3L9RA

Crystal structure of bovine cd1b3 with endogenously bound ligands
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
275
Chain Sequence
VFQGPTSFHLMQISTFVNSTWAQNQGSGWLDDLQIHGWESDSGTAIFLKPWSKGNFSDDEVTELVDLFRAYFIGFTREVQDRVNEFQLEYPFVIQVTAGCELHSGAIESSLRGALGGLDFVSIQNHSCVPAPDSGSRGQKFCALTTQYQGISDIIERLLSETCPRYLLGVLDAGKAELQRQVKPEAWLSSGPTPGPGRLLLVCHVSGFYPKPVRVMWMRGEQEQPGTQQGDLMPNADWTWYLRVTLNVAAGEAAGLNCRVKHSSLGDQDIILYWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune response
molecule keywords CD1b3
publication title Crystal structure of bovine CD1b3 with endogenously bound ligands.
pubmed doi rcsb
source organism Bos taurus
total genus 76
structure length 275
sequence length 276
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l9rA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l9rA01
3SKJL 4EDWH 4AIZB 2VDMH 4K7FB 3DSFL 1SBBA 2FIKA 2Z91A 4LLDB 4S1QL 5D7IE 1WIUA 1BVLB 3DHJA 4N0UB 4TYUA 2OL3H 4X7TB 5ADOH 3QI9C 3HE7C 12E8L 1ZLSL 1LMKA 1GGIL 4NQUA 3IT8D 5IMOB 3CFIC 4X83A 3KYAA 2A83A 2W0LA 2AXGB 5GS0D 1QHOA 4RMWA 3BWAB 2X4NB 1MCJA 4OQTH 2W9EH 3GZKA 3FQTA 2YZ1A 3TBYA 4LKCA 1VEPA 3VXOA 3EOYG 4HMCA 3HI1B 1D5IL 3ARTA 3BX7C 3DXAD 4UTAH 2C7UA 1KN4L 3BWUC 2BMKA 3EDFA 1WTLA 3BDXA 3WFEH 5K9JL 2EXYD 2QQQA 4LARL 5HVHC 4ZTPH 5ESAA 1B90A 3NZ8B 1A6AA 4XPGH 4MB5A 5T1KA 4XMPL 3RWIA 1LK2A 3MRRA 5KVFH 4F9PA 4HH8A 3Q5TA 4BYHA 4JJ5A 2P47B 1U8IA 2JKXA 1PG7H 2FH8A 3RUGA 5KSAC 4Y1AA 3SDCD 3EJYD 2R0LL 4JFEA 4I3SL 1IGIH 4HXAH 4QGYA 1PSKH 2VLRA 3LKSA 5D96B 4U1GC 4UMGA 2VAJA 5ACZB 2B2XH 3L3HA 1AJ7L 2XV6B 2R9HD 5IOPA 4EOWH 3IFNL 4BSWA 4M1GL 2F58H 3U46A 4AMKH 1AP2A 4CMHC 4YNYB 3U0WH 3QEQA 5FYLH 4TSAL 3LN5A 4KUZL 4O00A 5KVEH 1UWGL 4FQJL 4PB0H 3HTLX 4YZFF 2NR6C 5TJWK 3JUZA 1DBKH 1GZPB 2W38A 5CGMA 1JNNL 3LPFA 5ID1A 2Q8AH 4KWUA 2XRAL 1P2CB 1JZ8A 4NO0D 3O3BA 3N0PB 4P59L 1A6VH 1F3DH 4ZPVA 5IEKB 5L2JB 5E2VL 2WWMC 1CXEA 4JO1L 3BH9B 5CZXC 5DO2D 3J7HA 3CFBA 3MLUL 4QTHB 2DYPD 4ODVH 1IQDB 1WEJL 1H8SA 5EBLA 2R0WH 1A7NL 3AY4A 3L5IA 4JVWA 4WFGD 1KYOJ 2FHFA 5MERA 1CE1L 1KENL 4JFFB 5EU6D 5FKPA 3WLBA 3MODH 4M48H 5DHXB 3GSWB 1I1YA 3RTQB 2HTLD 5HI3C 3VXPA 5JHDD 2X1WL 1U8NA 3WFHB 5C08D 5DHVA 3FRUB 4YUEH 2A73B 1LGVA 2NZ9D 2Z92A 2F54D 2CMRH 3GK8H 2CDFA 4DGVH 2OLDA 4PYHA 3WO4B 3QULA 5IM7A 3CFCH 4G8GE 2XNAB 1FZMB 2CKNA 4RZCB 2V17H 3BE1L 5L0QC 3IKKA 4ETQA 1CR9L 3AU1A 1FPTH 4U7SA 3A6OA 5L6YL 1OD9A 1A0QH 1YDPA 1F3JA 2HWZH 1YY9C 4BK5A 4P4RB 1NGZB 2V2TA 3ROOA 4XVUD 3FQTB 1J8HB 4KKAC 5I74C 3QIUC 2HJLB 3KXFD 3C09C 3MLXH 4XNQB 5A2IH 3OL2A 4H1LH 2FX7L 2BMKB 3T8XB 4WHTA 4Z7UE 1QRKA 1YN6B 2NXZC 3IDJB 4UQ3B 1N8ZB 2OR7A 2J12B 3BPOC 4KPHL 4Z7WA 5B39G 1JL8A 5KAQF 4WHCA 2X5PA 1U8IB 4U1MA 5BVPL 2VZUA 4HK0A 2X09A 1JTOA 3QUXD 2V5YA 5F89A 3QBTB 4NQDB 5KW9L 1RZJL 3CGTA 5BZDB 3MNZA 4M43L 4UOW1 2X1PA 3UJIL 1MCBA 4MAYD 5FHAH 5TPWL 4NQTA 5K9OB 2BSSB 4TN9A 3TBWA 1BD2D 3NACL 4M7ZC 3VWKB 1XGPB 2H26A 3DMMA 1QO3B 3MCKB 1OAZL 3QXUA 4DN4H 1T21A 4CNIB 1XGQA 3CFKB 2R8SH 4JHAH 4UDUA 3BZ4A 2A1WH 3WEXA 4PD4J 1UA6H 3FQRA 4EDWL 2VDML 4RGND 3JTCA 1HHGB 3QHFH 4NNPH 4PJ8A 3OX8A 5ICYB 5FK9B 5GGSA 4Y4KB 5ADOL 1FG2A 4OFKA 2X1QA 2OL3L 3W9DA 4I9WD 5FM5M 2CH8A 2APBA 5H94A 1R6VA 5F93C 5HYFA 2QQKH 3JVGC 1TZGH 4G8EA 3OR6A 4WFED 5DRNA 5L2KE 2OSLB 2DQHH 3BGFC 4OQTL 3X12A 2W9EL 1MLCA 2EIDA 4YPGB 5HI5D 4NC1E 2XPGA 3WHE0 1RZIA 4UTAL 1J1PH 3S98A 3GJEB 2CQVA 3FO9B 3IXTA 3WFEL 5DR5H 1PX3A 4Z7UF 4YDIH 5DRWB 2DM3A 4ZTPL 5FGSA 4XPGL 4ONHB 5KVFL 4XCYA 5J13C 1NC2A 3M17B 3RX8A 4QRPD 3FO1B 2JB5H 4JRYB 1LEKB 4CKVX 1PG7L 3S3SA 1WK0A 4J3UA 5IGXH 5DS8A 5IWLC 1SM3H 4Z5RA 5AD0B 4QOKD 1IGIL 4HXAL 1KSRA 2CK2A 4RFEA 1PSKL 2XYCA 3GMQB 3H3PH 2B2XL 1FORH 1QEWA 4EOWL 3IGAA 4I0CC 1IGMH 2F58L 4AMKL 3C2SA 3U0WL 1WBYB 5FYLL 4YHPA 5KVEL 2DJ4A 4PB0L 5HYSB 1RUAH 1DBKL 4X7EC 4W68A 2R2BA 5JZ7C 1U8HB 4CVZA 4KJPD 2Q8AL 1IGYB 2VMFA 4OI8A 1U8LA 1N3NA 1A1NB 3TN0D 1A6VL 3JTTA 2CSPA 4PJBF 2AKRB 4HPOH 2R0KH 3B5TA 2XZQH 1RV6X 2GJZA 1Z5LA 4ODVL 5GGUB 3WO3B 2R0WL 4HZLB 1XGTA 4HXBH 4LNVA 5DJ8A 3RVXC 5GZND 5HBBA 1MFEH 1IEHA 4K7PY 1QFWM 5F89B 1EEZB 1FYTD 4OB5H 3IDGA 3RWDA 4NQCD 3MODL 5EOTB 1S5HB 4M48L 3UDWA 3EGSB 2N7BA 2OTUA 2WBKA 2YD2A 3IAQA 4G8GA 5D7IB 4YUEL 4R97C 1NMCC 1G7LA 4ZAKB 2P5WB 2CMRL 3GK8L 2D4FA 3RPKA 4DGVL 4K3HA 4U31A 3FB5B 5FM4A 2DIAA 2KQNA 3EHBC 3CFCL 3KGRA 4ACPA 2V17L 1U8KB 3HPJA 2PTTB 4APQA 3UTTB 4F2MB 3HZKA 5H94B 2SEBB 3IDNB 3TH4T 4PREA 1A3RL 1A0QL 3VFOB 5ILTH 2HWZL 1R3LB 2WQ8A 3MJGX 1JHLH 1FLRH 2ZCLH 5ISZB 1ZHNB 2J5LB 1RY7B 4Z7UA 4NN5C 1AXTL 2P48B 3MLXL 1EGJH 4TSCH 3KWWB 2AGJH 5KTEH 4LGPB 4JQVA 5TE6H 5HDBE 1XZ0A 1HZHH 3PHQB 4GG8B 4KK9C 3BRFA 1NC2B 4MAUH 2VN4A 1RZ8B 5JW4R 1NKOA 1UVQA 1JRHH 1MEXH 2C1OA 4M6MH 3STZA 2C3HA 4JFYB 1H3GA 1HH6B 3V0AC 5FO8A 5DS8B 1K4CA 1DQJB 1TITA 1BFVH 1BIIA 5FHAL 5EBMB 3AS1A 32C2B 2HLAA 4Y4FC 3ZLQC 5B4MD 1OPGH 4DN4L 1LQSR 3TZVB 1PFCA 2R8SL 3DXAE 2GUOA 2A1WL 2JELH 1UA6L 4O5LH 1A64A 1PVHA 3QHFL 5J1SC 5T5NF 3VDCA 1S78D 1DQQA 1OTUD 3VFPA 1F6LL 2F9BT 5L2KA 2AJSH 1S7VA 2KZWA 2X9YA 1RUMH 4PJBA 4EVNB 1T2QH 5H35A 5DSCB 2EYSB 2QQKL 1TZGL 3ULVH 2NY6C 4P23A 1HXMB 1YJDH 2DQHL 3V5DB 4ELMB 5CJBA 3L5HA 4Y4HB 4IIQC 1CFTA 5T1LA 3TA3C 1NDGA 4NQED 2E5EA 1J1PL 3W0WD 1A7OH 4KFZC 1BM3H 5DR5L 3E3QC 2NY2C 1L0YA 2C5DC 4L8BA 1ZE3C 1T5WB 4Z77B 2YS4A 3F62A 2DKMA 2BXYA 3UBXA 1UM5H 3UTSD 2ADFH 3KLSA 1FO0B 2B0SH 4Q6IA 1VHPA 3O6KH 5T3ZD 2JB5L 2J1KA 3NIFF 5IGXL 1ZA6A 4NDMA 3MRGB 4YXHH 3FT3B 2YPKA 2EKSB 1SM3L 1CGYA 5A43C 2D7TH 1DQDH 1BOGA 5BMFH 3BEWB 3TCLA 3H3PL 3D0VB 3MROA 4Y16C 1FORL 2LU4A 4B7IA 4Z7OE 4H8WC 4J3VA 4FZEH 3D3VD 3WNPA 5E70A 5F7HA 1U8QA 3WS6A 3B8YA 4JRXE 2ZJSH 5GGTA 4JZJC 3FCTB 1RUAL 5FUCC 5EU6E 1ZSDA 4GT7A 1WUNT 1MIML 5CZXD 4P2OB 5JHDE 2X4PB 2HH0H 2AV7A 3VI3E 2VDQH 2A2QT 3IAPA 5C3LD 3AVEA 4D0DB 4LMQI 5HHQA 2JJSA 2R0KL 3ARFC 3MJ8A 4OZ4B 5EIIA 2XZQL 2YEZB 5E08H 3VGBA 4M3KB 5FYJH 1KXTB 5KSUA 3O8XD 4HXBL 5C0IB 5HI3D 3X13B 5DUBB 1AGBA 4DKEH 1JHTB 1MFEL 5DMGD 1DANU 5DQJA 4S0UC 1CD1B 1EFXA 2DLIA 4NCC1 1P7QD 2R2CA 2GT9A 2Y6SC 3BVNA 5DVMA 1BIIB 1OAYH 3PL6A 4WFHE 4F7TA 4QLRA 5I1GH 4HIXH 3H2WA 4GQ9H 5DMYA 3AS3A 4PTUA 4M4PA 4PLJD 2MTPA 3KXFE 3MZGB 2EE6A 1ZK9A 4PJIF 2C1PA 4GQPH 3CUPB 1RJLA 3IDIB 3KLAA 4WI9A 5C0JA 2JJTA 4Z7OF 1WCQA 4AIOA 4IDJH 1PY9A 4BSVA 2DS4A 3QUZA 4LVNC 2AJ3A 4QXTA 3WLWD 4JY6B 1D6EB 4DZ8B 2V5MA 1CGSH 1ORQB 1JHLL 2ZCLL 3QJHA 4KK8D 3QXAA 3TGXA 3CFDB 4LDLB 1NCWH 5K9QI 5T1LB 2P8MA 1BD2E 3O6FB 4HX1B 5C09B 2Q87A 1EGJL 1ZVSA 3QXDB 3VI3F 4N9GB 1BZ7A 3HPLA 2AGJL 3T3PE 1M6OB 1FYHB 5KTEL 3VXRB 1HZHL 2YUWA 5DZNA 4LBEA 3O4OC 4MAUL 3V5HA 3ARGB 2PW1B 4PRBB 1ZVHA 4I9WE 1K3IA 3FQUA 3U4EB 1ACYH 1JRHL 1MEXL 2HA1A 5T1MB 4M6ML 2UWEB 3WN5C 2R4RH 5LCVH 4UQ2B 2DJUA 3RWFB 1BFVL 3DXAA 3GI9H 4WFEE 2XN9B 3TFKD 4P46A 1KTLB 2DM7A 1OPGL 4RNRB 1DFBH 2Z9TA 3GMOB 3JWNC 2HT4C 3PNWB 4LPCA 2JELL 4YLQT 3OJ2C 2EIZA 4O5LL 4XCFH 5DZLA 1KIRB 3LV3B 4GAJH 4OUOA 2AJSL 3ZKMD 4OLVH 1UJ3B 5ALCH 3RI5K 3SDCA 1RUML 3FAXA 1T2QL 1MCIA 2MQCA 1ZA3A 4JPIA 3ULVL 3DROA 4YFLF 1YJDL 2AV7B 1ORSA 4LF3A 1IAOB 3KPQA 3X11B 1A1OA 5F70A 3SO5A 1D7FA 1ZS8B 3R0NA 3WIFA 4QOKE 5I75C 5DF0A 1CG9A 2WNGA 4XRCB 1A7OL 4L8DB 1BM3L 5E9DB 5ACMA 3KAAA 3V6OA 3CDCA 3T3PF 5HHOE 3HKFA 2FL5B 4TNVF 2ADFL 2YUVA 2B0SL 3UTPD 3ULUD 2ZWLT 3O6KL 5F97E 3MFFB 4NO0A 4ZMAT 1IC4H 1A6PA 3GI8H 2ZG3A 4MX7B 4YXHL 3ULSB 4ZUWB 1AO7D 5DVLA 2D7TL 4MQSB 5BMFL 2QADB 3TVMD 1ZGLM 5GGQH 4JRXA 2W65A 4P49A 3SDXF 4FZEL 1UT9A 4N0FA 1EZVX 4I13B 5EU6A 3V5KA 5AWNH 1MCPH 3PHOB 5IJKC 1E4WH 3UROR 2ZJSL 5JHDA 1FYTE 3LMJH 3WYRA 2OM5A 4NQCE 1L0XA 4KJQD 1GIGH 4F37F 2F54A 3U79A 5IVZB 1IM9D 1OLZA 2HH0L 1YEDA 1QBAA 3OJDB 2KDGA 1OT2A 4LK4A 4YC2B 5E08L 2YA0A 3VFUB 2VZOA 2DQTH 4TUJB 5JPMB 5FYJL 4Q74A 5D1XD 2FNBA 3IS1X 1TCMA 4JPVH 4WVRA 5FUOH 4DKEL 2IPKA 4X7SH 1OGAE 1WSST 4WEBH 4PY8I 5HVFB 3KXFA 1OAYL 3TH2T 1N2RA 5D96C 3K74B 5I1GL 3EHBD 4HIXL 4GQ9L 3UXFA 5F44A 1FC1A 1G7QA 4V1DD 4KTYA 3ZKSD 3WFDH 1O5DT 3C87A 3ZE0E 1QP1A 3ERYA 1M7DB 1UB5B 3V6FA 2ZNWA 4LP4A 3QUXA 1B0RB 5F9OH 5TE4H 4IDJL 1WWCA 2HFFB 2G2RA 4MAYA 5GGRB 3VD9A 2ZUXA 4F58L 1BD2A 4OZFG 1VB9A 4YHZH 4JPIB 5IB5A 1CGSL 4V3DB 4ODUA 4IHOB 3C6SB 4RAUA 4GBXC 4GJTB 1NCWL 1IILE 5IW1B 3G5YB 4NRXA 3EAKA 4KI5C 4KK9D 3WNLA 2NX5D 3TPKA 2QSCH 2W60B 4U0QB 4PJ9C 4R0LC 3ES6A 3DUUA 4G43A 2CUMA 3L7EB 4NJAH 5M7QA 4GRLC 5T3XD 5D7LE 4FQXA 3FN3A 5I17A 1WVZA 4UU9A 3Q3GB 4WW2C 1ACYL 5F7DA 2R4RL 3P9MA 1WZLA 4HWNA 5LCVL 3C5JA 4K71B 3V0VB 3NN8A 3LRHA 5F71A 1JTPA 3SDAB 3KPPB 1DFBL 2DBLH 4ZFZB 5BRZD 3U36B 5HVWA 4XP1H 4NQEE 1CXLA 3W0WE 4NO2B 4XCFL 3V5KB 4QRPA 5D7KE 4DCQB 1U93A 5F9WC 3V0WH 4HD9A 1GZQB 4GAJL 2IAMD 4OLVL 3UTSE 2VDKH 4JZOB 4GMTH 5C9JB 5ECJE 4QOKA 5D1ZB 3T65B 1X5ZA 2Z8SA 5FECA 2FBOJ 2FLBT 3IJSB 3K4AA 4HDIB 5EOQH 3ILPA 3SBWC 3CLFH 2WBJD 3MJ9H 5CEXA 4P3DA 1KNOB 1VPOH 3VI4E 4JHBA 3RNKA 3MUGB 3CDGB 2AXHA 3D3VE 1F00I 3HAEA 4F80A 5DJXB 3HN3A 4OV5B 3H9YA 1MUJA 3L3GB 1CD0A 1JZ2A 5DJYA 4MD0B 2YSSA 1D5MA 4UT6H 1IC4L 3GI8L 2VR9A 2GCYA 3QDGB 1SHMA 2I9LA 3PV6A 5IVXE 1EJOH 4XHQA 1I1AA 3TBTA 3IXAB 3W11C 2X4QA 3MRBA 4DOHE 5GGQL 1IAIM 1YECH 1S7TB 5EO1B 5D6CA 1RZ7H 1S9VB 1FYTA 1TNNA 3U4AA 4H25A 5AWNL 4NQCA 1MCPL 3LRGA 2CDEA 1E4WL 1I8LC 3BQUC 1JIBA 4ZDHB 5IB5B 5SWZD 5IR1B 2E27H 2HJKA 3LMJL 5BQ7B 1I3GH 3IRZA 4QXUH 1GIGL 4L29B 4S1DC 2Y25A 2NY4B 4GH7B 4WJ5B 4MS8C 1TTFA 4JKWA 4AH2A 3ES6B 2YBRA 1MHCA 3VI4F 5EZLB 2DQTL 1OGAA 4YAQB 3MRLA 1L6XA 5DYOA 2E9BA 3BPNB 4JPVL 3VFSA 3KYMA 5FUOL 3TEUA 3MO1A 1JP5A 1CK0H 4X7SL 3HI6H 4Q2ZB 4WEBL 3RWEA 3WCYA 1P4IH 5I15H 4WHDA 1V7MH 2IADB 5D1QB 3JV4B 2MJWA 4P4KB 1WFTA 3W39A 3DV6A 4TSBH 5CHNB 4YDLC 2XFXA 4G9DA 1W8NA 5IVXF 3WFDL 4MA1B 4R3SB 4FXLA 3ZZ1A 1JGDA 5F72S 1H8NA 3OB0H 2DWDA 4LLUB 4HLJA 5F9OL 5TE4L 3BT2H 1I1FA 2IBZX 3I6KA 4YHZL 3G04A 5DLMH 3WFZA 2BCKB 1N4XH 2VSDA 3T2QA 4JFPB 2NTSP 2XWBB 4TUOA 3B9DA 1NSNH 5HHOB 4DVBB 1IVLA 2VC2H 2WSKA 4JM2B 3MRFA 4BH8A 2OJEA 2QSCL 1TJHH 1MWAA 4X98B 1JWMA 1C08B 2DLFL 4LGSB 5SX4H 2AEWA 4NJAL 3KR3H 1RD6A 4YIQB 1MUJB 3DOSA 4ZUSA 2CLRA 2G5BB 3HI5H 4M3JA 4PV8A 3D69A 1N6VA 1XIWC 4NQEA 4RA3A 3KPTA 5GGVH 3W0WA 2ARJB 2GTWA 3QIBA 4YHNA 1KGCD 2GFBA 3G6JE 3FONB 5A3ID 2RBLA 4XP5H 2DBLL 4PJ5B 3UO1H 1FQ9C 1TLKA 4H0GA 4RISH 1KIQA 4XP1L 1BWMA 1PKQB 1VEMA 2FJHA 3UTSA 2JCCE 1RUPH 4YBHA 3IS0X 1KLUA 2FO4B 2BXZA 1KPRB 3V0WL 3GSRB 4PTTB 1X5AA 3LKNA 5J9PB 2VDKL 3JBG7 4GMTL 4JDVB 1D5BA 1A1MA 3EOAB 2OX5A 1FFRA 3HNTH 1MCOH 2JIXD 5FO9A 4ZFOB 3D3VA 3V7AG 5EOQL 3DRTB 3CLFL 3MJ9L 4CDGC 1YYLH 2VL4A 1VPOL 4HS6A 4IRJB 3WJLC 4XPBH 3ARWA 5GHWH 5ERWA 2YD7A 3EZ8A 4ZUTB 1I8MA 5DJZA 4OCYH 2C4XA 4PYGA 3LQAH 3D0LB 4OGAC 4K3JH 2H32A 3TJHA 3HE6D 5FO7B 1KTDA 5IVXA 2ZCKH 3K80A 4XMKH 2VWEE 4FXKA 1S9YB 3DETD 5B8CB 4L4VE 4L8SA 4XPHH 4WTXA 3WS3A 1BX2B 2Q3AA 3OSKA 1EJOL 2WINB 1MH5B 3RNQA 3S5LB 1CFNA 1J0JA 3G6JF 1MHHB 3O8XA 3LKOA 4Y5XC 2D0FA 1DJSA 1YECL 2F53D 1P9MA 1I4FB 1RZ7L 2ZUTA 4KROC 3WNNA 1P7QA 3CC5B 2JCCF 2VN7A 3QDJD 1RZJC 3VRJA 5JW4M 3C60C 1G7JA 4R2GB 3I6KB 3DVNB 4ORGB 1D5ZB 2E27L 1HOCA 3E6HB 1K5NB 1I3GL 2R0ZL 3PABB 1H15A 1J5OH 3ZYJA 3ULUF 1S7WA 5ICZB 3S37H 4HUXA 4Y2DB 3VA6A 4HT1H 5D7LB 3QDME 4XBPA 1MWAB 1KUMA 1ND0A 5ANME 1UH2A 1KBGH 3MGTA 4ZXBB 5C0FA 2OJZH 1J0HA 4MXQC 2YUXA 4QYOB 4MDIB 3PJSB 2CIIA 4QWWD 5J6GB 1CK0L 2IAND 2J7LA 3EYFA 3HI6L 1LEIB 3RZWA 2E6PA 3QQ4B 1P4IL 5I15L 4Z18A 1V7ML 5IB3B 3I6LD 2ARJQ 1C5DB 4TSBL 2I27N 1T04B 2GSIA 4QRRD 3MRQA 5AZ2H 2NX5E 1N59A 2BSTA 4RIRB 4NYLA 1BJ8A 3ZKND 1JJUA 5CMAA 4R7NA 4EI6A 4LNRA 1R5WA 4ONGL 4X6DE 1LDSA 5IV2A 2OZ4A 1T66C 4GBXD 3TP4A 3BT2L 4PRHD 4XNZB 5I8EA 3TFKA 3Q0HA 1IBGL 5DLML 4NN7B 1H5BA 4JFXA 1N4XL 3TWCH 3FZUC 1ZT7A 1W0VB 3NFNB 4L1DA 1NSNL 2VC2L 4N68A 3QA3A 4QRSA 5EDXA 3EJZD 1OGTB 4E41D 5D2NE 5BRZE 1M7XA 3HB3C 1DVFB 1TJHL 3FTGA 4I77H 3I6GA 2DLTA 3HUJB 1DQLH 5B3NA 4IRSC 3B9KD 3I9GL 3KR3L 4ZNCD 3EO1A 3EW3B 1BHGA 2R2EA 3KS0J 3G6JA 4IOFC 1LP9E 3HI5L 2WWKT 2QR0A 1UZ8A 2JCCA 4KK6D 1HKLH 3ARSA 5B38G 4XP5L 3ARED 4ZUVB 2QQNH 3UO1L 4RISL 1ZXQA 5E8EB 1ZVYA 4WO4C 4GW1A 1CICB 3U83A 1NEZG 1RUPL 1LO3H 3LZFH 4YR6A 2XZCH 3ILQC 2F8OA 1DDHA 3H42H 4PY7A 2ZUSA 2CR3A 1AO7A 3LKRA 1T7XA 2XXCB 5HGDB 1J88A 4BQCA 3HNTL 2PO6B 4N5EC 5IB2A 1MCOL 2Q76B 5JDJA 4HCRH 5TDNB 5EPMB 4HUUB 4XHJD 1YYLL 3FHQA 3RY6A 4BH7A 1CDIA 3QQ3A 2X40A 4XPBL 5J11C 5GHWL 3ECBB 3SGEI 3VWJB 4OIIH 1R5VB 3V9FA 4I2XB 3WJJA 4L4VA 4OCYL 1II4E 2APFA 5IBLC 3LQAL 1B3JA 5TDPB 1UXSA 1XH3A 1JRHI 4K3JL 3RVUC 1F45A 4Q9BA 3GIVA 1A4JA 2ZCKL 4XMKL 1IM9A 3PGDA 4PP1D 5IG7B 1ZGLB 2FJGB 5EWIH 3AXLB 4P9HC 1LP9F 1ROWA 4XPHL 1CN4A 2E7LC 4JFZH 1S9XB 1T89C 3K4ZA 5DDHA 2GSIB 3D48R 3DGGB 2OYPA 4D9LH 4G8FB 1NUNB 1ED3A 3ARXA 3BQUD 5D1XA 4Z7VB 5ABDE 1NCTA 4ZFFB 3VRLE 3SO3B 2FZ3A 4DQOL 5DEZA 3FFCE 2COQA 4XXDB 1UJ3C 2HMIC 4DFIA 1D6VH 1JPTH 4OLEA 4NP4H 3QQ9C 4OLUH 3LS5H 1EO8H 3KHOA 5C0DA 4PG9B 3O4LD 1U91B 4PBVC 3QDMA 2MCPH 2XTJD 1J5OL 5FYKD 5ANMA 3IU3B 1XGRA 1HYSD 1VCAA 1JZ6A 5DJ2B 3S37L 3DTXA 4HIHB 5I16A 4HT1L 2JF1A 3FKUS 3OKNA 5C2BH 5FF6B 3OG6B 1TZHB 2BVQB 43CAA 1I7ZA 1KBGL 5GGTH 5EZJA 2RIKA 4U6XA 4RWHA 2OJZL 2R1WA 4JFOB 5CD5C 3NCYP 3C5ZA 2R2EB 2UV3A 4PS4H 3S36H 1CQKA 1U58B 4W6WB 1A3QA 3BZFB 3BRDA 5DJDA 1XF3B 5KN5B 1KIPA 2NX5A 1D5XA 5I1LB 4C4KO 1RUQH 4YXLH 2BFVH 1E4JA 5LGHH 2OI9A 4WEMB 2DQIH 2NLJA 4BZ1H 4HKJB 5KANI 4UBDD 5AZ2L 1OP9A 1KB5A 1Q72H 4Y19E 5DJCA 1LEGA 2NY0C 4EN3C 3BDBA 5IVOA 5EU4A 3EO0A 3O9WD 2AXFA 2J6EH 3REVA 1PZUB 1KG0A 4XBGA 1QSFB 3R0MA 2CRIA 1YEHH 4KVNH 1K3ZA 3O2DA 5E8OB 5CJXA 5D2NA 1I8IB 1Q9LA 4OKVB 4V2CB 5BRZA 4NUJA 3TWCL 4U6HB 4KKCD 4OAWA 3PDOA 3PWPE 1KGCE 1S7XA 5C0AE 4CAGA 1YA5A 3U0PA 3HR5A 5FDYA 1OAQH 4U2ZA 1MREH 1AGDA 3QUKA 3FFDA 4H26B 3OKEB 5EC1A 4OCNC 5DXWA 2IAMA 5BZWB 1YQVH 4I77L 1K4DB 1LP9A 3FQXA 1DQLL 3PQYD 1QD0A 3K8LA 5C86A 4R96B 5GSRB 3ARPA 1CZ8H 1WC7B 3OGCA 3U6RB 4P5TC 4ZOAA 1BOYA 3BYYA 5I0ZA 2XQYG 4ODTH 4MJIE 2WBJA 4Z76B 4NKMB 5HGAB 1MFCH 1JV5B 3RL1A 4OI7A 5E00B 3KPSB 3B6SA 5CINH 43C9B 4Q97A 1HKLL 4RDQG 2QQNL 4PJFE 1RK1B 3SCMB 2P24B 1VEOA 4AENA 2XWJA 3KPNA 2MHAA 5GS0H 2CKBH 3LZFL 2Y06H 4WV1C 3MR9B 4NRYB 3D39E 4JGJA 4POYA 1A7QH 4KV5F 3H42L 4BQBA 3C6LC 1X6NA 5F8RC 2Z35A 2IALA 2WANA 5F21B 1ZAGA 1GAFH 5HYSG 4XH2B 4OD1H 1KCRH 4CUCA 3GB7A 3S4SB 1MI5D 4HCRL 4J6RH 3BESR 3FQWB 4PJXE 4WW1B 3F7QA 2J88H 2VKXA 1U8PA 4A6YH 1NGWB 1BFOA 4K3DL 3ESUF 5HD8C 3C5ZB 4OIIL 5J56B 1QOKA 1IGJA 4IOIA 3QDJE 2A0LC 2YD1A 4HS3A 4UOW0 3V4PH 3GNMH 3MXWH 3G5VB 1KC5H 1B0WA 1MHEB 4UT9H 1UCBH 3DARA 5EWIL 3GMNB 4U3CA 2FYYB 3QUMA 3NGBB 3CMOH 1TQCB 4JFZL 3AM8C 3FFCA 3U4BH 2C26A 4UB0H 4X6DB 4GUPA 4D9LL 3H7BB 1KB5B 1UXWB 3DX8A 3O45A 4I18B 3PV7A 1RHFA 4U1SB 2DLEA 1XGYH 2DKSA 3NCEB 4AYFA 4LRNH 1D6VL 1JPTL 5IMLA 2Q1EA 4NP4L 3CX5J 4OLUL 4TTDC 3LS5L 1EO8L 5EO9A 1AGFA 4HJJH 4N0CD 4WGWB 2CPCA 4PJEF 2MCPL 4HKBA 4BM7A 5F9JA 4BFEA 1SMOA 4Y89A 3QIWC 3RX7A 2NW2B 3RGVC 2P7TB 4QTIH 2ESVB 3UYPA 5C2BL 2NZIA 2BHUA 4I0PC 2DMBA 2Y7QB 1URLA 3FQXB 4HHAB 2HG5A 2Q7YB 1CFBA 4ZYKB 3ULVC 3OKOB 2BRQA 4OFPA 3S36L 3AAZA 4EZMA 1U3HD 1OM3H 1YJDC 2BHZA 4IMKC 3DI3B 1FSKB 4X4ME 5DQ9A 1P4BH 4U0RC 3EOBB 1FZOB 1RUQL 4YXLL 2BFVL 2AVGA 5KSBF 3TO4A 1BF2A 5LGHL 3KPOA 2DQIL 4BZ1L 1O0VA 1T66D 4E41E 1VADA 2EKJA 1T03H 3RBGA 5GS1B 1Z9SA 2J6EL 4XGZB 4O2FB 4O2CA 2DM4A 5DEFB 1YEHL 3PWPA 4KVNL 4P57B 3KLHC 2CO7B 2BSRB 5EUOF 2ITDB 1AI1H 3U9UA 1XCQA 3WXVH 3P4LA 1EEYA 2HLFD 2IJ0C 1F4HA 2NW3B 2K3TA 4ODSH 5LAXA 2GW5A 3LRSB 3TNNA 4ZFGH 4Y5YB 3LEVH 2WP3T 2CR6A 5CEYA 1RSFA 3L3OA 1OAQL 1U8PB 3D25B 4YHKH 1MREL 2ZSWA 2YC1B 5JO5A 1YQVL 4YHYC 5IK3B 3T77A 2AJXH 5E6ID 1N0LA 2VR4A 1CZ8L 4NO3A 1M71B 3ZDXF 1EH9A 5I76A 4X9GA 3BDYH 5F3BA 4N0RA 5J8OA 1T7VA 5BW7A 1W72L 4ODTL 4OZHF 25C8H 1MFCL 1XR8A 4PP2A 4P5MB 4QF1A 1CU4H 5CINL 2P8PA 3M1BB 4YDVA 2VKWA 4MXVF 3D39A 3QO0A 1HQ4A 1BLNA 3GSUA 3DRQA 2CKBL 1FNSH 2XKSA 1LE9A 4U4BA 2Y06L 4N5ED 1PAMA 2H9GB 4PGEA 1A7QL 4C83A 1V3JA 3ZDYE 2EIEA 3L7FB 4AK1A 5DGRA 1GAFL 4PJXA 3QUYC 2V7NB 5CBAB 4OD1L 1KCRL 2AJZB 1BBJA 2PXYC 3QNYA 4ALAL 4BKLB 1H3WM 1S7QA 2IH3A 4KMTH 2MSPA 2F53A 2H2SC 2D9QB 3JXAA 4J6RL 3RAJH 1RI8A 2CIKA 4OF6A 2J88L 4YEFA 5C0CE 3QDJA 4A6YL 3QSKB 4DEPB 1CVSC 3MRDA 3NZHH 1F2XK 4NCDA 2VXUH 4NZTH 1NGXB 1CFQA 4WTZG 3P9LB 5EU5A 3MXVH 3V4PL 3GNML 5GS3A 3MXWL 3O4LE 1INEL 1KC5L 1UGNA 3LVEA 4UT9L 1UCBL 4Y19B 5KZCB 5LGKA 2VB5A 2XTJE 2LE9A 2LVCA 2Y4SA 3EKCA 3CMOL 2AJVH 4LAJH 3U4BL 3VXUB 4UB0L 4LLQA 4XI5C 5I9QC 5DJ0B 3GMPB 3QQ9D 4WU7A 5ADPH 1BFSA 3VXSB 1OOAA 4HWBH 4OT1H 5C07B 4G80B 1XGYL 1MJJB 4LRNL 4O2CB 2G75A 4W6XB 5IKCA 3HC3H 2LAGB 5C0AB 4DUWA 2EDHA 4HJJL 3F58H 4FFVC 3NOIA 1NMBH 3OKKA 1T6VN 2GIYA 3ZDYF 4WU5B 3MRCA 1CF8H 4P2QB 4JREC 4GS7B 3ZKXC 1RIVH 3OBAA 4QTIL 3MBEB 4L5FH 2ILLA 1QPXA 2CUHA 5GXBB 3B9EA 4IEFB 4OZHA 2OCFD 1QUNA 4MJIB 3OKMB 5HHNA 4X4MA 3NIGE 4NO3B 4L8CA 3MREA 4PUBH 5MP6H 3U7YH 2CDGB 1OM3L 3KPRE 3VFMB 3VD3A 2D3VA 4PJFB 3SDYH 4E41A 1IT9H 3K8KA 1EERB 3L6FA 2NY1D 1IAKA 2FJFA 1FFPA 2UY6A 1KPVA 3EYOA 5D72H 4PGJA 3GMMA 1F90H 5IROC 3B9KA 4XVTL 4QHKJ 2MWCA 3TIEA 3KNBB 3AROA 4H1LG 3O3DA 4UNUA 2NQCA 5CEZE 1MRDH 3BP4A 3CU7A 1T03L 3E2HA 5IFHH 2DTMH 4F8TA 5JQHC 3GBNH 3UAJC 1AKJB 2IPTH 5JPNB 2HRLA 5B21A 1F11B 3OF6D 3F7VB 2WAHA 4HKXB 4X99A 1CDBA 5K59E 3OXRA 3EZJB 5D6DA 1AI1L 3WXVL 3AREA 1TZIA 2YA2A 4ZFGL 2O26U 2YXMA 4ODSL 3VW3H 2W92A 2ZUQC 3LEVL 5FV2A 4YHKL 3BH8B 1HKFA 3MX0A 4Z8FH 1C16A 2EEAA 1HHKB 4YO0A 4P5TD 5DD6B 3QEUB 5B39A 1Y6MR 5C6TH 4OZGE 2AJXL 1ZTXH 4EI5B 4PJDE 4J8RB 4AT6A 3VGEA 1CXKA 1K85A 3NIGF 4X4XA 3BDYL 1BQLL 4LRIA 1JWUA 5CWSA 3L3IA 1JBJA 2V2XB 3MLTA 3MV8E 4NQSB 1C12A 4XWOC 4P2YA 3V95A 4F37K 4NZDA 1CU4L 2O61A 2VQ1A 1FHGA 2GEEA 2PYEE 4LCIH 3ARDB 5FGBC 4X9IA 3DYMA 4RMTA 5J3HD 4OJFH 1FNSL 3MRJB 2J8UE 5B22A 5F7YC 4PRPE 4TRPH 5DD0H 4LP5A 5B3JF 1EVTC 2EYRB 1W72B 1CGVA 1C5CH 3CAFA 5K59F 5DK2B 4W4OC 5C0CA 5CP3A 2VXVH 4KMTL 4WWKC 5F7LB 4L4TE 1BEYH 3RAJL 1D9KC 1IARB 2VXTH 4C55A 2OQJB 4K9EH 1FFOB 1QSED 5T3ZH 1BJ1H 2A0LD 3LKPB 1M05A 1V7NH 3RIAK 1FL3A 3DBXA 3NZHL 4UNVA 5HY9A 5SX4I 1ZT1B 2VXUL 4NZTL 3O4LA 4FTVE 3QEGH 3MV7D 1E27B 3JUYA 4LSVH 5AUMB 4PJGE 3ETBF 2A6JA 4PJDF 3QH3A 4ELKA 4NWUH 3SKNA 2P4AB 3BKCH 3G6AB 1KJ2A 3G5XB 3BP7A 1KEMH 3QPQD 4MCYA 1F4YH 2ZOLA 5DUPL 5KSVA 5C1MB 1ZLVK 1KPVB 1ZV5A 2AJVL 3DIFA 4GLRH 5ITBH 4G8IA 4A6YB 5ADPL 1WWWX 3HMXH 3G5ZA 1E4KA 4HWBL 4OT1L 2H32H 1VACA 4WUUD 3KDMA 4NHUE 1J05A 3OAZK 3U82B 4BUGA 2J8UF 3HC3L 1KIUA 2BNUA 1I7UB 4NGHH 3ARRA 4KRPC 3F58L 1NMBL 4I5BA 4XTRD 4OIAA 4HGKC 3ZE2E 3CX2A 4E42B 1YMHA 1MIEH 1SJVA 1CF8L 1EX0A 5FOBB 5MEOB 2FIRT 1RIVL 1SYVA 1QFOA 4EUPA 3O9WA 1W8OA 3SE3C 4L5FL 3TYFA 3QDAA 4OCMC 3BXNA 3PP3H 1FVDA 4DZBB 3KPRA 1LK3H 3QAZB 1EAJA 1CYGA 4EQ2A 1YEGH 1NFDF 4X4XB 4Y5VC 1ITCA 3L5WA 4PUBL 2UZIH 5EZIH 1SJEB 3DVGB 3U7YL 5MP6L 4PJGF 1JWSB 1QA9A 3V7MA 5HHME 2DYPB 3BOVA 3SDYL 2P5EB 5HI4C 1IT9L 3ESVF 4LVHC 5IFJA 1DEDA 3D2UB 4PRDA 5D72L 3QCVH 3SO3C 3GSVA 3CPLA 4GAFB 1F90L 2OTWA 1LE5A 1MRDL 1FJ1A 1M7IA 2DTML 1F4WL 3GBNL 1VERA 2AV1A 4OLXH 4FXGB 5C08B 3CXHJ 3G9VA 2IPTL 3R1GH 1OAXH 3NVQA 4U1LB 2DBJA 3ZYIA 1AFVH 5FDWA 1PKOA 3SOBH 4MNGE 1T4KA 5C0CB 3P30H 4OLZH 4G9FE 2Z93A 5DA0B 3VW3L 2M1KA 3ZE2F 5IMKA 4QHUA 3ZT7A 4XCNA 4F9PC 4OZGA 3A6CH 4PJDA 3QDHA 4Z8FL 3SE9H 3MZTA 2EZ0D 4C56D 3RWHA 4P2RB 5I19L 3HCVB 1UFUA 1BVKA 1ZTXL 5AYQA 2ZCHH 4U1JB 4Y8DC 1IEAA 1MI5A 1S9WA 1EEQA 1JI1A 1ZHKA 2PYEA 3KYOA 2VQUA 4PJCE 2Q6WA 2A6DA 3O3EB 1X5IA 2J8UA 1OF2A 3P4NA 3FT4A 1T2JA 3G5ZB 1TPXB 1A47A 4PRPA 4CU8A 3O11B 4LCIL 4F7EB 1WF5A 3P4OA 4AQOA 3GJFH 3CX5K 4OJFL 3QHTC 1QR4A 3O6MH 3BO8B 3H3KA 4X8JA 1A2YB 1IKFH 3HZYB 4PJAE 3D9AH 4I4WA 3HZVA 4RGNB 4KXZH 1OCWH 1V5JA 5IQ7H 1S7UA 4UV4H 2Y5TB 1C5CL 4KK5C 1QZ1A 2VRAA 3FT2B 4YHLH 5DTFB 2VXVL 5AG9A 3AY4C 5J6HB 3MGAA 2HKHH 4BFBD 1BEYL 1NFDA 3WIHA 4FTVA 2FLRT 3E1F1 4FQLH 4K9EL 3TYFB 3ULUH 5KANG 2NTFA 4UDTA 5T3ZL 1V7NL 4PJGA 3ARQA 1LNUA 4LVOB 2F8XC 3D18B 5AEAA 2YXFA 3ALXA 2HFTA 3RVVD 1JK8A 3QEGL 4N0CA 4LKXB 1YMMD 4O4YH 5TDOB 4GRMA 4LSVL 2V2WB 4MNQB 1A7BA 4ORZC 3S88H 4NQVB 4NWUL 1R3KB 3B2UC 1VKXB 3BKCL 1SY6A 3K81A 1KEML 4RMSA 5JUEH 1F4YL 3MV9D 1B9ZA 3HRZB 4PJCF 3GSVB 4U1IA 4O51B 5ITBL 1LO5B 3BN9C 1U92A 4NHUA 3HMXL 4CJ1A 1MCFA 5E5UB 1U3HA 5IF0B 1G7MA 1RFDH 1GH7A 4FABH 2R1YB 4OFDA 4HWEH 1TMCB 4RFNC 3RPIB 3S96B 2VXSH 2VYRE 1QG3A 3OB8A 4NGHL 3SDDD 3VD7A 1G0YR 2VLKD 4BFIA 3MV01 3EYVA 3QWQB 2DQFA 4IS6A 1G7PB 3C8DA 5IB1A 2EDKA 1MJUH 1MIEL 2X4TA 4LQ1A 2FEEL 5D70H 1DBBH 1EO5A 4QY8B 1UADC 4QT5A 4QHMA 5JW5A 2KH2B 4UAOB 2KZ1B 4ZPTA 1LK3L 5I66A 2JK5A 3MV8B 4Q9RH 1YEGL 5BV7C 4JDZB 2ADIA 2F19H 3DMMC 3TN0B 3MRHB 5GPRA 2UZIL 5EZIL 4XNUH 3MYZA 3WKMH 3H8NA 3EIFA 3RZCB 2JTDA 5BOPA 4ENEC 4PJ8C 3BGMA 3I3EA 3DYOA 1W0YT 2WQRA 1JF1A 2I07A 4HFWA 4Z78B 3QCVL 1R24B 1I7TB 5D7JB 4LCCB 3RDTD 5H37H 3UBXI 5IHUH 2D2OA 1NH6A 4MNGA 1HH9A 4PGBB 4OLXL 3R1GL 4G9FA 1OAXL 1MAKA 4I4WB 5CCKH 4L4TB 1AFVL 1P7KA 3MUY1 5INDA 3SOBL 2P49B 3N50A 1U8JA 1WZ1H 3HC4H 1S3KH 3P30L 4HEME 4OLZL 1KT2A 3BEVA 5IP4A 1FGVH 1T1XB 5T3XH 2D31B 2FCBA 2L7UA 3IB4A 3V6ZB 1DSFH 3A6CL 3DX7A 3G9AB 1C1EH 5EBWA 2WIIB 1G9EA 3T0EB 2Z31B 3O2DH 2GITA 5DT1H 4XWOD 2ZCHL 4PJCA 1WAAE 2G5RA 3AMLA 1VSCA 2DQCH 2HVKA 4U05A 3UYRH 1FV1A 2CLZA 4JY4B 1JI2A 2BRRH 5CSZA 1E28B 4FQQA 1JE6A 5ESQA 3T0XA 1ETZB 4WENB 4NHUB 3V8CA 5C71A 1QSEE 2IMNA 3FHAA 4NKOA 1QR1A 4NFCA 2R23A 3LD8C 5T5FH 5I6XC 3VXQA 3GIZL 1DN0B 3O6ML 4PRIE 3GMLB 3QI9B 1BP3B 3HE7B 1IKFL 3GFUA 2VLMD 3D9AL 2D9CA 1D9KD 1N64H 4PRAB 2A9MH 1OCWL 5IQ7L 1KLGA 4UV4L 4KJWD 1G6RA 4AY0A 4YHLL 1YNTB 2VL5B 3WSQH 2VAAA 3C08H 4MJ5A 2HKHL 5DJ6B 5C0GA 1TTUA 4FQLL 1RQ5A 3QIUA 4D0BB 3ULUL 1KFAH 4M6NH 1PYWB 4G5ZH 5EC2B 2Q7NA 5I66B 3UDWC 5HHMB 2N4IA 2NXYC 2HJFB 4H8WH 3I02B 4O4YL 4LOUC 5HVHB 4WUUE 4L9LA 2XI9A 4H5SB 5F88B 2HP4A 3RFZC 1AIFA 3HG1E 3S88L 4EDXB 4LSUH 3OR7A 1X5LA 2X4UB 2JLLA 4NFDA 4ODWB 5JUEL 5KSAB 3WMSA 2Z4QA 4APQC 1MFBH 2DIJA 1HHIA 1N5AB 2DF3A 4FG6D 5MEPB 3IAGC 3OJVC 4CW1B 4KJYA 4U1GB 3LN4A 3QCTL 4LASH 3RY4A 1RFDL 2A6KA 4CMHB 1NBZB 4FABL 2X05A 4HWEL 2ADGB 2X4RA 4HKZA 2VXSL 2ZUWA 2X89D 3QUMH 1U8JB 5GRZA 5DEGB 4D0CA 5E5RB 4XNXH 3UEZA 3ISWA 4JQVC 2AEPH 5SV4A 1MJUL 2BY3A 3MLWH 3QNXA 1QLFB 4M02A 3DX7B 1A6ZA 3MLRH 4NKDA 5D70L 4HUWA 1DBBL 2QKIB 1J12A 3PWLA 3BUTA 4GG6E 4DGYH 4F3FB 3OF6A 4F15C 3O41A 4LFHG 5E2WH 4KGJA 3MGOA 2F19L 2EYTB 1N5YH 3UZVB 1EHLH 2UYLA 4YK4C 3S37X 4XNUL 3B3IB 3WKML 1I75A 3MRNB 2BC4B 3NCFB 2VIRA 2BVUA 2AQ2A 3E3QE 5C0NC 2I9TB 5FA4B 4R26H 1NDMB 2BSED 3EYQC 1EHAA 4JG1L 1J8HD 2JE8A 4PJAB 3ZYOA 4NC1C 4NPYA 3DPBA 3VXQB 4KKLC 4B41A 4P23C 4OQ1A 5IHUL 3AB0C 1FN4B 1JF5A 1GGBH 2ICCA 5L0QB 4OZFA 4HIIA 5A1AA 5D2LE 5CCKL 1OARH 4PJ7E 1SJHB 3QFJE 3QO1B 5F6HJ 4AEHH 4J3WA 3BHBA 1WZ1L 4M9PA 4PV9B 2DQDH 3FO2B 3HC4L 1S3KL 4M93C 4Z7NF 3RX5A 4MWFA 1PDKA 1FGVL 8FABA 1IGTB 3T1FB 5T3XL 3TBVB 1T2XA 4LIQH 2VLJB 4NQDD 4XPTH 2HT2D 4FOMA 1OL0A 5I74B 1TCRA 3QIUB 4JFED 3C09B 1DSFL 1NGYB 4Q6IC 5I8CB 1QQDB 3VWKD 4OZIE 1C1EL 5HGHA 5FUCE 1FBIH 2YD6A 2P45B 4JANB 4WDIB 1WAAA 3SGDH 1XR9B 2NXZB 4QCIB 2AK4E 5DT1L 3T4AA 1FVEB 2NMSA 5CBEA 3BPOB 3GHBH 3MNWB 4LCWB 1S8DA 1MCQA 4Y4KD 3KPLA 4QRQB 1F97A 2DQCL 1R3JB 1MCEA 2DM2A 2ZNXA 3MOBH 3UYRL 5DK0A 1P4LA 2BRRL 1QSEA 2ADJB 4HK3J 1H8OA 4IM8A 4UZGA 1J1OH 4LL9A 3WS6C 4M7ZB 2ITCB 2BVPA 1GSMA 4LPVA 2FR4B 4PRIA 1VGKB 3HLAB 1U3JA 2EDFA 4LVEA 5E24E 5T5FL 5HDOA 4KK5D 3P2TA 1T1YB 3HNVL 4JFQA 3N06B 2JJSC 3BD5A 4GXUM 4LSPH 5D2LF 3EO9H 1N64L 2A9ML 4XZUA 2ICES 3LKQA 1I3RA 4JRYD 3ROLA 3VXTB 1HEZA 3WSQL 3BGFB 3C08L 3C5SA 5E95B 4WIQA 4WUUA 1KFAL 4M6NL 4YFLI 3SQOH 5CD3B 4MNHB 4YGVA 5C7XH 3GJFB 3HG1A 3PL6C 1X4XA 4JQIH 1RJYA 4FZ8H 4U1HA 4H8WL 4PGCA 3LQMA 3PHSA 2Z8RA 2DI8A 2H8PA 1NCAH 3CD4A 1BVZA 2OK0H 5J13B 5DJAA 4LSUL 2D0GA 5E5MB 5IMMB 1PZ5B 3W2DH 2AI0H 2GTZB 3NFPB 4FMFA 2WZPD 5HGBA 1MFBL 3VA2C 1WFUA 4XAKD 4LLVA 1Z0MA 3MRMA 4HIJB 1LD9A 4DN3H 4LASL 5A16A 1FP5A 4L4JA 5GRWA 1DEEA 5EIVA 1MAMH 1RZKH 2HYMA 1A21A 4LSRH 4RAVB 3TVMB 3TPUB 3TLRA 3P40A 5T33H 1WBXA 3QUML 1FVCB 1N26A 3LSOB 5EOCJ 4TNWF 2O5XH 1ODAA 5MHSE 4XNXL 3O2VH 3FB6A 1IGCH 4GG6A 4UI2A 2MKLC 3BPCA 5MEQA 5GS0C 3MLRL 1FIEA 1ONQA 1L4IA 5GRUH 1N6UA 2I5YH 4DGYL 4ZAKD 3WUWB 4HZAA 2P5WD 5ID0A 5E2WL 3UPRB 4KRMB 4P0DA 3GSNB 1K8DB 1HHHA 4MQ7A 4P46C 2EEBA 1JNHB 5D71H 1K2DB 1FAKT 1N5YL 1EHLL 2EXYC 1XCTA 5I1AA 4X6BA 2P8LA 3H7LA 3UTTD 1INQA 5EU3B 3CFEA 2CK0H 1RHHA 2EDTA 4R26L 2IEPA 2X9XA 1OAKH 5DMKB 4RRPA 5ISZD 4ZUUA 4R97B 3SDCC 3R8QA 4KRLB 3S36X 3QJFB 2VSCA 3INUH 4KMQA 4PJ7A 5D2LA 2ICEA 5E2TH 3MPCA 4LQFL 1MFDH 3QFJA 2GK2A 3N1QC 4OI9A 1GGBL 2R9HC 3VMNA 4X7CC 3CSPA 4V1DB 1OHQA 1T5XB 4HFUH 1RPQA 1G7IB 1OARL 1CD9B 4GW4B 1NC2D 4N0UE 3LKQB 4AEHL 3QEHA 4BSJA 2DQDL 4OZIA 3V6OC 1GPOH 3ROLB 1B4JH 2MKWA 3O6LH 4Y7MA 4LIQL 3S4SG 1F6AA 4XPTL 4X0KB 1OTSC 4B0MM 4NN5B 2AK4A 2BOCB 3QAZC 1FBIL 3AFLA 1JFQH 1JPGA 1Q94B 3PWUA 2B1HH 3TZVD 4PGDA 3PWNA 1HE7A 3OTTA 3GHBL 4M9OA 1UACH 2M2DA 1DBMH 3O3AA 2X10A 5L8KB 5FB8A 1MQ8A 3QG7H 3MOBL 2ORBH 2R1XB 5AYUH 1IRAY 1J1OL 3B83A 3CZFA 4Y4FB 2A74A 5F6IC 2JB6A 5I1CH 2HTLC 1SEBA 5HPOA 4XC3H 4LLMA 4L3CA 4Y4HD 5M94B 2D4DA 3U0TA 4LMQE 4JO3H 2ICWB 3IJHB 3H9HA 1HQRB 4YDJB 1GXEA 4I48A 3VFWA 3L3DA 1VESA 5JXED 1JMZA 4PPTA 5ALBH 5E8PA 3GBMH 4DKDC 4LSPL 5LBSL 3SY0B 5EFIA 1BAFH 1CGWA 3NABH 2WWKO 2NY6B 2HRPH 4K3EH 4M61B 1A9EA 2NXYD 2QSTA 4IIQB 4YHIA 3TA3B 4F57H 2PYFB 4ZG1A 1NCUA 3SQOL 1YN7A 1NUGA 3P11H 3SGKA 4JQIL 1LHZA 3SDDA 4FZ8L 4OLWH 5JOFB 4R6UA 1AD9B 2VLKA 3KYNA 3LIZL 4M62H 2P8LB 1NFIA 1T22A 4KI5E 1NCAL 2OK0L 5CUSH 3H3BC 4QRUB 4IMLB 3W2DL 1HCFX 2AI0L 3MC0A 4HC1L 2EIBA 1B0GA 3QUXC 1YNKH 4XNMA 4JFFE 3DURB 4F33A 4HJGB 5E8NB 4MAYC 3OAUH 4P2OD 4X6FB 4HH9B 1MLBA 4MA7H 4Y16B 4HGMA 3VFTA 3ZTNH 1WWAX 2VISA 5FYKH 4DN3L 4YFDB 4MCZB 2VABB 1MAML 4ZQKA 1Y18A 4LSRL 3WE6A 5DI8B 5FYLD 5T33L 2HFEB 1VA9A 4JZJB 3QG6B 4XCEA 1UQSA 3ARBA 5BJTB 2MOVA 5F7MC 5FKAA 3CXDH 1F6AB 1IGCL 5KAQG 2B39A 3DX9B 4FQXC 3FMGH 3QISA 2VZ3A 5SWZB 1FZJB 1HILB 2EC9U 4FQHA 1HSBA 2O5ZL 2E9WA 4QHNA 1J8HE 3PWUB 5GRUL 3FB8B 2I5YL 3RWGA 4K7PX 5HI5C 3ARFB 3C8KB 5TFSH 3FOLB 3DV4A 3VE0A 5C0ND 5D71L 1OWRM 2F74A 3EYQD 1MPAL 5L2KD 4WNQA 1FNHA 4H88H 4E0RB 4DUXA 1ZWIA 2A6IA 1UB6A 2CK0L 4J3SA 4RGMC 4EUPH 4BJLA 5DHYB 1OAKL 4NQDE 5F1KC 4GLRI 1I7RB 3AC0A 3L95B 5T1LD 3AS2A 4AIZA 4K7FA 4CJ0A 3O6FD 3BZEA 3INUL 5EB9A 5E2TL 2BX5A 2ZG1A 3H9HB 4LLDA 5C09D 3VFWB 1BVLA 1MFDL 4N0UA 4X7TA 5GRVL 2BK8A 3MMEB 2C3XA 3QRGH 5ENWB 4HFUL 5F8QC 4LVNB 5IMOA 5C0RH 5IJKA 4LCYB 2AXGA 3ARGD 1YPZE 3BWAA 4PBXA 2DOCA 1GPOL 2YD8A 1B4JL 2IMMA 5ICXB 4MVBA 4WI2A 2FEEI 2D0HA 3NPSC 2X70B 2XN9D 1QNZH 1T7WA 1JFQL 2X1OA 2B1HL 4XXCA 3NZ8A 2HAZA 4JVUA 5I8KH 4NSKB 2YRPA 1I1AC 3O4OB 1DUYB 1UACL 1DBML 1HXYB 5JIHA 3QG7L 3WN5B 3G08B 2ORBL 5AYUL 2I24N 4JRYE 3R4DA 1IGFH 2BDNH 5FYJU 2DB8A 5ACZA 5I1CL 1MNUH 3S6CA 2AEQH 3CFJB 4XC3L 3RWJB 4CN6A 4YNYA 4HUVB 2YK1H 5E9DD 3WE6B 1NCNA 1J0ZA 5ALBL 1R3HB 4R9HA 3GBML 3MLYH 4GO6B 2EDEA 1GZPA 5J0BA 4OD2A 1BAFL 4K8RD 3NABL 4B50A 2HRPL 4K3EL 1P2CA 1ZEAH 3T4YB 4M5ZH 3HZMB 5L2JA 3X3FH 4OIBA 4XAKE 4F57L 1MELA 5I75B 3BH9A 2H3NB 4QTHA 3P11L 1IQDA 2X89A 3UBXG 2QADD 2JIXB 2BVTA 4OLWL 4PJ9A 4OGYH 2YD5A 1U41A 4OV6F 1ZT4B 4M62L 5I73C 2F5AH 4GRLA 5F7WC 4JFFA 3QUZD 4NM8H 5CUSL 3GSWA 3RTQA 3TNMB 3WFHA 1YNKL 3FRUA 2X4SB 2A73A 4PJEB 3WXWL 3OAUL 3TJEH 3BZEB 5CGTA 1CI5A 4ZNEE 3ZHKA 5B4MC 3ZTNL 2XNAA 1FZMA 2ZKHH 4RZCA 5FYKL 3REWB 2EH7H 5L7XH 2P5WE 2X4OB 1SY6H 5IHLB 1S78C 1UWXH 4P4RA 1NGZA 3ZL4H 1OTUC 1JGEB 3UTTE 4KXZI 2QQLH 1VFAB 1J8HA 3CXDL 2HJLA 5E99H 4XNQA 4P46D 3JTSB 5ISZE 3T8XA 5FCSH 5KSBB 5I1IH 2H1PH 1YN6A 3U30C 3IDJA 1JFMA 3OKLB 4UQ3A 2MPAH 1N8ZA 1HHJB 5TFSL 3VFVB 3QIBC 3CSYB 3ZKQD 1AGCB 2C3VB 4JCMA 4NQDA 5A2FA 4TTGA 5BZDA 4H88L 1WCBB 2FEDD 2D7PA 4RQQB 5T5NG 3VGHA 4Z7WF 5B38B 5K9OA 1EXUB 4K9EC 2BSSA 3VWKA 1UZ6E 4ODXB 1XGPA 5C6WH 3IDMB 1QO3A 2DIBA 2ERJC 3MCKA 5EUOB 4CVXB 4P3CH 4HG4J 2B1AL 4CNIA 1NEZB 3CFKA 5DFVD 1T20B 4EXPX 1HHGA 5F1NB 5HJ3B 1FFQA 5ICYA 5FK9A 4Y4KA 4R90H 1P84K 1MCWM 5D7IF 3EDJA 1YPZA 1UG9A 1MAJA 3BW9B 4PGZA 1OTSD 5C0RL 4MD5B 2XG5A 4OD2B 4CGTA 4HSQA 4GAYB 2IH1B 1UC6A 3OPZH 2OSLA 3I85A 3MA9H 3WHE1 4BQ6A 4YPGA 4GBXB 3STLB 4PRHB 5I8OH 1A7PH 3GJEA 1DP0A 3FO9A 3JV6B 3SDAD 5E94A 4FFWD 4ELME 1QNZL 3VGDA 4U7KA 4JRXD 1CDCA 4PJ9B 4R0LB 5DRWA 4JN2B 4L8SC 5EA0H 4ONHA 5I8KL 4GRLB 1EBAA 3M17A 2V6HA 2FWOB 3GKWH 3FO1A 4JRYA 1LEKA 3VXMB 3O8XC 4WW2B 1JGVH 2BVOB 1P9MC 5DMGC 4XVSL 5AD0A 2EE3A 5D1ZD 2WMPA 1IGFL 2BDNL 4ZO6A 2DQJL 1UZ6F 2NPLX 3GMQA 1MNUL 2AEQL 2DMKA 1V05A 4PLJC 1RIUH 2CGRH 4KVCH 1A3LH 1YNLH 2ATPB 1WBYA 4K07A 4XWGH 4A2MA 2QV2A 2YK1L 3IJYB 5F9WB 4OFYD 5HYSA 3RL2B 3KJ4C 4WFHD 3MLYL 5HSFA 4MA8H 4F8QA 1U8HA 5KOVC 4FP8L 1JZ5A 2FSEB 3WLWC 1L9NA 1IGYA 1SYSB 4OUUB 1ZEAL 4P9HH 4R8WH 1Q9KB 3ZTJH 1A1NA 4M5ZL 4XP6H 5KS9B 3X3FL 4HBCL 2AKRA 1Q9OA 4KK8C 3QDGD 4KHXH 4J1UB 1KN2H 2LV4A 3LPGA 3CIQA 5GGUA 1A5FH 2OMNA 4HZLA 2KQMA 2G60H 4XX1G 1NJ9A 2ICWI 3GMRB 1UWXK 4OGYL 3VXNB 1EEZA 2F5AL 1NL0H 1RJZB 7CGTA 5HYJB 4NM8L 5FYLE 5EOTA 1S5HA 3EGSA 1Q0YH 5TQ2H 5EU7E 4ZNEA 2WUCH 1WQVT 4NQXB 1P69B 5D7IA 4W4NA 4WI8A 3V4VH 4ZAKA 2P5WA 3VGGA 3TJEL 3DO7B 3TFKC 2NY4D 3FB5A 5KG9B 3WHXB 2CLVB 2ZKHL 1H5BC 1U8KA 1YPZB 2PTTA 2EH7L 3PE9A 4FN0A 5L7XL 3UTTA 4F2MA 2SEBA 2VLLB 3IDNA 1UWEH 5HYQB 1SY6L 3ZT5A 3VFOA 4FQXD 5D5MB 3BQUB 3GBLA 4WFFE 1R3LA 5J12C 3DI2B 4OFVA 3ZL4L 5GISH 4QHLB 1ZMYA 4PDCE 1QSZA 2E7MA 2QQLL 5FCUH 5ISZA 3ZKMC 1ZHNA 3W9EB 4AJ0A 2QEJA 1A4KB 5E99L 3TF7A 5D1QD 4OBSA 5GRYA 4P4KD 3KWWA 2YUZA 5K9KB 3IVKA 1CFSB 5E94B 5I1IL 2H1PL 1T7ZA 3D85B 4KZDH 2IPUK 5DC9B 2MPAL 5C09E 3WFBH 1NANH 2NNAB 3WJLA 3PHQA 4GG8A 5GQBA 1UYWH 1RZ8A 4Q6YA 1WV7T 1NGPH 3I50H 4JFYA 3CJJA 3VXRE 1HH6A 1G1CA 1DQJA 4IJ3C 4M8VA 3LH2H 5DMIH 5EBMA 3UTZB 32C2A 3ULUC 5K33A 3FOMB 1G84A 2UWEE 3HS0B 4P3CL 5JW4N 1G9MH 2V5TA 4YDLB 3TZVA 5F3HB 2I60H 3K4DA 4UUJB 5HHPB 6FABH 4X9HA 2XN9E 4ZD3H 5HHOD 1X7QB 4JM2D 5GGRY 3MYJB 1H0DB 3TVMC 4R90L 2DKUA 4YWGH 2ATKB 4EVNA 5DSCA 2EYSA 4LPWA 2YHGA 3HMWH 3RY6C 3TIDB 1HXMA 1F2QA 3TBSB 3OPZL 2VWEC 3V5DA 4ELMA 4Y4HA 3MA9L 4RMRA 4WRLA 3WJJC 5SWQB 1Q9OB 5I8OL 4KJQC 1A7PL 1U3YA 1FGNH 4JN1H 4XAWH 1SJXA 1I1AD 4JE4B 5JXEA 3NTCH 4OZFH 1NJ9B 2WW8A 4PJ5D 4Z77A 1T5WA 1FDLH 5DC0A 5EA0L 4NWTH 2WV3A 1AR1D 1FO0A 5E9DE 2LAAA 3GKWL 1Z9OA 1JGVL 5D1XC 4BZ2H 1FH5H 3MRGA 5CFHA 3FT3A 1XIWB 4R4ND 2EKSA 2OP4H 3PQYB 3RQ3A 3BD4A 2CJUH 3IDYC 3MRIA 3OQ3B 3BEWA 3D0VA 2UWEF 1PG7W 3ZE1E 3B8SA 4KC3B 1PJ9A 3KG5A 1RIUL 5I1EH 1A3LL 3UTQB 3GUTB 1FPTL 1MY7A 1YNLL 2W0KA 1OGAD 4U33A 1UEMA 5LVEA 4L1HA 4R4FH 3PUCA 3FCTA 3VCLB 4MA8L 3IETB 3U1SH 5C92A 5DD1H 5DUMH 2APTA 3L9RB 4P2OA 2X4PA 4JLRA 4P9HL 4R8WL 2IG2H 3IVKB 4XP6L 5J57B 3NCMA 4D0DA 4POZD 3ZSTA 1WICA 4KHXL 4OZ4A 2YEZA 1NAKH 3MQIA 1P53A 4CBPA 1A5FL 2FDBP 3SGDI 2G60L 4FFEX 1G9NC 4UIMB 5C0IA 3X13A 5DUBA 2OI9C 3KHQA 1JHTA 2OBGA 4OM0H 2B4CH 1EJ6A 1CD1A 4IRSA 1G0XA 5E1AB 4NN6C 3X14B 1KCSH 3BIKB 3QZWB 4XPFH 1DUZB 3PGCB 5FAAA 4EKXA 4R2GD 1Q0YL 5TQ2L 2WUCL 1TNMA 5H2BB 1CGTA 3V4VL 4JHAL 4U2YA 2GAZB 5CJXC 3H0TB 4NNPL 3ZE1F 5D7LD 3CUPA 4Y5XB 3IDIA 4MB4A 4PB9H 5D2NC 1LO0H 3Q1SH 1W0WB 3CCHB 4KROB 4CMMB 3F6IA 5IW6B 1OTTD 5E03A 1UWEL 3T09A 4ZXBD 4JY6A 1D6EA 4DZ8A 4LPUA 1GCFA 4M8QB 3C60B 2K7QA 1ORQA 5GISL 4G6AD 2DWEB 2IAMC 5FCUL 4RA0C 5F7UA 3CFDA 1JPFB 4J3XA 3BP5B 3O6FA 3PWJA 1T0NB 4HX1A 5C09A 1JN6B 3QIBD 1AC6A 1F4AA 3QXDA 4UILH 4N9GA 1BFTA 1GVIA 2XXMB 1TENA 4KH2A 1M6OA 5D7KD 5EZOH 4YDIL 2OL3B 4KZDL 3VGAC 4CU6A 3VXRA 2WBJC 3WFBL 5HDBF 1DN2A 1UYWL 5GJTH 3ARGA 4QNPE 2PW1A 4PRBA 3DLQR 2EO9A 3TT1H 3MOAH 3U4EA 4O2EB 5T1MA 5IESH 1NGPL 3TH3T 3I50L 3LN9A 2UWEA 2X7LB 4H0IA 5J89A 3RRQA 3E0GA 2KL6A 4UQ2A 3RWFA 3LH2L 2ZOKB 1X5YA 5DMIL 4X4YB 2XN9A 3WUZA 1KTLA 2HVJB 2UUDK 2IQAB 3MRIB 4RNRA 1BBDH 4PR5B 3GMOA 1G9ML 4FNLH 4NT6B 2I60L 3CH1B 4JFDE 6FABL 3PNWA 1IGML 1HI6B 4ZD3L 3OAYH 4AQ1B 1KIRA 1P1ZB 2R56H 3LV3A 1DVFD 3JWOH 4JGMA 4YWGL 1UJ3A 3RKDD 3LB6D 5EO0B 3TM6A 3HMWL 3TJHD 4F7CB 4JLRB 1EPFA 1IAOA 3X11A 3MNVB 1ZS8A 1KCGC 1OP5K 4HPOL 3F7YB 1FGNL 3P73B 2OR8A 4JN1L 4XAWL 4XRCA 5MENB 4L8DA 2VJXA 4KKBD 5E9DA 2NY3C 3NTCL 5JHLH 1FDLL 2FL5A 5FHBH 3GRWH 4IRSB 2Q86B 1MCWW 1REIA 4NWTL 4OB5L 4NHCH 4DK3A 4QNPF 3MFFA 4N8VB 4NNYB 4BZ2L 1NMAH 1BZ9B 1MJ7H 4V2BA 4X5WB 1FL5B 3OXSB 4MX7A 3ULSA 2F15A 3IU4H 4ZUWA 2OP4L 1TVDA 2CJUL 3MUJA 2PO6D 1T0PB 8CGTA 2EECA 3QDGE 3ALWA 3GO1H 3PWVB 2QHRH 1ZHLB 4WO4B 1I3VA 4L3EE 2H6PB 3PHOA 4NZUH 4XC1H 5ILTL 3VWJD 4R4FL 5BS0B 5MI0C 1NBYB 1FLRL 3SJVB 4EXKA 3SKOB 3L3KB 2QSQA 3U1SL 1T0MB 4M6AA 5DD1L 5DUML 5CIPH 3PWJB 5IVZA 1N6QH 3F12B 4W6YB 1RJCA 4TSCL 2R39A 2IG2L 1NAMH 5E4EC 3OJDA 4MJ6B 4FFZH 5TE6L 1NAKL 3VFUA 4TUJA 4AL8H 5J11B 5JPMA 4X7FC 1NUFA 2W91A 3FQNB 3TO4C 4Z95H 1A9BB 3I84A 4OM0L 2XY1A 1KCSL 2YN5A 4XPFL 3ZMRA 4YQXH 4GW5B 4UIKH 3U2SB 1KB9J 5EUKB 3L3JB 5GIRB 4WCYH 4H1LB 4YE4H 4HW6A 3CNKA 3F5WB 3UC0H 1JVKA 2VE6B 2XWTB 4JPKH 5E1HB 5INCB 5A3IC 1CCZA 1M7DA 1UB5A 2Z8WC 4PB9L 1R5IB 1LO0L 4PY8J 4ZSOB 3SPVB 1J1XH 1B0RA 4LSQH 1MRFH 2HFFA 3LQZB 4RAHA 5GGRA 3K1KC 2VZVA 1N0XH 4IHOA 1FZKB 1L7TH 1PBYA 3C6SA 1IM3B 5IW1A 5C0EB 3G5YA 1XFPA 5HTSA 2ZPKH 4XBEH 1I3UA 1I8KB 3K3QA 3OAYK 1G7HB 2W60A 5TGBB 5EZOL 3CVHH 4MD4B 4NNXB 4MMXC 1KYOK 5BW7C 1OB1B 3L7EA 1KPUB 3P77B 1UM5L 1ERNA 2J3SA 3UZQA 5GJTL 3M45A 3Q3GA 3MOAL 5IESL 3FRPG 1CDYA 5D93C 1WBZB 3U48A 1JUFB 3V0VA 3HE6C 1DQDL 4XB8A 3SDAA 4U1NB 1P7HL 3KPPA 4KQ3H 4HJ0D 1K8IB 1BBDL 1MFNA 3DETC 4YBQC 3U36A 4ZFZA 4FNLL 4HK3N 2JJUA 1X5HA 4F7PB 4NO2A 2HKFH 4MSWB 2A9NH 4DCQA 2NY0B 4PJ5E 4EN3B 2R56L 1SQ2N 1GZQA 3JWOL 1PKQE 3IRPX 4GRWH 4JZOA 4L4VD 5C9JA 1Q9WB 3X3GH 4JG0H 5D1ZA 3T65A 2VDQL 5I1DB 1EV2E 3DUSB 1FCGA 1IL1B 3IJSA 4HDIA 4LHUB 1TVHB 1KNOA 5D8JH 3KPSD 3MUGA 1HDMB 1RZKC 1AXSB 3CDGA 4OFYA 3MA7B 5J1AA 2KPNA 5JHLL 5DJXA 4HIEB 5FHBL 1FL6B 1XGUB 4JM2F 3GRWL 3HA0A 4OV5A 3FO0H 4NHCL 3L3GA 4CADB 1HSAB 4MD0A 1IEBB 1IAMA 3AGVA 5SWSB 4P5TB 1NMAL 1MJ7L 2LABA 4QWWC 4HF5H 3VRIB 3QDGA 3IU4L 1VENA 4I8DA 3QDMD 4TNWK 3WNOA 4PD4K 3RIAF 5JORB 1YQ2A 3IXAA 4ZODA 1XF4B 4HQQH 1XF5A 1S7TA 2PCPB 3GO1L 5EO1A 1S9VA 2QHRL 1SVCP 2FX8H 2BOBB 3RHWF 4XC1L 4HWZB 4WV1B 4ZDHA 3ZKNC 5IR1A 3C5ZD 3E8UH 5FIEA 5BQ7A 3C6LB 3IFOB 1X44A 2X2YA 3WD5H 1AD0B 1AHWB 4L29A 5E7BA 1CDUA 3V2AR 1N6QL 2DI7A 4WJ5A 4YBLC 1NAML 4FFZL 5BO1H 4GKZA 5EZLA 3U7WH 1KJ3H 4LCUB 3EJZC 4AL8L 4YAQA 3MBXH 5JOPE 3WUWG 1EMTH 4Z95L 1TQBC 3KJ6H 1L9MA 4Q2ZA 3B9KC 2W1NA 3F7PC 4JFDB 1NC4B 3GI9L 2IADA 4JAMB 4EBQH 5D1QA 4UIKL 3E2HC 3Q6FB 3JV4A 4YQXL 4P4KA 3PIQB 1CLOH 3IFPB 2V9QA 3MV7B 4HLZH 5CHNA 4WCYL 4YE4L 2RHEA 4AM0B 3UC0L 4R3SA 1XF2B 1AGEB 1D3CA 3ZE0F 4JPKL 3RU8H 1W2KT 1I9EA 1JMXA 4KK6C 5D6DC 2ESVD 3BI9X 3AREC 5JDSB 3JWDH 3LHPH 4LLUA 1J1XL 2EEDA 4LSQL 1MRFL 2W0FB 5LJYH 5ALCL 5F7EH 5LG1A 1KJVB 1N0XL 3CK0H 5IB4B 4AEFA 1UM4H 4ISVA 5CGYD 2VQTA 2BCKA 1L7TL 4M7LH 5JNYB 5TF1H 4BFGA 4MJ4A 4JFPA 5C70A 1X5FA 2XWBA 2YZ8A 5HHOA 4DVBA 5GSVB 2ZPKL 4JM2A 1E6JH 4XBEL 3QIWB 3T3ME 5E4IA 3RP1A 3RGVB 1S7RB 4X98A 1C08A 4LRIC 4I0PB 5J1AB 3CVHL 4RSVA 5K93A 4Z7QE 4XHJC 3MRKB 5H37G 2BNRB 4YIQA 3OHXB 1WWBX 4R4BB 2GK0B 1CT8B 1BQHB 2G5BA 4J4PD 4L3AA 5IJVB 3HUJE 1I9JH 1WZKA 1F3DJ 4XNYH 4LEOB 1T1ZB 2ARJA 1YUHB 4U0RB 3FONA 4PP1C 4L3EB 3GSQB 4KQ3L 1MHPH 2FATH 1KOAA 4PJ5A 4KTEH 1XF5B 3MUHL 4JDTH 2GJ6B 1PKQA 1OSZB 2HKFL 2H41A 5F9DC 2A9NL 2C3WA 2FO4A 1X5GA 1KPRA 2BNQE 1CL7H 2Y23A 3GSRA 4PTTA 3T04D 4R7DB 3GSOB 3M07A 3WNMA 5J9PA 4JDVA 5KJRH 1MVUA 1O7VA 3X3GL 3AUVA 4JG0L 3EOAA 2GSGB 1JNLH 2HN7B 5IHZB 4HBQA 2NY3D 4NO5B 4ZFOA 3H9SB 1CE6B 2GI7A 2XTJC 3DRTA 1EEUA 5D8JL 2DL2A 3FFCD 3QXTA 4GKZB 4IRJA 1HYSC 1F42A 5KBNC 2RFXB 4NOFA 3MRPB 1RUKH 3VJ6B 5BVJB 4ZUTA 4YHYB 3D0LA 3FO0L 3QWRD 1NCCH 4X6CE 5FO7A 4LSSH 5HVGB 1YEJH 2XKNB 4M5YH 5ETUB 4I2XE 1S9YA 4C56B 5B8CA 1UEYA 3HUJF 1E4KC 4WUKH 4HF5L 1TXKA 1BX2A 4KGLA 2WINA 1MH5A 4GKNB 3S5LA 4PJHB 3B2VH 1MHHA 1EIBA 4HQQL 4TVSa 1I4FA 3FB7B 5FA3B 1IJ9A 1GYAA 4RMVA 4UBDC 2FX8L 3CC5A 5I71C 2G9HB 4Z7VE 1I85A 2VZSA 5CJ5A 3DVNA 2YPLB 4ORGA 1D5ZA 1FNGB 3R06B 3E6HA 3E8UL 4ISVB 5BXFB 5DHVH 1K5NA 3O9WC 3PABA 1BZQK 1D5IH 3WD5L 1FFNA 3QUYB 5ICZA 1E0OB 4X8XA 1H3TA 4Y2DA 2PXYB 3NCCB 5D7LA 3CMGA 4Y19D 4W70A 1RZGB 3TO4D 3HRPA 4KKCC 5BO1L 1LVEA 4S2SA 4ZXBA 5C3TA 3U7WL 1KJ3L 3C9NB 4X80H 4QYOA 3MBXL 1YY8B 4MDIA 3PJSA 5ESVB 4EQ3A 3VXSD 5CKGA 1EMTL 2KBGA 1NBVH 5J6GA 6CGTA 4G42B 5C07D 3KJ6L 4K3GA 1KXVC 1LEIA 2OTPA 3QQ4A 2P43B 4EBQL 4LLWB 3PWPD 1DLHB 3RUGE 5CIPB 5IB3A 1AJ7H 1RURH 1CLOL 1PLGH 5C0AD 1C5DA 4D9RE 2W07A 1T04A 1WISA 1NAMB 3CSBA 1OP3K 3SKMB 5I9QB 4TSAH 3RU8L 4RIRA 5LGJA 3FN0H 3MV9B 1K6QH 1GGCH 3MBED 3JWDL 3LHPL 4C4KT 1CXFA 5F7EL 3P0GB 1MVUB 1EAPB 3LEXB 4FQCH 5BV7H 4F7MB 4QXGH 4Z7VF 4MJID 3CK0L 4NFBA 3BUYB 1QVOB 5E6ZA 5I1KH 1NEUA 1NPUA 4M1CD 3DX6B 4M7LL 1QSFE 1F8TH 2APXA 5TF1L 3VFNB 4GKSB 1W0VA 5GZOC 3NFNA 1ZHBB 3O81A 2YD3A 4OGZA 4JREB 1E6JL 1OGTA 3ZKXB 3NFSH 3E6FB 2VTFA 1DVFA 5C8JA 3J8F7 3D39D 3HUJA 3P4MB 1AQDB 1BGXH 1ULVA 1A6TB 4RMQA 5TF0A 3K8MA 2BVYA 5DRZB 1U95B 5DD3H 4UT6L 4YBQD 1I9JL 1XT5A 5TE7H 2L0DA 4XNYL 1OW0A 4X6EB 1MHPL 2FATL 4ZUVA 4KTEL 3T08A 3LOWA 2IFFH 4JDTL 4Z0XB 5E8EA 4QRTB 4YX2H 3CVHB 3KPSE 1CICA 3IKCA 3MLSH 5CJQH 2B5IC 1F4XH 3TO2B 1DANT 1U8MB 1CGXA 2VITA 4MGXA 1OQXA 1JYWA 3QXWA 4EI5D 5HGDA 1FNEB 4QXUL 1FFNB 2QSVA 1JNLL 2PO6A 4QXWA 4EIGB 2Q76A 4N0CC 1WGOA 4KU1A 3N9GH 5TDNA 5EPMA 4HUUA 4JZNB 1IFHH 1V3MA 2ZUQB 4S2SB 1R3IH 1FIGH 3ECBA 3VWJA 5KVGH 5C9KA 1RUKL 1R5VA 1NANI 4I2XA 3ARDD 1K9TA 3RVWC 4GRWB 3VD5A 5TDPA 1NCCL 1T1WB 3BJ91 5C0BB 4LSSL 1ZGLA 1KB9K 1YEJL 4X5XB 5IG7A 4M5YL 2FJGA 3HC0B 3AXLA 2IFGA 4WUKL 4N1EA 1U3HC 3K2UH 1S9XA 4D8PB 1PD6A 3DGGA 5CZVH 3MJ9A 4G8FA 3B2VL 3OWEA 1J18A 5HPMA 4Z7VA 4YZFE 3VH8B 3LPWA 4ZFFA 5LGJB 3GSXA 4JQXC 1FO0H 4XXDA 4MDJB 4P48A 1WFOA 3HHRB 3GGWB 2DRUA 1OLLA 4C54A 4PG9A 5F7NC 1U91A 1QRNE 3BIBX 1VFBB 2R69H 1T3FB 1NCDH 5CS7A 1VDGA 2DLHA 3IU3A 5DJ2A 3DO3A 4HIHA 5F9AC 1QLRB 4WWKB 5FF6A 2YKLH 2HLFC 3WL9B 5C8JB 4NM4H 1TZHA 1D9KB 2BVQA 2W9DH 4DKFH 3DWTA 4MQXD 2VXQH 4X80L 4JFOA 2ESVE 4V3EB 2C4FU 1WTGT 5FOJA 2CD0A 1NBVL 5DRXB 2P46B 3IF1B 1U58A 3T2NH 3BZFA 5E6IC 1KCUH 1XF3A 5KN5A 3WIIH 3WBDA 4PLKD 5GGVL 5I1LA 3NCBB 1RURL 1PLGL 3BP6B 3UYOD 3QNZB 2BNQB 2N7AA 3CZJA 4HMDA 4HKJA 4P5KB 3IKCB 1H3PH 5GRXG 5I2IB 5JA8B 3FN0L 1K6QL 1GGCL 5CP7B 2VITB 1JPST 4X6DF 5F1IB 1QSFA 5E8OA 4FQCL 5BV7L 2UZYB 2NYYD 4QXGL 3SHSA 4HGWB 2V7HB 5D9SB 1Y0LB 5I1KL 2EICA 4DAGH 3I75B 4KRPB 1I8IA 4OKVA 1F8TL 4U6HA 2K1MA 1OT1A 4K23H 2H2PD 2XQBH 1RK0B 2P5ED 3FJTA 3NFSL 2V5SA 4X6CB 4H26A 3OKEA 3MLVH 1S7SA 5BZWA 3D2UD 9CGTA 1K4DA 4ZS6D 4J12A 1AY1H 5D4QA 1BGXL 4LLYB 3QFDB 4R96A 5GSRA 5L9DH 5HYEA 4XPAH 1C8PA 1WC7A 5DD3L 3U6RA 4Y5VB 3DECA 3PP4H 4MLIA 5TE7L 4Z76A 4NKMA 5HGAA 1JV5A 5E6YA 5K9QG 2FIKB 5E00A 4AEIH 3KPSA 2Z91B 4LVHB 1J0KA 43C9A 5C0CD 1WITA 5HPMB 3N85H 2WLYA 2IFFL 1RK1A 3GSXB 2P24A 3SCMA 4YX2L 3MLSL 1A3RH 5CJQL 1F4XL 2A83B 3MR9A 4NRYA 4FQ2H 5F1SA 4J7RA 4P2RD 3TBYB 4LKCB 5IVNA 2QJDA 3VXOB 1AXTH 4TVPD 2NCMA 4XH2A 1WT5A 2DI9A 3EFDH 2C7UB 3S4SA 5IQ9A 2QLVB 3N9GL 5ESAB 4L9LC 1A6AB 4WW1A 3FQWA 1IFHL 4OKDA 5T1KB 5DMJB 1LK2B 3RWIB 3MRRB 1AH1A 4JJ5B 1NGWA 1R3IL 1FIGL 3UX9B 5KVGL 2W9LA 3RUGB 2CUIA 4FMKA 4Y1AB 1NCBH 1GC1H 4YHMH 4JFEB 2PETA 3K2MC 2EXWD 3I2CH 2VLRB 3G5VA 3LKSB 4KHTH 4NJ9H 1L7IH 1MHEA 3L3HB 3PDGA 4NZRH 3GMNA 5IOPB 3BZDA 2FYYA 2X42A 4BSWB 3K2UL 3U46B 1AP2B 1LDPH 5CZVL 4X6DA 3QEQB 3H7BA 1UXWA 3LN5B 3MSPA 4I18A 2NY1C 4BK4A 3VRLF 4K8RH 1TJGH 3VXUE 4U1SA 1FO0L 1QRNA 2MCG1 5TQ0H 5ID1B 3KPRD 2EE2A 3VXSE 2MNUA 3F8UB 2UY7A 3O3BB 5C07E 4I3GA 4PJBE 4ZPVB 1UKQA 2R69L 4FHBD 4MNQD 1NCDL 1G9MC 4LDEB 4IOSD 3CFBB 5E7FA 3ARVA 3WFCH 5EBLB 2NW2A 2P7TA 5CEZD 2ESVA 2IGFH 2FB4H 2YKLL 4XCCH 4NM4L 1S7SB 2W9DL 2BHYA 2Y7QA 4P2QE 5MERB 4DKFL 4JCLA 3QB7C 5FKPB 3WLBB 2VXQL 1DE4A 5JTWA 4HHAA 2Q7YA 1I1YB 5E2UH 4CVUA 4ZYKA 3VXPB 3K46A 3OKOA 1U8NB 4LDOB 3T2NL 5DHVB 5HGGS 1KCUL 2Z92B 1SBSH 2ZZUT 2CDFB 5GS2D 3WIIL 1Q8MA 3EOBA 1FZOA 1EA9C 3QULB 5IM7B 4C57C 5DURB 1GGTA 4ETQB 1A22B 3AU1B 4NZJA 1H3PL 1YDPB 1F3JB 2B8OT 1LO3L 4IBLT 3SEPA 5GS1A 4P9MH 2XZCL 4J4PA 2V2TB 4Y8AA 5CJOH 3ROOB 4XGZA 3T0AA 4O2FA 1MIMH 5GZOD 5DEFA 1AHWC 4RFNB 4XT1C 4P57A 3MV8D 5J3HC 3T1WA 1WZMA 4Z0BH 1GJIA 2BSRA 4NC0B 2ITDA 2EO1A 4DAGL 4WHTB 5IQ9B 3GKZA 1ZLUH 2AK1H 2NW3A 4WI7A 3LRSA 2PYED 4Y5YA 3RZCD 4K23L 4EUPG 3ARUA 5CAYB 2XQBL 1FNAA 3D25A 4Z7WB 2YC1A 1RULH 4U1MB 2CRZA 4HK0B 5I0DA 3MLVL 2VUYA 3GM8A 1FAIH 1AY1L 4PRPD 4MJ2A 5IK3A 3MNZB 1PEWA 4ONOA 3QR2A 5D7JD 4BQ8A 3TBWB 5L9DL 5BV7B 3VDBA 4G7YH 1M71A 2H26B 3DMMB 4XPAL 1GRWA 1T21B 1KCVH 1XGQB 4JJHA 3GEWB 4UDUB 3BZ4B 3PP4L 3WEXB 4L4TD 3FQRB 4P5MA 2V5RA 4AEIL 4PJ8B 3M1BA 3MCLH 3OX8B 5GGSB 1FG2B 1JYVA 3QPQC 3W9DB 1QHPA 3N85L 3ZO0A 4PJFF 3MJ7A 4FTVD 1QRNB 3QWRA 2B4CC 4G8EB 1CGUA 3OR6B 5DRNB 4FQ2L 4K7PH 2H9GA 1AXIB 3T0ED 3X12B 4OCWH 3D1MC 1MLCB 2RR3A 2Z31D 4WHYH 1E6OH 3L7FA 2XPGB 4X9FA 1RZIB 2V7NA 2XT1B 5CBAA 3B5GA 3EFDL 2AJZA 2QTEA 3IXTB 2ZUYA 4BKLA 3SGEH 4XTRC 3V79C 4PJXF 5JLZA 3RVWD 3L5XH 4XCYB 5GGTL 4FS0A 3NA9H 3SGJA 3NIFE 1DE4B 5IBTH 1NGXA 4PS4L 1B2WH 2ENYA 3P9LA 4N1CA 1NCBL 1GC1L 4YHML 4Z5RB 2EDWA 3VG9C 3BPLC 3I2CL 4RFEB 4NJ9L 4KHTL 1L7IL 4Y19A 4NZRL 2JJWA 1IC7H 3QI9D 3QZWG 1QEWB 3HE7D 4JO2H 3IGAB 2ARWA 4HCRA 2Y1VA 3VXUA 1LDPL 1HNFA