 1R3JB 3T0EA 5ADOH 1MHCA 4PG9A 3S36H 4MDIB 4YZFE 1P9MA 3D39A 3T4AB 3RL2A 1ZANH 1YNLH 3C2AL 3U7AA 2XKNA 3QYCA 2IQAB 4FQCH 4U1HA 5IM7A 4PJ5E 5HPOA 4RAHA 1KCRL 1ZVYA 2D2OA 4OZ4A 4CBPA 5FCSH 2OMNA 2QBWA 2VSDA 3FONB 4HT1L 4KZDL 1P84K 2RHEA 4IMLB 4HWEL 5EUKA 2XICA 2Q76B 2X4UB 1I9RH 3BKCH 5DJAB 4H25B 3DYPA 1PG7L 5D6CB 3BHBB 2B5IC 1WTLA 2AEWA 4LRNH 2V2TB 4HBQA 1DLFH 1RZKL 5GGRY 5BZDA 2GJZA 3RUGF 3ZLQC 1A4JA 1EZVX 2VZ3A 4R3SA 3NFNB 2P5WB 1O7VA 4LQFL 1T04B 3KGRA 4H1LA 4WUKH 2AJVL 4UMGA 5CJQL 2A73B 2HJLA 4Y19D 1FFPA 2X4TA 8CGTA 3U2SB 2VWEC 3SJVB 3P9LA 2QQKL 2O5XH 4RISH 1YYMH 4I4WA 5IBLC 4MD4A 3NCBB 3PL6C 4X8JA 2Q8AL 5F9DC 4GKZB 3FQTA 3OKEB 1VGEL 2A6KA 1XGQA 2F58L 4PRHA 4ZFOB 2NY3B 1U9KA 5BS0B 2DLTA 2I60L 1FZKB 4HZLA 3RIAK 3TT3H 3GJFB 4OLVH 3JTCA 4M1GL 4YO0A 4V1DA 4M6MH 1ODAA 1IAMA 4NCC2 3LKPB 4F8QA 3QIUC 3B5HA 4ERSH 3TNMB 5ITBL 4XAKE 5IB4A 3O4OB 1ZGLP 1DEDA 1NCCL 4MCZA 3UDWC 1BIIA 1MQ8A 2F53A 2VDPH 2GK0A 3GGWB 2BRRH 3EUUA 4JFFB 3RGHA 4KK8D 3WE6A 4OLWL 3EYUH 1CQYA 2EDTA 1S5HB 4RRPA 1OWRM 5FYKU 5C0DA 1K2DA 3L1OL 3ARBC 4JN1L 4N9GA 1EMTL 4U1NB 4KI5F 2MOVA 1HKLL 2ZCKL 5I76A 5JHDD 1SMOA 3RNKB 3JSSA 2Y7QB 1LEIB 1IC4L 4Z7QF 4MMZC 5JLZA 3VXMD 1QFWL 4K7PH 3C5JB 3CJJA 2AJSH 4DFIA 1KTLB 4HKBA 3DGGA 1KG0A 4PY7B 4DKFL 4YX2H 1RMFL 5JW5B 1S9XB 3L3IA 4FNLH 4HGWB 5DVNA 1I9JH 1G9MH 1YEDA 4JO2H 4BFBD 4J1UB 4PGCB 4Y19E 1ZLSH 3GI8H 5DD0L 5J11C 5HGBA 1P7KB 4KUZH 1YN7B 4M5ZH 4UDUB 3SE8H 4HJ0D 4G9FB 5ADPL 1N59A 2H1PL 3FB7B 1NUNB 2MWCA 3AY4C 2P43B 2IH3A 4H88L 5L2KB 1E4XH 2VDOH 2YHGA 2ICES 3BDBA 2I5YH 2WBJB 4FN0A 4NJAH 4Q97A 1O0VA 5CSZA 1F8TH 4JCMA 5EZJB 2ICWB 2NY6B 3FB6B 1VA9A 4GQ9H 3MV11 1SBSH 4HPOH 3SDDA 4E41B 4M1CD 1FNEB 1OP5H 3A6OA 1GGUA 3MJ9H 1M05B 2NY1C 3ZTJG 3CFDA 2ZNXA 3QQ4A 4CJ1A 2H32H 4P57A 2UWEE 2ICEA 5KVFH 2AEPL 3GRWL 3H6JA 1GZQA 4LBEA 5CKAA 1RD6A 1Q9WA 1P4LA 3IDYB 3RNQA 3WO4C 3VFNB 2PTVA 1QBLH 3WHXA 3PXHA 4C56D 4WJ5A 5BZWB 5L9DH 3HC3L 4DZ8B 3GMRB 1RU9L 5F96L 4G8EA 5GS1A 5E6IA 5C7XH 1NLBL 1OPGL 4JRXB 2BK8A 2Q86A 5D2LA 5JHDE 2GT9A 5J06A 2PTTB 4K23L 2DOCA 4AG4L 5F9JB 1XGYH 3VXME 3TCLA 4HS8H 3SGJC 3IF1A 4P5TA 2YK1L 4BK4A 4KRMB 2MHAA 3P0VH 3UJJH 4XP9H 3LN5B 4OZFA 5CGYD 4KHXH 3O2DL 1KJ2A 3BEVB 3MV8B 5LGKA 2EYRB 1NMCC 2JIXA 3RTQB 4YEFA 4XNXL 3VXUA 4FG6C 1CGUA 5J8OA 5ESAA 4UV7L 1LP9A 4TPRH 4EUPG 3FOMB 5C2BL 1MJ7H 5HYJA 1A7RL 1OB1B 2HN7A 2X6MA 3TH3T 3PL6D 3RDTB 1SQ2N 5BW7A 3DO7A 5AAWA 2FECL 2LTQB 3F5WB 4HV8A 5D96C 2XN9A 5SWSB 1I1YB 1Q0YH 4WDIA 1W72B 5CEZH 4UV4H 5JR1H 3O0RL 1A02N 4NFDA 3MO1B 1T1YA 2F74A 1A1NB 3I3BA 1CDYA 2W9EL 1HWHB 3S3PA 5KVEL 3QIUD 5B21A 1WBXB 2YS4A 4PJ5A 3C60D 4WUUD 1RK1B 4MSWB 1GGIL 1PLGL 3C6LD 1KSRA 4P5KA 3K2MC 1DBAH 3DIFB 2WWKO 5C0RL 5EFIA 3D2UA 5KSVB 3RY5A 1H8OA 3A6CH 4NNXB 4Z7VF 3QDMB 5TE7L 5J12B 5GGQH 1F02I 4HFUH 5AD0B 5IW6A 1BQHG 2DJ4A 4JJ5B 5I1KL 5IVXF 1NAKL 3TT1L 4KVCH 4C56E 2E6PA 5FYKE 4KY1H 3V6FB 4F2MA 1B2WL 5IIEB 4M7JL 3VDAA 1JNHB 5CHNB 3NAAL 5KG9A 3IDGA 4ODXA 3RAJH 1XGTB 1TMCB 1U2CA 2CIIA 1MJUL 1NGWA 3K7UA 4AL8H 1ZA3B 5IFHL 3GHBL 3P9MB 1A47A 1N5AB 4JR9L 1I7UA 3C87A 5C0IB 5H37G 3UYOD 1GGBH 1B4JL 1K8IB 3GM0A 2XWBA 4U0QB 5TFSH 5LXGH 1SJHA 1IAKA 1G7MB 2UY7A 3RU8L 1AXSA 2OP4H 4Z78B 4P2RB 4PRID 2VWEE 1UKTA 1M71A 1T21B 2VXSL 4JO3L 1JYNA 43C9A 1A1MA 4WHYG 3KPMA 3OXSA 3CXHK 4QXGH 4V3DB 3FO2A 2BSSA 2FJFB 4HQQL 3QUZC 3JTSB 2NXZB 1TQBB 43CAB 4NN6B 4E5XA 3QO0A 3RWIB 4JM2C 1QSED 1GHFH 2NY4B 1Q0XH 2QQLL 3KWWB 5DQ9B 3MLVL 1BZ7B 3DXAD 3O6FC 4HS6A 2YA2A 2CLRA 4I1NB 1YNTA 3BN9C 1EPFA 1FFQA 4KQ4H 1JFMA 1T22B 2D7TL 5FF6A 4Y4KB 3MOAH 4JFOA 2JK5B 25C8L 3C8DA 4BUHA 3QPXL 3V52L 3ZDXF 4WUUE 2N56A 4OZHF 4H20L 4U05A 5GZOC 3LKOA 4X7FC 4ACPA 4LPVA 1K4DB 4LSUH 1M7IA 4M4PA 1KNOA 4H5SA 2H8PA 1X5FA 3PWJA 5GJTH 1OY3B 4FQQB 5MENE 3BPOB 4ZFZB 1OAUH 5D2NC 3OX8A 1XH3B 2DJUA 1OGTA 1JZ3A 3AREC 3RZCC 2AXGA 3DV6A 4D0BA 5D7KD 1CICC 5IVXB 5TE4L 2FO4A 5HYSA 1HH9B 2ZSWA 4W70A 4HFWA 5T3XL 1MHPH 3DUHA 2EDKA 2D9CA 5FM5M 5DFTA 3HC4H 4UQ2A 2R0WH 3OKLA 2Y07L 1MI5D 4Y19A 3KPLB 1H0DA 4F7CA 3HI1A 5JZ7C 2YR3A 1L6ZA 3MXVH 4NRZB 1PSKL 3KPSD 3AFLA 4OCXH 4U1LB 1NGXB 1N0LA 1CI5A 3NA9H 3TYFA 3KYNA 4DAGH 1X5YA 3BRGC 1IC1A 3BPLC 4PRIE 4MJIB 3LS4L 2R0LH 2A6IB 3EFDL 2E3VA 4FG6D 5HHQB 4OBSA 2NQCA 1ZHLA 4Y2OA 5CJ5A 4RFEB 4BELD 4LKXA 5EO0B 2V7NA 4XP1L 4DCQA 1QSEE 1V05A 2ITCB 3RVTC 2PNDA 1CD1B 2DB8A 2DQGL 4LEXH 4HUKB 2UWEA 1X6NA 3TA3B 4RAUA 5HDBE 2X4NB 1KYOK 4TUJB 1QLEH 4PTTA 2RFXA 5DMKA 2EZ0C 2R1YB 4S1QH 4D94A 4IDLA 4HXBL 3WFCL 3NVQA 1LD9B 2DI7A 2JJWA 5CJXC 1C5DA 2Z35B 2O5ZH 3MNVA 5KW9L 4M6NL 1RQ5A 3O11A 5GGTA 3HG1D 4FQXC 4LGSB 3VGFA 5F9OH 5JHDA 4G43A 1YEGH 5JIHA 2CR6A 4GW4A 3VXMA 1BD2D 3HTLX 1HQRA 5D7KE 1KV3A 3WL9A 1FLTX 3NIDE 4BKLB 1U8IA 3KPTA 3X12B 1JNJA 4RWYH 5DVOA 4R90L 2UYLA 2P24A 4LMQI 5D6DC 1W0YT 2GAZB 4JPVH 4QHMB 1UCBL 1MCOL 1PG7W 3ZDYE 1MI5E 2LU3A 3QI9C 1EEUA 3VI3F 4OBRA 1JHKH 1F3DH 3PGDB 5ALBL 3DVNA 4DW2L 3EGSA 3IU4L 4U1GC 3BP4A 5DJ2B 3BT2L 2DQDH 1FL6B 3ES6B 3KPSE 3SDAD 5TDPB 3IXAA 5GGSA 1YEJL 2VN4A 1NMAH 1MFCH 1AQDB 4ZFGH 3ZO0A 3NFSL 1E27A 4TTGA 3TIEA 4UNTA 5FECA 5DD6A 3BP5A 1LE5B 2K3TA 3L6FA 3EOYG 1FLRH 1HIML 3Q6FA 4JFED 4KKAC 4ZUWB 2EE6A 3U46A 4YBLC 1SYVB 1YMHA 4GMTL 4WU5A 3IDNA 2R69H 4U6XA 2XWTB 3QUZD 2Z8SA 4QTIH 1FZMB 4X5WB 2H41A 4Q6IC 3O2WL 5IVZA 1JWMA 1T2JA 3P40A 5D7SL 4WNQB 5INDB 3WBDA 3C5ZB 4XZUB 1A2YB 1CDCA 3O6FD 2DQTH 3P77A 4RDQF 7CGTA 4U1KA 2AERT 2IG2H 3T8XB 3P4MA 1H5BA 2CIKA 4WFFD 2CLZA 2N7AA 4OLUL 4BYHA 2AXFA 1MNUH 2DIBA 4C56A 1BVZA 5E99H 4KUCD 3MRJA 2A9NL 2VQ1B 3AS2A 5BO1L 1U2HA 3OJVC 5CWSB 1CGXA 4P2OB 1FL5A 5JXAH 3ULUC 3H9SB 2NMSA 3QH3A 5FO7A 1BD2E 1ED3A 3L95A 2P4AB 3Q3GB 3CCHB 2PYFA 4NGHL 4WHDA 3VCLA 3MBXL 2HVKA 4TUOA 5I15H 1JZ6A 3FO0L 1CT8B 3MLRL 4Y5YB 1A7PH 5IMKA 3H7BB 4F58H 3UC0L 5E03A 4OQTL 1CDHA 5C0ND 2EIDA 2CO7B 3MYJA 1MWAA 3LZFL 4YHOH 5KS9A 1AGFA 4XH2A 5JZ7D 3MV9B 4PP2A 1Q9KB 3PL6A 1SVCP 3T77B 3P9WB 4ISVB 3UZEA 2Y4SA 3MUHL 2YOCA 3V5HA 3ALXA 4JFEE 4ZXBB 2OTWA 3H8NA 1DQQA 4G6KL 2NY3C 1UVQA 3CVHA 1ZEAL 1KCUL 4JFYB 2N7BA 1W0VA 2ZG3A 1AO7D 3IJYB 3QIUA 4QHNB 2F54B 1PFCA 5E4IA 5GSRA 3I3DA 5J1AA 5HGGS 1T7VA 5KVGL 4M03A 4WUUA 2X05A 3RX7A 3RVTD 4XP4L 1NSNH 3C6LA 3HMXL 3QQNA 2R29L 1FFRA 2FEEL 4FQIH 1JI2A 1YEEL 3ILQC 3LHPL 2EEBA 3MRNA 3O4OC 1D5BA 5DC0A 2IQ9H 2G9HB 1WEJH 3REWA 1HK6A 1J1XL 1J88A 3DX6B 3HZYA 3KYOA 1D6VL 4WFFE 5EA0L 1YY9C 2B4CL 3GSQB 5EU4A 1MFBH 4TNWK 4DVBA 1I8MB 5KVDH 3L5XL 4CN6A 2X4PA 5JORA 1EA9C 3DARA 1YQ2A 1ITCA 3D0VA 4LVNB 3E6FA 4JFPB 1LO2L 5D2NE 4FQXD 1NKOA 1JV5A 4X6EA 5AZEH 4XMKH 1U91A 4LK4A 4ZS7L 4WI6A 4PJEE 1EXUB 2ADGA 2YXMA 4NKMB 4J3UA 2BSED 4KKBC 1FN4A 3BOVA 1U8NB 4LASL 2R1XA 1Y6MR 4N8PA 2XWJA 5FIEA 2BDNH 5BMFH 5B38A 1FH5H 3OHXB 4ZD3H 1ND0A 4JFXA 1AFVH 1G7LB 1F4HA 2JKXA 4PRIA 2IGFH 3QI9D 5F7UA 4PS4L 4NPYA 5GRVK 3ARDC 2DM4A 4FQ2L 2G2RB 1MVFA 5J9PB 3AVEA 1CLYH 4YEEA 3L3JA 4F80A 5IKCA 1TZHB 5D1QB 3GMMA 5K9QI 4PJGB 3AY4A 1P4IL 5DMGC 4QLRA 3SCMB 5HVHB 1N7MH 5CLWA 1QSEA 3JWDC 2CJUL 1PYWB 3DX7B 4TULL 3DXAA 3JV6B 4N90E 4K3JL 1QG3A 2WBJC 3I6KB 2HKFH 2Z9TA 4QY8B 5I8CB 4ORGA 1AO7E 2NY6C 1AGBA 4NZUL 1JK8A 4ZS6C 2BJML 4S1RH 5F7FA 4JB9L 2V7HA 1NGPL 4WO4D 3T04D 3GSNL 4Z7OE 3HI6L 4RAVB 1OAZH 4RZCA 3CC5B 4FFEX 3NFPB 4CNIB 1ZT4B 2D03L 1IC7L 3QHZH 4PJDB 1N2RB 5EOTA 3DVFA 3IDYC 4Y5VB 1HKFA 3A67H 5MEPB 4F7PB 4GW1B 4ELMB 4LARH 3MRFA 4N68A 2Y1VA 3IDMB 4YXKL 5DVLA 1DN0B 1KPUA 1MI5A 2NNAB 2VC2H 3ULUD 4HH9B 1DSFL 3S3SA 4X6DE 4KI5C 5FCUH 1QZ1A 3WXWL 2EIZB 1RURH 3QNZB 2P8LB 2F15A 2CPCA 2CDGA 3KPSA 5T33H 3HI5L 3QXDB 3CH1A 1IAIL 4LPCA 4XPGL 5GGVH 5I1LA 2IEPA 32C2A 4PV9B 4Z7WF 2YPVL 1GGCH 1I3GL 4XCFH 4OLXL 2P5WD 2WZPD 3RTQC 4FFYL 3GI9H 3RVWC 4JQIL 3B2VL 4OM0L 4HKJA 1UGNA 1EK3A 4HJJL 3SJVD 1F6AB 4QHLA 2Z8VC 3BIAX 5GJSL 1LILA 1GSMA 3RDTC 4XMLH 2VE6A 2LTQC 1A1OB 5HHXH 5HVWA 3ARQA 3RPIB 3OR7A 2NY3D 5BS0D 5LAXB 1NANH 4MVBC 2NY2B 5D71L 2J5LB 1A6ZA 5I1DB 2I27N 2XOTA 3HZKA 3IFNL 4ZPTB 2NY7H 1U95B 4XNYL 4G7YL 2VXVH 4DTGL 4C57C 3HG1A 3ILQD 4Q74A 3RVUD 5TH2A 1JZ2A 3I9GL 1JPFA 2PW2A 1BD2A 3K46A 4DKEL 4JPWL 2PYEB 5J12C 4X9FA 3V79C 4JZOA 1ZMYA 2E7MA 1L0XA 2X44D 1KFAL 4JFFD 2ID5A 5K9QG 4CVZA 1CDIA 2PR4L 1T0PB 4JANA 3BRDA 3DUSB 2AXJA 3MRPB 1I1AB 3ULUE 1HEZB 2J1KA 3EDKA 3UTTB 5JIKA 2W0PA 5C0EA 1G1YA 5IV2B 4HK0A 1QUNA 4GSDH 4KU1A 1YNKH 1CZ8L 1MCPL 2Y06L 5IB5B 2X4OB 3SDAA 4HUWB 5C09B 3U4AA 1KB9K 4QYOA 3KLSA 2DBLH 4YC2B 4MJ5B 1EAPB 4HEME 4GBXB 2CKBH 3WDJA 4JAMB 1MLBA 3V5DA 1JYWA 3ALPA 4XPBL 2EE9A 4WRLA 2P5WE 4JFEA 1BFSA 3H0TB 4KK5C 3ARDD 1KTKE 1ZHNA 3U7YH 3OZ9L 1XGPA 3ZE1F 4ONHB 1L9NA 3SJVE 3QUZA 5JOFA 2FATH 4JN2B 1EBAA 4PUBL 4P9MH 4ZOEA 4YQXL 5E9DD 2Y5EA 2NXZC 2Y5TA 1FDLL 1TQBC 2F8OA 4U4BA 1U8LB 4NN6C 2DQFB 3O6FA 4X4ME 4OGXL 2NY4C 5BS0E 4BSWA 2WBJD 3VGEA 4MNGB 5KVMC 3G5YA 1IM9B 1A6AB 2NY6D 3CDGA 2W0KA 4NYLA 4ZS6D 4U31A 2I9TA 2VH5H 4Y4KC 4G80B 4U7MA 1LWRA 1CWVA 2VIRA 1QSZA 4X7EC 5CEXA 3BMVA 3NIGF 4O9HL 5D2NA 4RDQG 2Q1EA 1KN4H 3BPOC 2OQJA 5MI0B 4PJEA 2BVQB 3MLTA 1AI1L 4OM1L 5DJ0B 4DWHA 4JFFE 1MF2H 1BX2B 1CICA 2CSPA 2DQUL 3RWGB 1UQSB 3QEGL 2FX7L 2DQEH 2QSTA 3QFJB 1U92A 1DDHA 3PWLA 2WWMC 1ONQA 1R3IL 4TUKL 1JE6A 3S5LG 2A1WL 4O4YL 1DQJB 2UZYB 1U8QB 1YECH 4JRXD 1BLNA 3BRFA 4KI5D 5DT1H 3AXLA 4PGDB 3O3BB 2HLAB 3EOAA 1RUKL 2YUZA 3QSKB 3O3AB 3I84A 3IVKB 4QF1A 1CG9B 3MRQB 3ZT7A 3BUTA 3HR5B 3RUGE 2VUOA 1KEML 1NGQL 3GK8H 5FK9B 2X4RB 1RULH 2DLHA 4DN4H 3MLWH 3RTQD 1NCUA 1I3RA 3RWDB 4I13B 4X4YB 3RVWD 1MCIA 1AO7A 1EEYA 3QQ9C 1HE7A 4LNRB 1LK3L 3VXNB 1BGXH 4HJGB 5LJYH 5E9DE 2FX8H 4M7LH 5DJYA 1FAIH 2XPGA 4XNQA 3RDTD 4K94H 5SWSD 1IGTA 2Z93B 4YDVA 3AM8C 3TA3C 4E41E 4MVBD 4D9QD 4MCYA 4AMKH 1T66C 3MRRA 1XR8B 5DD5L 4ODUB 4Z7UB 5FYJH 4PRDB 1MQKH 3GSVB 5I6XB 2C7UB 2W65B 3PWNB 1F90L 5FM8A 4FQXA 3OBAA 3TV3L 1KJMA 5L8KB 3HMWL 2R56L 4OF8A 3UP1A 1DVFC 3O4LB 1OP5K 2L7JA 3LKSB 3GHEL 3O6LL 1N8ZA 2X5PA 4X6DA 4XCYB 2LABA 4M4RA 4JLRA 5I1GL 5D6DA 1JZ8A 4GXUN 2HT2C 1FZOB 2AJ3B 3PWUA 4AIXA 2XZAH 3D9AH 1T1XB 4LIQL 4PRAA 2GSIA 5E8DL 5ID0B 2A6DB 1CE1L 2Z91A 4G42B 1OAYH 4JRXE 3QI9A 1BBDH 2H45A 2C4FU 2KBGA 5JNYB 1MCQA 4KI5E 3AMLA 1F2QA 5DFWH 3WNNA 2A83A 3QBTB 1WITA 4KGLA 4WFHE 2QTEA 3OF6D 1YEIH 3BE1L 5JIPA 1T2XA 4EUPA 2D3VA 2GCYB 4P9HL 3THMH 4WW2B 3FT2B 5GRVL 5GGRA 3KYMB 4NKOA 5GRZA 3MV8E 5EZIH 3BWAA 1FZJA 2QHRL 3QDGB 4KK5D 5I1CL 3WJJC 2PKDA 4P2RD 5J56B 1MHHA 3UTZA 1AQKH 1KULA 5FKPA 1YDPA 1RZ7L 1S9VB 3GSUB 4Q6IA 1DLHB 2NXZD 4QXUL 3RBSA 2ZPKH 4WO4A 5SWSE 3MCKA 3VXOB 5ESQA 2PTUA 4K9EC 4EVNB 3BIKA 2NY4D 4NUJA 5ICZB 3L3HA 3C5ZC 4M61B 3O6ML 5GZNC 2CLVB 3IFLL 1WZ1L 4MDIA 1BM3H 4G7VL 3T4AA 1R5IA 4KXZI 4AEIL 4RCAA 3MR9B 4LRIC 1BQHA 2IQAA 4XC3L 1CXEA 5FO9B 2X1OA 2L7UA 2Q87A 4PGBB 4UILH 5C0AD 1TJIL 4IEFB 3FONA 4HIHB 4D0DB 4IMLA 4RA0C 5I17B 4P2OC 2X4UA 2B1AL 4LOUC 1DQDL 5T1DH 1RZKC 5FXCH 1G7IB 1I7RB 5D6CA 3BHBA 2A6JB 5JPNB 1A9EB 5F7EH 2V2TA 3UYRL 4DFHA 4F3FB 2WWMD 4Y5YC 1U8JB 1JWUB 2P5WA 1PQZB 3IAQA 1UB6B 2F5AL 1INQB 3U2SA 4EDXB 4FQLL 1E28B 3UAJD 1NQBA 3CVIH 3SJVA 3S3JA 1P6AB 2A9MH 2WUBH 3DRTB 4ODTL 3MLZH 4BZ2H 4I0CC 2JJSC 4NO3B 3GKWH 5CINL 4F9PC 1IQDB 1JI1A 4OT1L 4GKZA 1YEHL 3OKEA 4Z8FL 1TVBB 4GQPH 2QR0B 4IHOB 3PABB 1FNSL 4X4MA 5DD1H 4ZFOA 4P2RE 5DA4A 3R1GL 1QR1A 3EO9H 5BS0A 4MJID 1FJ1B 2R8SH 4ZXBC 3DJ9A 4W6YB 2EIEA 1AJ7H 3GJFA 3QQ9D 4YHYB 1BFVH 1JGUH 4XPTL 1UXWB 1T7YA 3ZSTA 4F37F 2YD7A 3LKPA 3OKDB 3W39A 4OZGB 3N9GL 4KZEH 2FNBA 2O5YL 1DZBA 4LMQE 4OF6A 1JFQL 4PJXB 5DUML 3E6HB 5DUPH 1TQCB 1ETZB 4FQJH 5MERA 1WZKA 2AAVA 4JHZA 3INUL 3GM8A 2VXUH 4PJHB 4JY5L 4EI5C 5TGBB 3GGWA 4R4BA 1BAFL 1BFOB 3MA9H 1KXQE 1V7NH 4JFFA 3QEUB 3LQAH 1D5MB 1XF2B 5EB9A 3QUYB 2ZWLT 3GNMH 3MV01 1S5HA 1MCEA 5E56A 5C07B 4JG1H 4LVNC 1ITBB 2DQHH 4XWGH 4U1NA 3SY0A 1DVFD 4UIMB 5TE6L 4MA8H 4MB4A 1Z9LA 3RNKA 3RBGA 4XPFH 2X4QA 2Y7QA 5E1HB 4M1DH 5EOQL 2XQYG 3VRLF 2JCCF 5IVXE 3C2SA 3C5JA 3S36L 2HT2D 1KTLA 5F93C 3TZVB 1ZANL 4N5EC 5BCAA 5JW5A 4RX4D 1YNLL 1S9XA 4HGWA 4FQCL 2C26A 1EHNA 3RUGA 4J1UA 2IALA 5K93A 2P46B 2YEZB 3ARDA 1ZLUH 1P7KA 1GZPB 1MCBA 2JB5L 1EFQA 4DK6A 3GB7B 3HAEB 4UDUA 5E8OB 4L9LA 4P5MB 4K8RD 4HH8A 2R2BB 3K4AA 5D1QC 1FVDB 2R2HB 3FB7A 5E9DA 4W6XB 4ELKB 3SCMC 5HVHC 4IIQB 5IG7B 4L1HA 4MJIE 2WBJA 5HHVH 4LRNL 1S9YB 1XEDA 1MRCL 5E95B 1DLFL 3BH8B 2HMIC 4LSPH 5KANI 2VITB 4OFIA 3GSNB 4WUKL 1MAMH 4POZD 5F9AC 2V5RA 2I25N 1I9EA 3IRPX 4BZ1H 3V0WH 3S88H 3C5ZD 3K81A 5GZND 3S8WA 3MJ7B 3IETB 1BJ8A 3NCEB 5EH1A 1NFIB 1N3NB 4UQ3B 3VFNA 4MXQC 1IBGH 4KROB 4NZTH 4P3DA 4G6MH 4OJFH 4OLVL 4Y5VC 5DO2C 2JELL 3GMRA 3BZEB 3EFFB 2PETA 1HZHL 5A2LH 4HSQA 4JRXA 1QBMH 1UWEH 2FEEI 4EN3B 4ZMAT 3H9SD 4D9LH 3KJ6L 1MRFH 5GRUL 4M5YH 2DWDB 4OZIF 2FRGP 4JM4H 4R9HA 4DVRH 1JTTA 1FVCA 3MACL 2BY1A 1JZ5A 3OXRA 5C08B 4ZDHB 2VDPL 2EEAA 2BRRL 2LU7A 3LN5A 3DYMA 1KB5H 3BEVA 4PJ8B 4ODVH 2EYRA 3WIFB 3RTQA 1S3KH 4U3CA 1M6OA 1LNUB 2D7OA 3NZ8B 3FJTA 3FOMA 4HW6A 4J3TA 2W0FB 5DLMH 3TJEH 3CUPB 3CNKA 3TBTA 1OB1A 2P5EB 2PO6C 2DLFH 4JQVA 5H94B 3RDTA 2DQCH 3E1F1 3WN5A 2GQHA 3O6KH 4Q9BA 1I1YA 5SWSA 3UPRB 1KF9B 1Q94A 1MELA 5M95B 3SHSA 1W72A 5EWIH 5J6GB 4MVBA 2VLJD 4ZXBD 3P0YH 5C1MB 4FNLL 5GRJH 1I9JL 1A1NA 5I1IH 1G9ML 1HINH 3CFBB 3CFEB 1SJVA 2NY2C 2J5LC 4R0LA 4DQOL 1FIEA 4YE4L 3I02B 4M5ZL 4QXWA 1WBXA 4Q6YA 2HLFD 4X9HA 4HCRA 3G6AA 4UTBL 1TCRA 3BDYH 1RK1A 4MSWA 1FORH 3G6DH 1CFTA 3QULB 3TBYB 1OM3L 3ZYOA 5KSVA 3DV4B 1MCFA 5C9JB 3T1FB 4J3VA 3X14A 4OFPA 5CJ8A 3VFGL 4EI5D 1J7VR 5AD0A 4NJAL 2MPAH 4NWUL 1A7QH 3T65B 3HFML 2KUTA 1FPTL 5C86A 5FFLA 4GQ9L 5D7JD 1BVLB 3V6FA 5IIEA 4D0CB 1JNHA 1HXYA 5TPWL 1TMCA 2OTPA 4EJ1C 5LWYH 1I1AC 4FXGA 3H9SE 1ZA3A 2CK0H 4FZEH 1H3PL 3OF6A 1G6RH 4PLNC 1L9MA 1N5AA 3PGFL 5IQ7H 5C0IA 5KANG 2G5BB 1K8IA 2VQTA 3K8LA 3IKCB 5EORL 4B53A 4YC2C 1CDGA 1G7MA 4GBXC 1QEWB 1N6QH 3D5OF 1GAFL 3HCVA 4RMSA 4P2RA 4U1IB 3X13A 1I8LC 1T1WA 1T21A 1F3RB 2BFVH 3VI3E 4XHQA 3PDDA 2FJFA 1OCWH 1Q1JL 3SKJH 3NH7H 3JTSA 3MRMB 5C0JB 1XGYL 4LCIL 4UT9L 43CAA 2ZZUT 1I8KA 1K5NA 3IB4A 3OG4B 3RWIA 3AROA 3IJSB 4XMPH 1UYWL 5DQ9A 1IAII 5CD3B 2VLJE 1J9CT 1HDMB 3HNVL 3UJJL 1BZ7A 4XVSH 4UBDC 5F89B 3RJDA 4XP9L 4Q58C 4KHXL 1A3RL 1S7XB 1ZTXH 3TC9A 3W2DL 4XP6H 1T22A 1AKJD 3VD9A 5FB8A 3BGFB 1N4XL 4P23B 5C0AA 3RX5A 2W92A 5A2KH 4YHZH 1DFBL 4FQQA 4ZFZA 3D69B 1X5AA 4X9GA 5ACLA 4NJ9H 4Z7VA 4TOYH 3LRGA 4X0KB 4WI4A 4LAJH 3LN9A 5JR1L 5MI0C 4A6YL 1MOEA 5HHPA 5IVXA 4PJCB 4L3CB 4PB0H 1HH9A 4H8WL 4M8QB 2DQJH 4M6OH 5A43C 1R3KB 2CGRL 1A3LL 3MZTA 3KPLA 5IVOA 1RZGB 4JFZL 4JDZB 5GGTH 4PV8B 2J8UF 4URTB 4LVEA 3D3VB 4JG0L 3FQUA 3QEHB 5T3ZL 2DM7A 1I4FB 3G5XB 4U1LA 4HFUL 3SDYH 4O5LH 5D93B 2IMNA 5C71A 2W9LA 4KY1L 4MJIA 5FGRA 5AAMA 2A6IA 2HH0H 4KGJA 5DZLA 4HAFA 2UUDH 5HHQA 5DD3H 3RAJL 5F1NB 1WCBB 1OSZB 4RFEA 1RI8A 1W8NA 4AL8L 4PJGE 5EO0A 4N8VB 4R26H 3ARYA 2PO6D 2EH8H 4WW1B 5FDYA 1RJZB 5SX5H 5GIRA 2ITCA 5ALCL 4R4FL 1CD1A 3QJHB 3AM8A 1ZSDB 5HXMA 1NCDH 4NHUA 1U58A 3MBEB 4OI9A 2X4NA 2FIKB 1S5IH 2MCPL 1B6UA 5JDSB 1X5GA 3QNXA 5IFJB 2CMRL 1TLKA 1BBJA 2Q7NA 1OF2B 4NM8H 2NTSP 3F62A 2BVPA 5I6XC 4XHJD 2D0GA 1DVFA 1Z2KA 4PJBF 5BOZG 4P4RB 2WANA 4NQVB 1JGLL 4K3GA 1GHFL 3SGKC 2OR7A 3BP7A 2AV1B 2ZKHH 3BGMB 4PJDE 2PYED 4BKLA 3CDYA 3QB7C 1D6EB 4PYGA 3ZKMD 1EJ6A 4KQ4L 4RX4A 5IBTH 3VXPB 2GAZA 4LSSL 2XNAB 4QHMA 3PNWB 1DR9A 5KSAB 3TF7C 4LVOB 4F57H 1I1AD 5LGHL 1QVOB 3UTTD 2FJGA 2Q20A 5I73B 2BVEA 1Q38A 3FN3A 2BY3A 2FB4L 2QKIB 5E2VL 3PGDA 3B9KC 4B41A 1FL6A 3ES6A 3QT2A 5C09D 4LCWD 3NIFF 4WW2C 1UM4L 1TFHA 5I18H 1AQDA 1KCSL 2ZUWA 4GBXD 3V6OC 2EC9T 3WJJA 1LE5A 3H42L 3UCRA 1MHPL 4KKNA 4RSVA 4ZUWA 1PAMA 2IPKB 4J3SA 1AP2B 3DO3A 1V3KA 4PD4J 3U0WH 1SYVA 3H9HB 2Y6SD 5CBAB 1FZMA 5E2TH 4X5WA 1CLZH 1E4KC 3WJLC <