4Y2DA

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
270
structure length
249
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPQLVCHVSGFYPKPVWVTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
total genus 62
structure length 249
sequence length 270
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4y2dA01
3P73B 3WFDH 3F7VA 4BQ8A 1K6QH 4YBHA 2MSPA 1XMWA 2V5RA 3CPLB 3H3PL 5EU7E 1P7KB 3LB6C 1ADQL 5B39G 1RY7B 1BBDH 5D7LA 2IPUK 4F3FA 3V5DB 4EZMA 5IVXA 4HWBA 4I0CC 1QPPA 2CRZA 5DJYB 4D0DB 2ITCB 4HWEL 5DJXA 1OTTC 3NAAH 1CICA 1KT2A 3QFDB 3O2VH 4HFUL 4B7LA 4CMMA 3SE9L 1LD9A 4XXDA 1UYWL 1HXYA 4WJ5A 4MHHG 5JIHA 2ATKB 1ODAA 1KPUB 4Q2ZA 4LSUL 2YK1L 1P2CA 3MRNA 5I75C 1HQRA 4U49A 5ESVB 3E3QC 3EDEA 1EHAA 5BQ7B 1FSKB 2B4CL 4F9PA 1A1NB 1TZIB 4QCIB 5DUML 3SDCB 4F37F 1CF8H 1CQKA 2YS4A 3EDKA 3UDWC 3EOBA 1NMCB 4K07A 3FB7A 5FKPB 4C55A 1U8LB 1N64H 3Q6GH 3VD4A 3STBA 1MCHA 7FABH 1U3HA 3RVVC 1CLZL 3DMMB 4POYA 1BM3L 2NY0B 4XGZA 4NO5B 3WD5H 1ZKAA 4MNGB 1OOAA 3BZ4A 2UWEA 3F65A 1CFNA 1FG9C 3TT3H 2R4SL 3LKSB 1AQKH 3BZDA 3TNMA 4NN5B 2DYPB 2MCPH 3FT4B 4TYUA 3EDFA 1KFAH 2EE6A 2WWMC 2AVGA 3SKOA 4YDJB 4YO0B 3LRSB 1OM3L 1G7JB 4WI7A 3PABA 4YR6B 2IAMD 3QEQE 3I9GH 4PJ9C 3QEHB 2ZZUT 4KDTA 1N2RA 1KEGH 3FKUS 4X9GA 1CGSL 1C7SA 4X5XA 1AH1A 5DEZA 4ZFGH 4H5SB 4WU5A 1EFQA 2BNRE 4NBXB 5DK2A 3EJYC 5LWYL 1FYHB 2DS4A 5FO7A 1HSBB 3LDBB 4JN1H 1TDQA 2DLTA 5T1KD 4QEGA 1I1RA 2R15A 3OR7A 1NCCH 1CBVH 4HIHB 4P23A 3QUZB 2ICEA 4LPVA 2M1KA 5IB4B 1OD7A 1Q9WB 1UEMA 4X80L 1T1XB 4WTZA 1F8TL 1JF5A 4K55A 5CEZE 4NPYB 1FAIL 1VADA 1BVLA 1BWWA 1LK3H 4MDJA 1FL3B 2VH5H 1YEIH 1KIRB 4D3CH 3K8LA 4ELMB 4HV8A 4O58L 4FXGA 4ZFFA 3MCLH 3CK0H 3SDXE 4P3WA 3BESR 3QQ3A 2FH8A 3DTXB 4KK8D 1IKFH 2PR4L 2MQ0A 5A2FA 1CK0L 1EEUA 2Y5TB 2GY7B 1CXEA 4JFFA 5D1QB 1XZ0B 3QUYA 4Y88A 3SKMB 2RFXA 1J8HB 1IGMH 2VTFA 5TE7L 4FZ8H 4O2FB 4PV9B 4O2CB 3JV6B 4R8WH 2Z31B 1VFAA 5I1AB 4AJ0A 4YHYC 2EO1A 4MD0B 3RVTC 3CFCL 4PG2C 3SGDH 1G7HA 4HEME 3LMJL 4XNYL 3AREB 1YEKH 5DZNA 1DQDH 3D69A 2XZQH 3DX7A 1U95A 5FGBC 3ZT5A 1YQVL 3U9UB 2Q76B 1F2XK 5FUZH 1CI5A 1B4JL 3K4ZA 1BQSA 2PXYB 5TDNB 4DZ8B 5SWZB 2I60H 2Q7YA 1A7OH 2VMFA 4WDIB 3IFOA 3W82A 2ZOLB 3HMWH 3U0PB 4CVZB 1IBGL 4LCUA 2YD5A 4Y4FA 4R90L 4E9LA 4OKVB 5CIPB 3R0NA 3VFPB 4H88L 3QULB 3S96A 5L2KB 1S7XB 2H9GA 5AG8A 5TJWK 4FQXA 3CSYB 3FQWA 1I9RL 1AHWC 3BE1H 3ARZA 3KPQA 1HNGA 2C4XA 4X6BA 5SWQB 4HZLB 3QPXL 3ZE1F 1KLFA 4BKLA 3OGOE 8FABB 1DL7H 1U6AH 1WCQA 3TBYA 4Z7VE 1RZ8A 5C9JB 3WNOA 1OSPL 3JWOL 5IESL 4N0UB 1HDMB 5I30H 4LSVL 5IVZA 4XPTH 1L0XA 3IU4H 5EUOF 1TJGH 3L3OB 3KJ4C 4AYFA 2Z92A 3P2TA 25C8L 4ZODA 1KOAA 2VXVL 4YJZL 3VH8G 2HN7B 3MRKB 4OZGB 2ZCHH 3MBEB 4ZXBA 2NY7H 4Z7WA 4G43A 1YEGL 4UNTA 4NQDA 1PZUB 4MXQD 3UC0H 1BX2B 4KU1A 3U2SA 2Y06H 1VB9A 3S35X 5E1AA 4JFZL 1JZ8A 1JWSB 5JQ6L 5GJTH 2H8PB 2HTLD 4MCYA 2KBGA 4QRSA 4XXCA 2W92A 3TZVC 1G6RA 5K9JL 1DVFC 2BSTA 1V7ML 4UQ3B 4JQIH 4Y5VA 3O0RH 1U8HB 3MCKB 2VOTA 2P5WA 3BFOA 3I6GB 4L3EE 3ZTNH 4K3DL 4PG9B 1T66C 1NJ9B 1LNUA 2VISB 1UM5H 2IH1B 4OZGF 3MRDA 5KS9F 3QQ9C 2Q87A 3C2AL 5DRNA 2EH7L 4XCYA 5HPMA 1OPGL 3D2UD 3BXNA 1KV3A 1UM4L 3E1F1 3G9VA 4CMHB 2BRRH 5EBWB 4KMTL 2AXJA 1A7NH 4EUPA 5C8JA 3P4NA 4KQ4H 1P4BH 1R3HB 2D7NA 5DJDB 1BOGA 1PGRB 3KLAA 3LHPL 4XPAH 2OP4H 4WUKL 4OFDA 3NMEA 2QR0A 2FX7H 4NQVA 3QEQD 2EDTA 3MLXL 4P3CL 3X13B 4YDVB 4WIQA 4ZTOL 4ZUUA 2H32A 5I0ZA 3DARA 3T65A 5C0CD 3CFBA 1K8IB 3KAAA 3ROLB 3HE6B 4HG4J 4JPIB 5KSVA 5DT1H 3ULUL 3L3KA 4G9FA 2BNRD 2FHBA 3GBML 4OLYL 5IG7A 2QADD 3ZDZE 4PJBE 1ZT4A 1ZEAL 3ZSTA 1MFDH 3GJFH 4MJ6B 5CEZL 4I0KA 4LPTA 4R3SA 3S5LB 4JFEB 4CW1B 5D2NC 3T0EB 2AGJH 5D5MA 3F8UB 3ULUD 5ADPH 2LAAA 3GMRA 3VXRD 1V3JA 4RIRA 4DKFH 2VL4A 4HT1L 3MREB 5FF6B 5CEZD 4LARL 5E5MA 2JB6B 4GBXA 3BYTA 4PJEB 4I4WA 3C6SA 3I02B 2A77H 1D5ZA 4AIZA 4WHCA 3ZKXC 1NMBL 3VXSA 4W6YB 3F7VB 1R6VA 2FD6L 2B1HL 1QFWH 3QA3A 4Y5YC 2NY2B 4ZS6D 1GOGA 4A2LA 1A0QL 4OCXH 1GIGL 5IFHL 2OBGA 3M17A 5D7LB 1RZJL 2E6JA 3AU1A 4MHHI 2AJVH 3IDXH 3K81A 3MQIA 5DVMA 3VCLA 5DJXB 2FHFA 1G7LA 1ONQA 4BZYA 4RISL 4AEFA 3ZSSA 4CMMB 3D85B 4P4KD 4XXDB 1SQ2N 4WJ5B 2ILLA 4KK6C 2WUBL 3O6LL 2A9MH 5E9DA 3KG5A 4WW2C 2C1OB 3BGFC 4Q2ZB 3SY0B 5HY9A 4NP4L 1JF1B 4GQ9H 3MRNB 1HQRB 4JFPB 5DMGD 4GKZA 2NW2B 3EO0A 1URLA 4HCRA 4M7LH 5T1LB 3VXOB 3LOWA 1WFUA 3QNZA 4PRID 1FFPB 3QWOA 1AR1D 1A7PL 4IRZH 1P53A 5E8NA 5T5FL 5DQJA 3EOBB 2EIZA 2EICA 3FB7B 2OK0L 1KELL 5DZLA 3PWPE 4J12A 3VFWA 2ZUQC 4RFEB 3U0WH 3MJ7B 1NCDH 3DETC 1NCWH 4Y1AB 4G59A 4PS4L 3IKCB 4XGZB 1WAAF 4QXUL 3WMSA 2WNGA 1CFNB 3SN6N 1KCSH 4JFOB 4LU5H 2HTKC 3TNMB 4XPFH 5B4MC 2H26A 3JZ7A 3MJ9L 2VAAA 2ICES 4JDZA 1MCQA 1AGDA 3PABB 2R1WB 1BBJB 4X9HA 5I19H 1FZKB 1DBKH 1CXFA 2DTSA 1LK2A 4TQEL 4M7JH 4P2QE 1N2RB 3I50H 2IPUG 3N0PB 4LF3A 3MV7A 1T7WA 2Z35A 3DXAA 4KKBC 4LCWA 3TLRA 1IC7H 1L7IH 1TVBB 4HXBL 4KRLB 3ULVC 5ILTH 3MXVH 5J3HD 4YWGL 3FFCA 2NX5B 4GW5A 3UX9B 2WMPA 1DANT 4U6YA 5FO7B 2V17H 2DWDA 4X8XA 4N5EC 1AO7A 1CLYL 3OR7B 5FFLA 2R56L 2Y4SA 3EZ8A 2ICEB 4CVUA 1MCPL 2HH0H 1G9MH 4O02L 3G9AB 3LQAH 3X11A 5CJQH 2X42A 1MFBL 4AG4H 5HD8C 4XMKH 5I17A 1XF5B 1NGQH 4UINL 1MFAH 5HJ3B 1QSEA 3MXWL 4PJXA 4UAOB 1VADB 2QHRH 4I0PC 4MDJB 1A6ZA 1MHEB 1HHJA 5K59F 2JTDA 4M5YL 1HHGA 3ARBA 1KN2L 4Q9QL 5D4QA 5CJOL 5CP3H 3T2NH 2EDKA 1X5AA 1OF2A 3QQ3B 4LDLB 4TSCL 4U2YA 4JFFB 4ZTPH 3VD9A 4M6NL 2RFXB 1DFBL 5BOPA 3D5OF 4HZAA 1XGYL 3VXUA 2EDRA 3QG6B 1JHKL 3K0WA 3MUY1 1VFAB 5E2WL 1YEEL 1FSKC 2PO6C 5JIPA 3UTSA 1T20A 1FLRL 5AZ2L 3WNPA 1J10A 5ALBL 3SDCC 4GAGH 3NIFE 5HHNA 1NMCC 4LSTH 4K9EL 1G7HB 4DKAA 3K3QA 32C2A 1U95B 1LP9A 3EJZC 3DMMC 4TPRL 2C3VA 3CDFA 5F6IB 4OV5A 2NY0C 3FHAA 5IVOA 2Q7YB 3CH1B 1A1OA 2W9DH 4TVPE 4RCAA 4MX7A 3K1KC 4X99B 1PYWA 5EH1A 5TE4L 2DQDL 3S96B 4NN5C 3EO9L 2H9GB 3C6LB 4OTXL 4GH7B 1UADC 4R7NA 1UWXK 4QXTA 3KPQB 2WY3A 4X6BB 1IL1A 3DGCR 2IBZY 3V7AG 1FV1B 1MVUB 2F74A 3D39D 4KJQC 4FQCL 1BJ8A 4YHLH 3TBYB 5FOBB 1GC1L 1RZ8B 3QFJE 3ZKNC 5IMLB 3I3BA 2RB8A 3QIWC 3NH7H 4NCC1 4Z76A 2VUYA 1IGFL 5FGSA 4APQB 2X4PA 5IVZB 3KPMA 3VXNB 3EYSH 5FO9B 1QVOB 4YPJA 2Z92B 3SE3A 1KTLA 3BX7C 1C7TA 3LDBC 4KRPD 4ZUWA 1DBBH 4ZXBB 4FQ1H 3QUZC 4NQDB 3W9DA 4HPYL 1P7QD 4P2RA 3RTQA 3LEVH 3U2SB 1W72L 1MCSA 4PJDA 3K46A 4MCYB 1J1PH 3O3AA 1CS6A 5F71A 1LWRA 4RGNB 1G6RB 4G8GA 2BSTB 3EGSA 3PWPD 4Y5VB 4I48B 2HT3D 3V8OA 2P5WB 4ETQA 2X4UA 1CD9B 2CK2A 3IETA 4FZEL 4JHAH 4JY4A 1LNUB 4E5XA 3MRDB 3CMOL 5DRNB 3VRLE 3NTCH 5D1QC 5HPMB 3BXNB 1YECL 3WE6B 3BSZL 3S37X 3FCTB 3RVXC 5F1OB 4JY5H 2CIKA 4EUPB 3RWJA 4UI2A 1G0XA 2EE2A 3VGEA 4F7MA 2Z31C 2BXZA 3SPVB 4QKXB 5LAXA 2W07A 3NFNB 1MI5D 2NZ9D 2VIRA 4LHQB 4UQ2A 3DO7A 4LVOB 4M3KB 1WFOA 3Q5OA 2R0WH 3N1MC 3VWKA 3AREC 2ZCLH 5EULV 3CZJA 4L4VE 1VESA 4JRWA 5KSVB 1O5DT 2PXYC 1F90H 1QEWA 1T83A 5IG7B 1F4XL 1NKOA 1XF3B 1ZSDA 3PJSA 1OGAA 1ZT4B 4TNWK 1HYSC 4H1LG 4NUJA 1LEIA 1KCLA 4HIIA 4WHYG 5D5MB 5EZIH 4WENB 3GMRB 4QTHA 5F7WC 4RIRB 3BWAA 3PQYA 2Q8BL 5E5MB 5IHZA 4KKAC 4N0CC 1PW3A 2CR6A 2VDNH 5DJ6B 2F19L 4X7SL 1GPOH 3VXSB 5DMYA 2GSGA 3X14B 4YLQT 2DQEH 4K94C 2D7TL 4JDVA 2L4OA 3STZB 3B2VL 2CGRL 3M17B 3KPRE 2XKUA 3AU1B 2O93L 1E4KC 4P2OC 3SDDA 4HDIA 3L5WA 2NY6B 3MBEC 2LQRA 3DSFL 1MCBA 5JIIA 4JO1L 1G7LB 3WNKA 1MLCA 3H9SE 1YMHA 5SX5K 1UZ8A 1NAMB 4Q0XL 1YN6A 1X4YA 3WL9A 5HHOD 5E9DB 5B3JF 4ZD3H 1CFTA 2GITB 4ZYKB 4NYLA 4TVPL 5HY9B 4PJCA 2XT1B 3ARFB 3NACH 1N0LA 4KI5F 5DD0H 4YHML 4JM2D 2CLVB 5D2LF 4EVNA 1FZJA 3LH2H 4UIKL 2QHLA 1NSNL 1WFNA 4M61B 4OGZA 2AS5M 1G7QB 5DK3A 1BJ1J 3J8F7 1Z0MA 2FX8H 3G6JB 5DQJB 2JJWA 4PRPA 2I9LA 1VFBA 4CMHC 4FQIH 3ZE0E 3VFWB 1UACH 2ICWJ 2XY2A 3I6KB 1YN7A 3MRIB 1DUYA 4QRPA 5FK9A 1T1WA 1NC4D 1TIUA 1RZ7H 4HJ0C 4NC1E 2AXFB 5FKAB 1MREL 3KPSE 4WVRA 5CUSL 3RY6A 3SKUD 2UUDK 3TBSA 4V3EB 3MFGB 5CLTA 2EDHA 5FDYA 2ORBH 2H26B 2HJLA 5KSUA 4LVHC 3G6JF 2VAAB 3RWEA 4G6FB 3VFOB 3G5ZB 3HE6C 3LKPA 3WUWA 4KWUA 3UAJD 1OY3B 1CDGA 1O0VA 3W9EA 3V4VL 2Z91A 4AQOA 4O9HL 3V0AC 1LK2B 1XR9B 5D1XA 3T0EC 4HUVA 3B2UC 1HCVA 4X4XA 5DHVA 3RWDA 3DXAB 4TUKL 1L9MA 2BY2A 3ZYZA 5B8CA 1BHGA 4KJWC 3FFCB 5JO5A 4GW5B 5ISZE 1X5ZA 4QF1A 5HGAB 4DOHB 2DWDB 1AO7B 3TV3H 1U3YA 4MNQB 2XWBA 5IBUG 2XQBL 3V2AR 1U8QA 1KULA 3GKWL 3MNWB 4X83A 3D6GA 4Y5XB 3MRGA 12E8L 1QSFB 2YRZA 1VDGA 1IC4H 2NY2C 1UB6A 5ADOH 4FFYL 2A6JA 4KKCD 5I17B 4NOBA 5I1CH 1ZOXA 4BSJA 2H3NA 1PY4A 4Y19E 2W0LA 5IGXL 4PJXB 1RUKL 2OJEA 5DC9B 2CPCA 5D8JL 4J3UA 2AXHA 1HHGB 5BVPL 5I1KL 3DUSA 2GTZB 5TGBA 3TNNB 4LFHG 1Y6MR 1OF2B 3DUUA 4IMKA 4U0RB 1X5GA 5AYQA 3S88L 3ARDA 3QP3A 5B39A 2IPKA 3ALWA 1R3JB 2AQ1A 4Y2DB 5C09D 3VXUB 3ZYJA 3TJHA 5IOPA 3CFEA 4PJGF 1JN6B 4CAGA 1KTDA 5KSBA 3UTSB 1T20B 3H2WA 2ZNWA 2X4TA 1EBPA 4RX4D 2R1YA 5EWIH 3OB0K 3QDGB 5T1DH 2ED7A 3FO0H 2HJFB 1MHHA 4ELKA 3DX9A 3OKOA 3OKDA 4K8RL 5HHNB 3MRHA 2BVPB 2HLFC 2P5ED 2FNBA 3NVQA 2MNUA 4GQPH 3X3FH 4JCMA 1KCVL 1T3FB 2C3VB 2VLJD 4W4NA 4OV5B 3DVNA 1BQHG 5E00A 4WNQA 2F5AL 4K8RD 4YHOH 1A1OB 3KYAA 1RIHL 4ZNEA 1AFVL 1JRHI 3H8NA 5MEND 3INUH 1GHFL 2BNUA 3M1BB 5EFIA 4YDKL 5IWLA 2JE8A 3MRFA 5BV7B 5GZNC 1EZVY 4R7NB 1S7TA 4QXTB 5FA3B 5GISL 4XWGL 4G7YL 4ZSOB 2F53A 3IF1A 2D7PA 3CFKA 3PL6D 5C0GB 4PJ8D 5DHXB 1BFOA 4PREB 3QDJD 1LQSR 4JGMA 1N5AA 3BHBA 4KUCD 1JFQL 3HG1D 1H3WM 5DO2D 4JO3L 3MLWL 2VABA 5JW4R 4Z76B 3I3EA 3O4LA 3KPMB 4NUGH 3SGJC 1KTLB 1S7UA 2E27L 2DOCA 3ZKMC 3MUZ1 3LKOB 1ZT1B 2CO7B 4ZUWB 1XR8A 5ERWA 4OZFH 3T2QA 5EOQL 3ARWA 3W9DB 2VZUA 4MJ2A 4OLWH 4P2RB 5FYJU 3RTQB 5AG9A 2P42B 2X89D 3P9MA 1YQ2A 1KTRL 2AV1A 3UP1A 2BOBB 4U2ZA 4U3CA 4OQTA 1KJMA 3H9YA 4R4FH 4UAOC 4KPHL 5C0DA 3AVEA 4G8GB 3HUJA 1UCBL 1IGIH 3B9KA 3EGSB 3F5WB 4ETQB 2OJZL 2X4UB 3IETB 4LRNL 2ARJQ 4FOMA 5KVMC 3FB5B 1NLDH 4PJIB 5JW4M 3KJ6L 4JY4B 3SGKA 1JPSH 3ILPA 5DYOB 2YC1A 4E5XB 4QOKA 4HG4K 1MUJB 3VI3E 2WUCH 4OF3A 1WWBX 4GXVL 3SGEI 3UTTB 3V6BR 4CDGC 2BC4B 3RI5K 4XPGH 1XF4B 4PRHB 1CDHA 3OGCB 5FYLH 2CIKB 5L0QB 1UQSA 3RWJB 5M94B 4F7MB 5IUSA 5L6YH 5JORA 1QACA 3W11D 4ONHB 1Z2KA 2VIRB 4MMXC 4UQ2B 2YMXH 5EUKB 3DO7B 1INEL 3THMH 4O00A 4Z77A 1HOCB 4MJIE 2PW2A 3VWKB 1FJ1B 1R0AH 3LIZL 2IMMA 2PF6A 3ARGC 5F6IC 1DQJA 1QEWB 5ISZD 4AH2B 3ZE2F 2IANE 1VGEH 2JJVA 3L7FA 4KVNH 4ZO9A 4LVNC 3NA9L 1LEIB 4NUJB 4U1GB 1QA9B 3EJJX 3QUXB 3C6LC 1EUTA 4Z7UE 1UWGL 4D9RD 2N1KA 5C08A 3BWAB 3BDYL 4XZUA 3B5TA 3RA7H 4DCQA 2ADGB 4CN4A 3KPPA 3KS0H 5T33H 2MCPL 5I1EH 1Q1JH 3QHTC 1MHCB 4DN3H 1N7ML 3HRZA 3CC5A 3HI6L 2FBOJ 4JFDE 4OLZL 5CGTA 5EA0H 1HIMH 3L95A 4PIRF 2GQHA 3BJ91 5HYQB 1IAIM 2BVEA 3O8XC 4KHXH 5KVGH 3HN3A 4APQC 5IT2L 2X4NB 2HT4D 3E6HA 3MX0A 2XQYK 1QR1A 3TBVA 4LGPB 4HDIB 3L5WB 1UKSA 4ZXBC 1ZGLB 5FUCC 1MLCB 3IAPA 1L8JA 1YMHB 4JN1L 1UZ8B 4LLQA 4DFIA 5EO9A 1CBVL 3WL9B 2NXYB 2FDBP 3LCYA 4BSWA 3OXSB 4J3TA 5I1JH 4NYLB 2VB5A 4XXCC 1RZGB 4TTGA 2Q6WA 4UV7L 4RGNC 1DQMH 2YN3A 4PJCB 4NZRH 1I9JH 3QUMA 4Y5VC 4XAWL 1S78C 1IGTA 4PP2B 1C5BH 2JIXA 1FZJB 3VH8A 4EVNB 5C6PB 2ESVE 2V7NA 5GS2D 5D9SA 5DEGA 3T2PA 3UTQA 3IJHB 3HRPA 2ZG3A 3DBXA 3LAFA 2VDRL 3DLQR 4LNRB 4PRPB 2W60A 2I9LB 2VN4A 5GRUH 1VFBB 1IQDA 1A14H 3C2SA 2ZKHH 3VWJA 5FK9B 1YN7B 1I7ZA 1A9BB 4QRPB 5FGRA 4PJAA 4UV4L 3V52H 1HZHL 3REWA 1E28A 3VFGH 1TETL 1RFDH 3TBSB 1MRDH 1CIDA 1L4IA 1T0NB 2QQQA 4F2MA 3CLEH 4RWYH 4OT1H 1IEAB 2AJYL 3IAQA 4L4TB 2HJLB 5JHLL 5KSUB 2O61A 2ZJSL 1IGCL 3OPZL 4KJYA 1S9YA 2EH8H 4NQEB 3HFML 1VFOA 4FFVD 1KXVC 4NZJA 3RWEB 3S9DB 4NKIH 5ACLA 3LKPB 3WUWB 5DSCB 5I18H 3GJEA 3VXMA 1A6WL 3QI9A 4LLWA 3WFBL 1MIML 3KYKH 4IRSD 4JO4H 4Y7MA 4MVBD 2VDPL 5C07A 1I1YA 3GSNB 4ZPVA 3EYVA 3N1FC 3RBGA 4XNUH 4KVCL 3MPCA 3OKLA 1KB5A 4HUVB 3Q6FB 4KGJA 4WI2A 5B8CB 1RUQL 3ERYA 4JRXA 2BDNL 4XNQA 4MA8L 3FJTA 5E2UH 1OAZL 3ZMRA 3FN9A 4QF1B 2V2WA 3V6FA 3VFRA 2VLKA 1NQBA 4PJ7E 1MCLA 5JQHC 2M26A 1NCNA 2XWBB 1E4XI 1AQDB 1FAKT 1U8QB 2FB4L 4ODSL 1EJOL 4MDIB 4K3GA 3MRGB 2E6QA 2JCCF 1DL7L 4L3AA 5JR1L 4XP4H 2A6JB 4MD5A 1UT9A 1TXKA 3BD4A 3MOBL 4TSAL 5KZCD 5CGYC 4M48L 5EIQA 5E5RB 2NY6C 3ZYOA 3IU4L 4WO4C 1TJGL 3QZWB 3DUSB 4W4OA 5TGBB 2HMIC 4CVXB 1KXQE 3E2HB 4QXGL 2H2SC 3DUUB 1FNSL 3H42L 5DVNA 4P4KA 5E03A 4OBRA 2R8SH 1UZ6F 4K7PL 5ANMA 2JKXA 2YPVL 1V5JA 5B39B 4LSQL 3TO2A 1HILB 2R2EA 3RWIA 4CRPA 3ARFC 3EHBC 1INDH 4DTGH 3ELAT 3OXRA 5GJTL 3CFEB 3SJVD 3PWVB 1KTDB 5KSBB 2FEEL 1F4HA 3IGAB 2X4TB 5DR5H 2R1YB 1AXTL 3ZO0A 1QZ1A 1MHHB 4ELKB 4M62H 3DX9B 3SO3B 4AL8L 3OKOB 1F5WA 2R0KL 3OKDB 3P4OB 3MRHB 5J12B 2NR6D 3MA9H 5IVNA 2I26N 4LLVA 3HCVB 1DE4A 1A7RH 5DWUH 3QH3A 4TVSa 1WSST 5HDBF 3I84A 3V4UL 5L2JA 1FIGH 1MJ8L 3IFPA 3DVNB 4HMEA 3QQNA 5E00B 4WNQB 1KEMH 2C3HA 1A7NL 5ESQA 2IALA 1FFNA 3PDGA 5E2TH 4I2XE 1WWWX 4MJ5B 4XPAL 1QPXA 4I3GA 3SO5A 2BNUB 5D2NE 1I9IH 3VFTA 2MHAA 1JL8A 3MRFB 3RL1A 3EFDL 5SX4I 4PLKC 2CDGB 1S7TB 3S3PA 2ITDA 3QPQC 2YD1A 5AAWA 4XC1H 5CJ8A 2B8OT 5D7SH 3WLBA 4OI8A 3C5SB 5ICXB 4QTIH 1QKZH 3UJJH 2DQCH 1M7IA 1OAYL 2VXUL 3OWEA 4XI5C 1H5BA 1KB9J 4X7TB 3P4MB 5GGTA 1V8HA 4AQ1B 1S7UB 3H0TB 2Y23A 2H32H 5HDOA 1BFSA 1XR8B 5ERWB 5T1KB 2F8OA 1ZLUH 4GRLA 3U4BL 3FQXA 1W2KT 15C8H 4AEIH 4GAJL 5E4IA 4HW6A 1LO3L 4Y4HD 4QHLB 4Y5XC 1FRGL 4LEXH 5I8CA 3MLVL 5C0BA 3WIHL 3NOIA 1E6OH 4P46D 1FP5A 3C60D 2AV1B 3DVGA 3MV9A 4KZDH 3N9GH 4ZAKD 3ROOB 3C5ZA 5C0DB 3VGHA 3HUJB 3B9KB 2GEEA 4X6DE 3P9LA 5DS8B 1IM9A 1IEBA 3QG7L 4KZEH 2LU4A 3ILPB 1BQLH 2CRMA 3M45A 2XFXA 2XZCH 4G6JL 5FECB 3TA3C 4V1DA 1PKOA 4YQXL 5GS0H 5D7IB 4M43H 1CE6A 3MRMB 4Y2DC 1UQSB 2AABH 2VE6A 3ARYA 2EEBA 1DSFH 1LE9A 1Z3GL 5AUMB 1PG7W 4PJFE 1I8MB 2JELH 4GRWF 1CGUA 3GHBL 3C5JA 5A43C 2PN5A 3JTSB 4Z77B 5EU3A 2E9WA 2PW2B 4XNZB 4O2EA 3OL2A 5KVDL 2CDFA 2OZ4A 2J6EH 4OFIA 2AEWA 3EOAA 4IS6A 5JMOC 1DQJB 3MMEA 4S1QH 3PIQB 5FAAA 4MD4B 3Q48A 5TQ2H 4HUXA 3MO1B 3L7FB 4ALAL 1SJVA 3U36A 4ONGH 2GKIA 1L6XA 4HCRH 3CUPA 3LSOB 3HNTL 6FABH 2CD0A 5C7XL 2APVA 1J0IA 3X3GH 1BAFL 1IVLA 3I6LE 2BSRB 5BV7C 2EXYD 3ULVE 4DGYL 1K9TA 1GH7A 5A2IH 1EERB 1MQ8A 4XCFL 5FM8A 1DBAH 4DCQB 1XGQA 2DLGA 2MQ3A 3KPPB 1MEXH 3HRZB 3CC5B 1SEBA 1MCOH 1AGFB 2W0FA 2QSTA 4YX2L 3ZTJG 1T66D 3NZ8A 2ZUSA 2Y5EA 5IKCA 2OXHA 4OJFH 3E6HB 1JI2A 3JV4A 1VPOH 2UZIH 4TN9A 1RU9H 5HDLA 1DQQB 1G9EA 1EVTC 5J0BA 4RMWA 2A6IA 2EIEA 5E0QA 2VR5A 3WYRA 3BVNA 2VQTA 3E6FA 4XVTH 3U0TA 5EO9B 3UBXG 1IGYB 4Y89A 3DYPA 5HI3D 3ULSA 4POZD 3P11H 4L8SB 5JOFB 1G9ML 5HI4D 5CD3A 3LKRA 4BSWB 3F7RA 3T09A 4L29B 5C71A 4BK4A 3PXHA 3HC3L 2D4FA 5TPWL 1I85C 3NIDE 1FGVL 5I9QB 1D5MA 3QUMB 3TCLA 1QFUL 1RPQA 5EC1A 4YK4B 4WFFE 5I76A 2DBJA 3VH8B 2V7NB 3B3IB 5CSZA 5D9SB 4PRBB 1I9EA 2YZ1A 4L5FH 4P9ML 2K3TA 4WHTA 5CP7A 3QNXB 5JA9A 3CVIH 3JV0A 5C0AA 3PDOA 2W60B 3OX8B 1IQDB 4F33B 3HPJA 3VWJB 1WWAX 2VR9A 4XBGB 4JDTL 5L0QC 4KMLB 4MB3A 4HF5L 5IBTH 2NNAB 2OS7A 1ZTXL 3JWDH 5CKAA 3VG0H 5TQ0H 1JNHA 1PLGH 1KCGC 4MNGE 1NANH 1OLLA 3BN9D 5EPMA 5JXED 5HYIA 4XHJD 2E7CA 4F2MB 5CILL 3T1FB 4DKEL 2P24A 5JW4Q 4KJYB 1S9YB 5IV2A 3D25A 5DMKA 5C0CB 3WLWC 2J8UA 3VXMB 5FV2A 3Q1SL 4LLWB 5FHBH 3P4LA 3RGVD 5C07B 2QADB 2DLFL 4ZPVB 5DD6A 3ARSA 1JK8B 1OB1A 3GSRA 5J8OA 4U1GC 2XQYG 2NY1D 1KB5B 3QUXC 3ZDXF 2OTPA 4MS8A 2W9DL 1F11B 3VW3H 2OM5A 3VD7A 3C87A 5J6GB 1CFQB 4HGWA 3VXRB 4XNQB 2OQJA 2V2WB 3SQBA 3V6FB 2YKLH 4L3CA 3N1PC 3FQTA 1YPZA 3HI1A 4LHUD 5F9AC 4TUOA 3WBDA 3ABZA 4AIOA 1BFVL 1AP2B 3TGXA 3MRCB 4H1LA 5T3ZH 3ALXA 3TFKD 2AP2A 5IW6A 1O7VA 4DK6A 1CVSC 3GMLA 1LVEA 1Q0YL 4O51A 5CD5C 5MEQA 4U1NA 1SY6A 4XTRD 1ERNA 3WXWL 3ULUF 1CL7L 2IH3A 2EEDA 3HNVL 1JYXA 1QLEL 4ELME 3MLYL 3VG9C 3MZGB 5ICZB 2NY3D 1FYTA 2GK0A 3HNSL 1IFHH 1T03L 2HKHH 4P4KB 5J1AB 1AC6A 4HIJA 3SE8H 3RI5F 2NXYC 1KPVB 1IAIL 3GKZA 4WFEE 4OCSL 4XBEH 1KIQA 4LMQE 3O6KH 4KK9C 3S3SA 4ORZC 4U1MA 3SDXF 5IJKC 1J8HE 1KN4H 2R2EB 3DV4A 2X1OA 3RWIB 5CCKL 3QDMD 4D0BA 2PTTB 1RZFH 4JG1H 2R0ZL 4UZGA 2KQMA 4U1JA 1PG7H 4GMTH 3ULVL 3RFZC 1DBJL 4PRIB 5E08L 4X4ZA 1FO0B 2XN9A 3LD8B 4F58L 1K85A 5ITBL 2A0LC 5DLMH 1F3DH 1NKRA 2VDOH 4PJGA 1ED3B 1PSKL 1DE4B 4YE4L 4KKBD 3QH3B 3NTCL 4ZFZA 1IZKA 1SJHA 1S7RA 4UB0H 5ESAA 4Z78A 5SWZE 5ESQB 1J0YA 2IALB 4I18A 4EBQL 1I3RB 1HYRC 3W81A 4HHAA 4JKWA 3KPLA 5F88B 2DWEA 5L2KE 2MHAB 4RAUA 1R3LB 2VKXA 3RL1B 3FL7A 4XBPA 3L1OH 4W81A 1AJ7H 1HSAB 1J0JA 1P1ZA 2XICA 5F96L 1KJ3H 4UT7L 3KDMA 1K4DA 1VEPA 3S36H 2X4QA 4XNMA 5ITFB 4BZ1H 3QDAA 4DVRL 1C1EL 1M7IB 2FO1A 4MAUL 4J3SA 1H3PL 3ILQD 5K33A 5BW7C 4HIXH 3FN0L 4N0UE 5EN2B 2D7MA 1QFWI 3BRDA 4WU7A 2P8MA 5SV3A 4Z7VF 4OCNC 5CAYB 3NCBB 2YOCA 1L6ZA 3QT2A 4S1SL 3MLPA 1JV5B 2XZAL 3FQXB 4OZGE 4Z95H 3U7YL 5J1TC 1NPUA 4RZCB 5DD3H 4JQXA 5H2BB 5JW3H 1PKQB 2WIMA 4OCWH 2GUOA 1C12B 1Z5LB 1I7TA 2CUHA 3DVGB 3PP3H 1E4WH 1RJZB 4OF8A 4P2YA 5FYKH 3VXPB 4AIXA 4WEMB 5JHDA 4QYOA 3MLRH 3BH9B 2W9EH 1F2QA 1IC5L 2ATPB 3BWUC 3ARVA 1R5VA 2HVJB 4UUJB 1IM9B 1IEBB 5HYEA 5JPMB 3E2HC 5JPNB 4P5KB 2G60H 4V1DB 5CZVL 1W8OA 2I24N 3CCHB 3T3ME 1LDPL 1Z9OA 2VLRD 2EC9U 5HHPB 4GS7B 2MFNA 3NABH 3TJHC 1H9VA 3QQ4A 1RSFA 4ZD3L 4NHUA 3SE4A 4MQXD 3WKML 4V2BA 1MCJA 5F6HI 1U91A 1CE1H 5I66A 4KJQD 4LSDA 4D94A 4WWKA 3LH2L 3SO3C 3QCUH 5EU3B 5J12C 1FFRA 3IDMB 1S7WA 3BIAX 2APXA 3MZTA 4G3YL 5K9QG 3BGMA 2FX8L 2FCBA 3ME0A 5F72S 5C0RL 2VZVA 2EYSA 3MMEB 5IW3A 4XP9H 3ZYIA 4GT7A 4OF5A 1Y0LB 5HVFB 4Q7DA 1JUFB 2D3VA 3BAEH 4MCZB 2FX9L 3KYNB 3DI3B 4JFEE 5B38G 3AS1A 4HJGB 3T0EE 4DAGH 3ZDZF 4M7KH 1EMTH 2W59A 1GRWA 1K2DA 4K3EH 1XGQB 4C4KO 2Y72A 1EK3A 4HPOH 1F4YH 4H20L 5J11B 1BQHA 4YGVA 4PJEE 3D39B 2IQ9H 1Q72L 3PWNA 1EPFA 3GK8H 3LKQA 4P4RB 5EZOL 1ES0A 5C6TH 4OCLC 4BK5A 3IFLL 4OV6F 3RY4A 3AROA 2DQGH 5DK0A 2B2XL 1NUDA 3UBXI 5FHAL 3LS4L 3IDGA 1AIFB 4LRIA 4MQTB 4Z0BH 5MERB 2ZUYA 3SOBH 5D72H 2A6IB 3QCVL 4DGVL 3QIBA 3R0MA 3BVNB 3E6FB 3MA7B 1U36A 4M6MH 3T0BA 3GB7B 1Q38A 1P7QB 3TV3L 3RPIB 3MV8A 5DHYA 5I8EB 3M8OH 3ULSB 1NGWA 2O5YH 4IOSD 5CD3B 3LKRB 4PJHA 4FABH 4PRNB 5DHVH 2NW3A 4OLUH 4XPBL 5D6CB 3TVMD 1D5MB 3O3EA 3NFPA 3TCLB 3MUGA 1WAAE 3FN3A 2VQUA 2XA8L 5E2VL 5FB8A 2B39A 2LVCA 5KW9L 1A3RH 2PXYD 1WBXA 5IQ7H 2B5IB 5IROA 4WHTB 1SBBA 4KK8C 1U8OA 1Z0NA 1HYSD 4P59L 4DN4L 3RUGA 3BKCH 2CLRA 1R3KA 4M93B 1JZ4A 1A7QL 1IM3B 1H8SA 1MJJB 3VGFA 5L2KD 1JPGA 5J89A 4Y1AE 3BP7A 3F58L 1MHPL 1E27A 2WV3A 1JNHB 2GSIA 1BFTA 1MI5B 4GXUM 2AJZA 5EPMB 5GS3A 2XI9A 3LPWA 1GAFH 4XNZC 3CFJA 3BT2L 3C08L 4MLIA 3BGAA 5T1DL 3FO0L 3WFZA 1R5WB 1IQWH 3OTTA 5DMKB 2J8UB 1SJEA 5J57B 1U2CA 3CIQA 4I77H 4X4MA 1YEJH 1RJLA 3WFHA 3GO1H 4NO2B 1OCWH 1ZWIA 3GSRB 5A3ID 1A64A 4JFYB 3G04A 3MBED 4BFEA 5HYJA 1ZLWK 1RZKH 2N7BA 2GJJA 3BUTA 4JGUA 1JCKA 2OQJB 3C8KA 5FEBA 2NX5E 2APFA 4L3CB 1Z6JT 1MRCH 2LFGA 3FQTB 4X98B 4CGTA 4IJ3B 3TESA 1KTKE 3VGDA 2B1AH 3T0VA 4TUOB 3IVKB 3GDBA 1G7MA 2XRAH 2OR8A 5IW6B 1I1FA 3DIFA 3GMLB 4ZUTB 5GIRA 4O51B 4LOUD 3QO0A 3BPLB 1HWHB 1IKNA 1V7NH 5MEQB 4U1NB 5I6XB 2IH3B 2DL2A 3MODL 2KDGA 1OVZA 5LQBH 1IZJA 1CZ8H 5LCVH 2PCPB 5KVFH 4HAFA 5GGSB 1DN0A 1P84J 5BXFB 2F54A 2VZ1A 3VDBA 2DF3A 5H37G 1FYTB 4MXQC 4JPKL 2Z4QA 5H35A 1NLBL 2GK0B 4LCYB 4U6VL 3OAZH 3WIIL 4L8SC 3IDIB 1LDSA 4TTDC 1VEOA 4JFFE 2EDEA 1BIIA 1KIQB 2HTLC 4DQOL 4U1MB 3DV4B 5I9QC 4JHWL 2ZPKH 4I3RH 4HUNB 4YK4C 5IB5A 4JM2B 4D0BB 4R4FL 2EZ0D 5DD1H 4OD3L 1NCBH 3OG6B 3FTGA 2Q1EA 2AV7B 4U1JB 3OAYH 4IMLA 3HTLX 1OAXH 1D5IL 2R2HA 5BVJB 5HPOA 1JPSL 5I1DA 2WUCL 3VWJC 3VXQB 5IIEA 3T0ED 2V2XA 4ZFZB 3GUTA 1NC4B 1SJHB 3BP6A 4XPGL 4N5UA 4OQTH 1I8IA 1KB9K 5ESAB 4C58B 3MJ8B 4Z78B 2DM2A 1ZT7B 3VE0A 4I18B 1F3JA 4FQ2H 3WS6A 2OTUA 1G1YA 3MRRA 4HHAB 3RJQB 2HT2D 2EDJA 4HWBL 3S35L 4K94H 4S2SA 1LO0H 5FYLD 3CVHB 4NC0B 2BSED 5C1MB 5EC2A 1XGPB 5D7LD 2L7JA 5AD0B 4X6EB 2BVQA 2QADC 2FO4A 1JTOA 1K4DB 5KANG 4K7PY 1FFOB 2VKWA 2X4QB 4I5BA 4XNMB 3CZFA 4LPUA 1CICD 1BZ7A 3ULUC 1C8PA 1C08A 4KHTL 1H8OA 4WU7B 3NCYS 3LN5B 4XCEB 2PW1A 2AJUH 2M2DA 4NJ9L 3RA7L 1FVDA 1RMFL 4NQDE 4ODHL 5I1EL 1B2WL 2DB8A 5EA0L 4RMRA 1T22B 1TITA 5JHDB 1K8DA 4QYOB 2YPLA 3F62A 4GG8B 4KHXL 4RGNE 1R5VB 3B6SB 4RAHA 2P5WE 4C57C 1ORQB 1U3HD 5IBUB 5BO1H 2N4IA 4JJ5A 2MPAL 5LVEA 4NQCA 1SEQH 5IQ9B 1G1CA 2CJUL 4P4KC 4WCYL 3HR6A 1OTSD 4JM4H 4NM4L 4MXVF 1RZIB 3NPZB 4LLYA 4FQHA 5E6IA 5C09B 3QQ4B 1KCRH 3VRLF 5GZND 4NHUB 2HRLA 4P0DA 5I1JL 5L8LB 5K9QI 4EI5A 5A16B 1EBAA 1I9JL 1U91B 5CZKA 2GFBA 1EDQA 5I66B 1C5BL 1HQ4A 3DVIA 1AR1C 1A6PA 3LD8C 3LPFA 4YHPA 1B3JA 4HQQH 3WHE0 4QHUA 2Y07H 2P5EB 1ETZB 3FMGH 1AY1L 4WEBH 3BGMB 5I1IL 1BEYH 4I3SL 4PLNC 3B5HA 4C83A 4DW2H 2EYSB 4IRJA 2VLJB 1LO5B 4GG6A 4HS3A 4KY1H 4JFHD 2HFEA 4LCCA 2YPKB 5F97E 2ED9A 3GM0A 4P23D 4PRDA 4N0YL 4X9IA 5MENB 4Y4KA 2DM7A 4RQQA 2QSCH 1X4XA 5D5ME 5GSRA 1MF2H 1WZ1H 4E41A 5FUOL 5GRZA 1GZPA 5BZWA 1AE6H 3LEYH 1BQHB 1X5YA 1UC6A 4YGVB 1DEDA 4NKIL 3QDJB 1YEDB 5CZXD 2APTA 1S3KH 3HG1B 1J7VR 3LKQB 5DEFA 4HC1L 3VXSE 1ACZA 4YDLC 5B3JE 2IGFL 2X4SA 4FQLH 5IB3B 1C16A 4XAKD 3H9HA 1ZA3B 4TNVK 2DKSA 5DK0B 5F9WB 4JFFD 3QUYD 4XMLL 2OI9A 4RA3A 5A2KH 5E5UB 1J88A 2MQCA 2YRPA 1DQLH 3TBTA 3HMXH 4M00A 4MWFA 3GJFA 1T89C 1UCTA 3OJVC 4OIIH 4R26L 1Q9OA 2DQTH 3PDDA 2F58H 4P46A 3UTZB 3Q5YA 2VNCA 3TWCH 4BZ2H 4PJHB 5E9DE 2GI7A 5F8QC 4ZAKA 4JKPL 3U4AA 4LSPH 3O3EB 3MUGB 4P9HH 4J3VA 4I9WE 4WV1A 3MNZA 3VFSA 2F9BT 4NO0A 4PGJA 2SEBA 1RIVH 1T21B 5IMMA 1TNNA 5GHWH 2DQUH 2VC2L 2VDQH 1U8OB 2XG4A 2WAHA 1RUAH 3PP4H 4Y4FD 3G6JE 3RUGB 1ZGLM 2NYYD 2V5TA 2XTJB 1R3KB 3MYZA 4GS7C 4YFLI 2HWZH 4XC3L 4R97B 1AGCA 1VACA 3TIDA 1JPGB 1CR9H 4FQXD 4JQVA 4L9LB 1E27B 3QHFH 3ZE0F 4J8RA 3RWCA 5L7XL 2DQIH 1INDL 5EZJA 4DTGL 4IBLT 1RVFL 2AJZB 5EIIB 2EXWD 4K7FA 5ID1A 2FHCA 2I5YL 1YNKL 4ODXA 4S1RH 1UKTA 2H1PL 2GJZA 3NZHL 1DLHB 1SJEB 3MA9L 2DM4A 4FP8H 4HFWB 3MYJA 3WFHB 1A7RL 3B4NA 4YXHL 4LPCA 3TO4A 1ACYL 1ZWIB 3QWRA 2C3WA 4XP1L 2NMSA 4ZXBD 4CNIB 1JGUH 2A1WL 4CADA 5HYJB 1G6RL 5EOTA 3WJJC 5IFAL 3K2MC 3DXAE 3TT1H 1KACB 2A73A 5IB2A 4KGLA 4XWOD 1WEJL 2Q86B 3PGCB 3FFCE 3HC0B 1I9IL 3G5XB 2O5ZL 3L5JA 1AO7E 1JIBA 4RGND 5T1MB 4MNQE 1NGXB 3RY5A 3D0VA 3TBWA 2P5WD 1KCKA 2IG2H 1QFHA 1QSFE 4ZS7H 3JSSA 1I1FB 3MUHL 1QKZL 4TSBL 5GIRB 1SYVA 1BZQK 2DQCL 4MA7L 4BFBD 2WINA 4PJXE 3B9VA 1JE6A 5FCUH 2KL6A 3OHXB 1H3VA 1RULH 3DGGA 1DN0B 3BRFA 2F54B 5T5NG 3CLFH 5ECJE 2GIYA 5D71H 4OB5H 5D1ZA 5I1LB 5H35B 2Z4QB 3R8QA 2DD8H 9CGTA 1J18A 4LIQE 4YBLB 3WXVL 4JRYA 3W2DH 4QRRD 3BJLA 4IOIA 4U6TA 1BIIB 4F37K 1TJHH 4XP5H 1OARL 4RGMB 4ONOA 2PYFB 3VXUE 3EYUL 5IB5B 2HT3C 5GGUA 4PTUB 4LEOB 3FTGB 4G9FD 3I2CH 3UTSE 2B5IC 5E99H 3QDGE 1JNLL 5BMFH 3UBXA 1DDHA 4LAQL 2RR3A 2XZCL 4M93C 5KVEL 5IIEB 5HGHB 5GRJH 4MB4A 3P0YH 5F9OL 3GUTB 3VJ6B 3TYGH 3V4PH 4JVPA 4M43L 1A2YA 2RCSH 3RDTD 3VE0B 1A21A 1SM3H 1F3JB 5C0IA 1C5DB 4GBXD 2NZ9C 2AXGA 2OTUB 2X9YA 1DSFL 1I3GL 2BVUA 3MRRB 1RUMH 3SEPA 3U79A 4R96B 5KANI 2EIBA 3DX6A 1J9CT 5TF1L 5GS0D 3SCMA 2P44B 4UU9B 5M95B 4P3DA 1KBGH 4YXLL 3MOAL 1PY9A 4L9DA 1U8PB 5D7JD 1NAML 4ZSOE 4IRSB 3FB6A 5FO8A 2VQ1A 2FO4B 1OAQL 4HKBA 3FHQA 2B0SH 4RMSA 4ZOBA 2K7QA 4I5BB 2AAVA 1KJVA 2YZ8A 1PEZA 3UPCA 3PGFL 1BZ7B 4G7VH 2H2SD 1UWEH 1JYWA 3O2WH 4HKJA 4X8JA 5DRWA 3QUKA 3S37L 5HTSA 5CWSB 1A02N 2FLRT 4IJ3C 4ZFOA 2NXZD 2RBLA 5EBMA 1IMHC 3RZWA 1U93A 4P2RE 3UTPD 5MEPB 4KKNA 4NNPH 4WI3A 3J7HA 1ZXQA 3KR3H 1FDLL 1PD6A 4F9LA 5DI8A 3BPLC 1QRKA 2WBJA 2UYLA 1YY8B 2IFGA 1JHTB 1Q8MA 1I7RB 2F5BH 1N4XH 4G8GE 2BHUA 5KZCB 4GSDL 4HWZB 2NLJB 1VPOL 5J6HA 4PJIE 2H6PB 5LGHL 1HKFA 4NQCB 4N8VG 3BW9A 3EOTL 4IDJL 3HZMA 3UTTE 4JAMA 4NBYB 1YNTA 4NOFA 4FG6C 1ZANL 4XVTL 5HYFA 4PRHE 3VI3F 3GSUB 5IHUL 4FQHB 5E6IB 4GKSA 4NNXA 4ODTH 4UILL 1G0YR 3UTOA 4JM2C 3LZFL 3BIKA 3SJVB 4EI5B 1WBYA 2DL9A 4M1GL 5A1AA 4J4PD 3WN5A 3DRQA 4YHPB 2AERT 3GMPB 4EOWH 5LXGH 1MCWW 1GGCL 4L5FL 3MV7D 4MMZC 4FQJH 1QBAA 3DXAD 4LCWD 4Z7NE 4WW1A 3HC4L 2Y7QA 3KYMA 3DJ9A 3E8UH 4HS3B 3OSKA 3FFCD 5F1SA 5JNYB 1JGDA 3SDAA 1J87A 2E8ZA 4I18C 1YC8A 1OAUL 3PHOA 4Z8FH 1AO7D 2F8VA 2HFEB 1OSZB 4PRDB 3HS0A 4Y4KB 3BN3B 1PLGL 4LQFL 5GSRB 3JXAA 3EIFA 4Y16A 1OGTA 3MLZH 4HS6B 4JANB 3L9RA 4YFDB 4EIZC 3IDYB 1QSED 2BRQA 5BZWB 3UAJC 4R9HA 2OLDA 4Z7UF 4I13B 3S4SG 4UIMA 1IAOA 4PJBA 1ZVHA 3ARBD 2X7LA 1PAMA 5DEFB 1N59A 2DAVA 2GJ6A 3QJFB 4OD1L 2VZ3A 3HI5L 5I0DA 3B83A 4J7RA 1WIUA 1C16B 3H9HB 3UJTH 3O6FA 2AJSH 3OKNB 3ECBA 3K2UL 5FM5M 4OZHB 2LAGB 4D9LH 3VXUD 3QJHA 3TBTB 1IAKA 4MWFB 3GJFB 4RMVA 5DQ9A 1WF5A 5F89A 4U1SB 4ZOCA 3SGEH 2HFGH 1U42A 4P46B 3O3UN 3C60B 2BVTA 4WTWA 4ZQKA 4ZAKB 4C56D 2YN5A 1N5YL 4PJCE 4RRPG 1GYAA 1TZGL 5EO0A 3GI8H 4NO0B 3U7WL 1QNZL 1A4JA 1S7VA 2V6HA 3OV6A 5IMMB 1T4KA 5BV7L 1V05A 3MSPA 4KTEH 4RMQA 5T3ZD 4M5ZH 5J13B 3ARTA 3RAJL 5ETUB 2AI0L 4PRPE 3TN0A 4H1LH 5GS1A 1IFHL 1AGCB 4WHYH 1VACB 3TIDB 4QRPE 4A6YH 1TLKA 2XTLA 4JZOA 3SE8L 4XBEL 1SY6H 4U4BA 3O6KL 3P77A 1J0ZA 1KN4L 3HKFA 3KHOA 4TUJB 5E70A 2BFVH 4Q9RL 4K7FB 4CJ0A 1F45A 5T3XH 5IBLD 2BVYA 4XVSL 3WO4C 1NFDB 3MR9A 1PG7L 2RHEA 4L4TE 4GW4B 4ODXB 3OF6A 1CLOH 4NQEE 1MELA 3D9AH 3GEWB 1EHXA 5J06A 2D03L 1SYSB 1IRAY 3W5NA 4QHMB 43CAA 4LNVA 3TO4B 1QBML 4ODVL 2V7HB 1G7IA 3AM8A 4YIQA 4CADB 3GBNL 4DVBB 2A2QT 4P2RD 3RTQD 5LJYH 3OKYA 4OGYH 4NSKB 2A73B 2X9XA 5EZLA 2VDLH 3C8HA 1NGZA 1NFDF 1CGXA 1WCBA 1RUPL 1UA6L 3LS5H 1NGPH 2O5XH 3JVGC 3PL6C 3L1OL 1M05A 4G8GD 3HPLB 3V0WH 3EYOA 1AJ7L 3D0VB 2YA2A 1CGYA 4HKZB 4PJ7F 3IDJA 3V8CA 1F6AA 4P2QA 5B38A 4OUUA 1SYVB 2IFFH 4U7KA 3PV7A 5F9WC 1NAKH 2BHZA 4UTAL 3MRPA 1BLNA 3BRGC 1IE5A 5CGMA 1R5IB 1WC7A 3ZKQD 3ARQA 4HGMA 5LBSH 2E7MA 4OM0H 1QSZA 2NY4B 4JRYB 1A6VH 4IOIB 3U46A 3BIBX 1QBLH 4N1CA 3H3KA 3HHRB 3VWKD 4XRCB 5FYKL 4UTBH 1YYML 3NCCB 5GPRA 4WFHE 1JGLH 4JKKA 5KSBE 3GNMH 4NQSB 3CXHJ 4MXWL 1I1AA 3IJSB 1OGAD 4NZUL 3KPNA 5FYKD 4Q6IA 4LVEA 3TEUA 1ZHKA 1MOEA 5F7NC 4PY8J 4NGHL 2BJML 1KG0B 1MJUH 4IIQA 2FEEI 4L9LC 4HEPG 1A2YB 4GW1A 4OGAD 3PQYD 1Y6KR 2C4FU 3W11C 5EU5A 3D87B 3PWUA 5C0IB 4RDQF 2AXGB 3G6AB 4MA1B 3BQUA 4YHZH 2R23A 4LHJB 2VN7A 3KYOA 3R8BB 2IADA 1FNHA 5KAQF 1F6FB 1YYLL 1ZLSH 5J9PB 5EBLA 2EYRA 5I8KL 4YC2B 4L8CA 1TJIH 3QCUL 3P0VH 1MPAH 3OB8A 5FO8B 1UVQA 1OP9A 1E4XH 2E5EA 4PP1D 4HKBB 3RGVB 1FCGA 1YA5A 2DMBA 3SDDD 4M6OH 1QYGH 4MYWB 1KJVB 4LSSH 1XAUA 1FVEB 3CU1A 4X6CA 1RK0A 4DEPB 3HZKA 4TNVF 4HKJB 3HLAA 5DUBA 1GGBL 3QUKB 2NXYD 4JZJB 3IU3A 5IMOA 4LLDA 4ZFOB 4J3OC 4UT9L 5HGBB 4NQTA 3ZHLA 5EBMB 4JR9H 2I07B 4LHUB 1KGCE 1U93B 2Q8AL 4X4YA 1JPST 4NJAL 3VRIA 5I8OH 1RIUH 4OLXL 4M7ZB 3GI9L 3LV3B 2HKFH 2IQ9L 5DI8B 4XPHH 2HT4C 2UYLB 3G6DH 5HVHB 5C6TL 2VLLA 4PRPD 5IK3A 3V5KA 2AK1L 1BECA 1SBSH 3HUJE 3SBWA 3F7PC 4U6HB 1A22B 5LGJB 2YD8A 4QRPD 3TCXA 2VSDA 3U4EA 35C8H 4JO2L 2C26A 5J6HB 2R29H 4U6XA 2P48B 4YHNB 2NY3B 5FYJE 4YBLC 1AI1H 1RJCA 2ENYA 3BW9B 4X6DF 4JAMB 1W0YT 4MAYA 4G42A 5D7IE 4OZIB 2A9NH 4GUPA 3B43A 4RGMC 3GSNL 1WISA 2JB5L 4GKSB 1J11A 4NNXB 1UH2A 2O5YL 2MJWA 4HKXA 1B0GB 5IF0B 5TDOA 3AUVA 4FABL 1UM6H 3QDMB 2DLIA 5HHVH 4RNRA 4KROB 5JUEH 1IT9H 1ZVSA 3PWJB 3BKJH 3RWFB 4FMKA 4ZUSA 2AJXH 2X09A 4ONFH 3QNYA 1NANI 4O5LL 3V6OC 3DPBA 5D1XD 4JEGB 1DBML 1U8NA 5SX4H 5CEYA 2BCKA 2YR3A 4OZIF 2Y7QB 2OYPA 2UZYB 1YEHL 4TULH 4S0TD 5EU6A 4K23H 2AEPL 2AK4A 4FNLL 5JIKA 1JGDB 3SDAB 1KLGA 1QFPA 3WS6C 3MBXH 3F7QA 4M1DH 1QO3A 3BEVA 2DIBA 3KGRA 4KJPD 5I1HL 2XPGA 5CBAA 1D5XA 1D6EB 3PNWA 2Q7NA 1OGTB 4X6FB 4PUBL 4FFVC 1REIA 3L9RB 4L4VA 3WHXB 4PR5A 1FG2A 2YSSA 4JPWH 4IRSC 3EYFA 4PD4J 4MVBC 5F7EL 3FB8B 1FE8H 1IAOB 1JNNL 2AJ3A 4UIMB 3ULVF 4LCIL 3FQNA 2X7LB 4NZTH 4ODUA 1GCFA 1S5IL 3L3DA 2GJ6B 4TRPH 4I77L 3JTTA 3QIUA 4GKOA 4POUB 1RURL 3IKKA 4NHCH 4ACPA 3L7EA 3ARDD 3BKMH 3O45B 1A1MA 3ECBB 5INDA 3EBAA 1MH5A 3IS0X 5AYUL 2P43B 3TJHD 4JB9H 1IAKB 2VXSH 5HVGB 1KC5L 4EN3D 4L8DB 3K74B 5DQ9B 4WFHD 1MAMH 4Q6YA 1PEWA 4GRMA 2B1AL 1NMAH 1P4LB 2DMKA 5GGVL 5FOJA 1RD6A 1UWXH 5GGQH 3R06A 2NPLX 3CGTA 3QEUA 1JMXA 3DHMA 2D31A 1J1XH 1D5BB 1V7NL 4NZDA 5EO0B 4WI6A 2IPTH 4KTDH 1CZ8L 1A4JB 1S7VB 4AT6B 4KKLD 1T4KB 1JYNA 3NIDF 3H9SA 2HG5A 4MZ2A 5DURB 5AZEH 4DGIL 5DJAA 3SHSA 3NN8B 3GGWB 4LLMB 4EI6A 3TN0B 5E7BA 2VLRB 5CJ5A 5C0JA 3GMNA 4OM1L 5E6IC 1YJDH 2VL5B 4ENEC 3HR5A 2H2PC 5CINH 3D3VA 4W70A 4JPVL 4EI5C 2ZCKL 1EAPA 2J4WH 2F53D 4PB9L 2WWKT 4MNHA 1CG9A 4JVWA 3ZDXE 3W39B 1S9VA 5F93C 5MP6H 1HEZA 1X7QA 1ORSA 2EE9A 3MR9B 3CXDH 1TPXC 4R7DB 2NR6C 2ZG1A 4EXKA 1M7DA 1XIWA 4RFOL 3O4LD 2BVOB 5C0CE 4ZDHA 1EGJH 3FQRA 3VXME 3X12A 1FBIH 4PYHA 1WT5A 1D9KA 1U8IB 5DJ8A 43CAB 5C07E 5BS0A 3KPSA 2A6DB 3BDXA 1G7IB 4OQTL 1KJ2A 2ARJA 4YIQB 1JZ7A 1JJUA 4Y4KC 1KGCD 3H7BB 5B21A 3DURA 4WWID 4UOJA 4ETYA 4JG0L 3ULUE 5JLZB 3N1GC 5E8DH 3BKYH 3VXRE 3KWWA 2FATL 1AD9A 5FYJL 3GSQA 3IDYC 1OW0A 4NM8L 5BRZA 1M05B 4O4YL 4BSVA 3RNKA 3B9KD 4QRTA 5I71B 2X1XR 3PF2A 1J12A 3QEGL 1JWUA 3H3PH 3IDJB 1F6AB 2EO9A 4QOKD 5FYJD 1KPRA 4OUUB 5AAMA 5GGRA 5FGCB 2C9AA 3CX5J 43C9A 1ZHNA 4CN1A 4HWEH 4U1HA 4Y0GA 1UB5B 4HFUH 3QXVA 4XCCL 3I75B 3SE9H 5C86A 3JV5A 4Y4HC 1UYWH 4OGXH 4HH9A 4N0FA 3WS3A 1ITCA 4P46C 4ELMF 3C60C 4KRMB 2YK1H 3U46B 1NL0L 4PYGA 2EKJA 1MWAA 2R2BB 1KUMA 2QBWA 2Z9TA 4Y19A 4ZAKC 4G5ZL 3QXDA 5BJTA 3TVMB 2VLME 4BQ9A 2B4CH 5E8EA 1IJ9A 5DUMH 4HK0A 1N0XH 3QSKB 3OKMA 1VERA 2VXTL 1TVHA 1X5FA 3FO2A 4B0MM 1IAII 4PRIE 3KPNB 3CDYA 1QLRA 5BO1L 3BO8A 3FT2A 1YEFH 4HXAL 1CLZH 3P9WB 1CFSB 4IIQB 1ZV5A 5C08D 1H15A 4GW1B 3ZL4L 2R4SH 3QXUA 2DI8A 3PWUB 5SX5H 3RWGA 4NCDA 2X4RA 3S5LG 2R23B 4QWWD 1AXSB 4OSUL 5LG1A 3KYOB 1MY7A 2IADB 5EBLB 1OM3H 2NTFA 2G5BA 1C5CH 2DICA 1HNFA 2R69L 3AY4A 3MCG1 1SJXA 5F1NB 4BH7A 4DUXA 1CGSH 3OBAA 3O9WA 1G9NL 4X6CB 3QUML 3HZKB 5GRVK 2FJGA 5LWYH 1MJ7L 3B9AA 4BQCA 2CUIA 3HLAB 2EXYC 1BVKB 5DUBB 3HE7A 2QSCL 1ITBB 4TTDD 3IU3B 1WZ1L 5JDSB 1FNEA 2DJ4A 4GRWH 2UUDH 2X44D 4X80H 2JIXD 4X4YB 1F8TH 1PKQE 5B22A 5TH2A 5GRWA 3VRIB 1JVKA 1EHLL 2R9HD 1FAIH 3OR6B 3QB7C 2HAZA 3WSQL 4JHBA 1S3KL 3T04D 2VLLB 3V5KB 4O58H 8CGTA 5HYSG 3VWJD 1B0WA 3BEWA 3U4EB 1FIEA 2ERJB 1CK0H 4G6KL 3T2OA 2AQ3A 2K9UA 3GIZL 3ZZ1A 1YNLL 4V1DE 2NY4C 1XGRB 5HI3C 4POZC 5TE7H 4KMQA 4QRRA 3RL2A 4MAYB 4G42B 1MSPA 5HI4C 4PLJC 4GUPB 2CLZA 4AMKH 4NRXA 4J6RL 4WTXA 3RBSA 3T3MF 3TWCL 1MCWM 4BZ2L 2FSEB 5TDOB 1KB5L 2KZ1B 4OZFB 4WI4A 1U3JA 3CFCH 3NBNA 1BF8A 1BOYA 3E3QA 3VXMD 3T0WA 3QI9D 5HVWA 1G9MC 1CU4L 3O4OB 3LQAC 4FFEX 5C07D 3F7YA 3LMJH 3QO1B 2BNQA 4ZUSB 2APWA 3O6ML 5DUPH 3DVFA 3G5YA 2OSLA 1U8NB 1YQVH 1UJ3A 3DV6A 1B4JH 5CEYB 3WIFA 3S98A 1F4WL 1ZS8A 4JRXD 5EU6B 1IBGH 1T2QL 2AK4B 3VFMA 1EO7A 2VLKD 3RDTA 4N68A 1PZ5A 3FOLA 4H88H 3SQOL 4AEEA 1CR9L 4MA1C 1QO3B 3BN9C 4ZMAT 3BEVB 5JXEC 1HH9A 2LE9A 4XHJC 4PGEA 3SKNB 1I9RH 1D5XB 4MJIA 5DXWA 3QPXH 4YC2C 4HIEA 3F12A 3LQZA 4G80A 5ENWA 4BELD 1E6JL 3AB0B 5D7JA 1HI6A 2Z8RA 3WDJA 1OSPH 3HAEH 3RGVC 4F3FB 2IANA 1CXLA 2AJ3B 2JJSC 3D39E 3OB0H 5IVXB 3JWOH 3FQNB 3K80A 5IESH 4PJ9A 3L3DB 4LSVH 2NY1C 1U8JA 4U3XA 4DEPC 1CICB 3QIUB 1KT2B 3AS2A 5GZOD 4PJEF 2CDEA 1LD9B 4Z7UA 1JGUL 3ZT7A 3ARRA 4NNYA 2J6EA 1HXYB 3L7EB 5KJRL 2FGZA 1A1MB 4JZJC 5INDB 3QHZH 1YEGH 4XP6L 5SWSA 4HLJA 2WM0A 2VLMD 2YA1A 3QBTB 1FO0L 1P2CB 2EDBA 3GRWL 3V7AE 4HMDA 4R0LA 4JFQA 1MIEL 4JFDA 1LEKA 4NO3A 5JQ6H 4GRMB 5IVXF 3DO3A 3TFKC 2EDFA 2OTWA 2LVEA 4M7ZC 4F9LC 2VDML 2XKNA 2QTEA 5K9JH 1V7MH 3QXWA 1A6AA 4HJJH 3TJEL 5HVHC 3R06B 1JHLL 4XTRC 3QEUB 4K3DH 3PUCA 2D31B 4KAQL 2VJXA 3GZKA 1A6UL 4OD2A 1QRNA 4LPWA 1U3HB 5FCUL 5IEKA 2NY3C 4G6ML 1M71A 2G9HA 3LKNA 4YDIH 5IR1A 1OPGH 2NQCA 5DJAB 1UM4H 3A6CL 4EI6B 4Q97A 5D71L 1OD9A 2COQA 4KMTH 2V5YA 3BZ4B 2UWEB 1CDIA 1MNUL 2BP3A 4N8CL 3LHPH 3GMNB 5I73B 4ISVA 4WUKH 2W91A 2FEDD 5DD5L 3D3VB 3SKOB 3C9NA 4CUCA 3MLXH 1EAPB 2ESVA 1JNJA 4P3CH 4J4PA 1CG9B 4OFYD 5C2BH 1MI5E 4N8VA 5IP4A 2F8XC 1S9VB 5GGTL 1QTYT 1HEZB 1HINL 4PG2A 1X7QB 3IFNL 1R3IL 5E99L 2MOVA 3ZTJH 5BMFL 4GKNA 4OLYH 2UWEF 3MRJA 4X5XB 3WIHA 4ZDHB 1ZEAH 2J8UE 4WU5B 5D93B 5C0FA 5FGBA 1EFXA 5CEZH 5DJ8B 5GRJL 3PWLA 1NBZA 1T04A 1NUNB 3QXAA 5DK2B 5BS0B 5ACZA 1XGTA 3GSOA 1KJ2B 2ARJB 3TYGL 3V4PL 1P7HL 4GRLD 1GL4B 4DFHA 3GM8A 4P23B 1QFOA 5C0BD 4HT1H 3ESUF 3H6JA 3LEXA 2XXMB 3OG4B 3KWWB 5GRXG 1TQCB 2V9RA 3MV9D 1UJTA 1AHWA 3C5ZD 1NCAL 1TQBB 3WNMA 1NMBH 5BRZB 3KVQA 4OCRL 1BVLB 3RNKB 2FD6H 2B1HH 3BMVA 1M7XA 3P30L 2X10A 2JLLA 1KNOA 2PTVA 4HV8B 1IM9D 3N1QC 1Q0XH 5IFHH 1KPRB 4K2UL 4FXGB 3ILQC 4ZFFB 1RZJH 2LU7A 4V1DD 3CXHK 1GGYA 1NDGA 5GGRB 3RWHA 1I4FA 43C9B 1ZHNB 4OFVA 1DLFL 3QUYB 3RZCD 3FO9A 4GLRH 3WFCL 4RISH 3GMQA 2J1KA 3S4SA 5E6ZA 2FGWH 5T3XE 4N1HB 4G8IA 4KQ3L 3V6ZA 4AZ8A 1FYTE 3LN4A 2OZ4L 3O6LH 1JGVL 3QAZB 1T1ZA 4HH9B 4N0FB 3U7AA 4K3JL 3WDIA 4NP4H 1MWAB 5HHOE 4NNPL 4C56A 1KLUA 3BDBA 4DZBA 5BJTB 4X7EC 3KPTA 3DX8A 3TZVA 3D69B 1DVFA 3DX7B 4HK0B 3OKMB 3KXFA 1TVHB 3NIGE 1A7PH 5T5FH 2Y36L 4HUMB 2OK0H 4CU7A 5DVLA 3IFOB 1QLRB 5F70A 4Y4FB 4LCUB 3DROA 3TN0C 3RU8L 3BO8B 2J7LA 1P9MC 4PS4H 4WUUD 4KK5D 1MCKA 2R1XA 4QXUH 4RRPA 2D9QB 1U8MA 3FQWB 3EFFA 4FQXB 4MQXC 1AC0A 5KTEH 5JXAL 5H94A 1MLBA 3RWGB 4BKLB 1AGBA 2BY3A 3VGBA 1VFUA 3F6LA 3MJ9H 3R1GL 4ZPTA 1JRHL 2NTFB 2G5BB 5D70L 4BH8A 2XWTA 5F7DA 4LPYA 2A6KA 4FQJL 3BH8A 4TQEH 1FZOA 2PNDA 3E8UL 4FTVA 4HXBH 1A4KA 4I2XA 2VR4A 5IJVA 4Z7WB 4G43B 4CN6A 1RV6X 2FJGB 4EKXA 1MAKA 3NFSL 5E1AB 1CLYH 1EEYA 2R56H 3LPGA 3EUUA 1EV2E 4QRSB 3RX7A 1FNEB 4O02H 4AEHH 3FZUD 5DQDH 5I71C 5JOEA 5HI5D 2ZUXA 2Y25A 3H7LA 3BPCA 4UINH 3SKJL 2GT9A 4L8BA 4Y5YA 5KOMC 4MXVE 5F7UA 1MCDA 2OL3A 5C0AD 4KI5D 5JHDE 1KN2H 4XCYB 2E7LC 4Q9QH 1WZLA 1F00I 2YD6A 3BEWB 5CJOH 5TDPA 3UJTL 5C8JB 3P4NB 4TSCH 5F8RC 3D18A 3MACL 1BOGB 5IW1A 5IB1A 3W5MA 3KLAB 5CHNA 2J8OA 3HA0A 2FJHA 4M6NH 2K7PA 2QR0B 4MB5A 5C70A 1DFBH 4NQVB 4QRRB 1XGYH 3RL2B 5FYKU 3KLHD 4JCLA 1J0HA 4V2CB 4IOFD 4NRXB 4WW2A 1YEEH 5E2WH 3TVMC 2QQLL 4ZUUB 2H32B 5C09E 1FLRH 3VMPA 5AZ2H 4NHUE 3T65B 3CFBB 4P5MA 2BERA 4HUUA 3KPOA 3L3KB 4OQ1A 4G9FB 4JLRA 2I27N 2HRPL 4K9EH 5JW4N 2BNQB 4PD4K 5J7CC 2VUOA 4R3SB 1ZHLA 5CMAA 3G5YB 4KTEL 4TPRH 1UJ3B 3DV6B 4MS8D 2P5EE 1CD0A 4IIQC 1ZS8B 3A0OA 4PGDA 5DF0A 5EORL 4G6AC 2VLJE 4PJFA 3RDTB 5TE4H 2DQDH 1OTUC 1W0WA 4H8WH 4GBXB 3S8WA 4U05A 3EO9H 4I4WB 3C6SB 4OTXH 1CT8A 3O3DA 3RIAK 1D5ZB 3BI9X 4AIZB 1J1OL 2E6PA 5BOZG 5MENE 1WIOA 3VXTA 2R0LL 3QA3B 2CQVA 2DJSA 3ZHDA 4IHOA 5T3XL 1A9EA 2HFTA 3F12B 1LO4L 2KQNA 4FQCH 5ENWB 3EYQD 5D5MF 5D7JB 1GC1H 3DRTA 1CLOL 2GY5A 4DJMA 1WBZA 3QDJE 2XNAA 4LSRL 5ALCL 1RJYA 5A3IC 2BSSA 3HG1E 1IGFH 1O7SA 5T3XD 3VCLB 3A6BL 1ONQB 1FYTD 1J5OL 1X5LA 1IC1A 1BGXL 1S7SA 1FC1A 1HWGB 5CLWA 5E2JA 4FG6D 1XCTA 1A5FL 4WY7L 1PX3A 5SWSB 4HPYH 4CU6A 4PDCE 4N5EA 2NXZB 2VERN 4R0LB 5EIVA 4JFQB 2FBJL 4GKZB 4Y8DC 1W72H 3EO0B 4NO3B 1S9KC 2OTWB 1U9KA 2VXQH 3QNZB 2XKNB 4LOUC 1A6AB 3QWOB 4PJHE 1MVFA 2XN9D 3OJMB 5E8NB 1P7KA 1CFVL 5L9DH 5J1SC 1LO2L 5AWNL 2EIZB 3FQUA 4FZEH 5TFSL 1GJIA 4I0PA 2DJUA 1V3LA 1QRNB 4OD2B 2ERJC 2I25N 5DJYA 4D0DA 2ITCA 4LQ1A 2MWCA 3CVHL 5IR1B 3L5XL 1K3IA 1YECH 2RQ8A 4MAYC 3RUGE 1FGNL 4HBCL 4ISVB 2YD4A 3TPUA 3U1SL 4OCYH 4XB7A 5HHMA 1WUNT 5ESVA 3C9NB 2EZ0C 4KUZL 4JDZB 3UO1L 5BQ7A 2PO6A 1AGDB 1A1NA 3QWQB 4N8VB 1TZIA 2MKWA 2PKDA 4HX1A 3SDCA 2DI7A 3MLSH 4LF3B 3MV7B 4TOYL 4GKNB 2Z35B 1F4XH 4LCWB 1RI8A 3DMMA 4BUHA 1T04B 3QXAB 1B9ZA 4U6YB 4QNPF 1MJUL 4Q74A 3UXFA 3CX5K 5GGVY 4MNGA 1L7TL 1FH5L 2HT2C 5HYJE 5E95B 4MJ4A 4CJ1A 4OF6A 3LKSA 1HKLL 3VGAB 3X11B 4P2CG 2DYPA 1PG7X 1F13A 3GMMA 4D9RE 2F19H 4X7SH 1KCUL 1AHWB 5JHDD 1QSEB 4YDJA 5EOCJ 2ZSVA 1A6ZB 1HHJB 3ARBB 3P0VL 3QEHA 1MPAL 2D7TH 4R2GD 1E4XL 1X44A 1CICC 2CGRH 3MV01 5EOCL 3HZYA 4PB0L 3QIWA 3MJ6A 1NDGB 3DNKA 2IWGA 3T0XA 4EDWL 1GSMA 1HH6A 2BY1A 4JO1H 4ZNCD 3FO9B 3LRGA 4K71B 3GMQB 2F54E 3S4SB 3H3BC 4CKVX 2VDKL 4PJXF 4PPTA 4EN3A 1VHPA 5GJSL 3QUZA 3LN4B 5C3LD 4L4JA 4F9PC 5L88L 4LFHD 4TVPH 2DIJA 4WWKD 1ZLVK 3WHE1 4YHMH 3S36X 1GGTA 4C56B 1KLUB 3SDYH 3JTCA 3ETBF 4UIKH 3AXLA 2HKFL 1NSNH 1QSVA 32C2B 1OT2A 1LP9B 1KIRA 5MEOA 1U3HC 3UCRA 3KXFB 1SBSL 4OCMC 1JPTH 1B0RA 4MX7B 1OTSC 1SVCP 1DN2A 1PYWB 1BJ1H 2Y5TA 4ODWA 3V6OE 1PDKA 5D1QA 4PGCA 1AI1L 1XZ0A 3V0VA 5I73C 1B4RA 4YXKL 5IMKA 1J8HA 1MREH 5CUSH 2VWEE 1U8MB 1ZMYA 3EFFB 1CDUA 2A9NL 4PV9A 4O2CA 2DDQL 2UY6A 2Z31A 5I1AA 4FRWA 1IL1B 2KH2B 5H94B 2J88L 1MLBB 3GFUA 1LP9F 5E24E 2CMRL 1BZ9A 2F74B 4NWUH 1T5XA 1A3QA 5EBGA 3S34L 2Z93A 4ZPTB 1CQYA 4KDTC 2UV3A 4OLVL 4HWNA 5KBNC 1TZHA 4YBQD 2XWTB 2CIIA 2X4PB 2A6KB 3A67L 2Q76A 4O9HH 3BH8B 5TDNA 4DZ8A 1JP5A 5SWZA 1QHOA 4KDVA 2OR9L 3QIBD 1PBYA 4FTVB 1QLFA 5IJVB 3CSPA 3QRGL 4P23C 2WSKA 5H37H 4KFZC 5CIPA 3NCJH 1PVHA 3QULA 3MV8D 5EUOA 3WFEL 1S9XA 1TQCC 1EEYB 4PJDB 2QSVA 2XQBH 3WFDL 3GKWH 1K6QL 1TQBC 1OW0C 3O3AB 4LKCA 4M9PA 2OX5A 5DMIH 12E8H 2KKQA 5DMJB 4N0CA 4OFPA 1N6VA 4FFYH 4JPWL 5CZXC 4FHBD 1BBDL 5IGXH 4L8BB 1IGJA 4N0UA 2OL3B 4R4BA 4TRPL 3NAAL 2XTJD 4K3HA 5BVPH 5I1KH 3QUYC 3O2VL 3P3YA 1E4KA 4P2OA 3AS3A 2HN7A 3MRKA 4OZGA 5IW1B 2YD9A 5IB1B 5KS9A 5CHNB 4NQCE 3S88H 5LAXB 1WTGT 2FJHB 1OQOA 2ZWLT 3DHJA 4JB9L 4QGTA 1JPFA 1FORH 1E4JA 2YD7A 3FT3A 2W0KA 1KIUA 4PJIF 1X6LA 4BJLA 2H8PA 3BGFB 2ADIA 1CF8L 5GGQL 4P5MB 1NBQA 4HUUB 3SJVE 3KPOB 1K4CA 1I8KA 4K8RH 4PG9A 4RA0C 1ZSDB 4MA3A 3PJSB 2IH1A 1OGAB 1N64L 3Q6GL 3RX5A 7FABL 4Y4FC 1ZHLB 5CMAB 2Q3AA 2NYYC 1KCVH 5HYJD 5DVKA 4HIIB 3BZEA 2GHWB 3WD5L 5EBWA 2F5AH 4QTHB 3TT3L 4D8PA 4FQXC 1AFVH 1U92A 2DQJH 1AQKL 1JMZA 3PQYB 2NY5H 1GHFH 2A83A 5IHZB 1EVUA 2X2YA 4Z7NF 1DR9A 1KFAL 4YDKH 1CT8B 4OAWA 5HHQA 2EXWC 4M6AA 4QRUA 1J86A 3X13A 5GISH 4XWGH 2GSGB 4YDVA 4N9OB 3I9GL 4IHOB 1A9EB 2EECA 4JDVB 1K8IA 4ZUVA 3HE6A 4JPIA 2EE3A 1JFQH 3DRTB 1KEGL 1WBZB 4JO3H 3MLWH 3SDDB 2WBKA 4ZFGL 2F54D 2WQRA 2BSSB 3L3JA 3S5LA 4JFEA 1F97A 5E1HB 2E27H 4ZOAA 1S7SB 1YN6B 1NCCL 4PP8C 4XWOC 1WV7T 7CGTA 2IEPA 1CFTB 5EOQH 4OZHE 5E8OA 5FF6A 2JB6A 3QZWG 2IQAA 4F15B 3CSBA 5HBBA 1LK3L 4KPHH 2VH5L 1YEIL 1KJ2H 4D3CL 1BREA 1UCBH 2VITA 5JZ7D 2OJZH 4LRNH 3FQUB 2EKSA 3MCLL 3CK0L 3KJ6H 4I0PB 2EDNA 1DUYB 4G8EA 1IKFL 1T1WB 2QJDA 4LBEA 3VI4E 5HDQH 4GXVH 2Y9RT 4PJCF 1IGML 2ADFH 4FZ8L 1OP3K 3D85A 4R8WL 4LVOC 5FM4A 2YUVA 4OGXL 3P40A 5F3HA 2C1OA 1U3ZA 3TPUB 3SY0A 5HYSA 1WAAA 3DWTA 1JF1A 3GHEH 5HHMB 4JFPA 1INEH 2NW2A 3HMXA 2A38A 1JF6A 5T1LA 4XH2A 2PO6B 1YEKL 3VXOA 1RAMA 1K3ZA 1DQDL 2XZQL 3W9EB 1FFPA 1N0XL 3LIZH 4HX1B 5FA4A 2Z91B 2WLYA 2MKLC 2VO5A 5FUZL 1NFDE 5D1XB 1UJ3C 2I60L 4S1DD 4X4XB 1A7OL 5DHVB 4NFCA 3RWDB 3HMWL 3MGTA 4RFEA 1MWAH 1YEFL 3MJ7A 4Y1AA 2E9BA 5JO5B 3NA9H 3RDTC 3IKCA 4J23A 4GBXC 1FCCA 1F02I 1MAJA 1MFCH 1FZMA 2XY1A 1UWGH 3BE1L 5GS0C 4F7PA 4JFOA 3BDYH 1UB6B 4YHKH 3T3PE 3GMMB 1U6AL 3GBLA 4XVUD 1N7MH 2H3NB 2XIDA 3DECA 3HI6H 3PG2A 4OLZH 5D7JC 4H0IA 2YPLD 2ZSVB 2FECL 3Q5TA 2R1WA 5I30L 1BBJA 1NBVH 2OJEB 5ELIA 1BD2D 1C5CL 4XPTL 1FZKA 1J05A 4CL7A 5IT2H 3HZYB 2IF7A 4NQCD 3T4YA 4Q58C 3U6RA 3QIWB 1DUZA 1TVBA 2ZCHL 2NY7L 1HH6B 3UC0L 3ARDB 1Y18A 2NX5A 3SGJA 2Y06L 2IPKB 3EAKA 2NXZC 5E6ID 1EEZA 3VU2A 4ENED 4R0LC 2H2PD 1PX4A 5IEHA 2B20A 4EN3B 5IOPB 5GS2H 4EI5D 3JUZA 4JRYE 4KI1A 4JQIL 4UV7H 5F9JA 3O0RL 1XF5A 4XAWH 5HJ3A 3ZTNL 3PHQA 4RWHA 1UM5L 3AXLB 3UPAA 1MHEA 2E9JA 1J8KA 5MEOB 4M1CD 2CKBA 4IRJD 4KV5E 3T1WA 2VDRH 2X1WL 2BRRL 2YXMA 2V9QA 4KQ4L 1B0RB 1P4BL 4UV4H 2ENSA 1HZHH 2OP4L 4ODWB 5KSBF 4Y4KD 5E56A 3FOMA 4PGCB 3V0VB 5EFIB 3IDNA 5IMKB 4HC1A 1H3XA 4XHQA 2FX7L 1TETH 3QG6A 3TPKA 3N85H 4AMKL 1FC2D 4J4PC 2F53B 2X1PA 3IF1B 3CFKB 1KXTB 1BZ9B 1WQVT 1BFOB 2AJYH 4OFYA 5JHLH 2ZJSH 1IGCH 3OPZH 1T5XB 1N5AB 4G9DA 1F4AA 4X5LA 3BHBB 1N3NA 1P6AB 3HFMH 3RIAF 2Z93B 5DT1L 4XMPH 2APBA 1TZHB 1A6WH 4M9OA 1W8NA 2VABB 3WFBH 1MIMH 1MFDL 1D6VH 2CIIB 5DUPL 2VDPH 3O4LB 3ZHKA 4PY8I 3ARGA 1EUUA 2JJUA 2AGJL 4KVCH 5ADPL 3CH1A 1MCFA 2R39A 2VZSA 5I1GH 1JGEA 1QLFB 5DGRA 4FMFA 1RUQH 4HWUA 4DKFL 4YNYA 2BDNH 4FFWD 4X99A 3VGAC 4MA8H 4ESKA 1OAZH 5EUOB 5EG6C 2WZPD 3C6LA 1S9XB 2PTUA 3P9MB 2A77L 4U33A 2FB4H 4ODSH 1XFPA 1EJOH 3JWDC 1KJMB 4LKCB 1QFWL 2XKSA 5ACMA 3HAEG 1FV1A 1MVUA 1OT1A 5JR1H 4OCXL 3ARBC 5FOBA 4NO0D 3MOBH 4TSAH 4NRYA 2YC1B 4QOKB 1IGJB 5IMLA 4QGYA 2AJVL 3IDXL 1OP5K 3O8XA 4R4BB 3O2DA 4M48H 4U0RC 4APQA 3VXNA 4LPXA 4RGOH 5FO9A 1QVOA 3TH3T 2GYSA 4K71C 3RZCA 4P2OB 3RVUD 4QXGH 3GSWA 1FNSH 3H42H 3PGDA 4UDTA 4H0HB 5KS9B 2A9ML 3B8YA 3QHZL 4K7PH 5JORB 3HUJF 1ZLWH 2YPVH 1JPFB 4GQ9L 2DBLH 4LSQH 2KUTA 3FT3B 3W0WA 2OCFD 4OZIE 1X5KA 4M7LL 5KSAA 4JGJA 1FFQA 4JKLA 1BJMA 1XEDA 2ADIB 4HJJL 4I48A 4E0RA 1AXTH 5D7IF 4IRZL 5F6HJ 3QDME 5F7KC 1K4CB 4AL8H 1I8KB 2R0KH 4P57A 4MA3B 2FRGP 4ERSH 3TO4D 1T0PB 3QWRD 3U0WL 1LQVA 1NCDL 1HCFX 1NCWL 3B9DA 4X9FA 4L1DA 4YDIL 3V4UH 1ZA6A 3BZEB 3BD5A 1MJ8H 3WE6A 4WUUA 3FCTA 3BP4A 1R24A 4Z9KB 4D8PB 1UXWA 5C2UB 1MY5A 1NUGA 1U92B 5C08B 1KCSL 4LU5L 4XZUB 2A83B 3SPVA 4XPFL 3NFNA 3CX2A 4OAWB 5HHQB 3O81A 3HZVA 4RSVA 5IBLC 3MRBA 3EFDH 4QRUB 3V5HA 2AKRA 5C2BL 3L95B 3FFDA 4E42A 4RBPH 5I19L 4LVHB 1DBKL 4ZUVB 1F42A 1T2XA 4M7JL 3I50L 1QR1B 3SE3C 3UZQA 3TBVB 1XF3A 4XX1E 1IC7L 1L7IL 1OAYH 2VXUH 5ILTL 3MXVL 2GJ6E 3L3JB 3LY6A 5D1ZD 3RTQC 2V17L 2EEAA 3L5IA 4LLQB 2X70A 4CU8A 2NY4D 4JRYD 4FA8A 4L1HA 1WITA 2HH0L 3U4BH 3LQAL 4PLJD 4N90E 5CJQL 5E8OB 4GAJH 4LDOB 1LO3H 2C3GA 3MV11 4AG4L 1FRGH 2Q6WB 3MLVH 3WIHH 4XMKL 4XVJH 4F57H 5DJ6A 1NGQL 2IQAB 1MFAL 1IGTB 4GMSH 2JIXB 1K5NA 2QHRL 2UZXB 5DEGB 3UTQB 3X14A 5F1KC 2P47B 3BUYA 2VITB 2CUMA 3VMOA 3DBXB 4BA8A 3STZA 1Q0XL 2P8LA 3BPNB 2EKSB 5D2LA 3T2NL 3QG7H 4NN6B 5A2JH 3B5GA 4Z5RA 1I7ZB 4G8EB 4G6JH 4LBEB 4PJAB 3REWB 4WO4A 4YQXH 4ZTPL 1E28B 5GGSY 5DGQA <