4PJ5A

Structure of human mr1-ac-6-fp in complex with human mait trbv6-1 tcr
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
269
structure length
263
Chain Sequence
b'RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELLYSCHVEHSGVHMVLQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 263
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pj5A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pj5A01
4PJFF 3S6CA 3ARWA 1OSZB 2DQTH 2GYSA 1BZ9B 3FHQA 3MMEB 2JCCE 4FFVD 4M7LT 5CEYB 2LV4A 4HUXA 5DD1H 3RBGA 3BDXA 4OQTA 1I7UA 4ETQB 3THML 1KFAH 3I6KB 2JJWA 2H3NA 1GZPA 2ZCKL 3SGJA 4RIRB 4ALAL 1BPVA 3RJDA 2D7TL 4FTVB 4UB0L 2LTQC 4OF6A 3GSWB 4X6EA 5F9JB 3MRDB 3Q5OA 1VB9A 5ITFA 4L9LC 2I5YL 3NACH 3HLAA 4G6KH 1OGTB 3L3OA 3V0WL 1XCTA 1QYGH 1W2KT 2CXGA 1ZKAA 3HG1E 3QWRD 3TV3H 4L8BA 5IK3A 1HIML 4HX1B 3QFDB 3OX8B 2KL6A 1LO0L 2V7HB 3SE3A 1ACZA 1V05A 1C5BH 2XKUA 1YQVH 4EBQL 2HJKB 3E8UL 3W5NA 3GSRB 4XB7A 1ORSB 3VXRA 5E00A 5FYJE 4ZG1A 3STZA 3H7BA 1CFVL 5FECB 4S1SH 4P4RA 1CTNA 2YUZA 5F7UA 3MNWB 2ICES 1JZ4A 4MNQA 4QXWA 2VDPH 3IXAB 4XCNB 1UM5H 2B4CC 2V17L 5CWSB 1OHQA 5DO2D 1JVKA 4QXGL 4U1IA 4POYA 1AGEB 5B3NA 1AQDB 2LAGB 3SGDH 1QUNA 4WCYL 3HB3C 5F97E 5JR1L 5D72L 5DS8B 4CVUA 1OGAA 3CDGA 3MOBL 1BIHA 4PP1D 1MUJB 3P4LA 5GRWA 4RGOH 3QQ9D 4MHHI 4HJJH 4TUOB 2W38A 1KB9K 5T5FL 5L2KE 3BP4B 4J23A 4PRBB 3TVMD 4JVUA 2UUDH 2RR3A 3OJDA 4HH8A 3UBXB 1NGYB 3BH9A 4M03A 3MRJB 4BKLA 5GGUB 5SWSB 5ISZA 4XPFL 5J56B 3VXPB 3V95A 3PE9A 2R4RH 4LPCA 1U9KA 2AK4E 5L9DL 4WUUA 2F5BH 4KV5E 5J8OA 3UTSD 2KZWA 4W6XB 5JORA 1ZLUH 1M71A 1RD6A 4MCYA 1ZVHA 2VN7A 4M4PA 4ZPVB 3RZWA 3CSPA 4OF8A 2R2EB 5CJXA 4MNQE 4RAHA 2Z92A 1YEDB 5CAYB 1A9BA 5EBGA 3GHBH 1PLGL 3GGWA 3RWDA 1TJHH 5IGXH 1MRFL 4MXVE 2XZAL 4YHIB 2HN7B 3VXTB 3V0AC 1JHKL 1DLFL 3TPUE 1MFAL 2C3XA 4PRPD 3W82A 5FUCC 2CKBL 4YHPA 1RI8A 4MVBD 3SE4C 1IC7H 5IHUH 3DX7A 3N50A 3TNMA 3DUHA 1CBVL 1IAKA 1HEZB 4APQC 2G9HA 2H2SC 4XCYA 4MZ2A 5I75B 4IS6A 5ERWA 1NBZB 2VLRE 4I3SH 2EYRB 1EDQA 4R26L 1N2RB 4QHLB 4L8DA 5ACZB 5ISZE 4NFDA 4WI9A 4ELMF 2NYYD 2E7HA 3HPJA 1JNJA 4KC3B 4RMRA 3P9LA 4PRNB 1QHPA 3WDJA 4NKDA 2CLZB 3INUL 4WFEE 3C2SA 3GMRB 5EZJB 4E0RB 3FO9B 2CLVA 3WS6C 3MJ9L 5DQJB 3QQ3A 3IDNB 4LEOB 2I9LA 2VDMH 4Q6YA 1BGXH 1DQJB 2VNCA 4GAYB 1F11A 4OD3H 1MFEL 2HG5A 3RWEB 4FNLH 1UVQB 2BFVL 2ESVD 4GRLA 3BX7C 4KY1L 3HNTH 3D3VB 3ARDD 2QR0B 4GXUN 4JHWH 3TA3D 1X5JA 5GS1C 12E8H 2DIAA 3T3MF 4AZ8A 4PTTB 4F2MB 1MI5E 3B83A 6CGTA 5ICYA 4UI2A 2W9DL 5E7BA 4U6VH 3TBWA 1QSFE 4NWTH 1FE8L 5HHVL 4N0FB 3IRPX 1UB5A 5DSCA 1QBLL 1MPAL 5JLZA 3ARGB 3ZKXB 4FZ8L 2AGJH 3FN3A 2X4PB 2AV1A 3B9KD 4HGWB 5H37G 2DB8A 5C0RH 2OI9A 3U7WH 3U79A 1BD2D 3N85H 4HPOH 3CFKB 4JFYA 1LE5A 5D1QA 4RFNB 3WS3A 3RIAK 1FIEA 3QA3A 1CT8A 5LCVH 4GUPA 3WV0A 2YKLL 1SVZA 1A3QA 2H26B 1FYTA 1NGQL 1OSPL 5C7XL 1NDGB 2MHAB 1ZEAL 2R2CA 3WFDL 2A6DA 5I15H 5BRZA 3Q3GA 1VFOA 4RMQA 3V6BR 3HE7D 2ICWI 2D7MA 3MXWL 3PQYA 3QUXC 4NJAL 3TLRA 3IFLH 1NGWB 4N0RA 1J0KA 2NW3B 4P9ML 2HJFA 2XQYK 2X1XR 1QPXA 1T0NB 3MROB 1KLUA 6FABH 1A9EB 1SBBA 2ARJA 1NSNL 2AAVA 4HS8H 3VRIA 4NQED 1LILA 3UTTD 3WLWD 3QEUA 3PL6A 4YXLH 3NCBB 2VABB 5D7KD 3RU8H 2ARJQ 3MNZB 3VXNA 4QYOA 1HH6B 5F96L 1FZJB 2DBLL 3UJJH 5E9DD 4LIQE 4GKNA 4N5ED 2RGSA 1C7SA 4Q9BA 5CJOH 1JFQL 1YEIH 5J6HB 3V6OA 1D6VH 4DEPC 1ZHKB 4NOBA 3UYOD 4QHMB 1PG7X 4XC1L 3CXHK 4MXQD 5DEZA 4XP1L 4M1DH 2NX5A 2BSSB 4OKVB 3C9NA 2FX9H 15C8H 3Q1SL 5FO9B 3D39B 4X7DC 1GCFA 1DE4A 3CVIL 3GRWA 4I9WD 4GRWB 1R0AH 1CDYA 1DBML 2LQRA 1E4KC 3QI9D 2WQ8A 4X5LA 1A47A 2W07A 1T22A 1T1ZB 5AAWA 1GC1H 1EGJA 2P8MB 3UMTA 3V4PL 1PYWB 1XGYH 4YBQC 2YR3A 4KJYB 1F45A 4P2QD 4MA8L 4JJHA 4O2CB 2A74B 4QGYA 4PJAA 4RISH 4Y5YB 4KKAD 1FFNB 3NCMA 1CXHA 3MFGB 4KKNA 1MJ7L 4WU5B 3O3BB 1B4RA 1KCGC 1H15A 3IKCA 2YBRA 1BBDH 3TZVB 2Y07L 3W9EA 5IVXA 2ZPKL 4CBPA 5IMLA 1NL0L 5EN2A 1DVFA 3V6OE 5IW3A 1FAIH 1SBSH 1Z6JT 2ZCLL 1VGEH 4J3TA 2W9LA 3FT4A 1I1RA 3RX7A 1T1YA 4UQ2B 1D5ZB 1DP0A 3O8XD 2ICEA 1OM3L 1ODAA 1FZMA 1JGUL 4PJBE 3OZ9H 1JNLH 4AG4H 4NNXA 1NCWH 3QIBD 3V5HB 2COQA 4X6CE 5GS2D 5F3BB 3NCFB 2FEDD 1T2JA 4IOIB 3HPLA 4G42B 1SYVA 5AWNH 2R0KL 1AE6L 3VMPA 1LQVA 5T3XE 5BXFA 3T0EE 4AT6A 1AD0B 5E8EA 5INCA 1N6VA 2X4TA 2DJSA 3WXVL 5DLML 3AUVA 4NCC1 1IL1B 4PJ9D 1Q72H 1DL7L 4I18B 1J0IA 3EGSA 2CR3A 1CG9A 3MNVA 4J8RB 3QPQD 4ISVA 3BDYH 1C1EH 2IH3A 2VSDA 5DFVD 1KCVH 1U3HA 1BOGA 4H0IA 1JN6B 4BZ2H 3O4LD 1VACA 4MJ5B 4X6FB 5JQ6H 3BMVA 4QRRB 2Y06H 3KPMB 3WJJC 3BKML 4EEEA 2AEWA 3BPCA 2ICWJ 4JG1H 4TRPL 4L5FL 4PG9A 4C83A 3ZL4L 5IHLB 3K46A 4ZODA 2R2HA 5DJCB 5DJZA 2ADGA 1TCRB 3NIDE 4HZLB 2HFGL 5DJ2A 3H7LA 1C5CH 5KSUB 2W0PA 5HBBA 3UYRH 1CLOH 3H3PL 5D7JB 2EEBA 4TN9A 1P6AB 4MDIA 4NO0A 1U93A 5IMOA 3MCG1 2AXJA 2EDRA 3QHFH 1CXFA 3G9VA 2F8OA 1RIHH 5D6CB 4WO4A 5D7LB 2VRAA 3TH4T 3IAPA 3LAFA 1C7TA 1JF1B 2JJSA 5IWLC 1BHGA 1NEZG 3S35L 3MCLL 4UOW1 5BS0A 5IFJA 1YYML 1WV7T 4FA8A 3C6LC 2IPKB 3I84A 3U0PB 1OVZA 4ENED 3RA7H 4HGKC 2PTUA 2GAZA 4HS6B 4KUZH 4JZJB 1Q9OA 1FYHB 3X14B 2HVKA 3ORJA 2FO1A 1NJ9B 3WFEL 3KYAA 2FECI 2BSED 4Y16A 1KPVB 2APVA 4P2RE 1FGVH 5D7SH 3FCTB 3FTGB 3JV6B 2AJYH 3VFTB 3DVFA 1S8DA 2BSRA 2AEPH 5KS9F 3OAUL 4HXAH 3DMMD 1GOHA 4G8EB 1UG9A 4S0TD 5GS2H 3VD9A 2DQCL 2OTUA 4JZNA 3RKDC 3WNPA 2K1MA 1A6AA 2B5IC 4X9FA 4D9LH 1ZVYA 2MNUA 5FO8B 1JWUA 3UAJD 4RWYL 1OTTC 3QZWB 3KXFA 1YN7A 2ED9A 1RURH 3KLAB 1R3HA 3LEYH 3GSUB 2FYYB 5DHXB 5CSZB 4G5ZH 4LAJH 1ZHBB 1P4BH 4UTBH 4B5EA 4NUGH 1EAJA 4TQEL 3QJHA 5FGBC 4WVRA 4XX1G 5EO1A 2PO6A 4FQCH 3LH2H 1P7QD 3ILPB 1U3YA 3P30H 4XCFL 2N56A 4BUHA 3BWAA 1T5XB 3LSOA 5IFHL 1LEGB 1QFHA 4OCYL 2XA3A 4LSUL 3ARUA 1BQHA 4OM0H 2VXSH 3P2TA 1U36A 3QFJA 4KKLD 2DTMH 3JXAA 4P4KA 5E2UL 3ZYJA 2GY5A 3O6FD 5JW3L 3RUGA 3W2DL 3HAEG 3PV7A 1M05B 4MNGE 3VH8B 2RIKA 3BUYA 2ITCA 3VMNA 4X6BB 4H25A 2FECL 5EZIH 1KJ3H 5DR5L 4WFHE 2HFFB 1A0QH 2BHYA 5DWUL 1ZT4A 3E3QC 4KTEH 2DKUA 4CMMA 3HMWL 4BSVB 3FHAA 1AGFB 3V79C 3HI5H 1DBAH 1FVCA 3FOMA 4M93C 1E4WL 1ZTXL 4ZYKA 3QQ4A 4ZFOB 2CIKB 5C08D 3B9KC 3TESA 1A64A 5AD0B 3EOAB 1BMGA 1IC1A 5I1GL 1QBMH 5CCKH 3JTSA 4HKJA 2YXFA 1IFHH 1YJDH 3FB5A 2O5YH 3TYFA 1AO7D 3CLEH 4QRPD 3EOYG 3TJEL 2FGWL 1K8DA 1UJ3C 4G80A 3VWKB 2HRPH 1NC2A 4G43B 1DN0B 4J1UB 3L95B 4NKQB 3MA9H 4RAVB 1NDMB 1BOYA 1XZ0B 3HE7C 4KAQL 3RWIB 3T8XA 4TVPE 4R4BB 3QFJE 1C8PA 2VLKD 4EN3B 5HHOA 5FYLD 3CFJB 3RUGE 3BW9A 5FUOH 1UWXH 2EKJA 5EH1A 5I1AB 4XHJD 4U1GC 1I9JL 1HNFA 1CFTB 5DC4B 2Y4SA 3MBEA 2GSGB 4MJIB 4BFIB 5C09D 2G5RA 1V3MA 4JVWA 4FQIH 3TIEA 3ZE2E 1JI2A 4S1QH 4DCQA 2C7UB 3L5XL 4U3HA 5AG8A 1QSEB 4GBXD 2AW2A 3WFCH 2JB5H 4X7CC 2EH7L 3TGXA 4E42B 1NKOA 3BPNB 1S7XB 1EUUA 4MXQC 1PG7W 5HGGS 5TQ0L 4P23D 3MRFA 1MCHA 2P5EB 3VFSB 1BZ7A 4DZ8A 2MOVA 2AJXH 1A6TB 3F12B 5I16A 5M95B 1L0QA 2SEBB 1JZ7A 3QI9C 4GAGH 1SY6A 1Q0XL 3TBSA 1LO2H 2PW1A 3HRPA 2HVJA 5DK0B 4AM0A 4GH7B 1OAXH 1IEAB 3CVHA 5HJ3A 1F6AB 3MGAA 4PGEA 3FMGH 5CSBA 3UTOA 3VCLA 1KTDB 3AU1A 3OKLA 2R1YB 3PG2A 4WV1A 1HHHA 3HR5A 2FLBT 4PTUB 4UOJA 4P9HH 1MHCA 3DBXA 1CFSA 5HVHB 4OCWL 4XPAH 4DGVL 3SDDA 2BXYA 5FXCH 3DV6A 4HK3N 3GBNL 1V7NL 4MQXD 4IRSA 4QTIL 5CZVH 1A7OL 1T0MB 4GQ9L 4YDVA 4JY4B 4LDLB 3O2DA 4MMZC 1IT9H 4LOUD 4UV4H 5GISL 1IM9D 5HGHB 3HI6H 2X1PA 1J1XL 1I3GH 5TPWL 4HWEH 5EUKA 1MEXL 2OJEB 4GSDL 4PV9B 4QHNA 5FYLH 1QTYT 1RUAH 3AS3A 4XMKH 5F72S 5CGYC 4PJ9C 3WBDA 1A1MB 5J12B 3GMOA 4ONHB 1N0XL 3EHBD 5BO1L 1HKLL 4Y19A 3WHXB 5CJBA 2XICA 4DKFH 5GGQL 4MD5A 1IRAY 5I1KH 4LMQI 5DFVC 3CH1A 3I75B 4MSWB 1BQLL 1L7TH 4HF5H 5IVZB 4GFTB 4KQ3H 4JKWA 5JMRA 1Q9LA 3Q6FA 4YDIL 3FL7A 1WIUA 3UO1L 5EORL 2XT1B 4I3RL 4YDJA 1KG0B 1U8JA 4KJQD 4Y89A 2V5MA 4PREB 3ZYIA 4UT7L 5LQBH 2DWDA 1JTPA 2A1WH 4OGYL 1JPFA 5GSRA 4YWGH 1A3LH 4JHAL 3O81A 2APXA 5D1XB 2IANE 1TXKA 4RQQB 1R3KB 4G8GA 1OWRM 5ICZA 3PWVB 2NXYD 4ZTOL 3B9DA 3VFUB 1MREL 5GIRB 3PWPD 2JJTC 4GS7B 4HWBA 2BMKA 2J88H 3ZTNL 3EFDL 3F58H 4X4ZA 5GS0C 4Y19E 3U2SB 3TO2A 2ICWB 2F54D 5JPMB 1MHEA 3NPSC 5E1AA 2A9MH 1U8HB 4Y8DC 5LVEA 4ENEC 3SOBL 5I73B 4LCUB 4KQ4H 2ZG2A 3U0WH 1VKXA 3VXQB 3SKMA 5FF6B 1U8QA 2X6MA 1FNHA 1CE1H 3VFGH 1MCJA 1UKSA 5HDBE 3BJLA 3IU3A 1TVHB 4ZUWB 3RGVD 2I26N 1BBJA 1T03L 4X8JB 4PJHF 5GGRY 4RGMB 5IEHA 1NANI 1ITBB 5EU3A 2NY5C 3T1FB 3H9HA 4FQHA 1FAKT 1PD6A 2QSQA 3VXUA 5J13C 5CP7B 1PKOA 1CD9B 1ES0B 2HT2C 2B8OT 3LDBC 3IDGB 3KPSA 5I6XC 5HPOA 1YEJH 4KDTA 4G8GE 3PABB 1ORQB 4LCWD 1H5BC 1RJYA 2ZJSH 5E99L 1K4CA 4LEXH 1XF2B 5GRXG 2XXMB 2F9BT 2Q1EA 4LSPH 4FFZH 1S9VA 4JM4H 4H8WC 2VKWA 2GSIB 3B2UD 1HSAA 4NHUA 3ZKMD 4D94A 1FVEA 4O02L 2FR4A 4BH7B 5DHYB 1U58A 1VFAA 1T1XB 4OT1H 2EYTB 2ZOLA 4NCC2 1YY8B 1LD9B 1UM6H 2XPGB 5E8PA 1MCPH 3T04D 1OAKL 2HLAA 3RTQD 2ORBL 4EXKA 4I0PA 5B8CA 2OK0L 3O2VH 1S7VA 5F9DC 4Y5VB 4MD4B 8FABA 3O6FC 5CHNA 1N3NB 5I18L 1PZ5A 4F7CA 3DSFH 4EI5A 2JK5A 4C56A 4KVNL 3PGCB 2VXTH 4TOYL 4U0QB 2ZG3A 3GJFK 1AR2A 3TN0D 1TZHB 4NQVB 3KPNA 1CVSC 3TFKD 2B1AL 4U1SA 3VXUE 1CICA 4ZXBA 3HZVB 4CAGA 2P24A 4ZS6D 5J1AB 2Z31C 4KGLA 4U0RB 3QXTA 4YDKH 5JHDA 3VWJC 5IBUG 4OLVL 4R97C 1FNEB 1FPTL 1TMCB 2VAAB 1ZHNA 1NMAH 2IAMA 3FQTA 5E8DH 4WTWA 3RDTD 5A2KH 1LEIB 2EE3A 2X44D 2X7LB 4BQBA 4GLRH 4S2SB 5C0CA 1JP5A 1IJ9A 4NHUE 5HXMA 2XZZA 5FYJD 4Z95L 4YHKH 3SCMA 3ULVL 3L6FA 2GK2A 3SKJL 1A21A 3T0XA 1XR8A 4PPTA 1WZMA 1MCLA 2J5LB 4UBDD 5EC2B 1BVLA 4XPGL 3QCTH 3I3DA 2WW8A 4DN4L 1TZIB 2VDLL 1G9NL 2W92A 5IBTH 3UX9B 5DYOA 2JELL 2P8LA 5CEZE 4XI5D 2V7NB 1G7MA 1ZA3A 4FP8H 2VIRA 5IIEB 4WEBH 5TF0A 4OF5A 1RIVH 2Z9TA 5DJDA 1HXMA 3R0NA 4JN1L 2HFEB 1NCDL 4QRSB 3RL1A 1G7IA 5LWYL 2BHUA 1CIUA 3GSNA 3FT3B 4R3SB 3GJEB 2GT9B 4OV5B 1IILE 3MV7A 5KSBF 4CN1A 4OLXL 3LKSB 1WWWX 4GAJH 4UILH 4XP5L 4Y2OA 1OCWL 5M7QA 1VFBA 3MJ8A 3P4OB 4PJ8C 3RNKA 1MCIA 3O6ML 4FMKA 2AERT 5CFHA 4PB0L 2QADD 2WLZA 5IW6A 3KR3H 3MGOB 1X6NA 3LKQB 2ESVB 4HJGB 4HG4J 5EPMB 4FS0A 3U0TA 3VFVA 4LKXB 3T3PF 2CLRB 3BH8A 3VFRB 3ARDB 1DFBH 5ANMA 5C0CE 3OXRA 3AXLA 5ICXB 5DZOA 3VXRD 4IDJH 2BNUB 3W0WE 3HN3A 4JQIL 4ZUSB 5JXEA 3QUYA 3GKWL 4OUOA 3HAEH 3RX5A 3U30B 1ZK9A 5JPNA 4LSSH 1B2WL 1A1OA 1VERA 4OZGF 3S36H 3VRLF 3V8OA 4LLYA 4X6DB 4M3KB 4MNQD 5SWZA 2IMNA 4X7SL 4X99B 5CJ8A 5IJVB 2XTJB 5K9KA 4WI3A 1NUFA 1RJCA 4JLRA 5T3ZE 1PQZB 4Q6IB 4PB9H 2VC2H 3NFPB 4XPBH 3LRGA 2OZ4L 3QDHA 3KAAA 4AIZA 3PJSA 4I77L 5LXGH 1BD2B 2YRLA 5I76A 4PS4L 5EU4B 1T5WA 1MQKL 3EDJA 3O45A 1LO5A 4NNYA 5DDHA 4JFDA 4RX4A 5B39A 1J1OH 4NO3B 3WKMH 4PJXE 3L1OH 4NDMB 4CVXB 1LK3L 2B0SL 1UEYA 1DEEA 1NGXA 5CD3B 4M6OL 1RHFA 2ZUQB 4Q7DA 5DMIH 2NY2D 5FYJH 4HKXB 1AHWA 1E6OL 3JV4A 5BW7C 5ISZD 5ANME 1I1AC 4DVRH 3MJ7A 2DIJA 2GI7A 4OCNC 1S7QB 4O5LH 3CCHB 4Y4HC 5I9QB 4JAMA 2FEEI 3O3EA 4WUUD 5CUSH 2DM7A 2PYFB 5JQHC 1INQA 4OQTH 4PRAA 5E9DB 1G7PA 1FC1A 25C8H 2IH1B 3OKEB 1AJ7L 1HWGB 2FATL 1J8HB 3Q5TA 4ZFGH 5D71H 5BMFL 4PUBH 5L6YH 3TIDB 3EHBC 2YUXA 1I8LC 4MJ6A 1NCAL 4MXWH 5DT1H 5KVGL 1A4JB 5ESAA 1MCWW 4F7PA 1RZFH 3TF7A 5TH2A 1DLHB 1I7TB 5C0DB 5IR1B 4JFDE 1S9WA 1LO3L 5B38A 3B6SA 5IF0A 2YD6A 4RDQG 3MZTA 4G9FA 4MJ4A 5E6IA 2F74B 1QOKA 1RMFH 4PJIF 1VEPA 3IFPA 4ODVH 5KN5B 4P2QB 2YPKB 3QO0A 3RIFF 4Q0XL 4XBPA 3AFLA 3LZFH 4XNQA 2AEIT 4YXKL 1JNNL 1MFBH 3MRCA 3CZJA 1MY7A 5F44A 1OP3K 3BZFB 4W4OA 5K9OB 3IDJA 4HLZG 4OM1L 1XF5B 3TM6A 1OSZA 1BZ9A 3MMEA 3GUTA 1N64L 2NXYC 3MLUL 4PGDB 1IKNC 4ETQA 3PHQA 3EDKA 4YHML 4RIRA 1X7QB 4FTVA 3DPBA 3W81A 1Q9WB 2B20A 3RY6A 4XRCB 2P7TA 3GSWA 3CC5B 3O8XB 3MRDA 4GRLD 1YEFL 3KYKH 1U8OB 4PD4J 2NR6D 1ZXQA 3AMKA 4NYLB 5HYSA 3MLVH 3QIBB 3WFZA 3PV6B 2DS4A 2WSKA 4NPYB 2YD4A 1SHMA 4MDJA 4KPHL 3QFDA 2NY6B 1BREA 3F65A 1KACB 3OX8A 1P4IL 2RFXB 2HT4C 2B4CL 3O41B 3T4AB 4G6JH 2HJKA 2N7BA 4X4XB 3GSRA 1ZT7A 4P2OA 1ORSA 1R5IB 5GGVY 1F42A 3QP3A 4YHOH 1JPSL 5EU6E 5D1QD 5I1DB 1CU4H 3IFNH 1KPRA 1OF2A 5BZWA 2AV7B 3VG9C 4GG6A 3MNWA 1RUML 2VZOA 4LVEA 4OFVA 3IXAA 4XCNA 3CDFA 3TH2T 1YPZA 5CWSA 4JPWH 1CDUA 5JXAH 1FRGH 2X1OA 5GRUH 4N0YL 4TULL 4M6NL 3B2UC 4N8VG 1KN4L 3GMLA 3PQYD 1RIUH 3G04B 5KANG 5KG9B 1JHTA 3AMLA 3EYOA 1BFSA 1ZHLB 1LMKA 4ZD3L 5HHXL 2R56H 2J4WL 1BVZA 2HWZL 1MUJA 5KTEH 4OZIB 1XAUA 5GGVL 2BZDA 5D1ZC 4UDTB 1WZ1H 4HFUL 2YK1H 4HIHB 3H9SE 1NGYA 5HI3C 1X4YA 3MRJA 5GGUA 3QG6B 2DWEB 4B7IA 5I1CL 1TIUA 2BY2A 3VXPA 4V1DA 4U1MA 2AJUH 3D2UD 4ZAKC 3L3JB 4F80A 2NX5D 1S78C 3UJIL 2D03L 4ZS6C 3LD8C 5M94B 2MCG1 1BJMA 4GG6E 4ZPVA 1KGCE 3O9WB 5HHPB 1JNHB 3F7QA 1YEDA 3WIIH 2YS4A 1AI1L 1YPZE 4I4WA 4QO1A 1AFVH 1UC6A 3RDTC 5BOZG 1KEML 4YHIA 5A16B 2HN7A 3MFFB 2WZPD 3AM8C 3KLDA 4XMPL 3DECA 4N8CH 3DMMB 4XP4L 4PRDB 4ZTPL 4A2MA 3QNZB 5DQDH 3EOBB 2FO4B 3EO9L 3ZDZF 4NC1E 1JPGB 1JWSB 3G08B 4AJ0A 4CMHC 1NCUA 3H9YA 1NAKH 1VCAA 1HEZA 2CDGB 3I6LD 4UBDC 2W0FB 3J8F7 1S7SB 2P49B 4LIQH 1R3LB 2D0HA 1RFDH 2HP4A 3PUCA 1NBZA 4EXPX 2EYRA 3AY4A 2XWJB 2B1HH 4XI5C 3TT3L 1DVFD 1SJXA 5DD6B 3DURB 4GXVH 1N6UA 4O58L 2A83A 5E7FA 4ZOBA 3EYSL 3SDCB 1LO4H 4V1DE 3WLBB 3LS4H 5E8NB 3CX2A 3FKUS 4PRNA 4LLQA 4M5ZL 2APWA 2HKHH 2CLZA 4N1CA 5D9SB 1P7QB 5FKPB 1EEYA 3FO9A 4I2XB 5I1HH 3QG7H 4TUJA 3BO8B 2YZ1A 4C57C 4LEOA 1IGFH 1DQJA 3MC0A 2IMMA 4L4TE 3ILQD 3RWEA 5DD1L 1UVQA 4IJ3B 3SE3C 1G6RL 1KFAL 4KK6D 1X4XA 3D3VA 2VDNH 4P49A 3WKNA 5IUSA 1WC7B 1Q0YL 2QR0A 5GGRB 4XPTH 1C12A 4PTTA 2FIRT 3NACL 1I9IH 3TBYB 5MENB 4K94C 3GIZH 1U3HD 32C2A 1QYGL 3MRNB 3TV3L 3ARGA 4KVCH 4OI8A 4YIQA 2OX5A 3QPXH 1R6VA 1DQQA 4NZJA 3RIAF 2X4PA 4HGWA 1CGVA 2DLEA 1J1PH 5C6WH 1F8TH 3DSNA 3VGBA 3CFKA 1SYSB 3GRWH 3AB0B 1AO7B 1Z9MA 1YZZA 4D8PB 1U8IB 5C8JA 2H6PB 1A6WH 2H26A 4WW2B 3UPCA 4QKXB 4S1SL 2MHAA 1KBGH 5T3XH 3VXSB 5TF1H 4FZEL 4NO0D 3OB8A 5KVDH 3CLFH 3L7FA 2NY2C 2VLKB 2VDPL 3RJQB 5TE6H 1SM3L 2YXMA 4WO4D 1UM5L 4NKMB 4K7PX 1T0NA 2EYSB 2DIBA 3MROA 4AIXA 1A9EA 4NHCH 5F1OB 2VWEC 3QIUC 4Z7VA 5C09B 2FX8L 5BS0D 4F33B 2VABA 4LPYA 3MNZA 4PRIE 3UZEA 3EZ8A 1HH6A 1MIML 5CJXC 5C0ND 4GBXB 2D9CA 1CF8L 4ETYA 4F58H 4HJJL 3IU4H 3P73B 2YA1A 1I8MA 4QHMA 5IJKA 4TUKL 4Y16D 1MCBA 1IGJA 3QEGH 4NBZB 2D3VA 1JYNA 2ATKB 1C08A 4OKVA 1A8JH 2XZQH 2XKNB 3R4DA 1G7HB 4N9OB 3MBXH 1RZGA 4F15C 3DETC 1UZ6F 4PJ7B 5EFIA 2F5BL 3B3IB 1GGIL 3ETBF 4L3EB 1WFUA 5BJTB 2DDQH 4HD9A 2DQUH 4OCXH 3K81A 4Z7QF 4UT9H 4NQXA 3VMOA 3KXFD 5F9WC 3VGHA 2EO9A 4R4NC 3Q5YA 4PJCF 4KJYA 4XVJH 4AH2B 4WIQA 3ZT5A 4O2CA 2A74A 2GK0B 2Z91A 4XVTL 5JIHA 1U41A 1DQTA 2WIMA 1FFNA 4R96B 1C16B 1J5OH 4Z7VE 4WU5A 3O3BA 5C07A 2R23A 5C2UB 5IB1A 3ALXA 1MNUL 5E5MB 1MCRA 1VHPA 3I3BA 3TZVA 1IC7L 3EYQD 4MQ7B 4TSAH 3NA4A 4PJAF 4TVPD 3F5WA 4I3SL 2XRAH 3QFJD 4GRLC 5EULV 4PLOB 3CD4A 4OIBA 3ULUF 2Y9RT 3WHE0 5IMKB 3NIFF 4B53A 5IVXF 2P44B 4YHZH 1BIIA 3V5HA 1IM9B 3S88H 1TETH 4P3DB 4IRZH 4JRYA 4K7FB 1L4IA 2BVPB 3HFMH 4QNPF 4JO1H 1EH9A 4L4VE 3DVNA 3OJVC 1NLBH 3VRJB 2DL2A 3U4BH 4PJGB 5DJYB 4WWKC 4CUCA 4UINL 2VDML 3FRPG 4E41B 2R0ZL 4M61B 2VQ1B 3FB8B 4I18A 2OI9C 4GMTH 3FQWA 3OKNB 3LKPB 4YO0B 4M4RA 5F1NB 5D1QC 4FABL 3HNTL 4U1JB 4J8RA 1CE6A 2ZKHL 1KCRL 1EHLH 5C07E 4JHWL 4QF1B 1KPUB 4M7ZB 1VENA 4XNXH 4WUKH 3H0TB 3MRIB 4XBGB 1JN6A 5L88H 2PW2B 1NC2D 4HCRA 4QXUH 4U6VL 5AZEH 3L7EB 4NWTL 5I66B 3AROA 7FABL 4QRRA 1S9XB 3BKCH 3KPMA 4FQJH 4HBCL 5HHOD 1U8LB 2VH5H 2NXZD 4MB3A 2O5ZH 4LHJB 1DUYA 2AGJL 3WMSA 4S0SD 1W0WB 4OZHA 1U8NB 2VITA 5DFTA 5E2WH 5DJCA 1XGQB 2LU4A 2ZUTA 3STLA 1TCRA 4L8SC 2I25N 3PL6C 5D4QA 4HPOL 5EA0H 1U8KB 3MBED 5GGTL 5KSUA 3T0AA 4U2ZA 3KYOA 3IGAA 3QCUH 4JRYE 5D5MB 2UVFA 5C70A 3WL9A 2AABH 5LCVL 1RAMA 3MLSL 1N6QH 3C6SB 3JUYA 3G5ZB 2ZZUT 1BFTA 3JWOC 4K7PY 4LLVB 5D7LA 5I15L 3WDHA 5DJ0B 3WCYA 4F7TB 2OXHA 4NOFA 1ZWIB 2F19L 2F54B 4WFGD 2A6KB 4L9LB 2FDBP 3IFLL 2OQJB 4KRPD 3QUZB 3QDAA 4PJEB 1QNZH 3KJ6H 1NCNA 1CFBA 3U0PA 1M7DB 3IJYB 5TGBB 5C0BA 4JZJA 2D4FA 5TE7H 4JY5L 4TVPH 4YXLL 1BFVH 1EK3A 3RGVB 2APFA 3UJJL 1OP9A 3RVWD 3TYGH 3QJFB 1ND0B 5CJOL 1C5DB 2IC2A 3RZCC 4D3CH 1D6VL 3P3YA 1QLFB 4Y5XA 1A5FL 4J3VA 4IMKA 4OZHE 1CDBA 1HKFA 2CDFB 1RSFA 1HQRB 3EJYD 1RUKL 2IBBA 3U9PH 5CINH 3ULUC 2FX9L 15C8L 5FO8A 3EYVB 1JBJA 1HOCA 3QZWA 1R0AL 3BVNB 4HUWB 4LVNB 5E08H 2VZUA 3ROOB 4LCWB 1DVFC 3SDDD 1O7SA 5GRVK 5HI4D 1NBVH 2FYYA 3GSUA 4XNZB 5CSZA 4OIIH 4NQDE 2CK2A 3QDJB 4IRSD 1KCKA 4M9OA 3VGGA 1IGTB 5IHZB 3BN9D 5K93A 1F3JA 2AXHA 2G75B 1CD1B 5C0EA 4JB9L 3ILPA 5C0IB 5LKNA 4RISL 3OPZH 3N1FC 4O9HH 1T5XA 1ZA6B 3RTQB 4Z0BH 1LEGA 3CXDH 2LVEA 1QVOB 3ARFA 5C0BE 2JCCB 3HAEB 3ILQC 3KNBB 4U6XA 1YEGH 5FYKE 5L2JB 1UM4H 2H2PC 1BBDL 4JKLA 3DIFB 4KK6C 1RZJH 3VH8A 1FAIL 1M05A 1SBSL 3MODH 3NABH 3QO1B 3TN0B 2YD9A 3GIVB 5H94A 4Y19D 5EWIL 4DWHA 2HFFA 3K2UH 4JO3L 4P2YA 1VPOL 3D0VB 3MGTA 4ODUA 2FBJH 3WN5C 4AG4L 1JNLL 3DLQR 2XTLA 1NCWL 3F7YB 3DX9A 1ZGLM 2VDOH 3HG1B 4ZFOA 5C0GB 3V6ZB 4C4KT 1G7QB 5AWNL 2BC4B 5C3TA 4AEFA 5AD0A 5K9QG 4ORZC 3EOAA 5BV7H 2Z8VC 1P6FA 3GO1H 1F58H 4XXDA 3VFWB 3VI3E 1S3KL 3L9RB 1FGNH 5DI8B 1Q72L 1Z9SA 3NZ8A 4FN0A 4L3AA 1AGBA 4LSTH 3ZKQD 5CGMA 4G43A 1QR1B 3ARPA 5DK2B 5DJ6B 4J1UA 3L95A 1N5YL 4JGMA 4RAVA 1NDMA 3CVHH 4KHXL 5MEQA 1XZ0A 2DLGA 1F4WH 1C1EL 2LFGA 3RWIA 4G8GD 1GSMA 1KCVL 4YAQB 5MEOA 4R4BA 2BOBB 4BZ2L 2XG4A 4WHYG 4EN3A 4O2FB 2UWEA 4JZOB 3CFJA 3CU7A 2FJHB 3D0LA 5JQ6L 4ZUTB 4LSRH 2Y06L 5I1AA 4X6EB 1CFTA 5T1KA 1GH7A 3DARA 2HT3D 1IKFH 2C7UA 3UYRL 5L2KB 5LGJB 2QADB 3L3KB 1RZIB 1TDQA 4L8BB 1S7XA 4Y16C 5MHSE 2D2OA 2ADJA 3PWLA 3BUTA 2QSTA 3W39B 4ZNEE 1Y0LB 3O2DH 1WEJH 2VLJE 1A6TA 3VXRB 1OWWA 3F12A 5E00B 4XC3H 3R1GH 4X7TA 3H7BB 2AK4B 1GRWA 1WVZA 2YSSB 2SEBA 5L7XH 2C3HA 3VXUD 3CK0L 3NA9H 1Z3GH 5DK0A 5KANI 2DQDL 3FQRB 5IKCB 3EO0B 5CD5D 3KPSD 1IEAA 1Z5LB 1D5IH 4X83A 4MNQB 3RA7L 2UZYB 4KUZL 1F6AA 2UWEE 1ERNA 5D96C 1KTDA 4LCIH 4Q74A 2R1YA 4U1IB 2PO6C 3TPUB 1KT2B 2BDNL 2AEPL 1VFMA 4NQCE 2Q6WA 1U42A 3WNMA 5JDSA 4G7VL 3S8WA 1UFUA 3ARVA 4I0PD 1N8ZB 1RVFH 3K8MA 3HZMB 3P4NA 2VISB 4D9LL 2VUOA 2VLRB 1ACYH 4OF7A 4P4KC 1QD0A 1V3LA 4BYHA 1AD9A 1GOFA 1WGOA 1A7NH 4DW2H 2PNDA 1T0MA 3PIQB 3LEYL 1IQDB 4BKLB 4C56D 4EI5D 5ISZB 4JY4A 3RWJB 4G5ZL 1WCBA 4UTBL 4NUGL 3NCEB 5DJ8A 5F3HB 5EOCL 5HGHA 4FQCL 4ZXBD 3VXMA 2WIIA 2OJEA 4WJ5B 4UIKH 3O0RH 5TFSH 4WENB 5JHDD 3O3UN 1HQ4A 4HWBH 4EUPG 1A9BB 4LSVH 1FN4B 3GGWB 1EVTC 4ONHA 2VXSL 3DGCR 3S97C 2IAMD 2FX7H 2DTML 4TTDD 1KC5H 3WHXA 3I3EA 2JJVA 4V3DB 4Y0GA 1WISA 4YZFF 1UH2A 5C0CD 1HINL 3ARZA 1HCFX 4LGRB 4MSWA 3W0WD 3NFNB 2R1XB 3HRZB 5EZIL 1MI5B 3X3FH 1IAKB 1A0QL 1ED3A 1KNOB 2G9HB 1QSFB 4KTEL 3VGAC 4IS6B 2NY7H 2J8UA 3AREC 3QNYB 5ERWB 1BQSA 3RVUD 4BELD 4DN3L 3HI5L 1DBAL 2ADFH 1KG0A 2XY2A 2IPTH 2LABA 5T3ZD 3MV8A 3ZKND 5JOFB 4PREA 2ILLA 5HD8C 2DJ4A 1B9ZA 1QBML 3HPJB 5GS0L 3DXAE 3MBEC 5DJXB 5CCKL 2ZUXA 2QSVA 5GGSB 4NKDB 1IFHL 1SJEA 5D1XA 1RK1B 3MLXH 3MV7D 3CLEL 1R3KA 2CLVB 3D69A 3VXME 3F7VB 2D9QB 3QQ3B 3T2PA 3O2WH 4AENB 2HRPL 4MYWB 4G7YH 5FM5M 3VFUA 5GIRA 3REWB 1YQ2A 4KJPD 2UUDK 1EAPA 4MQSB 5FFLA 3U2SA 4V2CB 2ICWA 5JPMA 1NPUA 3MO1A 1AGDB 4U3CA 5EOCJ 4JFOB 3U36A 5FUOL 5D2LA 4RGND 1U8HA 4XWOD 3SDAB 5I8KH 4HWZA 4LCUA 1ZOXA 4K2UH 4HQQH 2Q86B 3VXQA 1NFIB 3QUYD 3AVEA 4L3CB 1WFTA 2J6EL 4P2CG 4FQIL 1I3UA 3TBWB 1PGRB 4HBQA 4KRLB 4S1QL 2J8UE 4Z7UA 5ALBH 2YD8A 1CDCA 4YQXH 4ODHH 4X8JA 5SWZD 5T5NF 3SJVA 1UB5B 2Q8AH 2JB5L 3WFCL 5DSCB 5JLZB 3BKJH 3RBSA 3MV8E 1UA6H 2AJSL 3BQUC 4JQXC 3MQIA 3MUY1 4X4YB 4H8WL 1S5IL 3ZHDA 1GL4B 2XQYG 4JFYB 3MLYH 2R9HD 2QKIA 5DD3H 3WS3B 3RY4A 1NBYA 1K4DB 1P69B 5SX5H 4JFDD 4LCYA 4RX4D 1UGNA 5KSVB 1I9RH 4DK3A 3SDDC 3PABA 1ORQA 1X6LA 3SQOH 3WO3B 1FORH 5CJQH 4U7KA 5HI4C 35C8H 2CMRH 2A6DB 3IRZA 4FG6C 3GSQB 5DVLA 3Q3GB 1OP5H 3GSVB 2GSIA 4LQFH 2ZCHH 3FMGL 2HJFB 3LRHA 3EJZD 1T1XA 2JB6A 2EYTA 2WV3A 5D2LE 3T2NL 3ZE1F 1LD9A 2XPGA 5FYJU 2EXYD 3IXTB 1II4E 4P9HL 4UUJB 1BFOB 2G60H 2IGFL 3VXNB 4QYOB 1W0YT 4OGXH 1SEBB 5D8JL 4GKNB 4MD4A 4Z7UE 5T3ZH 1N3NA 4CADB 4XPAL 1U95A 5MI0C 3SJVE 3DO7A 3PGCA 3GSOA 1LP9E 1XIWA 1B6UA 2IJ0C 4UU9A 4C55A 3D2UB 1U3ZA 2C5DC 2PUQT 3C9NB 3N06B 4PJBB 1UCTA 2OJZH 2WANA 1K2DA 1IT9L 4JGJA 4X6CB 1LWRA 1CQYA 4J4PA 3HI6L 1I3GL 3V4VH 1UKTA 4N90D 1FNEA 4G9FD 1TMCA 5E6ID 3ZDYF 4XHQA 5FYLL 1FL6A 3T0EB 1LEIA 3A6OA 1RUAL 2X7LA 2HMID 1G9MC 4XMKL 3P11H 4KROB 1HHJB 4ZNCD 4WI6A 1A1NA 3K8LA 2XZCH 5I30H 4JFFE 2Y6SD 4DKFL 5EU6D 2QTEA 3LPGA 4XTRD 5BVPH 1YC8A 3TT1H 3OKKA 4YBHA 4DUVA 1L7TL 4HF5L 2YBRB 1TZIA 3W9EB 4JFEA 2XWTA 4Z7WE 4KQ3L 4YDLC 1FNGB 2V7NA 4J3XA 3QNXB 4PY7A 5IIEA 4FTVD 1MJUH 3JZ7A 1MCEA 3FT4B 4X5XB 4Z77A 3UTQA 4JN2A 1T1YB 4XAKE 1AQKH 2ICEB 4O2EB 1QZ1A 4CGTA 4XNYH 3FT3A 4R3SA 3GJEA 1MCKA 2HT3C 4XNUH 1U2CA 5LQBL 3V6FB 4F8TA 3LKSA 2A1WL 1FIGH 2DQGH 4MAYA 1WAAA 3OAYH 4R4FL 3TJHC 5D70H 2X5PA 3HPLB 5HYFA 3AS0A 3ESVF 4FQ1H 4M7KH 3BD5A 2W60B 3MGOA 3NH7H 4HJGA 2ESVA 1UJTA 4DVBB 4NZRL 4EIGB 2BX5A 2CLRA 3VFRA 5L8KB 3ARDA 1FFPA 3BE1H 1Q9KB 3M8OH 2P5WE 2J88L 1NFDE 4HZAA 3FO0H 4P2OD 1KYOJ 3F58L 5I0DA 1F3DH 1KCUH 1DN2A 4LPXA 1CG9B 5E2TH 2P45B 5CD5C 4ISVB 4LLWB 2IH3B 3RVXD 3K80A 1KGCD 1T2QL 2P42B 1U3HB 4YGAB 1X5ZA 4Z9KB 4KQ4L 3U0WL 3FJTA 4JFEE 4Z7OE 5IJVA 1EHNA 3VFGL 1PQZA 4Q6IA 5F7MC 1BF8A 2NY3C 4EDWL 4P2RB 1KOAA 4MA1C 1JYVA 3BPCB 1BD2A 5AUMB 2LAAA 3KPRE 1QFWH 5EU4A 1NGZA 5GZOD 5DVKA 1P7HL 4C83B 2R4SH 4PBXA 4XMLL 1D9KB 2ADGB 4BH8B 3WO4B 5DJ2B 4FXGA 5C0JB 3U6RB 5B8CC 2PR4H 3G6DH 3BT2H 4NDMA 3U1SH 3N1MC 3WIHA 43C9B 4CVXA 5CS7A 4WWID 3VD4A 4NO0B 4IIQC 4LPUA 1U93B 2ENSA 5CD3A 2ZSWA 3RWCA 2DL9A 4PJDE 5EBWA 4R2GD 4K9EH 4HKXA 1RULL 4LEXL 5C92A 3ZSSA 4PV8B 4V1DD 5HGAA 1IMHC 4LSPL 3HE6B 2X70B 4FFZL 3CCHA 4JM4L 5L8LB 1CICC 2OCFD 4OT1L 1UM6L 1MCPL 2IH1A 5SX4H 3T0WA 2R2BB 1J8HA 3B43A 4LAQH 2HVKB 3G6JA 5LG1A 1UACH 2IAMC 4L4TD 1KIUA 5CSGA 3FONB 1OARH 2VLLA 4MNGB 1A4JA 3K1KC 5GRJL 1DLHA 3ES6A 1I7TA 5D2NE 3SCMC 5HDQL 3LQAC 1RZ8B 3WEXB 2N4IA 1KELH 4JZNB 4Z0XA 1NMCC 2XN9E 4RBPH 5IT2H 1A6AB 4JFZL 4YXHH 4QTHA 4X98A 1JWUB 2HTKC 2VSCA 1MHHA 1R3HB 3ZHKA 4P2QA 2YPKA 5J9PB 1NMAL 4G9DB 3TWCH 4HPYH 3VFMA 2E7LE 5FM5O 1TENA 1TQCB 4PIRF 1WWCA 2FIKA 3BZFA 1FCCA 1ROWA 1YMHA 1XF5A 3DUSA 5E4EB 3JTCA 4YHKL 1JWMA 5IB2B 3I2CH 1BQHB 3NIGE 4HV8B 3G6JE 1Q9WA 3QFJB 1X5GA 1CTOA 1CXLA 3CC5A 5EIQA 5IBTL 3C60C 3RUGB 1QLEL 3D3VD 1KULA 2BP3A 5E5UB 4RGNC 4FP8L 3OG4B 1RIVL 1U8OA 2GTZA 3M17A 5K9QI 2VDRH 5JXEC 3MOAH 4MA3B 4JJ5A 4JM2C 5F7EH 1IGIL 4NPYA 1FO0A 2WWMC 4ZO8A 3FOMB 3PGFL 4ZYKB 3QQ4B 2RFXA 4JRXE 3ARGD 3T4AA 4WI7A 3ARTA 3SO3C 2HFTA 4MJ2A 4X4XA 3MRBB 3KR3L 2BNQA 1OT2A 1ADQH 5K9JH 4XP9L 2R9HC 1L6XA 4BK4A 4HKJB 2EDLA 1M7IA 2X4OB 5GRZA 1DFBL 5I1DA 3TO4D 5D2NC 1RY7B 4OGZA 2AV7A 3LMJH 2B7DT 1K8DB 1MF2H 1IAIL 1NC2B 3BAEL 5JTWA 2CUIA 3LPFA 4EDXB 4N8VB 2HAZA 5DF0A 2EO1A 1R5VA 2BXZA 5A2IH 2DQIH 3S36L 3QEQA 4LP5A 1MLCB 3T8XB 2VLME 1U8MA 2ERJC 3KPOB 4BQ6A 5ABDE 2DJUA 2NXZB 2RAMA 5KG9A 1OTSC 4HUUA 1YY9D 3BW9B 1MRDH 4XPBL 4B50A 3C8HA 2EXYC 2QL1A 4PRHE 3WD5H 2Z8SA 4ZPTA 1Q1JH 4OZIA 5CILH 3TIEB 4FFYH 1W0VA 1WBXB 3CH8A 5IFAL 4UDTA 4KRNA 3FFDA 5JZ7C 3WKML 4GW4A 5LAXA 2DWEA 3CFCH 5DRNB 5C9KA 1EXUB 1M6OB 2DM3A 4JDTH 4OLWH 1CN4A 2BNQE 3MRFB 3L3JA 5DMIL 5BV7B 1W72H 4KRPB 5FYJL 1AR1C 1IQWH 2CPCA 5EZOH 4DVRL 4QOKE 5D7IA 4D0CB 3RNQA 4W4NA 3O9WA 2XIDA 1JV5A 5I8OL 5CUSL 3HUJE 5HHPA 1JNHA 4P59H 5E6IC 4ERSH 4AM0B 4GG8B 5B3JE 3OHXB 2J7LA 3QEQE 2GJ6E 1H9VA 4OQTL 1JHLH 25C8L 4YFLF 5A16A 4R7NA 5D71L 3MFFA 4PUBL 5L6YL 2AI0L 3WFBH 4PRDA 1EHAA 4H20H 4PGBA 3OKLB 1K6QL 4A6YA 4WV1B 1HHHB 1UCBH 5GJTL 1YMMA 1JPGA 1JWSA 4HIXH 4W4OC 3HC3H 4WI8A 3LRSB 4LRIA 2W1NA 1XGRB 3T08A 1S7SA 5C07D 1MHCB 3DBXB 3HS0B 4NM8L 1SJVA 2F8XC 3TZVD 3X12B 3GBML 4Y88A 2OR7A 3SGEH 5DD6A 4XCEB 4IRSB 5DRXB 3SDCA 4DJMA 1RMFL 4PP8C 4UQ3A 1E6JH 5E8NA 5CMAA 1S7RB 4YDVB 5D9SA 1FNSH 3GKZA 1UWXK 3LZFL 3K4ZA 1X5FA 4JREB 5D7IE 3BO8A 3RVVC 1OD7A 4X9IA 3VI4E 2Q8BL 4WNQA 2IANB 2P4AB 2X1WL 3PWNA 4JRYD 4KJWD 2YUWA 2IBGA 1A6VH 4QHNB 1L8JA 5C6TL 4K94L 3SDXE 3LN5A 1U8PA 3KVQA 5EDXA 3GI9H 5CZXD 3BZEB 3QUMA 4YEFA 4K3DL 3FFCE 5GGRA 1IBGL 4Y19B 2K7PA 1B6DA 4L29A 1YMME 1Z9OA 3KYKL 4X7FC 3OKOA 5ESVB 4LMQE 3MR9B 2W0KA 5MENA 3MLVL 2CK0H 1JGVH 3LEVL 3MRNA 1KTLA 1R3IL 5GHWH 3ALWA 4MS8C 1F4YH 4Q97A 1YNKH 4AQOA 3DROB 3GK8H 4QRRD 3LVEA 4PG2C 4YDJB 2X4SB 1U8JB 5HHME 4DKAA 5GZOC 1SYSA 2ZNWA 1XGTB 1I7RB 2FJGB 4IRJD 2DWDB 1JPFB 1KCSH 2H6PA 5ESQA 4WW2A 3OF6A 4YHOL 3QDME 2CIIB 4XB8A 3WJLA 1CU4L 1QHOA 1XF4A 3IFNL 3VXSA 4G8GB 5ICZB 3EDEA 1UQSB 1I75A 3MACL 3U4AA 2OS7A 4NQDD 4NKMA 3FZUC 4JPWL 2EYSA 4AEHH 1FRGL 3MRMB 3QHZH 4X7EC 2E7CA 3Q2CA 1I1CA 4G6AD 3TO2B 1E4XI 3RVTD 5DMJB 5F71A 3CFDA 2R56L 1UB6B 4RMSA 5I1LB 4JPKH 1VKXB 4GBXA 5KTEL 4X4MA 5C0BD 3O4OB 1GXEA 3RHWK 1U8QB 3P73A 3IU3B 3SGEI 2ADIB 5FYKD 2P8PA 1OQXA 1BBJB 3IDXH 2YK1L 3KWWB 3NN8B 3ULVF 1QPPA 2ATKA 2PTTA 1VADB 3D9AL 1GPOH 2XKNA 4LSQL 2F5AH 3QYCA 1HWHB 1RZ7H 2AJUL 3RY5A 4NBXB 4XP6H 3VXUB 5A2LH 3B3IA 3V5DB 5IQ7H 4L3EA 2IBZX 1Y6MR 2HH0H 5I75C 3ESUF 3QUKA 2JIXB 5FKAA 4JFQB 1RJYB 2EECA 3LIZH 3WIIL 4AH2A 4GRWF 1AFVL 2M2DA 3C8DA 1S9VB 4WTXA 2PYEA 5ILTH 4NHUB 4PFEA 1U58B 4N8CL 2ZOLB 4NZTL 3C5ZD 5E8PB 2X05A 2HLAB 5DQDL 4HCRH 3P0YH 3ARSA 1E4XL 1NAKL 4X4ME 4MQ7A 3ARFD 3TBTB 3Q6GL 4LIQL 4H0HB 1HILB 1S7VB 1RFDL 1H3PH 4L1HA 4GW5A 3BOVA 4OCSL 5E2JA 3K7UA 4F7CB 4EI5B 1J86A 1I1AB 3CZFA 4GXVL 4HDIA 2NY0D 2EE2A 4R90H 4MNHA 4Y4HB 3KPNB 3KGRA 1CDHA 3DV4B 4M8QB 1IM9A 1U91B 4P3DA 4U1SB 3IDYB 2HKHL 4S1RH 4UV7H 5D6DA 3FQNB 4ZXBB 1FL5A 4ODWA 5EU7C 5I1HL 3QG7L 1TNMA 3DI2B 5JIKA 1CL7H 3VRJA 3ARGC 4PJGA 3NCJL 3ZKXC 1NAMA 4E41A 5FHBH 4M61A 2VQ1A 2VXVH 4I13B 3HCVB 4Q9CA 3FQTB 4GW1A 3FB8A 5MHSD 3OKNA 3LKPA 4YO0A 5F1NA 2PYEE 3N9GH 4RFNC 1GYAA 1O0VA 5C0CB 1PDKA 2A77L 1S7WA 3W0WB 4QF1A 1KPUA 3EZJB 2PF6A 5JMOC 3NCCB 3THMH 3H0TA 3MRIA 3L6FB 4UIMB 2PW2A 3UTZB 3WNOA 4ALAH 2JKXA 5FB8B 5FYKH 1IGML 1XR8B 4P0DA 4OF3A 3L7EA 1IEHA 1S9XA 1O7VA 1KXVC 2YN5A 2I5YH 2Y5TB 4EN3D 3JWOL 5DYOB 4LLAA 5IM7A 4KVCL 1ZVSB 4H1LG 1W0WA 3ZDXE 1U8NA 1XH3A 2H8PB 3V0WH 1XGQA 3RL1B 3I9GH 1G7IB 4U6TA 3ULVC 5T1KD 1U8KA 4K8RC 3GRWL 1HIMH 2E6PA 4JKPL 2KQMA 3WUWG 2YRZA 3C6SA 2PETA 4PJXB 5GXBB 4IDLA 4EBQH 3RNKB 1NEUA 1KBGL 1NEZA 3QCVL 1HHKB 1PVHA 5IW6B 2ED8A 4LVHB 1EGJL 5DJ0A 4F7TA 1S9KC 4K07A 1J0HA 5KVDL 1ZWIA 2F54A 3K3QA 4L9LA 1DBJL 3VFVB 4BA8A 2VQTA 5TE6L 5ANMB 1I3RA 2CR6A 3AXLB 1Z9LA 3LB6D 3D85A 3QUZA 4J6RH 4MAUH 4PJEA 1M7DA 3IJYA 2DBJA 3QUYB 2E9JA 3S37X 5JPNB 1A1OB 1J12A 3LKOB 4LLYB 1IARB 2NZIA 2IQAB 1AC0A 3NAAL 3QJFA 5EUOE 1ND0A 5JUEL 3CXHJ 1C5DA 5K9KB 1KJMA 4JLRB 4F58L 5JR1H 2YMXL 5D72H 1QLFA 3MOBH 1V7ML 3T2QA 2C26A 1JF5A 4QWWC 3PJSB 4Y5YC 4N9GB 3KJ4B 2CDFA 3QEGL 5I76B 1HQRA 1T66D 3IJHB 5T5FH 4AYFA 2IBZY 1T5WB 2XZQL 4NNYB 2VAJA 2OR8A 3MBXL 4JFDB 4CDGC 1LNUB 3BVNA 4HUWA 3WE6A 2EDOA 2GTWA 3ROOA 5I1EH 4LCWA 5I1JH 3WXWL 4XPFH 1RUPL 2DQUL 1V8HA 4PGCA 1GJIA 1NGXB 4UT9L 3QDJA 3HMXA 5IHZA 2G75A 4ODXB 5IW1A 1CD1A 4QLRA 4HIEA 1AHWB 2K7QA 1AY1L 4K23H 1TCMA 5C0IA 2NY1B 3EFFB 1JGEB 1MWAA 3EIFA 4NC0B 1ZA6A 4JAMB 2EDFA 1GIGL 4P46D 5E8OA 5F7DA 3N1PC 1QVOA 1J5OL 3L3IA 3VXMD 5E2VL 4XVSH 3HAEA 3KNBA 1A14H 1INQB 1BLNA 1G7PB 1I1YB 4UDUA 2KUTA 1VEMA 5CZXC 3DIFA 1DLFH 3BKYH 1FC2D 1MFAH 4TSAL 5T1DH 2CKBH 1NGPL 2KPNA 4I18C 1WFNA 3QO1A 3GIVA 4GO6B 2XRAL 1QACA 5ADPH 2DOCA 4KK9C 1D3CA 1HYSD 4FOMA 4F7PB 1TJIL 4JRWA 2PCPA 5TH2B 4AEIL 2AXGB 1FJ1A 3O3AB 4YHZL 4XNMA 2AQ2A 5B38B 3B6SB 3S88L 3HG1A 3K74B 4IRZL 5C0GA 3V6ZA 4PJFA 3HFML 3K4DA 2IG2L 1QFUL 4XX1E 2BC4A 5J1SC 1F2QA 3INUH 3U4BL 3VDBA 1UXWB 2XYCA 3MV8D 2E6QA 3L9RA 1DSFH 4XBPB 5DI8A 5A40E 5JW4R 4XNQB 1EJOH 3X3GH 1UYWH 5J6GB 3SE4A 2VXUL 2EDEA 3AGVA 5D7JC 5EU6B 2AVGA 1FP5A 5DK2A 1XGPB 3IDJB 5D1XD 1DQDL 3GUTB 5HTSA 1TPXB 4WUKL 4YAQA 2BOBA 4O2FA 3C09B 1KJVB 3PHQB 4JZOA 4QXUL 1OW0C 3JTTB 4OIAA 2FJHA 5AZEL 1BP3B 5BCAA 5HGBB 4ZUTA 4LLDB 4G6AC 2P7TB 3RVTC 4FQJL 2MCPH 2W9DH 2VH5L 5C71A 3GHEH 1I1FA 5HHVH 1XGUB 5HYSB 1QBLH 1MPAH 4JZJC 4K71B 5L2KA 3I02A 5LGJA 3AC0A 4NQUA 4TYUA 3L3KA 1RZIA 4MDJB 4PJFE 3BPOC 2AABL 1UXSB 3GM0A 1N6QL 5H2BB 2RCSL 3H9SB 3SJVD 4JY6A 1RK0B 3EAKA 4LASH 3D6GA 3T65A 1Y0LA 3W39A 1PKQA 2Q20A 2XNAB 2P48B 5AZ2L 1ZT7B 2XWBA 4P2OB 5FUCE 1T6VN 5GS1A 1MJ8L 3GBLA 2AK4A 3MRPB 2YSSA 5JOPE 1QSVA 2FH8A 2R0LL 2J8HA 1KPRB 1OF2B 5BZWB 3FQRA 3QDGE 5IKCA 1FHGA 3EO0A 4GG6B 1T21B 1Z5LA 4YHYB 2OP4L 2PXYB 3EYFA 4P9MH 2VDKH 2O61B 4NFBA 1G6RA 2Z35B 5TE7L 1YPZB 4TVPL 4N0CC 1BFVL 3W11D 4U1KB 1NSNH 3OAZK 3DUUB 1XF3B 3TYGL 2NNAB 3WYRA 3GMLB 3TPUA 1KT2A 4D3CL 3BZ4B 1JHTB 3EYOB 1G7LA 4O00A 4M62H 2BCKB 1NUNB 5DMGD 1JFQH 3MJGX 5TDOB 5ECJE 4KKCD 2L7UA 5FGSA 1N8ZA 4ODBD 3HZMA 4OD2A 5CINL 3U9PL 2VISA 1G84A 4KK8D 4EQ3A 4XC1H 5D93B 4NN6B 2VLRA 1DTUA 3S37L 2C1OB 4YPJA 1GGUA 4R2GB 3PIQA 1IQDA 3CVIH 3UBXG 1NBVL 1PKQE 4NT6A 5E6ZA 3RWJA 4PGZA 1XIWD 4V1DB 4U1MB 1DBMH 4XAKD 1RZKC 5F3HA 2A38A 2R0WL 1I7ZB 4AMKH 1B4JL 3K8KA 1OPGL 4WJ5A 4J3UA 1CI5A 1L7IL 3OPZL 3V4PH 1GOGA 4Z0BL 4J4PD 4KI5D 3CXDL 3CSGA 1FN4A 4RFEB 2DLIA 4I4WB 4L4TB 1YEGL 1MCDA 1UM4L 3I85A 1RZJL 3REVB 3L5HA 1I8IB 3BP7B 3L3GB 4FFWC 3DGGB 1GGCH 3FB6B 3STBA 1ZLVH 5HY9B 2NZ9C 3GI8L 2ZPKH 3NFNA 3DX8B 3VWKC 2R1XA 5F9OL 1P5VA 2NY4B 1NL0H 3HRZA 1EA9C 1MI5A 4U1LB 2WK2A 1KNOA 2YWZA 4KZDL 1QSFA 1F4HA 2Y7QB 5DZLA 3ECBB 3F62A 3QNYA 5TE4L 4EN3C 4JFED 2VDOL 1DQML 5HI5D 4Q9RH 1G6VK 5JOFA 4KK5D 2A83B 3IAGC 5J4MA 2F53A 2C3WA 3KLHC 3ZYZA 3GO1L 5DJXA 1H3XA 3GM8A 4LLQB 5GGSA 2R0KH 3FB7B 4L9DA 1RK1A 2AQ1A 1EEYB 1BZQK 1W72B 3F7VA 3NTCL 3UC0H 4TUJB 4LSTL 1DANU 1SY6L 2ITDB 4MAYD 1P2CB 4AENA 1F5WA 3BPNC 3CVHL 5SV4A 3REWA 1F4WL 3Q48A 3LV3B 4TNVK 4WY7H 5A2FA 2C4FT 3G9AB 5HYQB 4X8XA 1AGDA 5J1TC 3HR6A 1DDHB 4JFOA 1H3TA 3SDAA 4ELME 3DHMA 4OFDA 1C12B 3X13B 2Q86A 4YFDB 5C9JB 1NFIA 4L3CA 5J0BA 2WQRA 2EIBA 2MMXA 4PRIB 4OCLC 4NWUL 5JNYB 1IKFL 4HHAB 32C2B 3P4MA 4OAWB 3IVKB 4KUCD 5KAQF 4L5FH 4DAGH 2XTJD 4YIQB 3ZL4H 1DQQB 2DMKA 2VJXA 4YC2B 3S35X 2WBWB 2F53E 3VGEA 4X4YA 5DVOA 2V5SA 3LCYA 2OMBA 2EE9A 3O2DL 3H8NA 3TO4B 2Z8WC 5HVHC 1K4DA 1DBKH 3HA0A 1CR9H 2VUYA 3R1GL 5C8JB 5KSVA 2HA1A 4JPIB 3T3ME 3NA9L 3ET9F 1Z3GL 5AYUH 3GSQA 5INDA 3BISA 4YBLB 3L7FB 3WJJA 1D5IL 2XQBH 3GSVA 3S35H 2Q3ZA 3TEUA 3OKMB 1YYMH 2FLRT 1IC5H 4HS3B 2YD7A 3TH3T 3MUZ1 4LHUG 5J57B 3ARXA 3IXTA 2XXCB 4IHOB 4CVWA 4Z7VB 5EZLB 1QLRB 1BWWA 2LU7A 2UY6A 3NPZB 1AC6A 3WFEH 4UUJA 3U4EB 1BFOA 5BOPA 4H1LH 1VSCA 1SEBA 1N7ML 4FRWA 5IQ9A 4CADA 1J8HD 1RVFL 3OAUH 5DJAA 1H8OA 1FSKB 1EO8H 1IE5A 2O26U 4ZSOA 2DQCH 1ACYL 1I8MB 2X10A 4WEUD 3RX8A 5IWLA 3D2UA 1IGJB 4GT7A 1DEDA 1G9ML 2VL5A 4DW2L 4Z7NF 1C08B 2Z0BA 4LDOB 4PJBA 4RWYH 4JHBA 1A7RH 2VERN 1RZGB 1MFDH 4X6CA 4POUB 5EFIB 3ZO0A 4L4VB 1Z0NA 4NQXB 4UIKL 2YA2A 1PG7H 3T0EA 1JGLL 5IEKA 4HWBL 4OZFG 3VFPB 1R24B 5B4MC 5IG7A 1HHJA 2Z91B 1U3JA 2FX7L 4OV6F 5HGDB 4OCYH 2X9XA 4LSUH 4KI5F 3TBVB 3U7YH 3PP3H 5D1XC 3TCLB 5C07B 2KQNA 2R23B 4FFVC 1YECL 3CX5K 5IB1B 5EIIB 1N4XH 5E2UH 5JO5B 5EBMA 3X3FL 1UKQA 3PDGA 1FNGA 5IB4B 4G8FA 4GS7C 3QNXA 3NZHH 2UV3A 2VLMD 3F5WB 4Y2DD 4OLYH 4X5XA 4ZSOE 2BOCA 3CSBA 2DMBA 1H0DB 4O2EA 3ZTJH 2DLHA 3UTSE 2L4OA 2WUCL 3OV6A 2Z4QA 2FWOA 4PRHD 3V6FA 2IPUK 5I73C 1E4WH 1MLBA 1ZTXH 1BIIB 3WIHH 4AY0A 4CRPA 1NKRA 4JRYB 2MQCA 2BRQA 3MLXL 1T80A 5I1GH 4FMFA 3DVNB 2W60A 2Q7NA 4POZD 2NY6D 4G7YL 4DVBA 2E5EA 4RGMC 1NC4B 1X5LA 4PRPE 1JPTH 4BK5A 4KDWA 1Q9KA 2FGWH 4KGJA 4DGYL 2QHRL 1EMTH 1WAAF 2BNQD 3FQWB 5DD5L 1CE6B 5DUPL 3WN5B 4LLWA 2UZIH 4M1CD 2FH6A 4Q58C 2CRIA 4OCMC 5KVFL 1UH4A 3MRLA 4HQQL 5A1AA 2V5RA 2VDQH 4N1EA 3W11C 1BEYL 3HZKB 4OZ4A 2DI8A 3QEQD 2GJ6D 5DO2C 4YJZL 4P2RA 1QFOA 2ZG1A 5ALBL 2BVUA 4Y8AA 4YQXL 4ODHL 1JTOA 3NCYP 4C54A 1MAMH 4P5KA 5AUMA 4F37K 1DUYB 4AQ1B 2EDTA 5DMGC 1CDIA 4IRJB 4KZEL 4X6DF 2E3VA 3BD4A 1UA6L 2VITB 4OZHB 4PP1C 1D9KA 4KKCC 3STLB 4KUCF 1UJ3A 3O3DB 4BH8A 3GB7A 5C0JA 3QQ9C 3U6RA 1A6ZB 2EH7H 3JV5A 3MLYL 1U92A 2GHWB 3IGAB 3KYOB 43C9A 3TVMC 3IS1X 3WL9B 3Q0HA 5EIVA 4Y5VC 4IMLA 4PGJA 1I9RL 4X80H 2I24N 5DA4A 3SQOL 5CJQL 3C5JB 4D9RE 3QIWB 2CMRL 3DRTA 4NQDB 3HHRB 3P77A 4XVUD 4LNRB 8CGTA 4PV8A 5I71B 3QXAA 2ZUUA 3HE6A 2X70A 4ESKA 4LQFL 2ZCHL 4DQOL 3E3QE 3RPIB 2X89A 3LQAL 5I2IA 4U0RC 3B4NA 4J4PC 3O9WD 2R2BA 3QRFM 4OFPA 5C0BB 3QAZB 2EH8L 5LGKA 3SDYL 4C4KO 3T09A 4BQ8A 3FONA 2CJUH 2AEQL 4S11A 1TVDA 1CGTA 5T3ZL 2V2XB 4JG0H 4MNGA 4WDIB 4GOSA 4ZDHB 1KB5A 4OCWH 2X4RB 4Y5XB 1J18A 5K59F 4MVBC 1RZ8A 3GSNL 3WEXA 4DGVH 3MOQA 5CBEB 1YMMD 4U33A 2J5LC 1NMBH 1FO0H 2OJZL 4QTIH 3ZE0F 4BFEA 1HOCB 5KBNC 1JF6A 2YPLA 5IVNA 1NUDA 3BJ91 4KK5C 2C1PB 3V4VL 3GMNB 5J9PA 2VQUA 2NYYC 4G9DA 1ZAGA 3S3SA 3SDCD 5FO7B 1F3JB 4KTYA 4F9LC 4N0UE 4NQEE 3UTTE 3UROR 1A7PL 2IFFH 4XAWH 3ZKSD 1MY5A 4ZOAA 3P11L 3SGKA 5C0EB 5KS9E 4ZS7H 3C5ZB 5IB2A 1VDGA 2BVOA 5I30L 3MLZL 3QULB 4AK1A 3ARFB 1N0XH 5BO1H 1ZGLB 1HKLH 5BVPL 3TT1L 4U6XB 4HV8A 1V5JA 4D0DB 3QH3B 2RJMA 4U05A 4NZUL 1GC1C 1XFPA 3RWGA 3ARDC 1BQLH 4I9WE 5E94B 1HE7A 3TA3C 2DN7A 2NY0B 5H94B 4NKIH 1AXTL 5JIPA 1FNFA 3U30C 4MA3A 2XA8H 4XNYL 1K9TA 3MGTB 4ODUB 4XNUL 3UO1H 2BVEA 1PX3A 2Y72A 4M5YH 4I3RH 1ZV5A 5MEND 4U3XA 3DX9B 1JTTA 4N1HB 2XTJC 2YPLE 2NMSA 4HSQA 4OUUB 4Q6IC 5D70L 4UT7H 2EDYA 3ARBB 4FQ1L 4M7KL 1JUFA 3MRBA 5GZND 1DQLH 3O6KL 3MV9A 2FB4L 4XXDB 3OKDA 2VLJB 2X4OA 3UDWC 3KHQA 1MJJB 2CRZA 2IEPA 1K5NB 3M8OL 3CSYA 3NZ8B 1KEGL 3FO0L 1AGBB 2MQ3A 4ZTOH 3OF6D 1KCLA 4Y4FB 1KCUL 4Y4KB 4EDXA 4N8VA 5E2TL 2VMFA 3ZTNH 1P1ZA 5MEQB 1QKZH 4DKEL 3EFDH 3VXSD 1MLCA 3E2HC 4Z8FH 5MEOB 2NQCA 1EBPA 4NRXB 3KPOA 2UWEB 4CVZB 4A6YH 4LLUB 4CU6A 3D0LB 3BP6A 2CKBB 5I9QC 3WLWC 3G5XB 4NO2B 5FGRA 3S96A 5T1KB 4IBLT 3A6BL 3F8UB 4NQCB 1QFWL 1WUNT 4V3EB 1P9MC 2HKFL 1WBXA 1T03H 4FQXB 4N5EC 1DUZB 5BZDA 3K1DA 5KW9H 2PR4L 2EIEA 3G6DL 2JJTA 5DRNA 1EXUA 3F7PC 1M6OA 2BHZA 4W68A 2ADJB 4OZIF 1MAKA 3PWLB 5CEXA 4JCMA 3MV9E 4P3CH 4TVSa 1G0DA 5C0FA 4PLKD 3RFZC 4X7TB 4D0CA 1IEBB 1L6ZA 2GY7B 4IOFD 3O4LE 5E99H 4A2LA 2EEDA 3FQUB 1MRCH 4L3ED 2XV6B 4GG8A 3OHXA 4FQLH 2ATPB 3QUMH 1J9CT 4O02H 3OG6B 2DQEL 1RJLB 2I60H 5C3LD 3V52H 1UACL 3RWHB 3T2OA 1OAKH 1RHHB 5EU5A 4YPGA 1FVDB 4KKAC 3V7MA 1UH3A 2PYED 5FOBA 1B0GA 3LRSA 4K3EH 5DC9B 1XGRA 2Q6WB 3BIAX 2DQHH 3UBXI 5JDSB 5L0QC 4JFPB 3HS0A 5ALCH 5H37H 3X12A 1IAOB 4KVNH 2MKLC 5IT2L 1H5BA 2V9QA 3RWFA 3OXSA 3P4NB 4TOYH 4XCEA 5DRXA 3O8XC 1AD9B 1EV2E 1S7RA 1MH5A 4HMDA 4U2YA 1NANH 1EFXA 3TWCL 3K2MC 5IBLD 3QIBC 3DXAB 3LEXB 1WCBB 1WIOA 4YNYB 2QEJA 4P46B 2MKWA 4OLVH 2FEDC 4HC1A 5DJ8B 1FPTH 2IANA 1ZSDA 3VXMB 2WIIB 2O5XH 4POZC 1Y6KR 1D5XB 1T4KB 3G6AB 2J1KA 7CGTA 2RB8A 3BZEA 1HQ4B 4HUNB 4LK4A 4E41D 4Z95H 4GRMB 4DZBB 1UEMA 3TC9A 1G7JA 3SKJH 1XR9B 5JIIA 4OCRH 3QPQC 5ESVA 3BP5A 4DN4H 1IC4L 3MR9A 2BY0A 2OTPA 3VWJA 1ED3B 5E4IA 2BNRA 5F7EL 2X1QA 3MPCA 4QXTB 1GAFH 3U7AA 3S4SG 2J8UB 3DROA 5LWYH 5FYKU 4F9PA 2X4SA 1TJGH 1N26A 1OB1A 3MV8B 4OLXH 1XGTA 4LU5H 1I7RA 2FJGA 5C1MB 1JE6A 1OCWH 5DVMA 5K9JL 3O6MH 1KV3A 1KUMA 3MLTB 1SJEB 2CIIA 3D69B 3LMJL 5J11B 1CIDA 1MF2L 1UQSA 1T7ZA 5MERB 5DD0L 2EKSA 2XG5A 2DQIL 3CMOH 3VE0B 3GMQB 3MRMA 4OLUH 1EAPB 4JQIH 4WW2F 1BVKB 1A6UL 3AAZB 3MO1B 1JCKA 1KYOK 1FH5H 3RHWF 4ZO6A 3U36B 1YJDC 5D2LB 3D85D 4OLZH 3QUZD 5DHVA 3WD5L 5I19H 1NCBH 1UB6A 4HWZB 4X7SH 4DTGL 5I1LA 4OTXH 1QSZA 4PJ8A 5C08E 4NC2B 5CILL 2BNRE 2E9IA 2ADIA 4I77H 3KLSA 4Z7UB 2V2TB 2VE6A 3KWWA 3KS0J 2AJ3A 3SJVB 3VD7A 3NN8A 4HKBB 1EO5A 2GFBB 3I50H 3DMMC 1KLGB 1LP9B 4QRPE 1VADA 2E7BA 1UZ8B 2I07B 3HNVH 4JDTL 2M8XA 3C08L 3PWUB 2B0SH 2BVQB 4NP4H 3V5DA 2QKIB 3SPVA 4ORGB 3UAJC 1NBYB 5EZOL 4M6OH 4LCYB 5GQBA 2JIXA 4PR5B 4JFQA 1T3FB 1NAMH 1OLZA 4P59L 4ERSL 1FFQA 1AKJB 3QDJD 4MA1B 4PJ7F 1JHLL 3H6JA 4XCCH 4PJHE 3U9UA 5BQ7A 5SWQA 1W8OA 1ZANH 3WFBL 3HB3D 2JB6B 2DD8H 4H20L 1WSST 4JFFB 1UCBL 5BMFH 1PEWA 4HIXL 1KIPB 3FO2B 1WBYA 1UWGL 2YZ8A 3VJ6A 1G0YR 5EG6C 1CXIA 4XXCC 1PFCA 3TBTA 3A67L 4V2BA 1D6EA 4IIQB 4KKLC 3R06B 1NCAH 1HILA 1Z0MA 2D31B 4IJ3C 4B0MM 1EJ6A 4Z7WB 3WHE1 1YDPB 1U95B 2QQLH 3DO7B 1EEZA 4WGWB 3GSOB 1I1AA 2DYPA 4HKZB 4RZCB 1XIWB 5CKAA 4UU9B 4Y4HA 1E6JL 1HZHH 4LGSB 5AAMA 3DV4A 4M8QA 1U91A 3FO1B 2G5BA 1YEKH 1CFQA 3FQNA 4RCAA 4P9HC 1K2DB 3HNSL 5EOTB 2JLLA 3FRPA 5I8EA 1WWBX 1BX2B 1MHPL 1WCQA 3R8QA 3BGMB 3HG1D 1NLDL 4Q0XH 5ETUA 5I8CA 5HHQB 3JWDH 1A6VL 1JNNH 2LU3A 3HCVA 1I8LA 3BEVA 1FL6B 1NCCL 1MCNA 4Z76A 1H8SA 3EOTL 2UVEA 3AB0C 4YR6B 2P5WB 2GIYA 1N64H 1NFDB 2WP3T 3VFNB 3W0WA 2Q3AA 4ZOEA 1A1NB 4UIMA 4PJGF 4YHMH 4K8RL 3UTZA 5FB8A 1MFCH 2FNBA 3FN0H 3H3BC 1CLCA 3WJLC 4APQD 1AGCA 3BPLB 3OKKB 5SX5K 1LDPL 3S5LG 4H1LB 4JFEB 3O11B 2A6JB 2XWTB 2WBJB 2Y5TA 1FZKA 1JGVL 4MCZA 5GHWL 4PY7B 1F4YL 1ZVSA 1YNKL 4XHJC 1OP5K 2VN4A 3GK8L 3UTQB 4Z77B 2H8PA 4JN2B 4JEGB 1YN6A 3KPRB 1CD0A 4HT1L 2DQFA 4U1HA 2NTFA 3K0WA 1DBBH 4LPVA 4GBXC 1NQBA 4MAYB 1JL8A 1IKNA 2B4CH 4PJXA 4LKCA 1HDMB 5AYQA 5L2KD 3HMXH 1HHKA 4P23C 4PJDB 3C60B 4L4JA 4W70A 5D5MF 3H3KA 1FFPB 4ZOCA 1MWAH 3C5SB 5LJYH 4S10A 1QO3B 2AK4D 4YX2H 3T77A 1DJSA 4JM2B 4OSUH 4TULH 5KSBE 3LKOA 2F58L 1FZOB 1KN4H 2IQAA 1TNNA 1H8NA 4HIIB 1MVFA 2YD5A 3MCKB 1EBAA 1PAMA 1JRHI 4ZD3H 5HHXH 4PJEF 2J4WH 2HWZH 3IDXL 2BK8A 3ARYA 4N9GA 5GGVH 3CPLA 3IJHA 3T3PE 1NGZB 1P7KA 4PBWD 1RUQH 5D2NB 4HFUH 4YK4B 2EDQA 1LNUA 2XN9B 3D18B 3ISWA 4EI6B 4FXGB 4OD1H 2YA0A 4ZUUB 5I1CH 1E27A 2DQJH 5IQ7L 3PWPE 4MQXC 3N0PB 4OZGE 2VLRD 3VRLE 3MV01 2ZSWB 3RWCB 4JO4L 4ODXA 1XCQA 3UJIH 3ZT7A 5EBWB 1ZLSL 2OR9H 1HI6B 4JVPA 1IGCL 4LOUC 2Y36L 1CZ8H 5HGAB 3EFFA 1JGEA 4NN7C 1YYLH 1WIPA 4WFED 4G3YH 2DLFH 5D1ZA 1KEMH 5F7YC 5FM4A 3L3DB 1I1YA 4HCRL 3P0YL 1CK0H 3OAYK 4XMPH 3NGBB 3BSZL 5MEPB 1BAFH 3G6JB 5IP4A 2H32A 4ONFH 1H3PL 4ZAKA 5FK9A 2VLLB 1OT1A 1JRHL 2JCCF 2IQ9L 1QFPA 3ES6B 1IAIM 1J11A 2AXGA 1QBBA 4R90L 4M43L 1KIQB 3O3AA 4Z0XB 3TT3H 4NQTA 2MSPA 1MI5D 2CSPA 4O58H 3AS2A 1OAYL 4S1RL 4UV7L 5EC1B 4QTHB 4X98B 5CKGA 1QSFD 3OAZH 5ACMA 1IZJA 2A2QT 2QLVB 4TPRL 4Y7MA 4KJQC 4M5ZH 4D9QE 4JRXB 1CL7L 1MHHB 4YBQD 1UXWA 3QRGL 3VFMB 2F53D 2VXVL 3P9WB 4ZQKB 5J6GA 5TDPA 3UEZA 3MLWH 4PLJD 4OI9A 2FIKB 3N9GL 5EU6A 2C3GA 1XGPA 2X9YA 1YMHB 3DUSB 2WWKT 1JWMB 2D0GA 4GKZA 1G6RH 1J05B 3RQ3A 2WUBH 1NH6A 3PWJB 2MTPA 1KJVA 5GRVL 3RP1A 5FYKL 1Q0YH 3JTTA 3JWDC 5HGBA 4F7EB 4Y2DB 4LLDA 2OMNA 4PJIE 1FFRA 1WT5C 2FCBA 2K9UA 3QUZC 4PRHB 2GTZB 3SDAD 1XGUA 3M17B 2X4NB 3JVGA 3I9GL 2FSEB 3QXDB 4JJ5B 4NSKA 3RGVC 1A02N 2CXKA 4MMXC 1F90L 3VXOB 1FO0B 3WUZA 1UXSA 2CRYA 5H2BA 5I74B 3H9SA 4PP2B 1RK0A 3H42L 2XNAA 4PYGA 4RWHA 1LHZA 2BNQB 2FZ3A 3MRPA 1KJ2A 1M7IB 4HUVA 4QRQB 4FZEH 1JYXA 4QOKB 4JFXA 5IROC 1OLLA 1T21A 4J6RL 4LVNC 4MAUL 2PXYA 1SM3H 3HUJB 3C2AH 4RBPK 2O61A 2Z35A 4XNZC 1R5VB 3QEQB 2GJ6B 4U1KA 3DUUA 1XF3A 1U8MB 4QY8A 4KV5F 3QWOA 2NNAA 3ZKMC 2FX8H 3BZ4A 2HRLA 4HUUB 3DRQB 4I5BB 5C2BH 1MIMH 4DFIA 2BCKA 3BIKB 1BJ1J 1T89A 1RZKL 3RTQC 5TDOA 1CF8H 2IWGA 2EDDA 4ZPTB 3IFOA 2BRRL 4NBYB 1R3JB 1HYRC 4MXVF 1W0VB 1WBZA 4TUKH 3SKOA 2P46B 3EKCA 2C1OA 5JW5A 3B2VL 3FFDB 3B9AA 3PGDA 4ZFOL 1FFOA 1F97A 4C59B 5I1EL 4FQ2H 3ZMRA 5I1JL 5DTFB 1H3WM 4GW4B 5LAXB 3ROLA 3TN0C 1K8IA 3VXRE 1OAQH 1GGIH 3TFKC 3QIUA 2WMPA 4FFEX 1ADQA 4IOSD 1I7ZA 4K23L 3LS5L 4EUPA 3C6LD 4DGIL 4M6MH 5D7IB 3RNQB 1JV5B 1OAUL 4R0LC 2DRUA 4XVSL 3SDXB 4RFEA 4XVTH 4L4TA 1A14L 5T3XD 3B5HA 3T0ED 5C0AA 3ZT6A 2CGRL 4R7NB 3BKYL 3RAJL 3F6IA 3REVA 1I8IA 5F6IB 3BP7A 5T1DL 3L3GA 5FGCE 3SBWA 1MNUH 3FFCB 3DGGA 4KROD 3FB6A 5HY9A 2YPVL 4PGBB 4A6YB 1KIRB 1OGAE 3MRGB 3DX8A 5ADPL 3RKDD 2X9WA 1YMMB 1HHGA 4KDVA 4U1LA 2N1KA 2Y7QA 3ECBA 1OTTD 1T7YA 2R15A 2AK1H 1FCGA 3SGJC 3RI5K 2MPAH 3ZZ1A 4J2XA 3V0VB 4XWGL 2R29H 4UQ3B 4NJ9L 4OB5H 4UAOB 5HHMB 5CMAB 4WUUE 2VWEE 1O5DT 2CUHA 3MLRH 3FB7A 2W65A 1DSFL 1W72A 3ZLQC 1EJOL 3TNNA 3X3GL 1MCOL 1UYWL 2ITDA 3ZDZE 1P2CA 4TNVF 4UINH 1E4JA 3QDMB 4HAFA 4JO2L 4WNQB 5KOMC 2R0ZH 2QADC 3PWNB 1I4FA 2DQTL 3LN5B 1U8PB 4FABH 4J3SA 3LV3A 5IV2B 5C0AE 2EICA 2ZKHH 4D9RD 3QUMB 5HYQA 1KCRH 3SGDI 1DDHA 3HC0A 4LCCB 2F15A 4BM7A 1P5UA 4NM4H 1UT9A 2MCPL 4L29B 3X13A 5C9JA 3GHEL 3M1BB 3OKOB 4G6KL 7FABH 4PRIA 5KSAB 5JNYA 4U6HB 4HBCH 5LGHH 5HHNA 4HHAA 4OAWA 3IVKA 2EEAA 4WWKA 4FQPA 1KTLB 3KPLA 4HAGA 4P2RD 1GVIA 1WZKA 4XPHH 1WTLA 5GGTH 2YHGA 4LASL 4NUJB 1C5BL 1YQVL 3MLSH 3TO4A 2V6HA 3GNMH 4TTGA 4RFOH 1D9KD 5ESQB 1A4KB 4O4YH 4JPIA 2YOCA 1TQBB 1XF4B 1F00I 2F19H 3DJ9A 5FHAH 1XEDA 3MRQB 2VDKL 3OKMA 4LHUB 4NIKB 2OTWB 4HS3A 1G1CA 4DOHE 1QEWB 2AS5M 3SE9H 5DMKA 4RMUA 3HI1A 5FA4A 1LE9B 3A6CH 2OYPA 3HE6D 4L8SA 4JY5H 2X42A 4IHOA 4M7JH 2ARWA 1QLRA 4PJ5A 5EZLA 4UT6H 3CFDB 4M62L 3U4EA 3IAQA 4BZYA 2X89D 2X4QA 5JHLH 3EO1A 1I8KB 4RGOL 2QHLA 1A5FH 1CGSH 1YUHB 4E5XB 2DKMA 2P8PB 4K7PH 4WTZG 3MUGB 1RUKH 4NN5B 1OOAA 5KVMC 3BYYA 2PTTB 4PJCA 5F21B 3UJTH 2AJVH 1TTUA 2R4RL 1FYTE 3ULSB 4WFHD 2HJLB 1IM3A 5EO9B 2CO6B 4MX7A 3OB0H 4I48A 5BRZE 4L4VA 4AMKL 3QUKB 4OZFB 2V5YA 5FKAB 3PQYE 5E95B 2YPLD 2B2XH 4H88H 1FG2B 5LBSH 3RZCA 4RSVA 4JB9H 3MYJA 4PJBF 3RL2A 3B9VA 3VFPA 1R24A 3GHBL 4P99A 1TJHL 5IGXL 4X6CF 2AXFA 3SE8H 1OAZH 4LF3A 5HGDA 4PLJC 2PYEB 3TBVA 3BESR 3TCLA 4LVOB 1FL3A 4PJ5E 1XF1A 1GGCL 2EXWD 5EIIA 5JO5A 3KPQB 1UZ6E 5IHUL 4HWUA 4QT5B 3SN6N 4CU8A 3EJJX 5IB4A 2DLTA 4Z7QE 3QHTC 4GW5B 5EWIH 5FCSH 2NX5E 4JO3H 1H0DA 1VPOH 5KJRH 5F7WC 4Q9RL 1T83A 1OY3B 2NR6C 3CZFB 1H3UA 4PJCE 3CFBB 4N5UA 3SDAC 4HDIB 3B5GA 4MNHB 4ZUVB 3RGHA 5ID1A 2OL3A 4UZGA 1JPST 1JZ2A 4P5TB 3BZDA 1FL5B 4ODWB 1NCTA 3UC0L 4R9HA 3FT2B 4M8VA 1Q94A 1S3KH 4CW1B