3L9RA

Crystal structure of bovine cd1b3 with endogenously bound ligands
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
275
Chain Sequence
VFQGPTSFHLMQISTFVNSTWAQNQGSGWLDDLQIHGWESDSGTAIFLKPWSKGNFSDDEVTELVDLFRAYFIGFTREVQDRVNEFQLEYPFVIQVTAGCELHSGAIESSLRGALGGLDFVSIQNHSCVPAPDSGSRGQKFCALTTQYQGISDIIERLLSETCPRYLLGVLDAGKAELQRQVKPEAWLSSGPTPGPGRLLLVCHVSGFYPKPVRVMWMRGEQEQPGTQQGDLMPNADWTWYLRVTLNVAAGEAAGLNCRVKHSSLGDQDIILYWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine CD1b3 with endogenously bound ligands.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune response
molecule keywords CD1b3
total genus 76
structure length 275
sequence length 276
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l9rA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l9rA01
2EO9A 5ICZB 5AD0A 1ZAGA 5D7IF 5KSAC 2R0KL 4JDTL 5IMLB 4P5TC 4MAYB 3VFGH 1RK0A 1X6LA 1HHJA 2B4CL 4E0RB 4C57C 4JO4H 3ZDXF 4S1DC 5IOPB 4LCWE 5DD5L 2H3NB 2GJ6A 3D6GA 3O9WA 1OT1A 2EYTB 4FG6C 4I1NB 3ULVE 1DSFH 5HYSG 5JHLH 3U6RB 3AGVA 5ISZA 1EBAA 1HDMA 3W11C 3RGVB 4GS7B 2JF1A 5GZNC 4KKNA 1X5ZA 4LBEA 4P5MA 3SE8H 2E7BA 2J3SA 1KXTB 5GJSL 5HHPA 2BFVH 2VSCA 4F15B 1VFBA 4ONHA 1N6VA 3SE3C 2VDLH 3DHJA 3CVHB 4LMQE 2QKIB 3GMRB 1PQZA 4ORGA 4UIKL 5E9DD 3LD8B 2EXYC 4N1HB 5L8LB 4RA0C 2ADJB 3VDBA 1WCBB 1Z9LA 4O4YL 3D0VA 4NN6C 1FZMB 2X4OB 4RDQF 2CIIB 5IHZB 4XVUD 2XI9A 1YEJH 2HVJA 4KAQL 4CN6A 1XF4B 2WQ8A 5ACZA 3FONA 1KJ2B 1NCUA 1JPTH 1NFKA 1FE8L 3DMMC 3UZQA 4OGXL 3VXSB 1KN4H 5JUEH 4FFWC 2W59A 4YHPB 1JF1A 5DRNB 3IDIA 3RAJL 4Y4KC 3OJDA 3IDNA 1YECL 4W70A 5E9DB 3OHXB 3O45B 3MQIA 3GHBL 3SDXA 3GB7A 3F6IA 4L9LA 3KS0J 4NDMB 4UV7H 2XN9D 5F89B 2V2TB 1DDHB 4R7NA 1U3HB 2PXYD 1RUPL 4JZOA 2EDQA 2PR4L 2ZSVA 4P3CL 4M9PA 4I5BA 4H26A 2F8XC 4RZCA 1NFIA 4ZSOE 4MJIB 3DVIA 1MCQA 4KUCD 3F6LA 3MRHA 4L4VD 1UEYA 3REVB 4NGHH 3ZZ1A 4NO3B 1HSBA 4KMTH 5E6IB 2A83A 3IDNB 1QKZL 1DQLH 1P4BH 1YEFH 4JY5H 2FNBA 3FKUS 1L0YA 3D0LA 4OZGF 1CFNB 1UACL 1K8IB 4TNWK 2FATL 1Q0XH 3JSSA 5AZEL 3SE3A 2DQGL 1RIHL 2P7TA 4PYHA 3BMWA 4WI5A 3SDCD 1U8NB 4EUPA 4ZPVA 5KAQG 1KB5L 3L7FA 4XCCL 4YDJB 2NW3A 3PWLB 1ADQL 2MNUA 3ZTJG 3O41B 4PLJD 5ESQA 4TTDD 2NX5B 5K33A 3O11A 1KOAA 4PJ9D 4ZMAT 3P0GB 4W4OC 4JKMA 4ZFFB 5J0BA 5EU3B 5GHWH 2NTSP 4DVBB 1A4JB 4YH6A 3CLEH 1FAIH 4R3SA 1A2YA 5IROC 3BISA 4LSQH 4WW1B 7FABL 4CJ1A 1DQML 4PRIE 3BZEB 2B4CC 1A6VL 3HE6A 2VDKL 3DROB 4KJQC 4ZPVB 2XZAH 2YKLH 4NSKA 1J12A 4AEEA 1WIUA 4C56B 3MZGB 3ZKXB 1N0XL 4NQXB 4GXVL 3KJ6H 2FX7L 4I4WB 1ZHLA 2NY6C 2GITA 1IQWH 4NN5B 3WD5L 1DANU 2PTUA 2PTVA 1JF6A 4HAGA 1EERB 4PGDB 3VFSA 1JHKL 2D4DA 3ELAT 1KPRB 5GISH 4KHTH 2OS7A 4G8GA 5C0IA 4UILL 2DDQH 1BQUA 1U9KA 2VLKD 1QYGH 2E9WA 2K3TA 5JPMA 4X0KB 4GAGL 1NUGA 5CJXA 4W4NA 3LV3B 3JWDH 4NQEB 3S36H 1LHZA 2RFXA 3AU1A 3TCLA 4YR6A 5CLTA 3RKDD 3JV4B 2AJYH 1FAKT 1G7QA 1HXMB 4OLVL 4ZDHB 2A77H 2R2EA 3EFFA 5CKGA 4WTWA 5DHVA 3LSOA 3QA3A 4U6YA 3BP4B 1ITBB 2CPCA 5AUMA 3O2VH 1T0MB 3QDJE 4LOUD 4NQDA 1TIUA 5CMAB 4ETQB 3PWPD 1BWMA 1CR9H 3SY0B 4MX7B 3RHWK 3RX5A 5TH2B 2OTWA 3LQMA 4MNGA 1QSFA 2Z31D 4JFEA 4YIQB 2LABA 1S3KL 4RRPA 4NQDD 3G5VA 3UJTH 1JZ3A 3EZJB 2FEEI 4NWUL 3VFWB 5TDOA 3QQ4A 4QRUA 5TFSH 1KJMB 3U79A 4GRLA 1JNLL 3QULA 3WDJA 2PF6A 3TWCL 1S5IH 2HMIC 2E7MA 3MLUL 4QTIH 5IBTH 3I50L 1P84K 3DXAB 3ZL4H 1YMMD 1FIGL 4XAWH 3RWFA 3VWKC 1TCMA 3H2WA 2UWEF 2VAJA 5ITFB 3VFGL 4ODUA 5DQ9B 2X89A 4UBDD 5HYQB 3IXAA 2W9EH 3RGVC 4I9WE 1DQQA 4P59L 3D39D 4LLMB 2CMRL 1WT5C 2XZCL 1CFTB 3FN0H 4R8WH 5CUSL 4DGIH 2D0GA 5F21B 3BP7B 4Y2DD 2P44B 2P5EE 3S37X 1I8LC 4BH7B 4M48H 5HI5C 3MJ6A 4ZD3H 1U58B 3GJFB 2V7HB 4U7SA 5DD3L 1MCHA 2DL2A 1Z9OA 5JW3L 2E5EA 2RQ8A 1RIUH 4YDLC 2XTLA 4HUXA 2E9JA 4WTZG 4MHHG 4HGWA 1WBYA 1TZHB 4EIZC 3ZDXE 1I85C 1RFDL 5HI3D 5I1IL 1A7QH 2APFA 5IVXF 2YPVH 2JJUA 2VH5H 1RHHB 2EIZA 3BN9D 3D39B 3JWOL 1KUMA 2J2ZA 1JPGA 4MB5A 4UU9B 2G2RB 5C9JA 5TDNA 4OF5A 1FO0B 4NQCD 2BNUB 4XPHH 4HLZG 1DEEA 4M6AA 3TN0B 4J23A 4QRRB 1H5BB 2BNQD 3MRGA 4M8VA 5EU3A 1MFEH 4K94C 4YZFF 4W6WB 4UQ3B 3LKRA 5KVEH 2B1AH 3RX8A 2A0LD 3KR3L 4PV9A 3KGRA 2BCKA 4LDLB 4RMSA 4XP5L 4XTRD 5SX4H 3GSVB 1FO0A 4OCSH 1EEYB 1KCSH 3S5LA 5DZLA 2DQEL 3KXFB 2VITB 2BZDA 4ZAKA 5F6IC 1FBIL 1NDGA 5FHAL 3RWIA 3MRJB 3O41A 1KJVB 5FYKD 4YXHH 2WZPD 3FZUC 1B0RB 4S1DD 1X5AA 5EORL 2YA1A 4YDJA 1VESA 3A6CH 3D69A 3HUJA 4XVJH 5DXWA 2DB8A 3QCVL 5GRZA 1IEBB 4WU7B 2Q3ZA 5C71A 1WWBX 2DKMA 1ZHKB 3O8XB 1UCBH 3TT3L 3SE9H 1KN2L 3ULVC 2DI7A 3G6JB 3HG1A 3QUZB 5DLMH 5I1AA 1J1PL 3QUXA 3BRGC 2UUDH 3KYKL 1HYRC 5MENE 3ARDB 2IPUK 3HRZB 3ZKND 5IFHL 4EXPX 5JW4N 2EDJA 2BOBA 4PJ7A 1IGFH 4KKBC 3ARQA 4YBQD 5IHZA 1ADQH 3H9SB 5HHOE 3I6LD 4PB0H 2AXGB 1OW0C 2ADJA 3CCHA 4OLWL 4MDIA 1IBGH 3PNWB 1F4YL 2C3GA 2P49B 4MJID 2B8OT 3MA7A 2CIIA 2DF3A 2ATKA 1S9XA 3IGAA 2COQA 4DGYL 4L4VB 2H26B 3BPLB 3KLHC 5L9DH 5FA3B 3LKNB 4Q0XL 1UADC 3NZ8A 3ARPA 3P4MB 4XRCA 4KUZH 4OKVB 1OAYH 4GMSL 2NY6B 5GSVA 4BZ2L 3TO4D 1V8HA 1IC7L 2VITA 1T6WA 2PXYC 3UBXA 2X05A 1CL7I 2X4SA 2AABH 1MLCA 1R0AL 1CLYL 1JE6A 2X6MA 3GSVA 5DJYA 1BQHG 1WLHA 2R1YA 3O3AB 1IGJB 5E70A 1MFCH 2R1WA 3O9WD 4HXBL 4H25A 3FB5A 4MS8D 1NBYB 5DC9B 4ZYKA 5I74C 3VXMB 4U1IA 5GS0L 3RHWF 5C0EA 1IMHC 5L2KD 1WFUA 2OJEA 1RPQA 1C5BL 4F8TA 4GAGH 4M7KL 2XWBB 3VWKA 2FIRT 4PJAA 4IRZL 1EXUA 5J6HB 4OI7A 2EYRA 3QI9D 4KU1A 4LP4A 4KWUA 1MHHB 3JVGC 2HG5A 1PSKH 5J11C 3PQYD 4XMKH 3VGHA 2K9UA 2VABB 3GSNA 4LU5H 1H3PH 2Q87A 3MO1A 3O2DH 3X3FL 4NN7B 3FB5B 1OTTC 3W0WB 3SPVB 1J11A 4PG9A 5I8EA 1IAII 3O4LE 1QP1A 4G42A 4QRTA 1DL7H 3NH7L 4UTBH 4MQ7A 4XNMB 4HX1B 4MAUL 5TGBA 5CBEB 3D85D 5E5UB 1KIQB 5JPNA 3RWFB 3EJYD 4PIRF 1EXUB 1QPPA 3MXWH 3MYJB 3WXVH 2YD2A 2AJZA 2XNAB 1T03L 5FYLH 3DTXB 3GRWH 4Z78A 4U1JB 3NZ8B 4GLRH 3P3YA 1A6ZA 4NWUH 3M07A 2X9XA 3FQWB 3VFVA 4HLJA 2YD4A 4NQED 4MA3A 4O00A 4ZYKB 2Q8BH 3KYMB 4AMKL 4Q9RH 3V4PL 5JOPD 4WUUB 1JNHA 2BXZA 5IHUL 1GGYA 3OTTA 4XHJD 2ZZUT 4QTIL 5IBTL 1F42A 5J9PA 3NBNA 1IC4L 2V9RA 3U9PL 4DKDC 2VISA 4KKLC 1VA9A 4P48A 5KANI 4JRWA 1J5OL 4KK8C 5FOBB 5AWNH 3OGOE 2EYSA 3QEHB 4KHTL 3QG6A 3DVFA 4M62H 5JNYA 4LSUH 4OLXH 1NGWA 3NN8B 4MA7H 2MOVA 4D9LH 3MRMA 3CX5J 4P99A 3STLB 3R06A 2X4PA 3EYQD 4OCLC 4WUUD 4YHOL 4MXVF 4QYOB 4OLUL 3LDBB 2BSRB 4YHLL 1L0QA 4F7EB 2EDNA 1JYXA 3BPCA 2H9GB 3D25A 4P2CG 4P3DA 5GRWA 2GJ6E 2YPKB 3V5DA 1J18A 4Z5RB 1YA5A 4U1NA 1FSKC 1TJGL 3BP4A 4OD1L 3SDDD 4O5LH 5CJ5A 2KDGA 1MFBL 1MH5A 1P7QD 4XMLL 4LASH 3DNKA 5LGKA 3BJ91 1SJHB 2VH5L 2DM3A 2IQ9L 1DDHA 1BFSA 1WC7A 4Y8DC 1F6FB 2CQVA 4LHUB 4MB4A 5GS2H 5C0BB 4U05A 2AEWA 5D96C 2VXSL 3SGDI 1WBZA 2GTZA 5IB4A 3QPQD 1A3RL 5HHOA 1K3ZA 2AW2A 1BEYL 1OAUH 5TE7H 2H2PD 4RQQA 5JW4M 4W4OA 1E0OB 4IIQC 2VUOA 2ZUYA 2O61A 4WFGD 1XF4A 1KB5B 2JB5H 1JGVL 3D0VB 4KJYA 3FQNA 4Y4FA 2HMID 1T22B 4NWTH 3IAQA 2J6EH 1CXEA 5CHNB 3RWCB 1J8HD 4CVXA 4JO2H 1AGEB 3D39A 4GRWE 3CVIH 3P30L 1RIVL 1RZJL 4PLOB 2X89D 3QEUB 4HLZH 4JQIL 4E42B 2CUMA 4GMTH 5HTSA 5IVNA 3IVKB 2IAMB 2EZ0C 1IGMH 1SJHA 3RVVD 3BIKB 1GRWA 4Y5YB 3RVXD 5E08H 5F6HJ 5I19H 4M7JL 4U1NB 3GSRA 1LEKB 1RIUL 5IUSA 2GTZB 5IB4B 1T7WA 5C2BL 3VWJC 4NQCA 1DBJH 1K8IA 3T0BA 5GRVK 4F37K 1K6QL 4XBEL 2JJWA 5F71A 3A0OA 2P8PB 5E94B 1NGXB 4GRWF 1RUKH 2W9LA 4HIHA 3UO1L 3QFJE 3DI2B 1D5XB 3J8F7 4DW2L 3HNSL 1BZ9A 2VXTH 5HYEA 4OCYL 3SKOB 3AFLA 4U6XB 3X17A 2GK0A 4UQ2A 2EXWD 4AL8H 2GW5A 3K8LA 4OF0A 3GMLB 1CT8A 3QB7C 3BQUD 1CXHA 2VE6A 1G9NH 3OF6D 5KBNC 1MFDH 3VMPA 2VLRB 2DQEH 3IDJB 3B2UD 4KGJA 1U91A 3VXRA 2EEAA 1MCJA 2L7JA 3M45A 1F8TL 3W2DH 2VAAB 3B5GA 2GQHA 2VLKA 4BSWB 4HS8L 4LDEB 3LY6A 1TZGH 4LLDA 3H7BA 3RL1B 4CW1B 5E56A 1C5CL 5JNYB 4FTVB 3U0TB 4PJ7F 3TZVC 5K59E 5DEGB 1P7KB 2G9HA 5C09A 2FX7H 4GRLD 5FFLA 4MQ7B 4XNMA 3QNXA 5IBLC 4IRJB 1XGTA 4MD0B 4KDWA 1UCBL 4L9LC 3FHAA 1MY7A 4TUKH 5FK9B 3V5KB 2AK4B 1NUNB 3RU8L 1GVIA 4P5TB 3KYMA 5MEND 1D5XA 3ZKNC 3KNBA 4QRQA 3HE6D 5E2TH 2VABA 4CNIA 2VXUL 2Z31A 4JFED 4GQPH 1A6ZB 4U6XA 3VXTB 4EBQL 4R2GD 2MQ0A 5EU7E 4YGVB 1IAIM 3LV3A 5HHQB 4XVSL 5F7KC 4MJ6A 1A47A 2Y36L 1GZQA 1QRNE 3F62A 5BS0B 1R5VB 3EFFB 5C7XL 3TNNA 3AREB 2BVTA 5LQBH 3I2CL 4H1LA 1JF5A 3ZMRA 2E7HA 3MUGA 3CSYB 2O5ZH 3E1F1 1JGLH 3PV7A 4X6EB 3AM8C 2X4QB 3SJVA 1KEGH 4Y4HB 3H0TA 4PGCB 1EAJA 1RZFH 2KKQA 3NFPA 1P4IL 4DKEL 4XMPL 1MFAH 2PCPB 1MEXL 4PGBA 5ELIA 1KG0B 3MLTB 5DWUH 4JDZB 5HHNB 1YEEL 3PWNA 4FXKB 2HFEA 3U4AA 1NANH 5I15H 3DV4B 4X5WB 1KSRA 3TBVA 2E7LC 3TYGH 4R96B 2AJ3A 1BOGA 1IGTA 3BPOB 4DGVL 3HPLB 1BZ7B 3ZT5A 3Q5TA 2X41A 1IRAY 3T0EB 4DVBA 2BVPA 5BCAA 4PLNC 1P7KA 2G9HB 1SMOA 3HC0A 3OKKB 4BM7A 3GIVB 3BZFA 1EHAA 4PY7A 5IJKC 3RX7A 1CS6A 3GMNA 5LGJB 3CC5A 3V6OC 3GIZL 3FTGA 1ADQA 4WO4D 4ORZC 5IGXL 4LOUC 1OGAB 4KMLB 4QNPF 1F5WA 3ZDYF 4DCQB 1JYWA 5MHSE 3LEVL 3VXNA 3BP5A 3CFIC 3IETA 4PJ8A 3UEZA 1OTTD 4I18C 5DFTA 3QQ3A 4XXDA 5DJXB 5C0AA 5I1EL 4PJEB 5DD1L 2ATKB 1YNTB 2I24N 4M48L 5D72H 3MRBA 5D2LA 5IW3A 5GGTL 3VH8A 4JFQA 4PP1D 4QTHB 3HZYA 2YMXL 3MRLB 5F7UA 5J57B 3UXFA 3TJEH 4UNVA 4DZ8B 5T3ZH 1E28A 2P24B 4K7PH 1W72A 1NBZA 2F74A 4JFHD 3GRWL 5JZ7D 4I8DA 4M6OH 3P2TA 3VFUA 1BVLA 3VXSE 4X7DC 1VACA 5CJXC 3O45A 3MRLA 2Q3AA 2X42A 1NKRA 3SKJH 3U36B 3AB0B 1A9BA 3V4PH 5FOBA 1I9JH 3NFNA 1LEKA 4PRHE 3C60B 4XHJC 1AHWC 4DZ8A 1EJOH 2D31A 3FO9A 3U9UB 2J6EL 5CIPH 4PY7B 3SQOH 4KKLD 4NKDB 2IMMA 5ABDE 3GSUB 4IDLA 5DRXA 1KNOB 5BVJA 1X5GA 5DA4A 4M62L 3DVNA 1W0WA 2Q1EA 1JNNH 4JJHA 3F7YB 3IETB 3LKSA 3OB0K 4U33A 1II4E 3KWWB 5LGJA 1NCCH 1T2QL 1P69B 4O2FB 4NRZA 4YHLH 5HI3C 3ZHDA 3T8XB 4G6KL 4TUOA 5KS9B 4N68A 2X4OA 1J7VR 5DFWH 2GFBB 3BN9C 4L8BB 1TVHA 1QO3B 3GMNB 1T22A 4J3UA 7CGTA 3RY5A 2R4RH 1HWHB 3SGEH 4O5LL 2V7HA 3GJFA 3VRLE 4JO1L 3VXUB 1A14H 3QEQD 5I76B 3PIQA 2HKHH 5BW7A 4BQ9A 4LVNC 5GHWL 4XC3L 2Z93A 2GAZA 1SEBB 2OBGA 4LLVB 5JORA 3MV8D 3S7GA 2A0LC 1CZ8H 3WNPA 2WBJA 1WBZB 4OCYH 1G7LB 4KKAC 1TETL 5K93A 2CR6A 1FG2B 1A22B 3IKCB 3QUZC 1I1FA 4H1LB 4GG6E 4PB9H 4RAHA 3N1FC 3BPOC 4FZ8L 1H3VA 3MUGB 2YBRA 1H8NA 1EEQA 1MFDL 4Z5RA 2MJWA 2R39A 2XQBL 4PJGE 3KPMB 1Z3GL 4HWNA 3DX7A 5IW6A 3ZKMD 3BE1L 3G9VA 4YGVA 5DEZA 4D94A 5C2UB 2NY3B 5ACMA 4F7MB 1H3XA 5BO1L 1TTUA 4NQDE 4YFLF 2OMBA 1K8DA 1YY8B 1KTLB 2R1YB 4ZO6A 3UJIL 5DQ9A 3E3QA 5HGBA 1QO3A 4FQJH 5DJ2B 3L5XH 5LG1A 4UDUB 4G8FB 1RZKL 1QYGL 3MRFA 4N8VG 1HQ4B 4XH2A 1HXYA 3HZMA 1LE5B 2ZOLB 1NJ9B 3S8WA 3MGOB 4ZQKA 1FYTB 2NXZC 2VQ1A 2IFGA 4M61A 2P5ED 3MA7B 2AJYL 4OLVH 4JG1L 4G80A 1JZ8A 3UYRL 3GSQA 3EYFA 4F3FB 1U3HD 3W81A 3TH4T 2FIKA 4X7SH 5B39G 4WFFE 2VZUA 1NJ9A 4XGZA 2VAAA 1DBAH 1ORQB 5C0JA 4G8GE 3FT4B 1I7UB 2UV3A 3BGFB 2VLME 4OUUB 2AP2A 4N5UA 3SOBL 3PWPB 4ALAL 4UIMA 2AJZB 4RGNE 4GQ9L 2VDRH 1N4XL 4LHUD 1F11B 2W91A 5E6ID 1HKLL 5D7JB 1T3FA 1XIWB 2VLLA 4J12A 4KDTC 2EDEA 4F7MA 3IJHB 2EXWC 4ERSH 3GSOB 5ITBH 4UIKH 5B39B 3H9YA 2UVFA 5CCKH 3QDMB 2DWEB 2NY2B 4TYUA 1DBML 2DLTA 3SGJC 2I07A 2O5YH 3QH3B 3EJZD 4FTVE 2R2BA 4RFOH 1INDH 3VG9C 5I16A 2YS4A 1N5YH 1JFMA 1V3MA 3PABB 3MRRB 1GGUA 4HIHB 1QBAA 4Q6IB 4P9HL 4YXKH 5F7HA 1BZ9B 3QQ3B 4XXDB 5DJXA 3PWPE 4JZJA 4NM8H 5F1SA 3BO8B 4KQ3H 1I9EA 3HC4H 1WCQA 4ODBD 4YO0B 4PJ8B 4OLZH 4G8IB 3ZTJH 4EDWH 4URTB 2M2DA 4WI7A 1K9TA 4GRLC 2Y07L 4MXWL 1A7OH 4N0UA 4CDHA 1M7IB 5ESAB 1OAKH 1YPZA 1KC5H 4KRPB 4TUKL 4X83A 2JCCF 2DQHH 3L7FB 3HE6C 2R0WL 3OAZK 5ERWA 4BKLB 4CRPA 2ID5A 4YC2C 1UWXK 1I9RH 2D7TH 2FDBP 4BFIA 4LSPL 4G8IA 2AJ3B 4LARL 4HUNB 3WO4B 2HYMA 3VGFA 4KVCH 2LV4A 3TA3C 3QWOA 3GKWH 5BMFH 4OZIA 1W0WB 3VRJB 1E4WL 5GGTH 4FFZL 2JLLA 4PJGB 4BKLA 1WC7B 2P7TB 3P4NA 1VGKB 4OZHF 4KK6D 4GBXA 5D7LA 1ZLSL 2B1AL 3TIDB 4APQD 4ELKB 1P6FA 5I6XB 2DWDA 4LMQI 2HLFD 3TO2A 4Y19E 4JZOB 3NCEB 3S96A 2NW2B 3Q0HA 3OAYK 2ZG2A 1MJ8H 4O58H 4TPRL 4QRPD 3KXFD 3NCYS 4Y1AD 2EECA 3LHPH 2R69H 2YRLA 1I8LA 3B9DA 5ANMA 4WIQA 4L4TB 4JZJB 5F93C 3EFDL 5HHQA 4IHOB 2NXYC 1A7NH 4NO3A 1KEML 1I7TA 2NXZB 5E99H 4KV5F 5F96H 3HZYB 5EOQL 5A2JH 1CLOH 4LSDA 3KJ6L 2HFFA 3CFKA 2AJUH 3H3BC 3MMEB 2QQLL 2YPLE 5F6HI 4GRLB 2GY5A 2VZTA 1MI5D 4WO4C 1H3UA 3SDDC 1NMAL 3MRMB 5A2KH 4M93C 4JDTH 3WHE0 2YZ8A 4MNQE 1A5FH 4WHDA 4XP6L 4H5SB 4QWWC 5LJYH 1T5WB 3AVEA 1LQSR 4XNZB 4H1LH 4ELME 4Z7OE 3CZFB 3QPQC 4WHYH 2P43B 4OM0L 4WI6A 4PV9B 1NUFA 3T65A 4HH8A 1MHPH 2A6JA 3QEHA 4WGWB 5DR5L 4RIRA 2Q86B 4DQOH 2R2EB 1IFHL 4OBRA 5AUMB 1QA9B 1WFNA 3RY4A 3P73B 1EO5A 1ZHBA 1CTNA 1MAML 1FYTA 5CLWA 2DJUA 4WFHE 1ZA3A 3UYOD 2V2XB 1ED3B 3F65A 2C7UA 4GMSH 2I60L 1H3WM 1VADB 2YPLA 4BQBA 1IC7H 1QG3A 3QIUD 1J8KA 4O51B 4M1DL 1B2WH 3I9GH 4L8SC 3V4UH 1FSKB 3FFCA 1R5IB 2HP4A 3P77B 5DUBB 4BH7A 3IFNL 1R3IH 4OZHE 2YHGA 3GUTB 4PJXB 3UDWC 1DLHA 4NZTL 5EUOE 5AD0B 1G9NL 4JQXC 3MBEC 4LPTA 5HYSA 5K59F 3VXOA 5E8DL 1IVLA 3RVXC 4G6AC 4Y5XA 5FO7B 3ZL4L 4IOSD 1TVHB 1IAKB 2VB5A 1U8KB 5E0QA 3RI5K 4OGYH 3QDGB 3EAKA 1ZS8A 4WENB 3P4OB 3OX8A 3RTQA 3SJVD 4CNIB 5C0EB 3M1BA 3OKMB 2DLFH 4XPAH 4ELMB 1YQVH 2DIBA 1FZOA 1NC4A 5FK9A 3V5KA 5BW7C 2Z93B 4X9HA 1CDYA 4K71C 3WFHA 3V6ZB 3DVNB 1IT9L 3L3OB 1DBAL 2IH3B 5KSUA 3OKOB 3EOTH 1ZLVH 1DQLL 1RZKC 3MRIB 3E2HB 3PL6B 1I1CA 1RULH 2L0DA 1QBLH 3GSUA 3HZKA 2F9BT 5HPMA 4I3RH 3LN9A 4FZEH 2ZUSA 3EYSH 2FECL 2OSLA 2R56H 3RZCA 3KPSE 5C3TA 1NMBH 1KIUA 1HKLH 3GUTA 2X4SB 5I30L 4UV4H 1QLRB 4HWBH 3LPWA 4HXAH 1M7DB 3QUYA 1OTSD 1F90H 2CD0A 3QUZD 3Q6FB 1QZ1A 1KLFA 3P0VH 5KSAD 4N0UE 4R0LB 3WYRA 3O3DB 3DJ9A 2JJSA 4FP8H 2DLGA 5C09D 1I1AC 4OFYD 4AEHH 1R3JB 2X4UA 1AR1C 3WE6B 1Y0LB 1NAMB 1BOYA 5ADOH 3B9KB 4AG4L 1FGVL 2UWEB 1YN7B 3T09A 5GPRA 5EC1A 3PHOA 5L6YH 3ZT7A 3HB3C 3F7VB 1LD9B 5IBLD 2NY7H 2NY5H 3IF1A 4OLXL 3UJIH 1BFOA 3VXRD 4UTAH 1FNEB 4HKBB 4YHPA 1ZGLP 2IPKA 3G5YA 5DO2D 2BOBB 4U2ZA 5J3HC 3DRQB 4CMMA 2B2XH 3TBTA 1MHEB 1T1YB 5I1LB 3V0VA 1FZJB 3V8CA 3WD5H 1FO0L 1NLBL 2NY4C 1IEAB 4KI5D 4R2GC 5IWLA 3IDIB 3A6CL 1JYVA 2VERN 1K4DA 2HRPH 2V7NA 2VO5A 4YK4B 4YNYA 2CIKB 1IM3A 3D9AL 2XKSA 3X14B 3OKKA 5D7LE 3MNVB 1MFBH 2R15A 4HC1A 3L1OH 3NCCB 4NO2B 4LASL 1P7QB 1NGZB 3GI8L 2GK2A 1L9MA 4X7CC 3GIZH 4ELMF 2HFGH 3MXVH 4LARH 4NO5B 1DEEB 1G6RH 1BM3H 4JFEE 2IPUG 3F8UB 4RX4A 2IQAB 4EI5B 2BDNH 4DCQA 5JTWA 2NMSA 1OF2B 3QI9B 2DMCA 1N26A 4J8RA 3W39A 3MROA 3DWTA 3EJZC 2BOCA 4V2BA 1V5JA 3GIVA 1MCDA 4LSVH 3DMMB 1YC7A 3FRPG 3O2DA 3E3QC 1QRKA 2ED9A 2IF7A 3VW3H 4P46B 3RVUD 1IARB 3QUKA 3GBML 4NO0A 5GZOC 4NM8L 4NRYB 4X4YB 4R97B 4UU9A 5DK3A 1PW3A 3HC4L 4JRYA 1EO8H 4PJGA 1RZ7L 5JXAH 4CU8A 5HBBA 3NIDE 5E8PB 3SDCC 1HH6A 2GT9A 4GMTL 1LEIA 1P1ZA 3MFFB 4LCCB 1D5ZA 3O6ML 5C07B 2DICA 3HI6H 5SWZD 1JBJA 3Q5YA 1DQQB 2JJTA 4O4YH 4G9DA 4OFVA 4QHNA 4TTDC 3S98A 4LVNB 2Z0BA 3ROLB 2VZ3A 4F7TB 3GZKA 4OJFL 1FRGH 4GUPA 4JQVA 4X5XA 2M8XA 3WJJC 5DK2A 2BOCB 1FE8H 3WNOA 2DBLH 2Y5EA 3C5ZC 1DQDH 4LGRB 4DGIL 3DPBA 3HC3H 1UQSA 4Y1AB 4R26L 4UOJA 4KVCL 1YUHB 4OF3A 4KJQD 4X9GA 3H3PH 4BELD 5JZ7C 1F45A 4KK6C 5HGDA 3SDYH 1NEUA 1F4AA 1YEJL 3MOAH 3NCYP 1U8MA 2PR4H 3H8NA 2DLHA 5CSZA 5IK3B 2QR0B 2AQ3A 5J9PB 3KVQA 3MJ8B 5I2IB 5IV2A 4CBPA 3DO3A 3S9DB 2DQDH 4WUUA 3QQ4B 4YIQA 1KF9B 5HYIA 4HUMB 1XZ0A 3ZYOA 3K4ZA 3KPRB 4ZFZB 1PY4A 4O58L 5JMRA 5IMMB 1WBXA 4NKQB 5JXEC 5E2UH 4MNGB 1DP0A 4HF5H 1A7PL 4BSVB 4U1GB 1CFSA 4JM2D 5T1KA 4LL9A 3SY0A 1I7RB 3ULUF 2VZOA 5F96L 4MA1B 1BQSA 2BY3A 1KBGL 5C08A 1S7UA 4PRHA 1MIEL 4HEPG 3A67L 4PJIA 5SX5K 1KB5H 2J5LC 1VFUA 3MLXL 1AD9A 4IS6B 3X13B 4B41A 5AEAA 2GCYA 4NFCA 3GNML 4D9RD 4N8CL 4X8JA 5F44A 5BZWA 5D2NA 4K3JL 4RFNB 4XPAL 3TNMA 4F7CB 4UMGA 4JM2B 5FYKE 3UTTE 3D2UB 3GI9H 4G80B 3DIFA 4NFDA 3QWOB 4OZIB 2IG2H 3D85A 1U8MB 5CSZB 2Y9RT 4YDIH 1OQOA 5DJCA 1DVFA 3BWUC 2E6PA 4H8WC 3I6LE 3E6FB 2YZ1A 4KKAD 2ZUQB 4HUVA 4GAJL 2OCFD 2VMFA 2PYED 4O9HL 4HV8B 3QBTB 1CGVA 1MUJA 3QQNA 4QXTA 1A0QH 2OJZL 3RIAF 4DUXA 3PWLA 2OYPA 2IH1B 1JHTA 2WAHA 3PQYA 4QRSA 1F4WL 3EGSB 3OAUL 1YDPB 5ILTL 3O6LH 2HJKB 4BFEA 2PYFB 3VWKD 4GXUN 3W9DA 5FYKU 1A4JA 5CD5C 2I60H 2VSDA 2QQKH 1LO3L 4UBDC 5JA9A 1JV5B 2ZUVA 1A2YB 1U36A 3RGVD 3VE0B 5DHVH 1K5NB 1J05B 5ISZE 4X7TA 4DGYH 2ILLA 1M7XA 4JHAH 2NPLX 4JREC 4J3OC 5ADOL 1DBMH 1UZ8A 2FR4A 2JB5L 1RZ8B 4HDIB 5GISL 4WW2F 1KENH 1X5FA 3MBED 5SX5H 2NXZD 1IAOA 4S1QL 4U1GC 4LGSB 4HHAB 4YHKH 4P49A 1G6VK 3WIIH 5E4EC 4HIJA 5I8KH 5J1SC 3LD8C 2RCSH 1JTOA 1ZTXH 1AXTH 4M02A 2DYPA 3C60C 3MV9D 3NAAL 2EDHA 3WFBH 3P77A 1R5IA 3BPCB 2FECI 4Z7VB 4ZUTB 3TBYB 1NLBH 5LKNA 1MFCL 2R0KH 4AJ0A 3GSOA 5K9JH 3I02A 4H88L 3ZTNH 1UM4L 5DRNA 5E4IA 3VXSD 5GQBA 3LMJH 3D5OF 4OKDA 1XR8A 5HGAB 4L5FH 1KJ2A 2CXGA 4P2RB 3REVA 3IS0X 3WKMH 2CRMA 5B38G 1H8OA 1QA9A 1QBLL 3FB8A 1G6RL 3MRBB 5E24E 5I0DA 1TENA 1T7XA 4OZFB 3UPCA 3T0XA 2PYEE 3B9KC 3OHXA 5JW4Q 1CYGA 3QULB 1CGXA 3EYFB 4ZOBA 1DN0B 5D5MB 1L0XA 1EFXD 5EUKB 3MLUH 2V6HA 4LU5L 1JN6A 1QEWA 2CXKA 5F1IA 4R7NB 4L8DA 2ZCLL 3X3FH 4HIIB 1FVDA 5LWYL 2HKFL 3FOLB 3UO1H 3TVMA 4Z18A 3EO9H 3S35H 3F5WB 3K46A 3ARDD 3C9NA 3MLRL 3STLA 4V1DA 3ULSB 3STZA 3J7HA 3EYVA 1T0NA 4X6BA 3FHQA 2APVA 4JFEB 3HAEB 4H0HB 3RZCB 4PJBA 4LBEB 4P5MB 1RJLA 2CJUL 2MPAH 3AMLA 2FCBA 4J1UB 3FQRB 4GSDL 3MA9H 1QSED 2IH3A 5KSUB 5EU7C 3AROA 5JUEL 4OV5A 1N5AA 2JELH 3GMOA 3HUJF 1XT5A 2R23A 1SJXA 5F7DB 3WLBB 4AM0B 5AZ2L 1RUQL 5E6YA 1EO8L 2RBLA 3LSOB 3C5JB 4FQQB 4PGEB 5IMLA 4UV7L 4L29B 3QXDB 4HKXA 2IC2A 4ONFL 2BNRB 4C54A 4EZMA 5ISZB 1NLDH 5HDBE 4KI5C 4ODHL 1FNGB 1FVCA 4HCRL 4XBGA 5I6XC 2C1PB 5HYJA 2GJ6B 5D2NC 5LGHH 2X4RB 1OB1B 5IQ9B 4X6CE 3ARVA 4BZYA 2BNQA 4KVNH 5F9DC 3WL9A 1EMTL 3IDGB 1NCNA 2ERJB 3GJEA 1MCOL 1JPST 2YA2A 3EZ8A 1A6WH 3QFJA 3I6KB 1YMME 1BBDL 3G04B 4XWOC 3UX9B 3AY4C 4MAYA 4U6TA 1BJ1H 3MO1B 2LU7A 3RA7L 1CZ8L 4APQC 3NPZB 5MEQA 5E8OB 2ZP0T 3QDME 4GG6F 1RUML 3SGDH 1B90A 1NGYB 4NZJA 2DQIH 1KLGA 3IJYA 3TFKD 1BWWA 1ORSA 3P73A 3O9WC 1Y6NR 2W65A 3VFOA 3QHZH 5GRJL 1C12B 4HC1L 2IPTL 4TSBH 5KSAB 1RAMA 4AQ1B 4YFEA 4M4RA 2NXYD 1YDPA 5SWZB 2BXYA 3RVUC 1ZEAL 1FAIL 4WVRA 3KLAB 3JWNC 1TJHL 4HGKC 2Y4SA 1KIPA 2V5SA 3RDTB 1XH3B 5AYQA 4M5YL 2CDFB 5MEPA 1CF8L 4DN4L 1QFPA 3D39E 3V95A 3PGDB 2IALA 4FFEX 3BN3B 1WQVT 1IGYB 3QIWD 4BSWA 2X1PA 4D8PB 2AS5M 5JW5A 2MSPA 4IRSC 3UJJL 1X5HA 5J7CC 3ARYA 3L3KA 5TE4H 3S37H 4PB0L 3JV0A 2C1PA 4KXZI 2I9TB 3U48A 4JANA 4PJFE 4YLQT 5C86A 1EIBA 1F6AB 3G6JA 3HG1B 2Z31B 1FV1B 2MFNA 1QVOB 1T5XA 1VGEL 4V1DD 2QHLA 5ALBH 5SWQA 4YPGB 1ODAA 2Q76A 2Y6SC 4DZBB 3KPTA 3WUWA 2E3VA 3ARXA 4YHIA 2ICWB 4R4ND 4K9EH 4I5BB 3CSPA 5C6TH 1I1YB 1DJSA 4P57B 3CH8A 4K3GA 5JW5B 2DLFL 5SX4I 1IBGL 4M7JH 1IZJA 5IM7B 3RL1A 3KDMA 3TBSA 1JWUA 1IT9H 3KPRA 5D71H 5MERA 3PF2A 1ZLVK 4HUUA 1ES0A 1XGQA 4F8QA 4N90E 1BD2B 3GMMA 5C0GB 4LHUG 3SDDB 3MRDA 3TA3B 1CU4L 5HDQH 2AJSL 3MRKA 4DVRL 4JREB 1H5BA 4UV4L 3QEQB 5D7SL 2MCPH 2D0HA 2QL1A 1BZ7A 3JZ7A 4D9RE 4HXAL 5JXED 4YBHA 3V8OA 2DYPD 3MGOA 4AL8L 2A9NL 4HMDA 1EX0A 4JM2C 3D2UD 4NIKB 4G5ZL 4F7PB 1SM3L 3D3VE 4RMWA 1I7TB 3KS0H 1PYWA 1M1SA 3U2SA 4HPYH 1HQRB 2LTQC 4S1SL 2XYCA 2P46B 3WS6A 5CINL 5INDB 5DFVD 3PP3K 2CK0H 4P2YA 4P2OA 5E8NA 1S8DB 3JTTA 4C58B 5I73C 3STBA 1WT5A 2HWZH 4BZ1H 5I66B 3L3IA 4X6EA 1KC5L 1F8TH 3QXAB 3VG0L 1HDMB 4NHUE 4PS4H 2PW1A 1K3IA 1UZ6E 2O5XL 4PY8J 1EV2E 3KPMA 4N1EA 5F1NB 5GGUA 4ZTPH 1V3KA 3EYUH 2A9ML 1QBML 3GSWB 4MD5B 1PGRB 1URLA 3CFJA 2H32H 4HSQA 3BIKA 3FRPA 4ZUVB 2XA8L 4JQVC 3HS0B 1BX2A 4OGAC 4PJEF 3LEYH 3UTSA 1CICC 1KXQE 3U2SB 2P5WE 4R4FH 2CKBH 5BMFL 1LO4L 4PD4K 3VXTA 1WBYB 4KGLA 2Z4QB 2DS4A 2D4FA 3IDXH 4LIQE 1KGCE 1U8IB 3GBNL 4FFZH 4UNTA 3ETBF 4X98B 3B8YA 3GMOB 3MBEB 1DANT 4L1DA 5IQ7H 2W0KA 1EH9A 3RZCC 1JGUH 1GC1H 3LKQB 4O02H 3MLRH 4P4KA 3KLSA 1L4IA 4CJ0A 3CX5K 3KYAA 4J8RB 3W39B 1J1XL 1M05B 3GMMB 4H0GA 2JB6A 1C7SA 5I8CB 4D9QE 5IWLC 5LXGH 5ACLA 3QZWA 4JHAL 2HVJB 3T77A 4X6FB 2Y25A 2APTA 5EOQH 5C0BA 5B3JF 3KPOA 4XAKD 3WIIL 1KNOA 3S34H 5BVJB 2NYYC 1Z5LA 3OKNB 5IVZB 3QAZB 1IAIL 3VWJD 1UVQB 1QRNB 4YAQB 1FDLH 4KTEH 2YEZB 4CN4A 3G9AB 3T1FA 4AEIH 3HFMH 2Q7YB 2MCG1 4A6YA 2W1NA 1RSFA 5IF0A 3PHQA 3U36A 2H9GA 4PFEA 3TIEB 3MJ9A 3IJSB 4U7KA 3WIHH 4M1GH 5E6ZA 4F9LC 3SKMB 5TQ2H 1Y6KR 4KY1L 1D5BB 3HCVA 3VFRA 4Z7OF 1KPRA 4JRXA 3HN3A 3TO4B 3UYRH 1LD9A 5J8OA 3BFOA 5HJ3A 3ZE0E 1XF5B 4IIQB 1Q1JL 4FQHA 4LSSL 3VA6A 4OUUA 1CG9A 1OAQL 1BREA 3O81A 1FIEA 2GJZA 2FHFA 3TPUA 3LEVH 4BUGA 4LAQL 1BLNB 1R5WA 1WK0A 4NKIH 3B2UC 3H3KA 5INCA 1RIVH 5SV3A 2JK5A 3HE6B 1CL7L 1ORSB 2CDGA 5ISZD 5JPMB 3OZ9H 3VWKB 1OCWL 1EZVX 2ADGB 5SWZA 4PJAE 2GJ6D 3MZTA 1QLFA 2J5LB 5D7KE 3PJSA 4X80H 3R8QA 4HEME 1JZ2A 3D3VA 4JFFE 1RUAL 4Z0BH 3U7YH 4X7EC 5F9AC 3BOVA 2VRAA 1A9EB 3ZYJA 4Z77B 1A1MB 4P0DA 5C0ND 2MKLC 1RUQH 4Y4FB 4NQXA 5I1DB 1C16B 1MCPL 5MEQB 1LEGA 1Y18A 2XIDA 1TTFA 4NO0D 1GIGL 3PJSB 3HPLA 3CFBA 4X4MA 2X9WA 1QFWL 5AG9A 1JZ5A 2CR3A 4WWKC 4APQB 1R3HB 1A7PH 3IXTB 4ODWB 5KSVB 4G7VH 4M8QB 5HI4C 4FXKA 3CFCL 3OKMA 1K85A 3LKSB 4HUWB 2Z8VC 5IKCA 3MREB 4ZOAA 2PCPA 5FYKL 3UTTD 1R6VA 5DHYB 3QDGA 3RL2B 2BNRA 3CVHL 4G8EB 5I17B 1R5WB 2P48B 4N0YL 4R90H 1MF2H 3BGAA 2ARJB 2P8MA 1NCTA 1H3GA 1AD9B 5ALCH 4K9EL 3CFJB 4F9LA 1SYVB 3LRHA 2FEDD 1FCCA 3RDTC 3ILPA 4XCEB 5FB8B 3C5JA 2EC9T 3GI9L 3GBLA 2WMPA 4H25B 2X2YA 1CTOA 4TNVF 5T1KB 3O2DL 4J2XA 1OB1A 3WXWH 1KT2A 1U95B 1IM9D 1OGAD 1A14L 5FDYA 2ENYA 3WDIA 2F58H 1LDPH 2G75B 3O4LB 4L8CB 4PRBB 5INDA 4X6DB 3D18A 2EDRA 4B7LA 2F54A 3FQRA 4R9HA 1I4FB 1OWWA 1LK2A 4D0BA 2D7PA 2VDOH 3VFTA 1S9WB 2DIAA 5FV1L 2QSCH 4GOSA 3ARBA 1Z0MA 4XCYB 4J6RH 3BH8B 4OSUL 3P4MA 5D2LB 4YUEL 4M9OA 5EZOH 1FORH 3DUSA 3G6JF 3SGJA 4IRJA 4MD0A 1TFHA 1QD0A 4C59B 5IV2B 3OG6B 3ULUD 1CF8H 2WIIB 2R2HB 1OD7A 4H1LG 5T1LD 1QSEB 5T3XL 4LLQB 1A6PA 3BMVA 1QACA 4HKZB 3TV3H 1OL0A 4TPRH 1GPOH 3GB7B 3KPOB 4Y4KA 5IG7A 3DGGB 1AGBA 2F54B 1JWUB 3MLZH 4S0SD 3BE1H 3RBSA 4N1CA 3NGBC 3UTZA 3M17A 4X9FA 4P4RB 1JZ6A 3LKQA 3RRQA 3P9LB 2YOCA 1CLOL 1YEHH 1S7SA 3HLAB 3IRPX 5B8CC 4Q74A 2VL5B 3L5XL 3FQXA 4H0IA 3QUYD 1UXWB 3VI3E 2J8HA 2Z91B 2WBWB 1KPUA 1CQKA 3CFEB 5F9WB 4U6VH 2MKWA 4FFVD 4PJGF 4XCEA 1AGFB 9CGTA 1ZK9A 3CH1B 4LVHB 3GKZA 4HGWB 1KJVA 5CD5D 5D93C 5HHMD 3VD9A 2JIXB 4OM0H 4Z6AT 1J87A 3WKML 1UG9A 1NC4D 1CI5A 1N7ML 2BSSA 3PGCA 4OZ4A 5EPMA 3H9SE 4LDOB 2WANA 2DD8H 2FWOA 3DMMA 4LSVL 4WWKA 5IBUB 1ZHNB 43C9B 4Q6IC 1MCBA 5GGSA 1BEYH 1T7ZA 1JRHH 1MCCA 1OM3H 4RCAA 3OKYA 1WIPA 2ZCKL 3LKRB 3IXAB 4JFDA 1BQLL 4U2YA 4TUJB 3QEQE 2ADIB 4QXWA 1LILA 4U1LA 3OKOA 4DGVH 4M3JA 5FCSH 1SM3H 1AXSB 3RJDA 4X7TB 2NLJB 2HVKB 1YYLH 3FO1A 4TVSa 4BK5A 3MV11 1JV5A 3AUVA 4HBCL 3DV4A 4X5WA 3PG2A 4F2MA 3V4UL 2JCCE 3RWDA 3O6FA 3LKNA 5SWSB 5JHDB 1QNZH 4YBLC 5INCB 4RGOH 1NFDB 1SY6L 1TVBB 2EH7H 4OJFH 1OLLA 2YUWA 4JEGB 2I07B 4NP4H 1ZXQA 3CJJA 1F00I 4PR5B 2OK0H 1MCFA 2R29L 3B9KD 4U1SA 1DUZA 4OF7A 1CICD 1NCBH 1NKOA 2H6PB 4U1MB 2JJVA 4JFFD 1RU9H 4HWEH 1WV7T 3WBDA 1XGPA 1JIBA 3BUTA 4YHNB 1CFVL 3DYOA 3U7WL 4PREB 3VD7A 2B0SL 3G6DL 1RV6X 4IIQA 2G60H 5D2LE 2DQJH 1MNUL 5C2BH 1UZ6F 2Z8RA 4JFFA 5CSBA 3EOBB 5E00A 2C7UB 3LB6D 3PE9A 3B9KA 4LLWA 5E4EB 2EE9A 4W81A 4G6ML 2H32B 3P4LA 2XOTA 1AGCA 1EDQA 2VXQH 4WY7L 4Q2ZA 5CJ8A 3ZKQD 2DLEA 3PWUB 2JCCA 3L3GA 3VGBA 4YQXL 4LQ1A 3CMOH 4JPIB 2E8YA 1H15A 5MP6H 1Q9WB 4FMKA 3V6OA 4LLWB 2APWA 4BQCA 5L2JB 3RWIB 1CDIA 1YNLL 3WDHA 4D8PA 4MXQA 1RJLB 1VCAA 4NBZB 1PLGL 5LCVH 3P11H 4G6FB 4UB0H 1IGCL 3SCMD 4JRXE 5DA0B 2GI7A 2EXYD 2EKSA 4AEHL 1MCPH 1U3HC 1FFRA 4HWZA 4OB5H 3LQAC 5BOZG 1FPTH 2SEBA 1PG7W 1IGYA 1VFMA 1FVDB 1BQHB 4TNVK 4DUVA 1UQSB 2OLDA 2HT4C 5EBGA 1MY5A 1MLBA 1HHGB 3DMMD 3OR6A 3MYZA 1DBKH 4ETYA 1EGJA 3OR7B 1SYSB 1FNSL 5EU4A 1MSPA 4PJIF 5F1KC 1FL6A 1G7QB 1HXMA 5E6IC 3H9ZA 3M1BB 4ZDHA 3U30B 4EN3A 1RJCA 2AJUL 2Z4QA 1S9VA 3WIHL 3SKUD 5HHMA 1YN6A 4WHYG 5FO9B 4K3EL 1AGEA 1FZKB 1Q8MA 3FOMB 4FQCL 3MLWL 5KVFL 3QNYA 1RI8A 2VWEC 2AJXH 3QXWA 2ZSWA 1SBSL 1UWEH 3I6KA 4PJCA 3K4DA 4XP6H 3PWVB 4YHZH 2ZJSL 5HHXL 4P46A 3ZE0F 3PP4H 3GJEB 4K94H 4UUJB 2M1KA 5IVXA 3FO0L 1HCVA 3K2UL 1X5XA 1V3JA 4LKXA 6CGTA 2F8VA 1D6VH 4DK3A 3E2HC 3PL6C 4N9OB 2X4RA 2DKUA 5DQDH 1CL7H 2ZSWB 4WWKB 1MI5E 1A7RL 4LVEA 3HTLX 5GRYA 3BGMB 5C08E 1FZKA 1P9MC 4J6RL 1N0LA 1J1OH 1T66C 5E9DE 4JRYB 2J1KA 4X5LA 2FX9H 2YWZA 3ALWA 3LN5B 1RUAH 3SBWA 3QDAA 5C0CB 4I0PB 2OTUB 2VXVH 2KL6A 2ZUTA 3MTRA 1E4XL 3QXUA 1YN6B 1LMKA 5EU5B 1AGFA 4PV8A 3B4NA 3N9GH 1AO7A 2R1XB 2BERA 2XXMB 1J0JA 3UTSE 4F7EA 1O0VA 4WWKD 4X6CB 3WIHA 1GGBL 4XNYH 3O3AA 3LQAH 3MR9B 3MGAA 5CBAB 4NUGL 5E8NB 1U8QA 4U1KA 3BZ4B 5MEOB 4MJ5A 4MYWB 4DWHA 1B4RA 2VDRL 2YA0A 1IM9B 4Q7DA 4Y19D 5C0CD 5T1DL 4P2QB 4TVPH 4WDIB 5DVMA 5FEBA 3RUGE 3R0NA 1NL0H 5EULV 2PKDA 2HWZL 3BKML 3DX6A 2NY0C 1C7TA 1OP3K 2BVUA 5FKAA 1U8QB 1IC5H 5EC2A 5KVMC 2EDYA 3AXLA 2BP3A 4NO2A 4U6VL 5E7BA 5JO5A 1YN7A 4J3SA 5HXMA 4I9WD 4IM8A 3KPSD 1G9ML 2KBGA 1AD0B 4LCYA 5T5FL 1EFXB 4P9HH 3U4BH 4NKMB 2Q8AH 4D0BB 2XQYK 3FO9B 3SDXF 5DQJB 4F58H 4KJPC 3OBAA 2F58L 4OTXL 4R26H 2G5BB 1LP9E 2H1PL 4PP2B 5JDSA 3DXAE 3IDXL 1HN1A 2DD8L 3GFUA 2V5MA 2YMXH 3HI1B 4X4ME 1KIQA 5JPNB 1T1XA 5DMJB 2CGRH 2IBZX 1NSNH 2MTPA 3OKEB 3RNKB 2VIRB 2A6KA 1YEKH 3ULUC 3QHTC 4HBQA 4U1SB 1OAKL 5JIIA 3EOAA 1F4XH 3NIGE 5DFVC 1BQLH 5C0DA 1FN4A 4OI9A 3P0VL 4IRJD 3MLPA 3WE6A 4TTGA 2FB4L 3T0EE 2Y06L 4XMKL 4MA8H 1MFNA 1F6LL 2QSVA 4Q58C 4WHTB 5SWZE 3NA4A 2ZOKA 4DTGH 5GGTA 2ZKHL 4GW4A 4PUBH 1CE1H 3OG4B 5EN2B 2FL5A 2LU4A 5GGVL 1BIIA 3CAFA 1Z9SA 1PZ5A 5FO8A 4G7YL 1J0IA 2W9DH 5ENWB 1UXSA 3VMNA 1ZV5A 2OM5A 3JV5A 2O93L 5CP7A 3FTGB 1JNNL 1NC4B 3HNTH 2X1WL 1YNKL 4GKOA 3QUYC 1NAMH 1REIA 5BJTA 1Q9KA 4WCYL 2GY7B 1B0GA 4HWEL 3G08A 3S4SB 1JZ4A 1OSZA 3N1MC 3RA7H 4PJ9B 3C5SA 2CH8A 2GEEA 1ZMYA 2HRPL 3PGCB 2WV3A 1FN4B 3UYPA 2WWKT 1XF5A 1RY7B 1AFVH 4QHMB 1MRCL 3GSNH 1KJ3H 1I8MA 1FNGA 3NABH 5ID1B 4EUPG 2VDMH 4U0RC 4Y2DC 5CJBA 4OF8A 3WIFA 1NCDH 5EN2A 1I85A 4FA8A 1XMWA 2J8OA 3WKNA 1JI1A 2ZOKB 4G6AD 3EOAB 5JA8B 4ODVH 4M5YH 3QDMA 1JCKA 3ECBA 3MRPB 2AKRB 2NYYD 3TBWB 4JM4H 1CGYA 4YXHL 2XRAL 3S97C 3KHQA 1CICB 5T1LB 1YMHB 4RBPH 5J13B 4LFHG 3IDYB 2W60B 4DUWA 4ZNCD 1TJGH 4OD1H 4X6FA 3BEVB 1EHLH 2CLZA 2VLKB 4NNYA 1T2JA 3G5ZB 3TT3H 5C0JB 3T65B 3H7LA 5HD8C 4DFIA 3OQ3B 3G5XB 1XIWD 4M4PA 3WV0A 3TVMC 4QGYA 5D5MA 2VXSH 5IFHH 4XTRC 3KPSA 2R23B 3NIFE 2WINA 1U0QA 3CDFA 4PRPE 4HIIA 3VFNB 1U93B 5DMKA 5TDPB 4DEPB 3T0WA 5CZVL 4WDIA 1IM3B 2XZAL 1XR8B 3SO3C 4H88H 3U7WH 4FQXA 4XPGL 4F2MB 3JUYA 4RBPK 3LQZA 1F4YH 2IAMC 3C08L 5A1AA 3EYOA 4H5SA 3FZUD 3LPFA 1FRGL 3O4LA 5C0CA 1I1AD 1B2WL 3OXSB 3FO2B 3G5XA 2E8ZA 4GW1A 1YUHA 1IQWL 5I1LA 4K94L 4NQDB 3V6OE 5A16B 3MRNB 2VLRA 4PJ8D 1I7ZB 1HK6A 3FO0H 1AR2A 3DVGB 3CVIL 3I6GA 2FZ3A 1INEL 4U1KB 2KQMA 5EG6C 3MRGB 1ZLWH 3VWJA 4O2CA 3HB3D 3QNZA 4YX2H 4RAUB 4LPXA 1U8OA 4OM1L 4AENA 1X4ZA 5CWSA 3QWRD 5JIPA 1EBPA 2AEIT 4WUKH 5LWYH 1RZ8A 5E2VH 5J1AA 1J1OL 1Q38A 4TVPD 4DK6A 1UH3A 5FM5M 1S7QA 1I1AB 2X4TA 3FFCE 5I1GH 4JM2F 2VL4A 2Q7NA 1XCQA 4JO4L 2QLVB 3SCMC 4KKBD 1NBQA 3UP1A 1XR9B 5DGRA 1NGXA 3L3DB 3SGEI 2DIJA 1G0YR 4PY8I 1M7DA 3QUYB 2HJKA 4M93B 5C3LD 2YSSA 2DAVA 3B8SA 1PSKL 5HSFA 3VXUE 3KLHD 5ICYB 5HHVL 4JFHE 1M7IA 5ESAA 2AXJA 2PYFA 2GYSA 2VDLL 1FJ1A 2PW1B 3RDTD 3BRFA 2I5YH 4XXCA 4ODHH 2JIXD 2XZQH 3Q2CA 3BKMH 1GSMA 4OD2A 5EWIL 1A02N 4KZEH 4FABL 1WZ1H 3FOMA 4N5EC 4ELMA 2WNGA 4N8CH 3BW9A 4KVNL 3D3VB 4NFBA 4ODSH 5IEHB 3C8KA 3E6FA 3BPNC 4MS8C 1MCKA 1MREL 3U1SL 3ARBC 4MQXD 3IFPA 1BQHA 4YDIL 5EU4B 5FM4A 1AQKL 2YN3A 5E1AB 3G6JE 3BD3A 4Z0XB 3ARUA 1M6OA 1MUJB 4QXTB 5GZOD 4Z76B 2MQCA 3C09B 4OCRH 5E5MA 3WUWB 3SN6N 5MENA 4CADB 1WJ3A 1C5CH 3B9EA 1A4KB 1IGIH 3PABA 1QSFB 3QI9C 2CIKA 2VLJA 4JZNB 4L3EE 1CFTA 3JV6B 4LP5A 1LK2B 3RNQB 3QH3A 4Y19B 3DGCR 2HN7B 2FX9L 3MV8E 4BSVA 2I9TA 4LPUA 1LO2L 4MXQD 1N7MH 2Z92B 4D0DA 5AWNL 1VHPA 2HJFA 2GSIA 2IANE 3WNNA 1VADA 5D6CA 5EO9B 3QCTH 4B50A 4CDGC 5GGRY 2F5AH 5D7JA 4HKBA 2JJSC 4MQTB 1JRHI 2ZUUA 4EBQH 3CLFL 1JJUA 4IS6A 1OP3H 5GJTH 4M7LT 5IESH 5C0RL 3CK0L 1TQCB 5D1XB 1NMCB 1XGYL 1A7NL 3MOBL 5JOFA 3KPRD 2EDKA 5I1KH 1RIHH 4NBXB 2D0FA 5DC0A 4PJFB 4OIAA 2VDNL 2DTML 2QQLH 3LH2H 3VH8G 4RA3A 2VDQH 1X5YA 4HZLB 3DXAD 3FFDA 2VQUA 4CMHB 1S7RB 3UTQB 1JGLL 4L3CB 4JG0L 1P53A 2ITCB 5EOTB 3QG6B 1F97A 2J88L 5FAAA 2AEQH 4P5KA 4TRPL 4OCWL 1A4KA 3ZTNL 5FGBA 4G42B 4QRTB 5ICXB 4OFPA 4LNRA 2VZSA 5I2IA 2CSPA 2HJLB 3CU1A 5E1HB 1NCBL 3MRIA 2N1KA 5FYLE 4PBWD 5CD3A 1D9KD 2FGWL 1MRFH 4QHUA 3V4VL 3HZMB 1YEDA 1UA6L 3O6FB 3TCLB 4U1JA 2BSSB 4OZ4B 5EPMB 4NWTL 5D6DA 2WWKO 2ZG1A 1ITCA 1PZUB 1SBBA 1NGQL 3HS0A 3SE9L 4RISL 3IKCA 3G04A 3OX8B 3RTQB 5DLML 4JFDD 5GS2D 5BOPA 1OTUD 4TUJA 4WW2B 3RWEB 3K1DA 5DUBA 4JCMA 3PV6B 3MGTA 1RJZA 4QRRD 1D9KB 5FGCE 1OOAA 3O0RH 2MPAL 3MRCB 4AM0A 2DBLL 1DLHB 1DSFL 3CXHK 4JR9H 5FGBC 2YSSB 3VFRB 4P2OB 4MD4A 2Y23A 2H2PC 3B9VA 4FNLL 3P9LA 3NACL 4FN0A 5DYOA 1KV3A 3HNTL 4IMKA 5HYJB 4X9BA 5F72S 4NQVB 3STZB 4R3SB 4IRSB 1RK1B 5GS1B 5IB5B 2OP4H 3L9RA 5EOCL 4DKFL 4MAYD 1CDJA 1EFXA 3PIQB 5HGHB 1TQBC 1S9VB 3QFJD 2XKUA 3C2AL 1F58H 3LRSA 1Q9LB 4ZUUA 3BD5A 1MOEA 5F7DA 4HUUB 2D31B 4LIQH 1QHOA 4RMVA 3A6BH 3SDDA 4XZUA 5T5NG 5HYJD 1G7JB 4HXBH 4I18A 5H35A 2AJXL 2H45A 3VFTB 1HYSD 4L8DB 5KSBB 3DLQR 3RVVC 1F4HA 3ZE1F 3ARGA 2G75A 4NO5A 5I30H 4KTDL 4X9IA 4P23C 4OZFA 2ICWA 5IQ7L 1T1YA 3DUSB 4HKJA 3C60D 3FCTB 4K7FB 4OD3L 5E2VL 1IEHA 5TDPA 3T3MF 4PTUB 4LLQA 2HT3C 1E6OH 3QEGL 1MAJA 4MZ2A 1RZGB 5EU6D 3L3GB 5DMGC 3UTPD 3BYTA 2OTUA 2XZCH 5EC1B 1NUDA 5TF1L 3FAXA 1FFOB 2F54D 3HE7A 3WIFB 1TCRA 5DT1L 3DYMA 4PJEA 1XIWC 3TVMD 3GO1L 2AI0H 5ID1A 3TO2B 3D18B 3TJHC 1E28B 2P24A 4MAUH 3QPXH 4ZAKC 2BC4A 2NY3C 4ODXB 2OJZH 3FONB 3U82B 2B2XL 2EDOA 1GGTA 2C9AA 2J12B 5TQ0L 1NEZA 3C5SB 4JJ5A 2AVGA 3GGWB 4CVUA 3GRWA 4I0PC 1MPAL 4X7FC 5C0BE 1AKJD 4NZRL 4ZXBC 1A1MA 5MEPB 2BNRD 4YEFA 1SQ2N 1K4CB 4L3EA 2VLJE 2P8LA 3UTTA 1I3RA 4HT1H 2XQBH 4I0KA 4X4XA 1PYWB 2AV1A 3TZVD 5EBMB 1EHXA 1KLUA 4QOKB 4YFLI 5C6TL 3GJFH 1DQTA 3C8DA 4M8QA 4D3CH 2FX8L 3K7UA 4LSSH 3RTQC 5HPOA 2YKLL 4HFUH 4YX2L 4K3DH 4LCCC 4MWFB 2JK5B 1HNGA 2Z35B 4PJDE 5T5FH 3EIFA 1KB9J 2XA3A 5EUOB 3QCUH 4XPFH 4I3GA 4OZHB 1I75A 2ITCA 1QQDA 3HNVL 4WW2A 3RWEA 1QSVA 4JB9L 2BC4B 4P9MH 4QOKD 3ILQD 2EIZB 5T1KD 4IMLB 2AJSH 1UH2A 5TPWL 1IQDB 5D7SH 2MCPL 1T1ZB 4PJ5D 1W8NA 2NQCA 1MJ7H 5IESL 4K2UL 4FFYH 4C56D 3MOBH 4XWOD 2NY0D 5IMMA 1QUNA 4LLVA 2JCCB 5JORB 5K9JL 4DFHA 3CH1A 1PEZA 1GJIA 4O2EB 1ZA3B 3HCVB 5CD3B 5DJZB 2R2BB 4JPWL 1FV1A 3Q1SH 2EIDA 2VC2L 2PTTB 4FQHB 4BZ1L 3O6MH 1RZIB 4MJ6B 2DWEA 1XFPA 1TDQA 4KQ4H 3MNZB 4PJIB 1CFVH 1N5AB 1CR9L 3TFKC 2B0SH 3G6DH 5FYKH 2G60L 3F58L 5FA4B 1ED3A 3IDUA 4MQXC 1XGPB 1N3NA 4AH2B 4ZPTB 2BJML 4CVZB 1K2DA 3VRIB 4G6MH 1KCVH 5BZDA 1GOGA 3VMOA 5D7KD 1BBJB 3QUXD 3QIWC 2WSKA 5CEZL 4U6HB 1X7QA 4ESKA 2F19L 5IHBA 1JL8A 5IR1B 3JBG7 5KVDL 1HXYB 3WXWL 3NIGF 1HI6B 4NQEE 2Y7QA 4F15C 4N8VB 4NRXA 5TE6L 3BW9B 3F7QA 4PBVC 2M26A 4I3SH 5F7EH 4YE4L 1VKXB 3DSFL 4PD4J 2JELL 1GC1L 1UCTA 2IMNA 1SEQH 4LFHD 1AY1H 4PJ7B 2NNAA 1LK3H 1S9WA 5D5ME 4OZGA 1W72B 5ANMB 4WJ5B 1NCCL 5AG8A 2Y6SD 1A6WL 2HN7A 2I27N 2QADD 2XTJC 4OFDA 4UT9L 5E2UL 3TH2T 3SJVE 4R4NC 3T1WA 3TF7C 2WY3A 3GMLA 5LXGL 2ADFL 2VLJB 2JE8A 5J89A 2E9IA 4NQCB 5FUCC 4FNLH 2D7OA 4EDXA 2QSTA 3MODL 4XB8A 4QNPE 4ONGH 4PLKC 1MIEH 1JPSH 3A67H 1QBBA 3A6OA 3KAAA 3S34L 1G7IA 2VDQL 5DI8B 2LU3A 1RJYA 4YEEA 4LCUA 3NH7H 4GO6B 1BBDH 1E4JA 2F5BH 4IJ3B 2XT1B 4L8SB 4NJ9L 2H41A 1KIRB 1HZHL 3SDAB 5F97E 3VXQB 5BXFB 1P7HL 5CHNA 3RWCA 2R69L 1U8LA 3FN3A 1UXWA 3GSWA 1R3HA 4MD5A 4J4PA 4EIGB 1D9KC 1L7TH 2DM2A 2OL3A 2Q6WB 1MLBB 3DARA 2FBOJ 4XP5H 3RVWD 2AJVL 3JTCA 2IPTH 4WW1A 4KTDH 1MWAB 4S2SB 4NKIL 4JFYB 3UTQA 3D2UA 2O61B 1T7VA 2C3VB 3LOWA 3IGAB 1ZVSB 1QLFB 1MHEA 3LAFA 3U0PA 4RGND 5JXEA 1AC0A 2P8LB 1OGTB 3I84A 5ALBL 2FATH 5AZEH 3UDWA 4RAVA 1OCWH 4MJIE 4G6JH 2A74A 1OM3L 1YMMA 3VGAC 4YHIB 1KYOJ 5EBLB 1BP3B 3KDMB 2B39A 4YHOH 4OGAD 3G6AB 3S37L 4NN6B 4LK4A 1DE4A 4IOFC 2WK2A 4QEGA 2Q20A 1MI5B 5F8QC 1QVOA 1T5XB 1HIMH 3G5ZA 2IPKB 5LQBL 3CPLA 4Z7UA 4KFZC 4P2QD 4L8CA 3QUZA 3WUWG 2NR6C 3L95A 3QUML 4RGNB 4HJJL 5I0ZA 3U46A 1MVUA 4ZFZA 2D7NA 3MRRA 3RZCD 3QDJD 5DUMH 3U7AA 4JHWH 4NQCE 1MELA 2H6PA 4J3WA 4P5TA 2GTWB 1TITA 4U1MA 1NFIB 1A3RH 1HINL 3PWPA 4QOKE 4YGAB 2Q76B 2ED7A 1WAAF 4Z7WB 2XTJE 4A6YB 3LMJL 5FM5O 4Z76A 3TT1L 3A6BL 4M61B 4QHLB 1EA9C 3BKCH 4FQLL 4C55A 1HYSC 4ZO9A 4FTVA 2MHAA 3O3DA 3K0WA 4B0MM 3NCJH 3VRIA 4Y8AA 4BZ2H 3VA2C 1CXFA 1AE6L 1NSNL 3LIZH 2VQ1B 4J7RA 4JPVL 5TH2A 3KJ4B 1WWAX 3P30H 2HKFH 2NLJA 4XZUB 5FOJA 4OZHA 4K8RL 2HT3D 1ZS8B 4UDUA 1FFPA 3S35L 3FMGH 8FABA 1EZVY 4S10A 3WNMA 1OSPH 1X9QA 1YY8A 4JFDB 4TSCL 1VFAA 4BFGA 2C4XA 1YMHA 1W72L 2PO6B 3ARED 4OFYA 1I8IA 4JGMA 5FHBH 3FFCD 2HFEB 4LLYA 1GHFL 1C5BH 1RHHA 1IC1A 1JFQL 3TFKA 5GGVH 4GG6B 4K07A 1UWGL 4LSTH 3TJHD 3C09C 2HG5B 4UB0L 3GO1H 4K2UH 4QHKI 5DTFB 4Z8FL 1CXIA 1CXLA 2YPLD 2R0WH 3EYUL 2XWBA 3VI4E 3Q3GB 4N5ED 4Q97A 1NAML 4EVNB 4NC0B 4OIBA 5D1ZB 1B4JH 1BF8A 1G84A 3I85A 4LPWA 5TQ0H 5K9OB 1D6EA 4I0PD 4AY0A 4U1IB 4U1LB 3BP7A 3UTSB 3LEYL 3PP3H 2VTFA 5GGSB 3K3QA 3DV6A 4PJ9A 3WFZA 3PWJB 3UTPE 3CFDA 1HCFX 4PJDA 3G08B 4U0QB 4GG8A 3ARFA 5FYLL 4OGXH 5A16A 1KN4L 5GSVB 5DVLA 2CO7B 1I9IH 1I3VA 3IT8D 3RTQD 3RAJH 3K74B 1F02I 3EYVB 1MLCB 1UYWL 4MXQC 5C0NC 4GG6A 4UTAL 1XGTB 5HVGB 4X4XB 3HMWH 4KK5D 4L9DA 1NBYA 4D9QD 1ZHBB 1U93A 5DMKB 2CDEB 3KPNA 1K4CA 1TZGL 4L3EB 5D1QA 1IC4H 3VD4A 3X14A 2OR8A 1ZT4A 1QSEA 3HE7C 1GZPB 5CAYB 3FQXB 3V4VH 2X4NB 5FYJH 2QR0A 4HJGA 2DL9A 4OI8A 1A9BB 1ZT7A 2A6JB 4MA7L 5EOTA 2PO6C 4NNPL 3QFDA 5CILH 3FT3B 2JB6B 5DJDB 5I8CA 3M17B 3IAGC 5J1TC 3U83A 4LAJH 2YPVL 3I3EA 4QRPA 5EUKA 4DKAA 4OLUH 1FYTD 3DGGA 2A83B 2W0PA 5T5NF 1QLEH 4JKPH 1CLZH 2ICEB 3H9SD 2P4AB 2BDNL 4GUPB 4RSVA 3UPRB 5GS0D 3IFOB 5JOFB 1IEBA 3G5YB 1JPSL 3BI9X 2D03H 2WWMD 2UZIH 1MFEL 3QSKB 5EFIB 3V6FA 4OZIE 2H2SC 4GBXD 5CZKA 1LE9A 2HAZA 3CX2A 4S0UC 1OPGL 4XNQB 4ZOCA 3PGFL 1Q1JH 4PJHE 1KCSL 3D87B 2UVEA 2C3VA 3UC0H 1Z3GH 4M7ZC 5E9DA 2O26U 2R29H 3WFCL 2C26A 4RDQG 2YXMA 3C2SA 4X6DE 1IC5L 3TIDA 5A2FA 1MI5A 4WU5A 2QADB 4IMKC 3S96B 1DUYB 4FQJL 4R7DA 2A6DA 4CGTA 1RZKH 3N06B 1OSZB 3TYGL 3VXUD 2QV2A 1YEIH 4WEBH 3ARTA 2X7LA 4NHCL 4QWWD 1CBVL 5H94B 1R24B 3CFCH 4Z7WF 1EJ6A 3IAPA 1ZVSA 1I3GL 4BK4A 5FO9A 3V6ZA 5HHMB 5DHYA 1IGTB 5DZNA 5E8DH 4ZSOB 4ZNEA 5HHME 1OARL 2EIBA 5DJ0B 2CLVB 3GMPA 4JN1H 1B88A 5CSGA 1NGYA 1EVUA 5L2KE 3H9HA 5IGXH 1XF1A 5ICXA 3HHRB 2A77L 5TGBB 4FFVC 4OLWH 1AKJB 1FVEB 2DQGH 1V3LA 12E8H 5MI0B 1Y18B 2YN5A 4PLKD 2H3NA 5I19L 5I16B 5CINH 1RZJC 1MRDH 5JLZA 3QIUC 1MF2L 4GKSA 5B38A 1ZSDA 4YDVA 5B8CA 3EOTL 5ALCL 4K7PY 1RUKL 1RVFL 3MLTA 1OP5K 4HUVB 1GCFA 1Q0YH 1FNAA 4PJ7E 3UMTA 4ODSL 1DBKL 3B2VH 4U3XA 1MCIA 4MCYA 5EO1B 4OGZA 3QRGL 3IJSA 1L9NA 1I1YA 1HINH 4YHML 2X1QA 4ISVA 1C8PA 4K7PL 4PP2A 4ODUB 1G7MA 1XCTB 3QXTA 2DRUA 3F7VA 1R0AH 1WBXB 1CE6B 3PHQB 1FVCB 1A1NB 2ESVD 5D1XA 2FYYB 1E27A 4P23D 5IR1A 2V2XA 3RVWC 1HOCA 4KZDL 1UVQA 3SKJL 2GCYB 2VDOL 4PRDB 3NCJL 4LLUA 2BVOA 1PKQB 5FUOL 4LEXL 5IFJA 5I8OH 2ZJSH 5HHXH 2A1WH 1NC2A 1O7SA 3ESVF 1PJ9A 5GRXG 1LO2H 5E2JA 3PXHA 1KACB 4R0LC 1X5IA 4N9GA 3G5VB 3JV6A 2CUHA 4XH2B 3U0TA 1BGXL 5DQDL 5D2LF 4U1HB 1VB9A 2F5AL 1H0DB 4QF1B 2IG2L 3C9NB 3GSQB 3S36L 4HK0B 3VFNA 4U6YB 1FO0H 3RPKA 3IDJA 5IFAH 5BV7L 1AHWA 4WFFD 1NFDA 5DEGA 4NJAL 4NUJB 4K9EC 5BS0D 1OTSC 3OKNA 3WFHB 2FH8A 5I1KL 4XP1H 3RU8H 3PWUA 3PDOA 1FZOB 4ODTH 1MQKL 4ZXBD 2EO1A 1HOCB 2OTWB 3REWA 3F7RA 3DO7B 1IAIH 5HVFB 2FHBA 3LB6C 4U7MA 2HKHL 2QQQA 1AR1D 3WHXB 4XC3H 4R97C 5GGVY 2GSIB 3IU3A 3MV8A 4HG4K 3DX7B 3GK8L 4GKSB 5B38B 4NYLB 1JGEB 3BVNB 4LLUB 3C6SB 4HK3N 4E0RA 3LHPL 4Z7UF 5T33L 1WWCA 4TVPL 5DK2B 5KTEL 3I75A 3UCRA 2AK4D 1E27B 5DO2C 4HMEA 3G6AA 2P5EA 4KQ4L 5E8PA 5F1NA 2DYPB 5GGUB 3S88H 1JPFA 2ZUWA 4WEUD 2DJSA 1G7MB 1XCTA 2NY4D 1OGAE 4WNQA 1D5ZB 5CEZE 1MFAL 4E42A 1IAOB 1BF2A 4QO1A 3LIZL 3VW3L 1VGKA 3ABZA 2RCSL 1NGPL 2HRLA 4TUOB 5KS9A 3U0PB 1XCQB 3RQ3A 3I50H 3T8XA 3GBMH 1XGUA 1QNZL 5SWSA 3ILQC 2ZCKH 5JHDA 3SGKC 5BRZD 4HKXB 3HR6A 4F58L 3DUUB 2P5WB 4JQXA 4HIEA 2AK1H 5ECJE 1EAPA 1RZ7H 4TSCH 1HHKA 1YYLL 1IGJA 4JGJA 1U8OB 3FQNB 1UJ3C 2BVYA 3BZDA 3QCVH 1A3QA 2VL5A 1EVTC 2W92A 3VXUA 2B1HH 4I0CC 4S1RL 4JG1H 4MDJA 1EAPB 1QPXA 1LK3L 5C1MB 2MHAB 2Y06H 3T04D 4HJ0C 3R8BB 2WBJD 4KDTA 2C3HA 2XY1A 1UKQA 3ALXA 1N59B 4MNHA 1X3DA 2IQAA 32C2B 3SOBH 1JMZA 5L2JA 4GAFB 5H94A 4P2QE 1HEZB 4BQ6A 4U3HA 5DI8A 3V5HA 1F58L 1NGZA 2IANA 1U8NA 4ERSL 3DURB 4HULB 3X12B 1MJUH 3BH8A 5I75C 3QHFL 2IJ0C 4HFWB 1HH9B 5HGAA 1YNLH 1PY9A 4RAUA 3VFUB 5MERB 3MLVH 5FUZL 4FABH 2BY1A 3OPZH 4FRWA 4XBPA 1YC8A 1INDL 5H37G 5D8JH 4NJ9H 2RJMA 5KSBA 2Z8WC 4MB3A 1D5IL 3EOYG 3TPUE 2BSRA 1NGWB 4H20H 5C0CE 4P4RA 2G5BA 4ONFH 1QFUL 2EDBA 4P57A 1FH5L 1AQKH 2X4PB 3P9MA 4KQ3L 1L7TL 1PKQE 1IGML 3KXFE 2FIKB 1VDGA 4TNWF 4HH9B 2NY1C 3FT3A 4WU7A 3C5ZD 3BZFB 4HFWA 2IBZY 1ORQA 5JO5B 1BPVA 3BP5B 1G9MC 4L9LB 4NDMA 1E6JL 1EMTH 2B5IC 2PO6D 1R3JA 3VFWA 4LEOB 1QOKA 2XWTB 3MUZ1 3V5HB 3L9RB 1UJ3B 4PYGA 4MXVE 2YUZA 3ZKSD 1K6QH 1UC6A 2XACC 2XNAA 1CD8A 3IB4A 2BY0A 1QLEL 4MNQA 4ZNEE 1AXIB 5GS0C 3TF7A 1VEMA 4G6JL 2EEDA 4N8PA 2WWMC 1H3PL 5E8OA 2BVQA 4G59A 3JWDL 5DSCB 2H2SD 4GBXC 5ADPH 5HGBB 3MLZL 3PWJA 1B0GB 1T0PB 5DS8A 1RZIA 3BKJH 4XNUH 4E5XB 3P0YL 4KJPD 1HHJB 5C0AD 1OPGH 4FQCH 1PQZB 4ORGB 3ME0A 4O9HH 3JUZA 3ZHLA 4I77L 5EU5A 5B4MD 1KG0A 1CVRA 4KC3B 1KYOK 1PZ5B 1JP5A 4F33A 4C83B 4Q0XH 4JG0H 2FL5B 4N5EA 2FD6H 3V2AR 4WO4A 3VI3F 3HMXH 4NCC2 5CIPB 2IFFH 3N50A 4IRJC 1MIML 3WN5C 2VN4A 3GHEL 4HAFA 5C09E 4UDTB 1LNUA 2AV7B 1H5BC 5MI0C 3LQAL 4IOIA 2HJLA 2PO6A 1KCKA 1FLRL 3MV8B 1KELH 1U2HA 3C5ZA 1UA6H 1KGCD 5KJRL 4S1QH 1YY9D 3R1GH 2X09A 4E5XA 3HMXA 1H3TA 4QHKJ 5DK0A 4WO4B 3QIWB 4G43B 5F8RC 3BIAX 3IFLH 3RI5F 3IU3B 3TIEA 4WFHD 2FLBT 1NMAH 4RWYL 4MCZB 1NBVH 4H8WH 4LCIH 4KRPC 3UBXB 2D2OA 3RJQB 2D3VA 3T4YA 2A73A 2FBJL 2FHCA 1VFOA 5C70A 1MHCA 4UT7L 4P23B 4BSJA 4X7SL 3RFZC 4MDIB 3OJ2C 4J4PC 4X8XA 2PXYB 5EIIB 1JFQH 3O3BB 5FKAB 2A2QT 2MMXA 4EUPB 3VGEA 1O7VA 2R0LH 4A2MA 3S3SA 5M7QA 1CFNA 3U46B 4YNYB 1CU4H 2OXHA 5T3XE 4F57H 5DJ2A 3H7BB 4NM4L 1A6AB 4MNQD 3OKEA 3MNZA 5I1IH 5F3HA 5I15L 2H26A 1JK8A 3MCLL 3WS3B 3IU4L 4G5ZH 4R4BB 3EO0A 1U8JB 3ROLA 4AMKH 4Q9RL 5EO0A 2ZUQC 1FNEA 4N0CC 3DI3B 3HUJB 4PRDA 1DLFL 2ZKHH 3MMEA 4XPBH 3SDAC 5DRWB 5I8OL 1MCEA 3CSGA 4KKCC 1X6NA 1C08B 4JFQB 4QTHA 2GSGB 1HEZA 3JWOC 2FYYA 3P4NB 1CXKA 3UPRA 5L0QC 5HD8D 2X4UB 1SJEA 2W9DL 4G7YH 4OCSL 3RUGF 2DOCA 2NTFB 2OI9A 1EUUA 3L95B 2X1XR 2QJDA 3KXFA 1C1EH 3DX8B 4RAVB 2DI9A 4OV6F 5BRZA 2XN9B 4NQSB 3N1PC 4NPYB 5DD0H 5DHXB 3QUMA 4AT6B 4APQA 3T4AA 5L88H 1A6TB 2HT2D 5BV7H 4Q9QL 1TNNA 2HH0L 4M7LH 2CKBL 2APBA 3MJ7B 1YQVL 2X4NA 2XY2A 3KYNA 3HG1E 4PBXA 4B7IA 1TVBA 4OB5L 1F3JB 4HG4J 3L5WB 2LVCA 5DT1H 1ZANH 4EOWL 2YD3A 4JDZA 5HHNA 4ZAKB 4O2FA 1I3RB 3NIDF 4PJXF 4RQQB 4IRSA 1PVHA 4CVXB 1EEYA 5T3ZE 4R96A 3L7EA 3BH9A 3SDAA 1RJYB 3O8XC 3VXQA 3VJ6B 5DUPL 4KPHH 2CDGB 7FABH 3MV7A 2NTFA 2OI9B 1F90L 2UZIL 3GJFK 3TNMB 4N0UB 4F7CA 4LLAA 3QJFB 1FL5B 4JJ5B 3SQOL 1DUYA 4YXLL 4NQTA 1WSST 1B6UA 2OZ4A 4U31A 3H0TB 2NX5D 4G9FA 4PRIB 5FO7A 4JKKA 4XVTL 4PJDF 3WS6C 3BHBB 1U8LB 5DVKA 1N0XH 3T0AA 1OWRM 3BVNA 4HT1L 4HIEB 1ZEAH 1IEAA 4YHZL 3UROR 4N90D 5K9OA 4R4BA 2YC1B 3B3IB 2VR9A 4LCUB 3Q3GA 5HHOB 5SWSD 3R06B 5JHDD 3W9EA 1Q9WA 2CKBA 2ARJQ 1J8HA 2YRZA 4JLRB 3E0GA 2DMKA 3ET9F 4F7PA 2BNQE 4JFZH 2YD7A 2ZSVB 1CD9B 5JHDE 3CFEA 1NC2D 3QCUL 5SWSE 3VH8B 1HSAB 3CUPA 3I75B 4ZG1A 2K7QA 5HYJE 3SDXB 4GRMB 4BH8B 1FC1A 4JFFB 3SE8L 2XKNB 2FJGA 3HLAA 5F7YC 1A5FL 5GJSH 4P23A 1OAQH 5H37H 5H8DA 4M6NH 3OSKA 1LE5A 5CGYD 4QXGH 5D7IE 3UTZB 3FQUA 4IRZH 1KTKE 5EB9A 5CMAA 3T3ME 5JQ6L 3PGDA 3C6LB 1G9NC 4JHWL 3QDJB 3ARSA 4WFGE 2VXTL 3WNLA 2CDEA 4U6HA 3PL6A 3E2HA 4X5XB 3TT1H 1NL0L 5IW6B 4PJBF 2XZZA 1T04B 3BKCL 1MAMH 3VG9B 4RFEA 1FNFA 4Y2DB 5TFSL 1RVFH 1FL3A 2QKIA 3GMRA 3OAYH 5ESVB 3OKLB 1KTDB 1IKFH 2J4WH 1KFAH 1KTLA 4XMPH 3S6CA 4NCC1 3NGBB 5DMYA 5I8KL 1AXSA 1GIGH 4G8GB 1QFUH 1TPXB 3DTXA 3NFPB 4HK3J 3MCG1 4XP4H 2UYLA 2EDDA 3NTCL 4PJAB 3Q48A 5JLZB 1KPVA 3GSXB 1CQYA 4MS8A 1W0YT 2C3WA 2YC1A 1AQDA 2CMRH 4XB7A 5FIEA 1SYVA 5DMIH 4R8WL 5CUSH 5C0AE 5ICZA 4LPYA 4TOYL 5J6GB 1CGSH 4AK1A 4C4KO 2R1WB 4Y5XC 5E1AA 1G7LA 4M43H 3GMQA 3LKPB 1YPZF 4Y5YA 4HIXL 1UT9A 1F3DH 3OAZH 3FT2B 2YPLB 1SEBA 5EBMA 4GQ9H 2BRQA 2Z35A 8CGTA 4NRZB 1D7FA 4PGDA 1JI2A 2V5TA 1KTDA 3OKLA 2UY6A 4UAOC 3QO0A 4TSAL 4FMFA 2J7LA 2XZQL 5IFAL 5DS8B 2EDLA 3WLBA 3QEQA 8FABB 4JCLA 2NCMA 1AKJA 5EUOF 3V79C 3ARZA 2VN7A 2Q6WA 4OSUH 3DBXA 1BJ1J 2V7NB 2EDFA 4XC1L 2O5ZL 1T0NB 1UGNA 4X6BB 3H9SA 3ULVF 2V9TA 5DVOA 1M71A 1EO7A 4UINH 2F5BL 1ZT1A 4WHCA 3TV3L 2HLAA 1KB9K 1U92A 3GK8H 4EDWL 1UB5A 4AZ8A 1GPOL 5I1CH 1IGIL 5L2KA 5JDSB 1OAUL 3TN0D 3R4DA 2CUIA 2Y07H 3O3EB 4RMQA 5C0RH 1JHLH 1CT8B 1U41A 4F37F 5HY9B 1CIDA 1Q9OA 2E7LA 1KELL 15C8L 3O2WL 1I3UA 3HAEH 5EO9A 5C0DB 1NMCC 1WZMA 2DTMH 4LQFL 1B3JA 3BUYA 3FB7A 1MCOH 5JW4R 1HE7A 4OQTL 1ULVA 5GRVL 3THML 2ZNWA 2PNDA 4OZGB 2K7PA 2VOTA 3ZE2E 5L88L 1XGYH 5B39A 4Q9QH 5H35B 4GW1B 1HH9A 1N59A 5KVGL 2VDPH 2F74B 4PJIE 1F11A 5DD5H 3ARGB 3CXHJ 4NZUL 4GAYB 3QISA 5E03A 2IALB 5GRUL 3V0WH 3ZLQC 3L1OL 4IDJH 2CDFA 2UWEA 1U6AH 3HC0B 4L3AA 5EU6B 3DURA 1OD9A 2R0LL 4K8RD 1YZZA 3T4YB 1UJTA 5CP3A 4V2CB 5KZCB 1VFBB 1MJ8L 4ZODA 3FB8B 2OQJA 1DBJL 4I0PA 5D7IA 4KK9D 5ILTH 4ZO8A 2HTKC 3IU4H 4KUZL 4HUKB 1HQ4A 5D9SA 2LQRA 3BEVA 2NY1B 1TZHA 4KRLB 5E99L 3ZT6A 1MWAA 4Z7NF 3BDYH 3F58H 4OQ1A 1ZA6B 5DMGD 4J3VA 3QHFH 3MNWB 1JPFB 1YEIL 5I9QC 1VSCA 1JPTL 5IVOA 5C0FA 2DQCL 3TBWA 3ROOB 3U7YL 4O2EA 5D1QD 3AREA 3PWVA 3GDBA 1I3GH 4NOFA 2DKSA 4ZAKD 4HMCA 2NY3D 3BO8A 3SJVB 4OLYH 2J8UE 3DIFB 4WUKL 1DFBH 2OP4L 1U58A 1WGOA 2OL3L 4DKFH 1ZKAA 3FN0L 2J8UB 2YR3A 4NNXA 2X70A 1OSPL 4G6KH 4K7PX 1UM4H 1R5VA 5HGGS 3O4OC 3OR7A 2ZPKL 5FF6A </