4PJ5A

Structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
269
structure length
263
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 263
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pj5A01
1AIFA 1U8PB 2PKDA 3FQWB 1OTTC 1QG3A 2O26U 1CD1A 1XMWA 3S3SA 4LOUD 4DFIA 3O6FA 1V3JA 4NQDE 4F8TA 2KDGA 4Y4HD 2WAHA 5B21A 1ES0B 1HI6B 4FQ2L 5KSBF 5DRNA 1V5JA 3SDYH 2YWZA 1BFOA 3L1OL 1RIVL 3M17B 5MERB 5EPMA 1BD2D 3S36X 3D0VA 3ZDYF 1MAJA 1X5LA 4NZRH 5IVXF 2P5WB 3UAJD 4FQCL 5LGJB 1X5YA 2AJ3A 3RIAK 1TFHA 1VFMA 1OAKH 5IF0B 3I3DA 4QXTB 4U6HB 1Q9KA 5CUSH 4M61B 3E1F1 4AL8H 4R96B 1GZPB 1T80A 5EU5B 3P0GB 4TVPD 1TQCC 4RMWA 4M5YL 2YPLE 1F97A 1M71A 4M9PA 3ARPA 4YUEH 5HGDA 3UJIL 4P5TB 4OGYH 5F89A 4XP5L 2A83B 4CL7A 2PTTB 5LKNA 5EUOB 4Q2ZA 1PG7H 1LK3L 1XGUA 4AK1A 5F3HA 5I1IH 3UTSB 3JV5A 1EFXB 1D9KD 4HS8H 1AR2A 2Y07L 5MEQA 4NZJA 1EGJA 2V17L 4U4BA 2AJXH 4X9HA 4HZLB 5DWUH 5E2WL 3G5ZB 1I9RL 3V6OC 2AABL 1A6VL 2GHWB 2OL3L 3B3IB 3TP4A 2YD4A 2W65A 4JE4B 4HS3B 3QYCA 1NC2D 3EDKA 3FZUC 4J8RA 1P4IL 2R1YA 1PX3A 1QLEH 1E6JH 4G8GA 2X1QA 4NZUH 4KMTL 3ECBB 3K81A 4KRPD 4I18B 5DT1H 4G7YL 2HRPL 4JZJC 1BOGA 1MFBH 1FBIH 1N2RB 4CVUA 5E9DD 3TN0B 2DQUH 5T1MA 2ICWA 1WBZB 4H26A 5E00A 5GGTH 3QIBD 4ORGB 2W60B 4Z18A 1JYVA 1CFQA 2X5PA 1QOKA 2GJZA 4P4KD 3S7GA 2F74A 3MRGB 3BUYB 4XP9L 4LSSL 5DUPL 3MV8D 4U1SB 5CSBA 4N5EC 4WWKB 1VSCA 3PG2A 1W72H 5EU6D 1J9CT 2BXZA 2DTML 4AEIL 2WSKA 1YYMH 4OCSH 4PB0H 1MIMH 5IQ9A 5EB9A 1BVLA 5F44A 2P45B 4POUB 2FX9H 4YPGA 3IDJA 5ILTH 5BV7B 1KIRA 2X1OA 3FN3A 1UACL 4QRTB 1NBYB 3W39B 1D6EA 1A4JA 3VW3L 2NY4D 5I76B 4NKMB 5EBGA 3AGVA 3H7LA 3P73A 4FFYL 3U7YL 4NM4H 3WFDH 4K3GA 4CU7A 5BOZG 2ZOLB 5HD8C 3O3AB 2WBJC 3OAUL 5D72L 5GS1A 2AEPH 3SE9H 3PABB 4GKZB 1UKTA 4G9FA 3GSUA 5IVOA 5GHWL 5ESVB 4XZUB 1XF2B 1ZT4B 2DQEL 2Z8VC 5DD5H 3C5ZB 5EBLA 3QSKB 2AK4B 3HMWH 4XPTL 5DJYA 4PDCE 3BKMH 1KB5L 3LV3B 5DLMH 3R06B 2HFTA 2YD1A 4Z7VA 2CK0H 1CZ8L 4LPTA 3O4OB 3MV9A 3UYPA 1T5WB 1U8MA 1ZHBA 4NDMB 4HD9A 1KXTB 3JTSB 5EN2B 3X3GH 1HEZA 4L8SC 1FNFA 2XFXA 5SX4I 4WUUA 3TH2T 3CDYA 1ZGLM 4LLUA 1KPRB 4KK6D 4PJDA 4WHCA 1IBGH 4PJ7B 4G8GE 1KCUL 1UT9A 3MR9A 5TFSH 1T2JA 2BK8A 5AD0A 4X6FB 5HJ3A 1NGXB 5DZLA 1MQKL 1J0YA 3ZKNC 4YHYC 3MGAA 2MKWA 1BQSA 3PP3K 2KQNA 4X4YA 3P30H 1BJMA 1UVQA 5IM7B 5E2VH 4KDTC 3WHE0 3UTOA 5FUCE 3IDXL 1JNLL 2HH0L 3TBSB 2AVGA 5IW6B 1IGTA 3GEWB 3CDCA 5F7YC 4WHTA 4OLVH 3TFKD 2DLTA 1WIUA 3UEZA 3EZ8A 2AQ2A 1JUFA 1P5UA 4IDLA 3BHBB 1MIEL 1A4KA 4LHUD 5D6DA 3IFNH 1SYVB 5LCVH 5D71H 2NY2B 3DYPA 4KKLD 1G7MA 1MRDL 5BJTA 5EDXA 1YMHA 2A9ML 4BK5A 1P4LA 4JQIH 4XRCA 4YGVA 1FFOB 5K59F 1IC4L 3FB8A 1T2XA 1QQDA 3BPNC 4NKIH 5JXED 1IC7L 3QIWD 2YA1A 1OAYL 1R5WB 2NY5C 3VXRD 3NCMA 2DL2A 5EZJA 1GGCL 3F7QA 4MDIA 1KTLA 5EU3A 1ND0B 3QUZA 4XHJC 5DD3L 3GMOB 4JQXA 1RU9H 4QXGH 2EXYD 4N0YH 1HIML 2G60H 4KK5D 3QH3B 4Y16C 4LLYA 5CEYA 1F4XH 2Q8AL 1OGAE 2X89D 5HHPB 2AAVA 4DVRH 4WU5B 5D70L 4CJ0A 4KXZI 1XGPB 4MXQC 4JY6A 4YHMH 2CLRA 4HW6A 3MV9E 1RK0B 4D0DB 1ZGLA 3EYSH 3CSBA 1K5NA 1V05A 3RKPA 4UV4L 5EFIB 5FF6A 3O6MH 2D7MA 4NM8L 4P2QE 4Z77A 2KH2B 5K33A 4NO0B 4Y1AD 3CC5A 4PJGF 5JHDE 5DMIL 4F7PB 4PJFB 4JFEA 4NN7B 3U30B 4BKLB 2Q6WB 5FYJH 4MYWB 5FKAB 2B5IC 1U8KA 3FN0H 3HZYB 3RY6C 1CFVH 2BC4A 2H9GB 3NMEA 1R3IH 3QUYB 5D7LA 2EIZB 5I30H 2DQCL 3I6KB 3VGEA 7CGTA 1T1YA 3ARDC 1GXEA 4LPWA 4Y4KC 1JV5B 3O8XD 5IK3B 1W0VB 1QBLH 1MF2L 3LS4L 5JPNB 3BQUB 1QFUH 4HT1L 4PY7A 4KPHH 3MLYH 1O7SA 1IGJA 5EO9B 4MMZC 2BOCA 1ETZA 3HRZA 3SDCA 3RKDD 1WIPA 1YJDC 5I8EB 5DD0H 3FO2B 4OLXH 5A2KH 3KLAA 4H25B 5DR5H 3RZCA 1NC4B 5KJRH 1XIWC 4LU5H 1AHWC 2E27L 2H45A 3KPSA 5F9OL 1PGRB 3TJHD 3PWJA 2F19L 4PD4J 3FTGA 1T2QH 3IFOB 1HQ4A 5H35A 5I71C 5FUZL 2AJSH 1R5VA 4AH2B 3DI2B 1VDGA 3TIEA 3BP7A 3SJVB 3OF6D 3MJ8B 3OJDB 4HIEA 5C0BB 1JF1B 2JB5H 4P59H 2ED9A 3NIGE 4HUWA 3SKJL 3H42L 2GY5A 4NNPH 1MCWM 5ERWA 1XGQA 4RGMC 3S8WA 3BPOB 3KYKH 2VLLB 4OD1H 2E6QA 4QF1A 5I16A 1AGFB 5C0EA 8FABA 2VXSL 1DEDA 5CEZH 2HMIC 2YSSA 2BHZA 4UIKL 1C12B 3WDIA 4PGDA 4TUJA 3BSZL 1IZJA 2B4CC 4LNRA 3DROB 3R0NA 1U6AL 2FYYB 1NDGA 3P77A 5CAYB 2ITDA 3JSSA 3VXUD 3SDXB 2XTJC 4ZUWA 1NMAH 1KYOJ 2VDMH 1QSZA 2DLHA 4J1UA 4M9OA 4O2CB 1HH9B 2Q7YA 4NC2B 4PJBF 1MNUL 4JFEE 3EAKA 2ED7A 4NOFA 2Z31B 4PJXF 4NHUA 2ZUVA 5ID0A 1T6VN 2PO6C 2XTLA 4WTZG 2YD5A 4ONGL 3SGKC 1MOEA 4MS8D 4FFZH 3O4LA 3CFDB 3SDYL 3VWKB 5IB2B 1T21A 1CLYH 2FHCA 5SWSA 2DD8H 4L3EE 4POYA 2EKJA 4NZRL 3RAJL 1S3KH 5DRZA 1YA5A 4GKSA 2WINB 1KT2B 3K0WA 1T83A 1U8HA 4M7JH 5JR1L 1OAKL 2F5BL 1C1EL 2GTZB 3WO4C 5ANMA 2BSRB 1X7QB 1OTSD 1NLDL 3ARBA 4AL8L 3UMTA 3AS2A 4Z7QE 1I85C 4MA7H 5CHNA 3WXVH 5HI3D 4X6CE 4EI5A 3WFEL 1DANT 5F6IB 1BJ8A 2VDNH 4TOYL 3NGBC 1IGFL 1JZ3A 4OGYL 3VJ6B 1K8IB 4G9DA 3UDWC 5GRJH 3OG4B 5FKPB 1RJZB 1HHJA 3ZE2F 3BGFB 1FFNB 4WI8A 3VE0A 1XGRB 1X6LA 5JW5B 4ORZC 4ZD3H 5HI4C 3DMMC 4FXGA 1S7TA 4JM2B 4HS8L 4GAGL 5CGMA 3UO1H 1MCNA 4FMKA 2OTWB 2HKHH 5KOVC 4HJ0C 2AJXL 2R4RH 4FFWD 4K9EC 3RNKA 5GGRB 4ZO6A 1XH3B 3TYGH 3QUML 3IU4L 3OL2A 3IDNA 3TT1H 3V52H 1S78D 3D85A 4NQEB 1FVCB 2R23B 5IT2H 2OYPA 3STZB 1H5BA 1PEWA 4WU7B 1WICA 1TVHB 1BQLH 3JBG7 4NZUL 3MLSH 4MD4A 3CNKA 5DT1L 5T1LB 1KJ2A 4OZIE 3H7BB 1BQUA 5CINH 4LGSB 5HYSB 2PN5A 3U0WH 1SM3H 2DQUL 5DJ6B 3LOWA 1OPGH 4S2SA 3HE6D 3GK8H 3RWCA 3MNZB 2HVJA 2W91A 3H2WA 3VGBA 5SWQB 3QQ9C 4XVSL 1NGZB 4FQIH 4TNVK 5D2LF 3WJLC 1H8OA 2CQVA 1IC5H 4WEBH 4Z7NE 4TQEH 5HYQA 1W72L 4J4PD 4Y5YA 3TWCH 4OCSL 1DL7L 2OMNA 5ID1B 1RZ8A 2UUDH 2EDWA 2BNRA 4OZGE 1FZKB 4OF3A 4E41B 1LE9B 2XWBA 3MOQA 4CADA 4OBSA 3CLEL 4WGWB 5GGRY 3QRFM 1WWAX 3X13A 4D2NA 5K9QG 4PLKD 3LAFA 4B7IA 1EUTA 2XN9B 2BDNL 1SHMA 3MLVL 4DOHB 4OI8A 3BT2L 5L0QC 1H3PH 4NM4L 1CE6A 3WFDL 3CSYB 3VCLB 5I1HH 4YDIH 1I1AB 2NY0B 3AU1A 4HKXB 3ZDZF 5SX5H 2LAGB 4GXUN 3WO3B 3K2UH 3CFCL 4YAQB 2H1PH 3HAEH 4ERSH 4FTVB 2BY2A 1YEEL 1A7OH 2APWA 2YZ1A 3KPOB 4S1RH 4G42B 4OZHA 5FK9A 2CK0L 3U6RA 4U1KA 4E42A 1R3LA 3EO1B 2DMBA 5E8NA 1ULVA 1KG0B 2OK0H 3HI1A 3P0VH 5DTFB 2X4QB 1BAFH 4HGWB 1S7SB 2FLBT 1D5ZB 2YUWA 1WQVT 2APTA 4NUGH 1IBGL 4W4OA 4TUOA 3TGXA 5IR1B 2X41A 3L3HA 4YLQT 5TFSL 5D7JA 3PDOA 5CBEB 5ISZE 2P7TA 5HYSG 5JHLL 3ULVC 3P11L 4KRNA 5EG6C 1MCLA 2YPLD 1Z5LB 2DQDL 1QSFB 3QB7C 1Z6JT 4AEHH 5ALCH 3PV6B 3KJ4C 2E7MA 3WYRA 4ALAH 4O02L 3P30L 3DO7B 2O61B 3O9WC 2O5YL 3F7YB 1B0GA 4TVSa 3I9GH 2N7BA 3GJFH 3UTZA 3V4UL 5AAWA 5GGVH 5F8QC 5KSAC 1K6QH 5IVZB 5E7FA 1PY9A 2X4PA 2E3VA 4LQFH 3DI3B 2AK1H 1B4JH 5C6WH 2X4SB 4KROD 5CJXC 4MA3A 1OP3H 1FGVL 3B9KB 3T3PF 2R0WH 4N8CL 2FEEI 4JAMA 3MRDA 4MJ4A 3QO1A 1CTNA 3UXFA 4OD2A 3REWA 5JIHA 5KVDL 2C1OB 1UB5A 4XGZB 5IBUB 3MRLA 4KZDL 5TGBB 4JQIL 4JPKH 1I7RA 4NKIL 1LQVA 1I7TA 5ESQB 1T3FB 3TCLA 1HCFX 5GISH 5MEPA 4GT7A 1MHEB 3S37H 1U9KA 5C0JB 2H26A 3CK0H 2FZ3B 2ADJA 4QXGL 5FV2A 2CLVA 2GJ6E 4N0YL 2G60L 3VFWA 5INCB 3DV6B 9CGTA 2XXCB 4M5ZL 3O6FD 2BY1A 3WS3B 4MQXC 4N9GA 3SHSA 4OM0H 1LE5B 1T20B 4QCIB 4WV1B 4YHML 5D5MB 5DEZA 3LB6C 1W72B 3MGOA 1Z0NA 3FKUS 2VLMD 3G9AB 4KC3B 2NMSA 1QFWI 3QIUA 1RURL 1AGCA 4FMFA 5ICYA 3DHJA 2XRAH 1SBBA 4X0KB 1ROWA 5DGQA 2CRYA 2XTJE 1MSPA 4HZAA 1QNZL 3BGAA 5DUML 4ODVH 4QRSB 2Z8WC 3FO1B 2BCKB 4BSWB 5DVKA 1J8HA 2F5AH 1VERA 4NCC2 1ZANL 2VXVH 1PJ9A 2IANA 4YHNB 1MCHA 4I3RL 2RBLA 5F9DC 3NZ8B 1WK0A 5E8PA 1PYWA 2R1XA 1IRAY 4MJ2A 1MEXH 2XIDA 5E1HB 2F8OA 1JYWA 5HVHC 3N1FC 3HLAB 3SE4C 1PD6A 3BZFA 3H3PL 1N3NB 2RR3A 1E4JA 2ADGB 5IB1A 5FA4A 1BX2B 4RAUA 1U58B 4NKDB 1WWWX 3QCVH 4HMEA 4G3YH 1QFUL 4GAYA 2VKXA 2AXJA 4X7DC 4D0BB 1J05A 1CLOL 4DGIH 4Z7UF 2RIKA 4BSVA 4O2FA 4K3JH 2Z4QA 2NXZB 5INDB 1JGEB 25C8H 5F7FA 5IBUG 1KCKA 1DQLH 4G8GD 3PP4H 5GPRA 5FDWA 5DR5L 1YZZA 3OKOA 2WUBH 4ODXB 5KJRL 2AJUL 5ELIA 4QT5A 1NL0L 1MLBB 1UJ3B 1JMZA 4D94A 4DGYH 5H94A 1XF1A 3GSXB 4ELMB 3NA9L 5E5MB 2R9HD 1T2QL 2HLAB 4F9PC 5JZ7D 1FIGH 2AJSL 5JNYB 3A6BL 1YDPB 5DSCB 2IC2A 1U8IB 5F1SA 3DXAE 3UYOD 2BVUA 2JB5L 2DM7A 4P59L 1OWRM 4OCWH 3VFPB 2AXGB 5HPMA 3SKOA 1E28A 1OB1A 2ZWLT 3KYKL 3QAZB 4EN3A 4OD1L 3ZYOA 4PFEA 4Q6IA 4CDGC 5F1IB 1AI1H 2AJVH 4MQSB 4EVNB 3QA3A 5JW4M 2APFA 5E5RB 1RZKH 3GSVA 5ABDE 5GS0H 3HNSH 4LEOB 4LHJB 1AQKL 1T6WA 2BMKA 2DB8A 2DI8A 5DVMA 1RMFH 3L7FA 4P5TC 5KG9B 4KU1A 2DTSA 2H41A 4MJIE 4O2EA 5JW4R 2FECI 1NMAL 3FONB 4HIIA 3V7AE 2VDML 1BWWA 3VD4A 1S5HA 5T1KB 2HLFC 4LMQI 4MHHI 3MROA 3WL9B 1FORH 2W59A 1V3KA 3GHEH 3GFUA 1HQRB 1VFOA 1CBVH 2CMRH 1QLRA 4GG8A 1JZ5A 4G9FD 4PRNB 2NY6D 3MRJB 4FFZL 5I75B 1SEBA 5J3HD 5IG7B 1TJIH 5DC9B 1QA9A 1N8ZA 4PJCB 2DD8L 1BFVL 3MRFB 4ZAKA 2BVOA 4I18C 1S3KL 2PR4L 2FIKB 4EXPX 5DJ0B 2CDEA 5JO5A 4FFVC 3MV9D 1AR1D 1FQ9C 2Y06H 2E7CA 2R56H 2IQAA 3EYUH 1UCBH 4KI5F 1MCOH 4WUUD 2FD6H 3E2HB 4FXKA 4MNHA 2V2XA 4HH9A 3SN6N 2V2TB 4HUNB 1MI5A 4P2QD 1JJUA 1KXQE 4JFFB 4X99B 3EYVB 5BOPA 3WSQH 1ZLUH 2ATPB 5C0ND 4W68A 1TVBA 4KKCC 4OGXL 2E9BA 1Z9LA 4YBQD 2YPVL 1F90H 5GRJL 4UU9A 1JGUH 4HUXB 4G8FB 4F8QA 3B5HA 4P3CH 1NFIA 4PD4K 4ZD3L 4LCCA 5J1AA 4C57C 5C3TA 1AD9A 1WFTA 3RVVC 1CVSC 2WP3T 2DI9A 1L7IH 5C1MB 3MUHL 3TJEH 2HKHL 3X17A 4U1MB 5DMJB 4JDTH 2V5MA 3PL6A 4RFOL 1R3JA 3CPLB 5B3NA 4G80A 5EU4A 1V8HA 3TT1L 4YZFE 1FIEA 5M94B 1HXYA 1Z3GL 3FQXA 5FXCH 2A6IA 5DYOA 1I9IH 4UT9L 1LO0H 4P46A 2AV1B 3K80A 1RZIB 5I8CA 3BO8A 5HHMA 1HYSC 3ULVE 3D6GA 3ZL4H 3S36H 4PJ9C 1WITA 4HS6A 1SM3L 1VENA 2VLKA 3O3DA 5HGBB 1KYOK 1CXIA 1MCQA 3HZVA 4JFHE 4IOIB 1EVTC 1ZT1B 1OPGL 1X5JA 1M6OA 3MUGB 3D3VB 4DQOL 2M8XA 4FQIL 3TBWB 4HJGA 2VLJA 4Z7WB 1I9EA 2VSDA 3PHSA 4WEBL 1NCCL 2WUCH 2XPGB 4TQEL 5ECJE 3OSKA 3QUZD 4MCYA 4K8RD 2E6PA 5LAXB 2C7UA 3PDDA 1WZ1H 5E2UH 4Q9CA 2EE9A 5J6GB 1UH2A 2EECA 5GSRB 3MBEA 4L9LA 4IS6B 1JNHA 5CILH 3I6GB 4PJAA 3QDAA 3TA3B 1U8PA 4RAHA 3ZLQC 1UM6H 1IKNA 3LKPB 5IJVA 4ZNEA 1KFAL 5FHAL 3ULUD 3RNQB 2WK2A 2E8YA 2FL5B 2BRRH 3QNXB 1NFKA 2XZAH 3JVGA 1HI6A 2NW2B 1H3PL 3BP6B 1T7YA 1JGVL 4OLYH 3M17A 2FBOJ 5MERA 3FOLB 3T2QA 3H9SA 2F54A 5I1HL 4JFED 4M6AA 3EO0B 4YDIL 2YZ8A 5LGJA 3JTCA 5ALBL 2AQ3A 3UBXI 2BNQB 3TBTA 5IF0A 2RCSL 4QOKB 4U6HA 5GSVB 2BY3A 4M61A 3MRIB 4ERSL 1B0RA 1Q1JL 3RRQA 4OAWB 1A7OL 3DSNA 5D7LD 1GZPA 5F7MC 2NY2C 3P2TA 4R8WL 4HFUL 3O45A 3DURB 4OTXH 2A83A 3OMZA 3CSGA 3P0VL 3MMEB 2Q76B 1IGMH 1NGYB 1WBXB 4C56B 1NKOA 3BJ91 3AB0B 5HHME 1EFXA 3SDCD 5KANI 3UTQA 1UEYA 3RWIB 1WV7T 3TBYB 3SDAC 1RULH 4NBYB 4ALAL 4WHYH 3SGJA 3GGWB 5DFVC 3U7WL 4U3XA 1G6RL 3RIAF 3KG5A 2GAZA 3WFCL 2CKBH 4PJIB 4ZSOB 5GGVL 1A7RH 4UT6H 1CDIA 1CGUA 4F33B 4PRPB 1NAML 3AXLB 4LQFL 1WLHA 1N2RA 2AK1L 1B4JL 3BVNB 1U8LB 3TN0A 4ISVB 5BRZE 4Y5XA 4ZS7L 2HA1A 1J5OH 4F57H 3NBNA 1J87A 1JHTB 4PRHE 4HGMA 3KNBA 4NYLB 4JLRB 3CMGA 4NN7C 3U30C 3IDGB 4GFTB 1UB6B 3KYOB 2XZQH 4MA1B 4U1SA 4WWKA 5KVFH 2UY6A 5D6CA 3MRKB 1YY9D 1N59B 3VWJB 2H2SD 1LO5A 4B41A 3ARRA 4BFBD 1MCBA 1ZSDB 1WF5A 4HX1B 3MACH 2ZUWA 5GISL 5J56B 4IRJC 1FZMB 4WW1B 4OLWH 4I5BA 3CK0L 3TF7C 2P5WE 4YHPB 1A0QH 4WFFE 3BQUC 3BMWA 4UAOC 1RJYB 1ZA3A 3RPIA 4OM0L 1X5FA 5D93C 1WVZA 4V3EB 3CH1B 3IXAA 5I76A 5E56A 4UOJA 5KS9B 3LPWA 3QHTC 5IB4A 1U8JB 2NY7H 4PR5A 1MCWW 3L5XH 2Z8SA 2ZOLA 2DICA 2IAMB 3UTTA 2QQNL 2XRAL 3Q1SH 3ESVF 3PABA 4BELD 5CZXC 5EUOE 1IFHH 5E95B 4KMQA 4ODVL 1NFDB 5C09B 1BBDH 1XF2A 4LCUA 4NUJA 4LVOC 3J7HA 1ZT4A 1UM4H 2F5AL 2VZ3A 3ARBD 5CKAA 3UTSE 1ADQL 4QXWA 4F9LA 1T0MB 1B9ZA 3LV3A 4EI5D 3F6LA 1CICC 3FHAA 3R06A 4QYOB 1CDBA 3F12B 5SWZE 3KXFB 5EN2A 1MEXL 4L8CA 4I13B 3BPOC 5B4MC 2UYLB 4PBWD 4FHBD 4AENB 4PYGA 3ZYIA 4U2YA 5CWSB 2IH1B 3WXWH 1IZKA 3RWGB 4YC2C 2DBJA 3HB3D 2WBWB 3QCVL 3T0DA 4PTTB 2DWDB 3QXWA 4LKCB 3P4OA 4IRZH 1NGXA 4JEGB 1P7QA 4PUBL 5JOEA 4UINH 4K3JL 4OLZH 3UJJH 3RZCC 2IGFH 3D85D 2DF3A 4HXBH 4JPIA 3VRJB 2BVEA 2QQQA 1A22B 4BQ9A 5DHXB 3WHXB 3ZKMD 2JE8A 4C59B 3ZSSA 2A73B 3VFVB 4LRIC 1SQ2N 4ZXBA 5SV3A 1JFQH 1C8PA 4GW5A 2XICA 3TYFB 35C8L 5C9KA 3I3EA 3QFJA 2VABA 4KTEH 4OCWL 1ZKAA 5IB3B 1GGIH 3PV7A 2WWMD 2FRGP 1C5CH 1OAXH 4HF5L 4M02A 5E1AB 2BSTB 4W6XB 3WJJA 2B2XH 2VR5A 5FUOL 5EO0B 1U2CA 2BNRD 1IQWH 1GCFA 1R5WA 2P49B 3RDTB 1AXTH 4NQVB 1FCCA 4NJAH 4LSVH 1NAMB 1BEYL 3G6JA 1LD9B 1ND0A 3C5SB 5T3XD 4FQXB 3GMOA 3RGVC 1GGBL 3D5OF 4WGVB 4LP4A 3QEUB 1G0XA 4G6MH 4OUUB 3QH3A 5B38B 3BGFC 1NGQL 4DK3A 3SCMB 1D5IL 3T4AB 3VFOA 5T1DH 3U0PB 4MA8H 2AK4E 2Y23A 4JM2C 3BH9A 4IMLB 1FV1B 2OJZH 3WIHA 1XGPA 2FH8A 3CVHH 5CIPH 3RX8A 3GHEL 2WW8A 1KIPB 4QGTA 3DRTB 1WC7B 2D7OA 2CJUL 2ZCLH 1DJSA 2CMRL 4X6BB 4RNRA 5BQ7A 3NTCL 5EFIA 4BFGA 4P3DA 1HILB 1EAJA 4KVCL 4Y4FC 1IL1B 3B43A 1OF2B 4PJ7E 3PNWA 4NO0A 3HI5L 5BVPH 4R4BA 4XP6L 2VERN 4WRLA 2WP3O 4BKLA 4FNLL 2Q6WA 4Z78A 1FJ1B 2C26A 5GRUH 1L0XA 3EYQC 5FKAA 2J8UB 2R56L 3HZYA 1UCBL 2MMXA 4YR6A 3VG0H 3QUYA 3BD3A 4J2XA 2QKIB 5GGVY 4WTZA 3TPUB 3IDUA 3I6KA 1DFBH 5D7JD 5AYUH 4N0CA 4DUVA 4LCWB 4M4RA 5IK3A 4G6JH 1F90L 1P4BH 3F58H 3O2WH 5L6YH 1JGUL 3KPPB 1Q9OB 4P3CL 1X5IA 2H8PB 2LVEA 4P5KB 2FO1A 4YFLF 5EO9A 5DJAB 5IHLB 2F8XC 3HC4H 2LABA 3PIQB 1FP5A 2FBJH 3TJEL 1Z9MA 3FQTB 3GHBL 3ROOB 3WDJA 3CZFB 5I8EA 5BZWB 3FO2A 2VXUH 5I1GL 5K9OA 4KRMB 4H25A 4WW2F 2W0LA 4OZ4A 2APVA 5IFJB 3AM8C 3K2MC 2PYEB 1I9IL 1EEZB 1LO0L 4JRWA 1KPVA 1LK2B 1JYXA 1PFCA 3IFOA 1IAOB 4Y0GA 4DZ8B 4ZUUB 5B38G 4ZO9A 1MHPL 5C0BA 2NY0C 3TPKA 5DHVH 1JPSH 3EFFA 3MX0A 2BJMH 3KR3H 2Q20A 1JHKH 4OQTH 4P2RE 5I8OH 1ZEAH 2CR3A 2XQYG 1AGFA 2FB4L 4Y5YC 43C9B 2M2DA 5HYIA 3I50H 3MOAL 3T0EB 1C12A 2WUCL 4M1DL 5E4IA 4P48A 3DROA 5I66B 2AXFA 4JKKA 3IXTB 3F5WA 3B2UD 1FL6A 1FVDA 1GVIA 1CGTA 1WZ1L 4I2XB 4KJPC 1FAIH 4K55A 3I2CH 1ZS8B 4LSDA 1P7KA 5ACZB 1BPVA 4OFVA 5HGAA 4PV8B 2W9EH 1EHLL 4PJFE 1B4RA 1MREH 1UM6L 2Z31A 5AEAA 3FB6A 2A6DA 4PGEB 3WFHA 4X8XA 1P9MA 3LZFL 1H0DB 3QIUD 5KSBA 2BRRL 3R4DA 4MJID 2XZAL 4RZCA 3O2DA 4HIXH 3GRWL 3RBSA 3MLWH 1NJ9B 3BRFA 4GS7C 2C3GA 3P3YA 2VB5A 1J8HD 4M48H 4HC1H 2CRMA 4OLYL 5E4EB 1KSRA 5IVXA 3NIDF 4OF7A 4UIMB 2DYPB 2IAND 2JIXB 1KLFA 1QFWM 4JVPA 2NNAB 1LO3L 3C6SB 2K3TA 4NSKB 1YMMB 4WJ5B 2HFEB 3S5LB 3VFUA 1B88A 2FJGB 2CDFB 2R2EB 4OLUH 3BH8B 3LN5B 4FQ1H 5GRXG 3QPQD 5I1EH 1X7QA 3VFSB 3MZGB 4C55A 4JHWL 4KJWD 5L8LB 4X6DB 2OSLB 2Z35B 1R3KB 5L2KB 2WWKT 3WN5C 1KBGH 5FKPA 1SYSA 4HV8B 43CAB 1FFNA 2Q8BH 5MENE 5JW5A 3DLQR 5IBTL 5IW3A 3MV7E 1IEAA 1RUPH 2ERJB 1IGCH 2DQJH 3ZE1E 3L5HA 3OKDB 5GXBB 1U3HD 2OTWA 3SJVE 3N85L 2V5RA 1NCWH 5C0BE 1S7QB 5I1CL 2GKIA 2Y25A 4NRYB 4EQ2A 3V6FA 1XH3A 3FFDB 4ZODA 4M7KH 1CDHA 3L7EB 4YNYB 2G75B 4KKBD 1WCBB 2CKBL 1T03H 1FVCA 3NOIA 3LKRA 3WIFA 3IETA 3STZA 4YWGL 2OX5A 3GIZH 4G5ZH 3RL1A 1A7RL 1TVHA 4H1LB 3WCYA 3ZYJA 1HSAB 4UT6L 3HMXL 1E4XL 5AG8A 3C2SA 3H7BA 5HDBF 1V7NH 3NIGF 5HYSA 2DQFB 3SDXE 4J3VA 5DJ6A 3QJHB 5I74B 1BMGA 4EN3D 3C5JA 4R7DA 1J5OL 4F57L 2VQUA 5AUMB 2D7QA 2R4SH 3CLFL 4ZUVB 4PS4H 1C08B 1IQDB 2NY5H 1NGZA 4MLIA 5C6PB 1FSKC 2XZQL 4U0RB 2PNDA 4V1DE 4LPVA 2MJWA 5HHOB 4F2MA 5DO2D 3HE7A 4ODHL 4ZQKB 3ULUF 1ZT7A 2VZVA 4FQJH 3IU3B 1KC5H 2GI7A 4RBPH 2J2ZA 4JFOB 5LGKA 3S5LG 4E41A 1LE9A 2ESVA 1A0QL 4QXUH 1INEH 3WS6A 3LHPH 5F1NB 2X44D 4QRPB 5KN5A 1CD9B 5B8CA 1VFUA 3QJFB 2NXZC 5E94A 2ATKB 1OD9A 2F58H 3JZ7A 2NY7L 1NKRA 4MNGB 5EH1A 4M7ZB 3L5XL 3CSYA 3UPAA 1XZ0B 4ZTOL 3VCLA 1JE6A 1IM9A 1OL0A 3DRQA 4ZAKD 3ARGB 3Q1SL 5C0GB 1G1YA 3FT3B 1UJ3C 3MRQB 4TNVF 4APQB 1BP3B 1T4KA 1YNTB 2OR7A 3KPLB 1SJHB 3WLBB 4YDJB 4M1CC 1H3VA 3VXMA 3UC0H 1TJGH 1MI5D 4X8JB 1O7VA 1Q94B 1S5IH 2QHRH 3RVUD 4HUVA 4YBLB 4NRZB 1N5YH 3C2AH 2H6PB 4Z8FH 1LO2H 4JZOB 4MD0B 2X10A 4ODUA 3G5YB 3NFPA 4U1GB 2BSSB 2YD8A 4Y19B 3DSFH 4WHDA 1KG0A 4YGAB 4H1LG 4NQEE 2X4QA 8CGTA 1DUZA 1A1OB 4HGWA 3DX8A 5EC2B 4P9MH 1IE5A 5KTEH 4NWUH 3IRZA 1FLRL 3HFML 4S1DC 3P4MB 1AGDB 3B5TA 3HPJB 2C4FT 1YJDH 3EGSA 3PWNB 1Z5LA 4U1IB 1QSFA 1MCFA 3PL6D 4KHXH 4HCRL 1JNNH 2B1AL 1QBAA 1MCPH 1PW3A 1RIHL 4OLZL 1X5GA 1GHFL 3D39A 3UJJL 3DO7A 3RTQD 1T7ZA 1MFCH 1I7UB 4KHTL 4OJFL 3ARZA 1G7QB 3F7YA 4X5WB 1ZXQA 4P46D 5EZLA 4OT1H 3C60B 5EBMB 1F6AB 4MQTB 4R4NC 5HHMD 3MO1B 1P69B 3ESUF 1DN2A 4EUPH 4L4JA 3KYAA 4XCCH 3QDJB 4LGRB 5I1JL 3DPBA 3OHXB 4JFDB 4ODSH 4OZIF 2FX7L 3JV4A 2ZNXA 4RGOL 1JFQL 1IILE 4UTBH 3TZVC 3B9KA 2ZUQC 1T04B 3V8CA 5CCKH 3B9EA 2YEZB 5I15H 4KTEL 4PGBB 2VLJD 2HRLA 3IYLW 4XGZA 2HT3C 1FNAA 2B4CH 2DLFH 4Z7NF 2CKBB 5E70A 5TGBA 1G84A 5F6HI 5IP4A 2PYFB 4JRYB 2XN9E 5TH2B 1FFPB 3E2HC 5BRZD 2GK2A 1AO7B 1SBSL 2YUVA 2OZ4H 4DOHE 1IQWL 4X4XA 5ESQA 3GBNH 2C3HA 4LSVL 4XP4L 4XPAL 3NCBB 2VLRE 2EC9U 3PHQB 1UXSB 3SE8L 3L3DB 4WI7A 4TSCH 4XC3H 1MHEA 1A6ZB 3T0BA 1A47A 2E7LA 3QI9A 1JHLL 5GGTA 5INCA 1QRNA 3DV6A 4KZEL 4XC1H 3JWOL 2GCYA 2QQLH 5T1DL 4MA8L 4NO5B 1DE4B 2P24B 3SE3C 1TCMA 1ONQA 3QDMB 4FTVE 3QR2A 1NCDH 2V7HB 4U31A 3SDDA 3T65A 1UWEH 3TNNA 4WV1A 4RA3A 1UYWH 1XCQB 5D5MA 5IEHB 1W72A 3H9SD 3W9DB 4ODTL 2MFNA 4OFDA 5TQ2L 3BZDA 1K2DB 2FR4B 3GMRB 1L6ZA 4U1LA 3PQYA 4GG6B 4GBXB 4H20L 3KPQB 3RWFB 3LQZA 2NX5B 1MVUB 3L3IA 4PJGA 4WVRA 3FO1A 2F53B 1MWAH 4J3UA 4KQ4H 5BVPL 1CU4H 2DRUA 4YHNA 5D1QA 4PREA 3KPRB 5DD1L 5IFAL 1HN1A 1QSFE 3NZ8A 4JO2H 5GRUL 3OKLA 4HDIB 1PQZB 1CD8A 3ZHDA 3F62A 3QEQB 5H2BA 5DQDH 1WEJH 3FN9A 4ZFFA 3HLAA 1OOAA 4GRLB 4BH7B 3SBWC 4Y2DA 4O4YH 3IS1X 1KEGL 1XF3A 1DFBL 1H3WM 3UTSD 3NZHL 2P1YA 1U58A 1NBQA 1EFXD 1BZ7B 4G6JL 3MA7B 1EO8H 2G9HB 3KVQA 2R8SH 1P4BL 3O2WL 2L0DA 1HHHB 4HSQA 1MHCB 1NBZB 4D0BA 4I0CC 4K9EH 3BWAB 1KPUA 3ES6B 3I02B 4LLQB 4WHYG 3UYRH 5INDA 3HC4L 2LTQC 2FBJL 1GGYA 4F3FB 3TA3C 3K7UA 5DJDB 1KGCE 3BD5A 2ZG1A 4I48B 4YX2H 4KJYB 3HZKA 3KDMB 2AXHA 2X70B 2A38A 4IRSB 3VD9A 4YHZH 4HPYH 5E5MA 3TN0D 1S7WA 2HLAA 2R2BB 4MCZB 15C8H 2EDQA 1U8IA 3NCJH 4Z7OE 5E03A 1IAKB 2KZWA 1BJ1J 1JPSL 4ZS6D 1RZFH 2XT1B 1RIUH 4BK4A 3AVEA 4WWKD 2BJML 5J13B 1JHKL 4OQTL 2GFBB 2O5ZH 4QRRA 2C5DC 1TNMA 1ZEAL 4U2ZA 4HIJB 2NXYD 5CKGA 1CGSH 3I50L 4G43B 4EVNA 5I6XB 3MBEC 5C0CB 1OAQL 2DLGA 4JCLA 5BVJB 5D5ME 5JW3H 5BCAA 4WO4B 2GUOB 4W70A 3EYOB 4NPYB 5F3BA 2A77H 5KG9A 4QHNA 3BEWA 1U41A 4HMDA 3AREB 3I2CL 3FONA 4MZ3A 1OGAB 3E6FB 3SOBL 4NZDA 2BFVL 2VDLL 4PJBA 1MRCH 5E6YA 4YBHA 4YO0B 3C6LB 3AB0C 5T1KA 3UBXA 2D4FA 4PJXA 4XP1L 2M26A 4KJQD 3PWLB 4K94H 1MRFH 1MREL 3WL9A 4PBXA 2CIKB 1N6VA 4DN3H 5JQ6H 1YEJH 2DKMA 2OP4H 4OZHF 1HQRA 1DBJH 3AY4C 2D03H 4HIXL 4PRNA 4PY8J 3MRJA 2WWKO 5IJKC 5EOQL 5CJ5A 3FOMB 4XBPB 3QRGL 5JHDB 3C5ZD 3HUJE 3B9VA 3MRFA 1JWUB 2QTEA 1AGBA 4NQXB 4XPHL 1FFQA 1FDLL 1QHOA 1HHIB 4FQ1L 5TDPB 3K1DA 3BESR 5DJ8A 5JOPE 3CVHB 2PXYC 2GYSA 1S8DA 4P23A 2CDGB 3HI6H 3INUH 4JY4B 1S9VB 1HINH 2EYSA 2BVQA 4X99A 1NPUA 4Y89A 2ATPA 4BFIA 1OD7A 1RJCA 1A5FL 4NHCH 5I73C 2OI9B 3C8KB 3ULVH 3QXUA 1KBGL 2FJHA 3PGFH 1P7QD 4HUXA 3VWJC 2DBLL 3NCFB 4K7FB 4ELME 5IMOB 4YK4B 5D1ZC 3ZYZA 1G0YR 1IGCL 2UWEE 4JFYB 3TM6A 1CQYA 3ABZA 5DQ9B 2VR4A 1TQCB 1KACB 2A1WH 4OCYH 4QEGA 5DRXB 4HEPG 4MVBA 1IT9H 4U1MA 2IALB 4HWBH 3TVMA 4FQHB 3CPLA 1ZK9A 2E7HA 3RWHB 1HOCA 1FNHA 4M7KL 1TTUA 1T03L 4MLSA 3BAEL 3GBLA 3GIZL 2GY7B 4M8VA 4G5ZL 1CYGA 2AV1A 5FGBC 4YFLI 1YN7B 2V5TA 1NLBH 3MXVL 1EVUA 1NUFA 1A6AB 3A6OA 3BKYH 1EHXA 1VCAA 3HNTH 4P2OA 5HGBA 3ARFC 4IOIA 1ZT1A 3ROLA 2R4SL 3MUGA 3D3VA 5AZ2H 2X4UB 5D2LA 2HG5B 1CFSB 3TBWA 4Z7WA 4JZJB 1LILA 1KEMH 2EH8H 4NQTA 1RJLA 5LAXA 3DYMA 5J6GA 1SY6H 4NN6C 3DUHA 5E99H 1KIQB 3V4PL 5GRYA 1L0QA 4ONHA 2H2PC 4KUCD 4IM8A 4PJCE 4CVXB 2HYMA 4U1NB 5IW1A 4PJEE 4CN4A 4KVNH 2ZUSA 4OF8A 3LHPL 5MEOA 1X5KA 1QO3A 4GW1A 3NFNB 2I24N 3RNQA 3LKQB 2FL5A 3OKNB 3QNXA 1BZ9B 2F58L 5D1XB 4YDKL 2NW2A 3ETBF 4M6OH 4MAYB 1C5BL 3BP6A 4L3EB 4PG2C 2Y72A 4DKAA 5CD5C 2EIBA 3IDIB 4JFFE 2I9LB 1CXFA 1MUJB 4NO0D 1TENA 3FOLA 4XCEA 3WKMH 4R4FH 1KJ3H 2P4AB 3T0XA 2NZ9C 4N0UB 4N0FA 3ZT5A 3EJYC 3MUZ1 4U49A 5TDOB 2BNQA 3T3MF 4QTHB 1IAII 4HPOH 4XPFL 3MLZL 2KBGA 1D9KA 3MRIA 3QUYD 4Y4HB 1GAFL 2X4RA 1A6WH 1M05A 1TJGL 3LSOA 3IJSB 2HKFH 1FFRA 5DEFB 3C2AL 4WFED 4Z8FL 1LO2L 4MDJA 3JWNC 4PJHB 1OSPL 4N0CD 3DSFL 3HS0A 1KCLA 2NYYC 1ED3A 4MXVE 3EOAB 2Q76A 3G04B 5FECB 5IHZA 4P9ML 1FO0H 3QHFH 1TZHA 1RUQL 4Y7MA 1INQB 3K3QA 4NWUL 1B2WH 2CUHA 3DX9A 5GS3A 3FB5B 1DBKL 2PCPB 2Z92B 4OCRL 3LEVH 4XNQB 4KHXL 3TBYA 1JNNL 4FN0A 4YDVB 1MCPL 1NC4D 3GGWA 3QIBA 1TLKA 1FVEA 3O6KH 1MFCL 2CUIA 2W38A 3EHBD 3SCMC 4YZFF 3BDYL 3X11B 1HHGA 1T22B 1T1XB 4OT1L 3BEVA 4ODWB 1KN4H 1J0JA 5LBSH 3S96B 4PJIA 4ZSOA 3ELAT 4GXVH 4ZXBC 4O58H 2QR0A 5ITBH 1VACA 5C08E 4F33A 4PRPA 1EUUA 4CMHC 4YHLL 5ENWB 5C0BD 4ODSL 3U36B 5DMGC 3BZEB 3BVNA 3ILPA 1PSKH 4IOFC 1CGXA 2HP4A 2X05A 2Y6SC 1N64H 4UTBL 2ZCHH 3L6FB 1CDGA 5I15L 1T89A 1UJTA 4OFYA 3O11B 4PYHA 5J9PB 4MXWL 5D8JL 2HTLD 2XZCH 1A6UL 1CT8A 4L29A 4JGJA 1U8OB 3KYOA 3REVB 4KRPB 3FQUB 4R3SB 4Q9QH 3L3KB 3RJDA 3V9FA 4G8EB 3GSRB 1E27B 4Q74A 3MRKA 3JV0A 1N59A 4BQ6A 5CEZE 5E9DB 2BXYA 4OZGB 3VFTB 2OZ4L 1S7XA 5C2UB 2DAVA 1ZSDA 2VZ1A 2IADA 2JLLA 4HX1A 4PP1C 4ACPA 1C5DB 3BN9D 3HC0A 4O5LH 3MLXL 4P4KB 1OSZA 4DVBA 1EAPB 4TSCL 1MHHB 3OXRB 1HHKB 3U4BL 3PP3H 4LRNH 2JK5A 5M7QA 2Z31D 3MV8B 1QSEA 4QWWC 3LH2H 1XF5B 3SGEH 4QOKE 4XC1L 4EBQH 3BXNB 1LMKA 1DBAL 3GO1H 1NCDL 1OW0C 2C3WA 3T04D 3MCKA 2J6EH 1UWEL 1ZMYA 3VWKD 4I3SH 1RSFA 4XAKD 4U6YA 4Z9KB 2IAMA 3ZT6A 1QVOA 1AGEB 2SEBB 4F15C 4Y16B 4XWOC 3MREA 2D31A 3MJ9L 5C09A 3SO3C 1NMCB 4C56E 3VI4F 1MWAL 2FSEB 4KQ4L 4JO4H 1TETL 1F8TH 1CU4L 1CQKA 4UDUB 5F6HJ 3L3GA 3BIAX 1T0MA 5ACMA 5IMLB 1NCBH 3TO4C 3F12A 3H3BC 3KXFA 4Y5VB 5DQDL 1WEJL 1WIOA 3N9GH 3B8SA 3QDGE 1JN6B 3T2OA 1I1FB 2IH1A 3OWEA 5ISZB 5TQ0H 4LEXH 1HNFA 4ZSOE 1UKQA 2XNAB 3EFDH 4JCMA 2MTPA 3O3EB 2DWDA 3C8DA 1EDQA 4WUKH 5J11C 5LWYH 3HR6A 2ZPKH 2B5IB 2Y9RT 4P5MB 3HAEA 4M6ML 4XMLH 5JW4N 5BXFA 5AWNL 1YPZE 1DDHA 3LPGA 4OZFA 2EXWC 3UYRL 4UILH 1J1XH 2X09A 4ELKB 4DAGH 4X7SH 3WNNA 5GJSH 2VXQH 5CEXB 4MJ6A 1U95B 2IFFL 4YX2L 1EHNA 3LKOA 4W6YB 4GUPA 1XCTB 3LDBC 1ZLVH 2A73A 4HPYL 1DVFC 4N5UA 3VFVA 2FJFB 2IJ0C 3QEGH 5E4EC 2JF1A 1AQDA 1C16B 4IHOB 1BIIA 3TYFA 1FLTX 2X42A 1VADB 4JDVB 4PJAF 3NCJL 1WFUA 5E8DH 5C0FB 1XIWB 5IB3A 1RIUL 5MI0B 3BW9B 1T1WB 1N7ML 3H3KA 2O5ZL 2WNGA 4M7LT 1S7RB 4RCAA 4HBCH 5C07B 3D69B 1RUMH 3HE7D 3VG9B 1W2KT 3CFBA 3GJFA 3O0RH 1TPXB 3WLWC 1AE6L 2JCCB 2OTUB 1KTDB 4FS0A 5KS9E 5C8JA 5I71B 3L1OH 1RIVH 5JMRA 2I07B 4EUPB 3RDTA 5JW3L 1CLZL 4LASL 4PV9A 1WJ3A 4CJ1A 5ESAB 5KSUB 4E41D 4WI2A 4C83A 5HYJB 5CD3B 4NOBA 3L5JA 2A77L 4JJ5B 2VQ1B 2ESVD 4LSPL 4FQXA 4ZO8A 2MHAB 3IGAB 4RGMB 3VFMB 4ZFOL 2R0ZH 1JI2A 1NFDE 5C09E 5GRZA 2XN9D 5KSVA 2GT9B 3T4AA 3U0PA 1IGIH 3LRHA 4K94L 3G08B 3SPVA 3WE6B 4DN3L 5JQ6L 1YEJL 1IM9D 3JUYA 3DRTA 3CUPB 5HDLA 4ZYKA 4L8DB 2XTJB 4AT6A 4HUUB 1I1AD 5GS2H 1OCWL 2IF7A 3WBDA 1ZV5A 2YOCA 5L8JB 1DSFL 5EUOF 1YEDA 3MJ7A 2HFFB 2AEIT 4QHUB 5ITFB 3VXMD 2Y07H 1ZVYA 3N1PC 5J4MA 3C08H 1RVFL 3BP5B 3MFGB 4NNYB 4NO2A 1I9RH 2HTKD 4Z5RB 5TDNA 1A6VH 2OL3H 2J8UA 3EOBB 4YEEA 1AY1H 5DJCB 3RWJB 2OR9H 4U7SA 1I75A 1HINL 3TPUA 4XBEH 4GRWF 4KMTH 4Y1AB 3GSWB 5IQ7L 4NHCL 4LCWA 3FQNA 3HCVB 1A1NB 4P2CG 3O41B 4LLVA 1QSFD 4Y88A 1CR9L 3KPPA 3WO4B 5EUKB 1MWAB 2J3SA 3ARTA 2DI7A 1FZOB 4HUKB 2H8PA 4P5KA 1KLGB 2YC1A 3M1BB 1Q0YH 2WANA 1G9NH 2X7LB 2FX8H 3DBXA 2JKXA 4K3EL 2A1WL 1WT5C 4S0TD 1IT9L 4YHOH 5DUPH 4HWBL 4MGXA 3NGBB 3CFKA 2LVCA 2VL5A 3BJLA 1OLZA 3K8LA 1J8KA 2UUDK 3CDGA 5IROA 2DTMH 4AEIH 1AC6A 5IFJA 1GRWA 4EUPG 4BUHA 2PYEA 1JZ6A 3Q6GH 1WFNA 3B9KD 2XWJB 5CLWA 2BHUA 3BDXA 4H0GA 1NUDA 4N68A 4PRDB 4DZ8A 2OXGA 5IMMB 3FMGH 4R7NB 5IV2A 3ARGC 1N0XL 4LSUH 1II4E 1UACH 3HNTL 5DDHB 1XGYL 4APQC 1T7XA 4XNXH 1IJ9A 4XI5C 1FYTA 2DQIH 3OR6A 4B7LA 1CTOA 3D0LB 1QYGL 4FFYH 4D9RD 1F42A 4AY0A 5BS0B 3T0EA 4YBLC 4JG1H 4ZMAT 3MRMB 4NNXB 1K4DB 2FWOB 1PLGL 3OAUH 4EDWL 5SX5K 4H88L 2EH8L 4U1GC 1RZ7H 2R2HB 1JWMB 5DVLA 4C4KT 1F45A 3WUWB 3QI9D 5GHWH 3QXAB 4I2XA 1QRND 2BOBA 3G6AA 5C71A 2DQEH 4LGPB 5ACZA 4Z6AT 1VA9A 4CVZA 4XPTH 5B8CC 1RUAH 4PV8A 4QY8A 5TE7H 3RL2B 1NUGA 2IPUK 3SDDD 1KB5H 3TIDA 1YC8A 3BYYA 4PGEA 1I7ZA 2E8ZA 2VN7A 4K3DL 2J8UE 3GIVB 3PQYD 1JVKA 5D7IE 3JTTB 4QHMA 2ZCKL 2HVKB 4DKEL 1K4CB 3FRPG 4P57B 1D7FA 2YR3A 3C09C 4Z0XB 3TPUE 3QWOA 1O5DT 3C60C 4KKAC 1KCUH 2AKRB 4R4FL 3UROR 3EOYG 2L7JA 4TSAH 3VI3E 5D1QD 4LCWE 4NO3A 2X4TB 1MQKH 3C6SA 5IBLD 3QUKA 4ZFOB 1YMMA 2HFEA 1Y6KR 4JY5H 1OQOA 2C3XA 3OTTA 1ZHNA 4PLOB 3BH8A 3GJFK 3PGCB 2OQJA 5F7NC 2I60L 2Q7NA 5L0QB 5JDJA 3IDXH 3QNZB 3T08A 3VFSA 3VXSB 4XCYB 2XACC 2HH0H 2HKFL 4OGZA 3T77B 3FRUB 2GSIA 5I1KH 2Z93B 5C0AB 3F7VB 4X6DA 3MZTA 3NAAL 5BW7C 4XTRC 1ORSB 4Z95H 1I8KA 4NFBA 4PJ5A 4TPRL 1PKQA 2FHBA 3IT8D 2PW2B 4HV8A 4P0DA 1BFSA 1S9WA 1FNSH 3QHFL 1YN6A 2A6KB 5SV4A 1B2WL 3OKDA 3O2VL 4I0PC 2YRLA 5D7KD 1JYNA 3MRNB 1MRDH 3UCRA 1S7QA 2BP3A 4NRYA 1XEDA 3LKNA 3STLB 3O6KL 4PLJD 1ZTXL 1Q9LB 3LEXA 1T5XB 2NY1C 2YA0A 4PRIB 4IJ3B 4YH6A 4YNYA 2G75A 4S1QL 5HDQH 1HKLL 2GSGB 1OAYH 4L1HA 1KN4L 5LBSL 1L7TL 1T66C 4GXVL 1HSAA 3WUWG 5ITBL 1GGCH 4UTAH 4B5EA 3Q0HA 2DS4A 4NQCB 2JB6B 4G7VH 4PGJA 3AS3A 1HIMH 3W0WE 5FAAA 5F9WB 2ZCHL 1OT1A 3BPLC 1PX4A 4K71C 1MH5A 4HHAA 5D70H 4KUCF 5HDOA 4NWTH 3V5DA 4CMMB 4IIQA 5HHNA 1VKXA 5DJZB 4ZUVA 1C08A 4UV7H 3QCUL 1D5BB 4TNWF 4LLWA 4FG6C 1H15B 1DQDL 4XAWH 1JTPA 4UV4H 4FQPA 4EXKA 4GRLC 4E9LA 4NM8H 1DN0A 3IU3A 5FCSH 5E8EB 1I8IB 2ADIB 4MX7B 2CIIB 4O5LL 5T1KD 5DMIH 3HE6B 3VXTA 4J3WA 1QLFB 1Y18B 1JRHI 1YMME 2QSTA 4NQDA 4CNIA 2OTPA 4U3CA 4N8VA 1ZHLA 2P46B 3VXNA 4EBQL 3HRPA 4UMGA 4R0LC 1YEHL 2ATKA 1E6OL 4XVUC 2ITCB 4I3SL 1SVZA 5HVGB 4QRQB 3P9MA 3QP3A 4X6DE 1XZ0A 2NR6D 4WY7L 3MLRL 3LS4H 4DEPC 5L2KE 3P9LB 3MRPA 3T09A 3FT3A 4HT1H 2X4OB 2EC8A 2K7QA 4DWHA 1YNTA 3U1SL 3DIFA 3KPLA 4JO4L 3EJJX 4YDJA 1F8TL 4YHIA 5CP7A 3IDMB 2HT4C 2YPLA 4X8JA 1EERB 1YY8B 2H6PA 4JZOA 4UDTA 2CO7B 1L4IA 1Q0XL 1NANI 3VU2A 1F3DJ 3G5YA 3H0TA 4M43L 4XCNA 2BSSA 5J13C 3N9GL 1KTKE 4K07A 5F9OH 1TZIB 1EXUA 1EGJL 3RJQB 2MNUA 2P8MA 5IWLA 1JPFA 4X9FA 3MSPA 3T0VA 3LN4A 3EFDL 4HMCA 3P4MA 1D5MA 5FYJD 3HPJA 2R15A 3GMPA 4MVBD 5LWYL 2W0KA 4LCYB 3TVMD 3H42H 1UH4A 1MCRA 4XMLL 4RISH 2V7NB 1ORQB 3ULSA 1TCRB 5HVHB 4MB3A 4XXCA 2HT2D 4U33A 1G7LB 3AAZA 5EORL 1P7HL 3D48R 4DAGL 3DV4A 4X7SL 3A67L 4UIKH 5EBMA 1F6AA 3BSZH 4QTIL 1U92A 2WIMA 1G7PB 5IOPB 3QUXA 1CXHA 1VEPA 3OHXA 4JFDA 1FO0B 2E9JA 5HHOE 5E6IC 4JO1H 4PRAA 3DUUB 3SDXF 3SGDH 3VXQA 1U8NA 4PRHB 2LU7A 1VPOH 3L5WB 2A6JB 2YEZA 1MNUH 1MY7A 2X4NA 3D3VD 3ILQD 2VRAA 4LKXB 4PGBA 5E8DL 2ZG3A 4LLMA 2X1PA 5FYLH 4NFDA 1OP5K 3BZ4A 2A2QT 3JWOC 3QO0B 3DVIA 4HBCL 1MJ8H 4LPXA 4HQQL 2QLVB 2XWTA 1RUML 4ONGH 4L4VB 4QRPE 3O0RL 1H3TA 1H3XA 4RGND 3NN8B 4XPBL 4NQSA 1P6AB 1T0NA 4MNGE 1BZQK 5I1AA 4PP2B 3NIFE 3LKSB 4JKLA 4RIRA 3PHQA 1UXSA 3RAJH 1UQSB 2C3VA 3MRBB 3TO2A 2OI9C 3L3OB 4YHKH 5JR1H 3FT2B 4KK9C 2F5BH 1C1EH 2R0ZL 4U1JB 4XMKH 1U8QB 4DW2L 5C0RH 5GGSY 4YK4C 1NLDH 4JRXB 1ZLUK 5CEZD 1DE4A 1IGIL 2P24A 4RRPG 2H3NB 1AKJB 5DVOA 2RAMA 3WFEH 3GZKA 4OGAC 3CFJB 4R2GD 3MYJA 5FO9A 1XCQA 3GMMB 5GZOD 3AMKA 5IEHA 3FCTA 4TOYH 4OFPA 1IGFH 1AIFB 2LU3A 5EULV 3GSQB 3G5XB 3P40A 4NC1C 2AI0L 4Y19E 1K2DA 5CSZB 4OCLC 3CFEB 4W81A 2EEAA 1IMHC 2NLJA 1CD1B 4GG6A 2BNQD 4GBXA 4MD5A 2YMXH 3KPQA 3MNVB 3RWFA 2AERT 4HJJL 2Z0BA 3ARVA 3VGAC 5EOCJ 4DCQB 3CX5J 4GAGH 2ENYA 4W6WB 2ZNWA 5DRNB 5MHSE 4IEFB 4JM2F 3C08L 5SWZB 4J3TA 3TH3T 4HDIA 4AMKH 1IAIM 2W92A 3QUMH 3IU4H 2W0FA 3UTPE 1AY1L 1A7PL 2AJ3B 1UWGH 2NQCA 2OR9L 2RHEA 2VWEE 3U0TB 1F00I 4RMUA 3AFLA 4LPUA 1Q9KB 4XBEL 2VDRH 1HH6A 1DANU 4BH8B 2N7AA 2DKUA 2G9HA 4R26H 3L3JB 5E2TL 3QDJE 5KVGL 1CL7I 1HHHA 4JFDE 1NBZA 4NRXB 5HGDB 2VZOA 2Q86B 2KQMA 5F89B 1Q0YL 1G9NL 2FX8L 4Q2ZB 5JIIA 1ZVSA 4N90D 5HXMA 3C9NA 1XGUB 4MQ7A 4F3FA 4YHOL 5F3HB 4XVSH 5DJDA 4WW2A 3MJ6A 4X98B 4ZPVB 3KLHC 4PJ8C 1QEWA 2VR9A 4PRPD 5MEQB 3EIFA 3OKYA 1ACYL 2X70A 4IRSA 3HG1B 1DL7H 4JRYE 5D1XC 1PAMA 3DOSA 3Q6GL 5T3ZH 3ARWA 1AO7E 4MAYC 4C4KO 4P2OC 3W2DL 2W65B 2NY3C 3VRLF 1TZGH 3FMGL 4KRLB 4OFYD 1BVKA 1VFBA 4J8RB 2GITA 4LSUL 3WMSA 2C1PA 3CLEH 1IAKA 4XNXL 3HHRB 3FT4B 4LOUC 1BOGB 5L8KB 2BDNH 2DQIL 3E3QC 1UCTA 3VH8B 3MLVH 4Y4HC 4L5FL 4HIJA 3BT2H 3CJJA 2ICWB 4H26B 1FNEB 5T1MB 2XA3A 3QDME 1F6FB 4JG1L 1S7VA 2D0FA 2GJZB 3SKMB 5C0DB 4WO4A 2GUOA 2F74B 1JGDB 1RZ7L 3EYOA 4PJ9B 2RJMA 3UAJC 1E4KA 3MRRB 5DK2B 5JOFA 1QSED 4GG6E 2QV2A 3AREA 1OGAA 2NX5E 3CFCH 3E6FA 2ZUUA 3QXVA 4PTUA 1LP9B 3VFRA 2IH3B 4KGLA 3QQ4A 4M62H 2F53E 3V0AC 3C6LA 1RUAL 5TE7L 1YEEH 3ULUL 4I1NB 3QQNA 4L4TE 5E08L 2LV4A 3KPRE 1KELH 1WTGT 2CIKA 4JHBA 2IAMD 3BDBA 4M6NL 3OJ2C 3OKMA 5GZND 3QEQE 3O3BB 1FZJA 4X9BA 1KIRB 3KJ6L 2Z91A 4OD3H 3OX8A 4XT1C 4P2QA 4D0CB 5C09D 4ZPTA 4XBPA 1D6EB 1A4JB 5JHDA 4I8DA 2ADFL 3RWEA 1EEYA 5J8OA 5JHLH 4TSAL 3P11H 5EO1A 3MTRA 2DQDH 4TRPL 3PWPE 4JY5L 3MODH 4O02H 1MJJA 3KXFD 5GS1B 2EE3A 1HHIA 4UBDD 5DMKA 3QG6A 5TDPA 1MJUH 4NCDA 1MFDL 3BIKA 2O5YH 4G9FB 3GSUB 3G6DH 3CVHA 5CIPA 2VC2H 1DLFH 2CDGA 2UZXB 5ADOH 5A16B 5I1KL 3GBML 3V4UH 5EBLB 1JPGB 1XR8A 3GNMH 3RGHA 2EH7L 5DJYB 4GMTL 4KRPC 4Z95L 5A3ID 1YEFL 3DUSA 3C8KA 2VZUA 1IC1A 4Z7VB 1DQQB 3OR7A 5DJXB 3BOVA 1U8MB 1FNSL 3UZQA 3H6JA 5I1LA 1FGVH 1HEZB 2WY3A 4N8CH 2VUOA 2XFXB 4ZOAA 4WUUB 4AM0A 5DQ9A 4P4KC 2R0KL 4PJDB 4YQXH 1I8MB 1UWXH 5KVDH 2OL3B 4GKNB 3SKUD 3MR9B 3VH8G 3GJEB 3RWHA 4KZDH 4PBVC 4WDIA 5AD0B 3SKNB 5F1OB 5HJ3B 3MFFB 5HDQL 1CF8L 3QEHA 4MWFA 1Y6MR 3THML 3RX5A 2ICCA 4X4YB 1UVQB 1L0YA 5C0CE 1JZ7A 3LIZH 4UTAL 1ZE3C 5D2NC 2X9WA 4G7VL 3SDAB 1A6AA 2C4XA 3GI8L 3IB4A 3GB7B 4M5ZH 2VITB 3DVNB 3V6OA 4P2RB 4ZFGL 2NYYD 1NMCC 4B53A 2DM4A 3TV3H 4JB9L 4CKVX 4ZDHA 4NWTL 1HSBA 3BKJL 2HG5A 4UV7L 3RDTD 2CLZA 1DEEA 3CXDL 3VFNA 4JZJA 5D5MF 1RURH 4XAWL 1FN4A 4GQ9H 4Y5VC 4FQXD 5BJTB 4RQQA 1YMHB 5GJTH 3MRCB 1QNZH 5DUMH 1J86A 5HHVH 1PZ5A 4XRCB 4YGVB 6FABH 1ZANH 4CVXA 4DJMA 3FB8B 1QQDB 4U1NA 4X4ME 3OJVC 5DHVA 1JFMA 4I3RH 4F80A 1FPTL 5DVNA 4ESKA 4N5EA 2D9QB 5EZJB 4HWUA 4MDIB 1KTLB 2P5EE 3HC3L 4OV5A 1F4YL 3QUZB 2JJSC 2BNUA 3LKQA 4X7EC 3H3PH 3OKNA 3X12B 1YC7A 3ZTNL 2Q3AA 4UQ3A 3IDYC 5EOTB 4L3CA 4LLYB 5CEYB 4L3EA 4KK6C 1K3ZA 5L2JB 4IRJB 4E5XA 5J7CC 4UAOB 4JY6B 3FFCE 1CLOH 1KULA 2CLRB 3RVTD 5TDOA 5D93B 4KI5D 5IMKB 1ZGLB 3QZWA 1J0IA 1QKZH 3BGMA 1KB5B 3CD4A 5K9JH 4WI6A 4X6CA 5FF6B 3IJSA 4AIZA 4Z77B 3WEXB 5A2IH 4JM4H 2WBJA 5I17B 3T2NL 1Q9WA 1G6VK 2AJUH 4LCWD 5MI0C 4U6VH 1NL0H 2YHGA 4ZUTB 5MENB 3TFKC 3NA9H 4HC1A 3VG9C 3MV7B 3BISA 5FECA 4LVOB 1TPXC 5CZVH 4TTDD 2V9QA 2UZIL 1NDMA 2JJUA 3A6BH 3PHOA 3JWDL 5T5NG 3ZDXE 3FB5A 1CICB 1L9MA 1A6TA 5KW9L 2Z92A 2UVFA 4OCXH 4JN1L 4U7KA 4GSDH 4KKLC 4UT7L 4L8SA 4RISL 3V6OE 4ENED 1KJ2L 1A7NH 1XT5A 4XWOD 2PYED 3QWQB 4PY7B 3X11A 1T22A 1TVDA 4JG0L 1T1XA 3IF1A 5JXEC 1IGJB 4YC2B 1QSVA 4ODWA 3QIWC 3S96A 1AQKH 1T1ZA 1G9ML 4OZIA 3SDCB 1ZGLP 2OCFD 2I9TB 1J1OH 2H32A 1M7XA 2FDBP 2VUYA 4JO1L 4QNPF 4CDHA 5AG9A 3BZEA 5B3JE 3RZCB 4KK5C 2G2RA 1FYTD 4KDTA 4WEUD 1VPOL 12E8L 4OLEA 5CJQL 3LCYA 1P6FA 3KPSB 4J12A 5J9PA 3FTGB 3T0ED 3CAFA 1HQ4B 1JZ8A 3QNYB 4V1DB 1ZWIB 4WNQA 5FYLL 4M1GH 3REVA 3FQUA 4LFHG 3L3KA 1GOFA 1MJ8L 3GSRA 1E27A 2EYTA 3ZT7A 1OGTA 5T3XL 4YXLL 1XF4A 3OAZK 4OZGA 3ZKSD 3RU8H 3EJZD 1QZ1A 4UZGA 1BFVH 3D2UB 4AIXA 4JGMA 1C5DA 1JBJA 4QF1B 5I16B 5C0EB 8FABB 2PR4H 3OXRA 1HHKA 4YHKL 3WNLA 2YSSB 3VD5A 5EIIB 4N0UE 1KCSH 2VDPL 4XMKL 2AGJL 1XF5A 4GW4A 5SX4H 5C0RL 1NDGB 3ZHKA 1P5VA 2VZTA 3BXNA 3E3QE 3OKEB 3B8YA 2WZPD 1QR1A 5GS0D 3MLTA 4ZUWB 1U93A 3KYMB 4OKDA 5DRWB 1NGWA 1OY3B 2DYPD 2UZYB 2E7BA 1BD2E 2JIXD 4OGXH 2YPVH 3O8XC 4PJHE 3RGVB 1QFPA 4Y16A 1YMMD 1VHPA 2YMXL 3CIQA 1LVEA 4AQ1B 4NHUB 4CBPA 5DEGA 3S4SA 3T4YB 4G6KL 4KV5F 1U0QA 2FSEA 4HKZA 1F4AA 2PUQT 4MXQA 3O4LB 2RB8A 1U3JA 5K9KA 4UDUA 1D5XA 1NBVH 2EZ0D 5SWSB 2QL1A 4RFOH 3V6ZB 4Z76A 2DQHH 4PGCA 5JLZA 4AMKL 5DK3A 5DRZB 4PJ5D 4F7EA 4GKSB 1Z3GH 1UWGL 5HGHB 1U8HB 4RWYL 2DL9A 1WFOA 2W9LA 4MXVF 4UT9H 3V0VB 3NVQA 4Y4FB 4X5LA 1I1FA 5ANMB 5JORB 3TJHC 2VDRL 3NH7L 5ISZA 2HWZH 1T7VA 1LEKA 3ARBB 4NZTL 4JANB 4ZUSA 5I9QB 4R26L 5CHNB 5DGRA 1Z9OA 2VISA 1KN2H 4OCMC 2J7LA 4G9DB 2XKSA 1HHJB 2B1HL 4DQOH 2ARJB 3VE0B 3ARDA 3W5MA 2K7PA 1VFAB 4OM1L 4Y4KA 4FXGB 5CEXA 1S7TB 1NCCH 3I6LE 1U95A 4Z7WF 1REIA 3ARQA 5EA0L 4S11A 5FCUH 3RNKB 5T3ZL 3H9HB 3W11C 4GKOA 5E9DE 3TNMA 2AV7B 2FJFA 1GC1H 3LY6A 4LVEA 2ARJQ 3IDNB 1KXVC 5F7DB 1TZGL 2R69L 3Q6FB 4IHOA 1SMOA 2BVPA 1YQVL 4KXZH 2ZUTA 1CE1H 4JDVA 5FHBH 1H5BB 1Y0LA 2DMKA 1NEUA 2VXTH 3ARSA 1L6XA 1XIWA 3MV8E 3X14B 1KFAH 3BW9A 5FHAH 1AHWA 4TSBH 5HHOD 5F7KC 5EBWA 5JUEL 1EBAA 5EU6E 1DQML 4TYUA 2OTUA 4K94C 3U4AA 4MS8C 4HK3J 1KTDA 1JGVH 3T3PE 1XAUA 2VLRB 2I07A 1QPXA 3LRSA 1J0HA 1EPFA 2DIBA 3N06B 1I8LC 5D2NE 3F7PC 3CXHJ 4ZTPL 2GJ6A 5ALBH 5F7EH 4F7TB 5IEKA 2J8OA 2MHAA 1JRHL 2RCSH 3GUTA 4NQDD 3P4LA 3VFMA 5GIRB 4UOW1 2MPAH 4M62L 3CX5K 4Y5YB 1Q1JH 1OTSC 5DQJB 3OGOE 2NW3A 2A0LD 1I3UA 2BNRB 5HI3C 1KELL 5HI5D 4R8WH 1MLCA 4HFUH 5HGGS 4DGVH 2IPTH 3IFPA 2JJVA 4CADB 4L8DA 4OD3L 4XXDB 1DR9A 4IJ3C 3X13B 5KAQG 2DDQH 3QXTA 1ZVHA 3PWUA 4X4ZA 4MZ2A 5CJOL 2V2WB 2FH6A 4CGTA 3SQOL 2BVYA 1MAMH 5K9QI 3MODL 1MCDA 3BP5A 2PO6A 3VXOA 4FFWC 3U7WH 1UA6L 4Z5RA 1CGYA 1FNLA 5F9WC 1G6RH 1MCEA 1MJUL 1KNOB 3WFCH 4E0RA 4LDEB 3FO9A 4GS7B 3G6DL 1S78C 5CFHA 4P9HC 1TTFA 4UUJB 1ACZA 1DLFL 1G7IB 1KCVH 2VC2L 4N1CA 5ADOL 2FCBA 3EYFA 3IKCA 3GNML 1SJEA 1TTGA 1RHHB 2ICES 4PJIF 4HWZB 5MHSD 2QADD 1NAMH 3KPNA 3PE9A 5DHYA 3HCVA 5FV1L 5HVWA 3FQRA 1CIUA 3U6RB 3F6IA 3HA0A 2JJTC 1MWAA 1F02I 2YPKB 4ZS7H 5E8NB 1K8DB 4DKFL 1KLGA 1CK0L 5DI8B 1I85A 3W9EB 3A6CH 2ZOKB 1CWVA 3HE6C 4LARH 4NQUA 3U4EB 4BFEA 4YQXL 4TUOB 2HJKB 3QUMB 3WN5B 5D7JB 2P7TB 3QUXD 3ZKXC 3GSNA 3UDWA 1QFOA 3QDJD 1EZVY 4J4PC 3TCXA 4JFDD 5C07E 5CZKA 4Z7UE 3GMLA 3DMMA 2JCCE 4JVWA 2CXKA 5CGYD 2OJEB 3B2VL 4X9GA 5I1DB 5IESL 3DXAA 2XWJA 3LIZL 2XYCA 1QBBA 4PRDA 1U91A 5EZIH 4R7NA 5HYJE 1A64A 4JHAL 3UTZB 2X2YA 4G8IA 1P2CA 4IIQC 5DDHA 5IHBA 1JWSA 4YIQA 4XTRD 2Y5TB 4PLKC 3TV3L 4GLRI 2F8VA 5DD6B 2P8LA 5KS9F 5BS0A 3BE1L 4RMRA 3K8MA 4DFHA 4JAMB 3MRMA 4NNXA 3VXRE 1K4DA 4I77L 1WAAE 1DP0A 2QQNH 2MQ3A 2XI9A 4GQ9L 4MJIA 3REWB 5GJTL 4PG9A 3Q5TA 3WUWA 2W0PA 1F4WH 1UB5B 1WWBX 2X6MA 5HHVL 4J3SA 1NFDF 6FABL 3BD4A 2J5LC 1ADQH 1EFQA 3RL2A 4N0RA 4CN1A 3WJLA 1FSKB 2WIIB 3TCLB 4QHLA 2BX5A 4FQQA 3GIVA 2ADJB 3IKKA 5FB8A 2CLVB 4GBXD 3VFWB 3JTTA 5IKCA 2DN7A 1FG2B 5CLTA 4CU8A 3HUJB 3GSOB 1F3JB 4N9GB 4P57A 1UFUA 4Z0XA 4R97B 1C7SA 4WI3A 2AKRA 4Y1AE 2IQ9H 5IIEB 4HIHA 2X4TA 5LXGL 4PUBH 3DETD 1N5AA 3MGOB 3U46B 5LJYH 1QKZL 1WCQA 1AGCB 1YEKL 5K9JL 1P1ZA 3BFOA 1U3HA 1WBYB 4AIOA 4JDZB 3U48A 3TESA 4XCYA 3FRUA 3QWRA 4JM4L 2Z93A 1NCNA 5C0AA 3F7VA 3PXJA 1I3RA 2IANB 3E8UL 4XPGH 4U6VL 1M7IB 1ORSA 4EQ3A 2YUXA 1OAUL 5E8PB 2PW2A 3O6LL 5CZVL 2UWEB 2MKLC 1BOYA 5E2JA 2A6KA 1F2XK 4GO6B 35C8H 3OXSB 1MCSA 3KS0J 4OCXL 4JZNB 2FEDD 4GSDL 3RUGB 1XR9B 4LAQL 4I4WA 4HF5H 5FYKU 3STLA 5FUOH 1CDUA 1A7NL 4IRSD 5F9JA 4Q9RH 3LS5L 4O2FB 5IB5B 1RZGB 2Z4QB 4IDJL 1BEYH 5BS0E 3VGHA 4ETYA 4XBGB 1J0KA 4NQCA 1J1OL 1GGBH 5E5UB 3IVKA 4M3JA 4OF6A 3OKOB 1NGQH 4X5XB 1A6PA 2PW1A 1D5IH 3O6FC 3O9WA 2XG4A 3IJYA 4DTGH 4HWBA 4CMMA 5KSAA 3D9AH 5C0CD 1GPOH 4POZC 4M1GL 4WO4D 2CJUH 3HNVH 3NTCH 3MC0A 5CJXA 5HPMB 3VXUE 3ARED 3RU8L 1OB1B 3TZVB 1OGAD 4LHQB 2YD9A 2ZUQB 3HR5A 4KVCH 1F11A 5F7UA 1DCLA 1AD0A 2YN5A 3UJTH 4MX7A 2CIIA 3C6LD 1UM5L 4PJEB 3HI5H 4XP6H 4HFWA 3HN3A 3O2DH 4JFQA 2GTWB 4FNLH 1KCSL 3VMNA 1Y18A 2DM2A 1DBBL 2BMKB 3MGTB 4K2UH 2D9CA 4GH7B 1OTUD 1AFVH 3L7FB 2NPLX 2XKNB 4LVHC 2J8UF 1NGPH 5DC4B 4KK8D 3LRGA 4WCYL 3VXSE 1S5HB 2WMPA 4EI6A 5JHDD 1PEZA 5JXAL 5C0AE 1OTTD 4ETQB 4H1LH 5A2FA 4DZBA 3P9LA 4NN5B 1SY6A 1HNGA 3MROB 2CGRH 3KWWB 1LEGA 5C9JA 3E6HB 1CS6A 1BREA 4QLRA 3O81A 4JGUA 4GG8B 4D3CL 1CN4A 1NBVL 3IDMA 5FGSA 3GHBH 1N8ZB 1YY8A 2DQHL 5I1GH 4ZAKB 2BVOB 3RTQA 4FABL 3H8NA 4KAQH 2I27N 3T0WA 2CDEB 5JO5B 2R0LL 4J3OC 1CIDA 3V6BR 4PRIE 4U6XA 3B9AA 4RFNC 1R24B 2R9HC 2HWZL 2IQAB 5JZ7C 2V2XB 4HH9B 1QACA 1MI5B 4KDVA 5DFTA 1MHPH 5MP6H 4A6YA 1KN2L 4D8PB 3OPZL 4NQCE 7FABL 4LCYA 1QTYT 2OMBA 1LEIA 1FCGA 1FL5B 2IFGA 4LIQL 5GGQH 3BPCB 2V7NA 1ORQA 3SE4A 3MOBL 2HJFA 4OKVA 4CW1A 2FB4H 3Q3GB 3PJSA 32C2B 3MOAH 5J1AB 4M1DH 5C08B 4XWGH 4KH2A 3B5GA 3V8OA 5IOPA 2B8OT 5TE6L 5JMOC 1JIBA 5FCUL 4JQVA 2E5EA 1FO0A 5BRZA 1MCJA 2IWGA 2XOTA 3DUUA 1GSMA 2PETA 1N6QH 1GC1L 4HLJA 2MCPL 4PRHA 2LTQB 2A6IB 3L5WA 3FZUD 1CE1L 3FQWA 3B6SB 5FHBL 1EHLH 4P46B 2VXTL 5KOMC 4NP4L 3BO8B 2V5SA 3LZFH 2BY0A 2IG2H 2QQKL 2EDHA 4TSBL 5GS1C 4OIIL 1YEIH 3GRWH 1ES0A 2VLKB 4F9PA 2NY6C 5JW4Q 3NN8A 3GI9H 4J7RA 3MCG1 5J3HC 3KPMB 1NEZB 1HK6A 4PP2A 5GRVK 3W82A 4B50A 2QEJA 3OB0K 3DYOA 2P5WA 1LO3H 5F7EL 3MRBA 2QSCH 3L3OA 4HJGB 4N5ED 2VLJB 3VGGA 4A2MA 4QXTA 4U1JA 1AR1C 2MPAL 1U8QA 4MCYB 3OKKB 3BP4B 2C7UB 4JKPH 4R96A 1C7TA 1DUYB 2FO4B 3RIFF 3H9ZA 5D1XD 5EU5A 4MNQB 4S0UC 3MBEB 4JHWH 1AKJA 3K1KC 4K7PY 4L3ED 1X5XA 3CFJA 4PJAB 4DGVL 4RDQG 4P5TA 3MA9H 2IPTL 4X6DF 5C0NC 4BZ2L 4OUOA 4KTDL 3GSQA 1QBML 3G5XA 2PTTA 1BM3H 2YK1H 4YBQC 5EUOA 5CSZA 3CFEA 4NBZB 3MNVA 5IJVB 2DDQL 2JJWA 5IBTH 4KUZH 3UTSA 3S34L 4DCQA 3RI5F 4PPTA 3IAGC 2DQTL 3N85H 5HD8D 1MAML 3BUTA 1QUNA 1VGKB 5SWZA 3NFSH 2WBJD 4HZLA 3G5ZA 4AZ8A 5I1CH 3H9SB 2F54B 1G9NC 3B3IA 4LPCA 3QDGB 4HS3A 2J6EA 1E4WL 3U0TA 3TBTB 1KCVL 2UV3A 4YWGH 1BF2A 3VDCA 5L88L 3ECBA 3LQAL 3RPKA 3HMXH 1E4XH 3AUVA 4I18A 1B0RB 5I0ZA 1P53A 3K8KA 4BH8A 5D6DC 3L3JA 4NGHH 2IBBA 3R1GL 1WBZA 3O45B 4NRXA 1YPZB 2Q86A 4ORGA 1NH6A 1P84J 2W60A 3DHMA 2PXYB 3A6CL 3MRGA 4XNUH 4LARL 3CLFH 3BUYA 1A21A 5I2IB 1S9KC 1A7QL 1KCRH 1HZHL 3E0GA 5I73B 4X98A 4ZPVA 3G9VA 3ALXA 3UTQB 3ZKND 5KZCB 3QUZC 2VJXA 4K8RC 4ODHH 1H9VA 1KENH 1NEZG 4JQXC 1Z9SA 4L4VE 3HG1A 2CO6B 5D1ZB 3FJTA 3FB7B 2GAZB 3OGCB 1KOAA 5EZIL 3CXHK 4GRWB 4KY1L 3I6LD 4QRTA 1NBYA 3W39A 3FT4A 4NKMA 3ULUC 2WLZA 3VH8A 4JRXE 5IHUL 1FNEA 4Y5XB 5I19H 2NCMA 5KVMC 4EIGB 3O3AA 4ZTOH 3NIFF 3CVIH 5C0DA 3SKMA 1JGDA 3S3PA 4PJ9A 3KNBB 4F37F 4GKZA 5F96L 3VFGH 2EDJA 3MRRA 5DK2A 3ARFB 1F4WL 3WIHL 5ESVA 4XZUA 3N0PB 3C5ZA 5D6CB 1LP9A 2AK4A 2IH3A 1ITBB 4XX1G 2Z9TA 1LO5B 2NXYB 5C2BL 2EYRB 3QHZL 1W8OA 1T5WA 4NDMA 3JTSA 2N56A 4XHJD 2J12B 1X6NA 2VLME 4HLZG 4KKNA 1AXSB 4I5BB 3O3BA 4Y16D 2KPNA 4NN6B 3MBXH 3LVEA 1KPRA 3AMLA 3S6CA 4D0CA 3V0WH 1ZA3B 3RPIB 4PJ7A 3IXAB 2I5YL 4JREC 4LLDB 1FLRH 3HFMH 1TJHH 4MXQD 1UZ8B 2IQ9L 5IB4B 4X6FA 3SDCC 4PR5B 4AYFA 4WI5A 4HCRH 1WZLA 2B1AH 4M3KB 1RIHH 3UTTB 1GHFH 2Y7QB 5IM7A 2W9DH 2VYRE 2VH5H 4OFIA 4RAVB 4KHTH 4OJFH 3P4NB 1G7HB 5J1TC 5A16A 4LCUB 4NUJB 3TBSA 5C6TL 5ISZD 5IW6A 1JPGA 3QXDB 2IBGA 4XPGL 3ARYA 1F4HA 4NJ9L 5I1JH 1RZJL 4JFPB 5D4QA 2FX7H 2KZ1B 3RBGA 1DQQA 5HVFB 4RGOH 5DJXA 4Q0XL 3HG1E 1FAKT 3BHBA 1CFNB 4LCIH 4L8CB 3RY5A 1SYVA 4UNUA 3ARDD 5LGHH 4I0KA 2YUZA 2C4FU 3PF2A 4Y4KD 1I8MA 3NCYP 1G6RB 2OL3A 4GKNA 5EZOH 4DN4L 1FRGL 2WQRA 1A3LL 3GJEA 1JMXA 1FFOA 3SKNA 3P4OB 3MFFA 1P7QB 1RV6X 1YY9C 4KQ3L 4Q9RL 1QPPA 1SBSH 1EO5A 4H8WH 4K23L 4M8QB 2H2SC 2J4WH 4XP4H 5CS7A 3LEYL 4XPAH 5FYKH 3SE8H 5EU7C 2GW5A 1HE7A 4JPIB 4OB5L 4JR9H 3SDAA 1CXKA 3TEUA 1JHLH 1XIWD 3QFDB 1EH9A 3GB7A 2VITA 3DVNA 4KZEH 3D25B 4P2RA 1V3MA 3JWOH 4PP8C 1LP9E 5HHPA 5C07D 4DTGL 1F2QA 3TC9A 4WU5A 5BO1H 4ZXBB 3AS0A 3D9AL 5D96B 4YXHL 5J06A 4LK4A 4GW5B 1GPOL 1RK0A 4D0DA 2HJLB 4CMHB 4ODTH 2R29L 3CGTA 3HNVL 3QFJB 5TQ2H 5HYJD 2VABB 2GJ6D 5FO8B 4H20H 4EEEA 1T83C 2JELL 3MRCA 4GG6F 4X9IA 3AC0A 3UJTL 3M45A 1BGXH 3VXPB 1FE8L 2HAZA 4F7PA 3ARBC 4PJFA 2K1MA 2HMID 4YFEA 5I9QC 1FG9C 5DD1H 5IFAH 3O2DL 4X6EB 5T33L 4EI5C 1KTRL 2Y1VA 4K2UL 3LMJL 3G6JB 3H9YA 1AFVL 5D7IB 2XTJD 2H9GA 4ZNCD 1BHGA 1NGPL 3X12A 2EIZA 3EW3B 4G9FE 5EOTA 1KEGH 3NZHH 4C54A 1GYAA 5L2JA 4IRJA 1JV5A 3VFOB 4V2CB 1W0VA 2EDRA 1Q72L 3BH9B 5E24E 3HB3C 4BM7A 4ZFZB 5JPNA 3TF7A 3BQUA 2CGRL 5BZDB 2WLYA 2EKSB 2PO6D 4Z7VE 3WIIH 5IMKA 4FQLL 3JWDC 4CAGA 4RNRB 1KJVB 1KB5A 5BQ7B 4WUUE 5KVEH 3GKWL 1A2YB 1UADC 4P3DB 1H5BC 4HK0B 1ZLVK 3MLUH 4PJDE 3WEXA 3NIDE 2P8PB 5I17A 3PNWB 1NC4A 1PVHA 3NPZB 4F15B 1R5IB 4R4BB 4KAQL 4QO1A 2VTFA 3IJHB 3ZKMC 3KHQA 4ZUTA 5MENA 1Q8MA 3SO3B 4Z78B 3MV7A 3HPLB 2FEEL 5CP3H 2EIEA 1G9MC 1QRKA 4AH2A 4YR6B 1JPTL 5CJBA 4PY8I 3SJVA 3MJ8A 1CICA 3OJDA 5MP6L 1JF1A 2D7NA 4FP8L 2UY7A 3TO4B 2WM0A 4WI9A 5GGQL 2WWMC 5JIKA 5DC0A 2VLLA 1TDQA 3QPXH 5J6HB 3CX2A 5HI4D 3DMMD 4EDXB 1HCVA 2N1KA 3TT3L 3I3BA 3VD7A 1OAQH 3ET9F 3DXAD 4RWHA 4XWGL 2GJJA 2CKNA 2FYYA 3QCTL 4HJ0D 4F7MB 5J11B 1QFHA 3WNKA 3SDXA 3W0WB 4NT6B 2I9TA 3N1GC 4Q6YA 3NPSC 4KI1A 3ZKQD 5K9OB 1JZ4A 3SOBH 1N6QL 2BFVH 2VDLH 3DWTA 4OZ4B 5GGUB 4O2CA 1HH9A 2LE9A 2E6JA 4XP1H 3RX7A 1KPVB 5BS0D 1H8SA 3QNYA 4V1DA 1ZWIA 1NAKL 2IG2L 1QFWL 5E0QA 1NQBA 3LDBB 4GAFB 2I26N 1YEIL 5HDBE 3RVWC 3LD8C 1DVFB 5EOQH 4LRIA 2R1WB 3CFDA 3GI9L 3VWKA 5IB2A 3EFFB 3GMNB 3WV0A 3QRGH 5BMFL 4G59A 4L9DA 3D2UA 1JNJA 4OF5A 2BERA 5AZEL 2C9AA 1GGTA 1MQ8A 4CU6A 3QQ9D 2QSCL 4G6FD 2WINA 1KT2A 4TVPH 4XPHH 2Y36H 4R90H 1FDLH 5EIIA 2GTZA 4Z0BL 2BSRA 1OWWA 2AXFB 1I9JH 4EZMA 3F5WB 4JKPL 4AQOA 1FL6B 1FVDB 3ULUE 3OKEA 4NKQB 3W11D 4S1SL 1P7KB 3KYMA 3QBTB 5DRWA 4W4OC 5HGAB 2Q87A 1A5FH 1QR4A 3MA9L 3VJ6A 5D7JC 1K8IA 3RGVA 1BM3L 2YK1L 1KIUA 1RJZA 1OP9A 2ZSVB 3FB6B 2A6DB 2DBLH 3WFHB 1XGRA 1ZLWK 4KUZL 3T4YA 1PZUB 5KSBB 3VMPA 5DZOA 1J10A 4JM2A 5DJ2B 4RZCB 5HBBA 4TNWK 5FA3B 3VXSD