3L9RA

Crystal structure of bovine cd1b3 with endogenously bound ligands
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
275
Chain Sequence
VFQGPTSFHLMQISTFVNSTWAQNQGSGWLDDLQIHGWESDSGTAIFLKPWSKGNFSDDEVTELVDLFRAYFIGFTREVQDRVNEFQLEYPFVIQVTAGCELHSGAIESSLRGALGGLDFVSIQNHSCVPAPDSGSRGQKFCALTTQYQGISDIIERLLSETCPRYLLGVLDAGKAELQRQVKPEAWLSSGPTPGPGRLLLVCHVSGFYPKPVRVMWMRGEQEQPGTQQGDLMPNADWTWYLRVTLNVAAGEAAGLNCRVKHSSLGDQDIILYWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1b3
publication title Crystal structure of bovine CD1b3 with endogenously bound ligands.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune response
total genus 76
structure length 275
sequence length 276
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l9rA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l9rA01
3BGMA 3ZSSA 2A9ML 2Y6SD 2RCSH 2AEPH 4ZFZB 4JR9L 4PJXE 1ZA3B 5IFAH 3V4PL 4OM1L 2HWZH 2BNRE 2ZUSA 4NRYA 5B3JF 2F54E 3ZDYF 1Q9KA 3QIWC 4G6FD 3F7YB 4K7PY 4MHHI 3ARGB 2EDQA 3P11L 1N6QL 5F3HB 4ORGA 3RVWC 4KKLC 1MVUB 4RAHA 5B22A 4BZ1L 3DURB 4P9HL 1J8KA 4ENEC 3V0VA 3RWGB 5DFVC 4BA8A 3KS0H 5F1KC 5JHDD 4NNPL 2BNQA 3G5VA 5EPMA 4RNRA 1AJ7L 1A64A 3C5ZC 1MJ7L 1CGXA 4KI1A 1TVDA 3QDMA 1E6OH 1FL3B 4PFEA 2DDQH 1KPRA 1BWWA 3WNNA 2DQFB 3MLZH 2ARJQ 5T5FH 2CGRH 4YO0A 1YECH 1ZVYA 4CRPA 3FFCE 4JKLA 4U49A 5IT2L 4ZOCA 1S7XB 1LD9B 4ZNEA 4HGWB 2H1PH 4OLVL 5FB8A 3EIFA 1FGVH 5DD0H 5FF6A 3DVNA 5I6XC 5IHUH 1AXIB 1LO3H 4NO5A 4JY4A 4U1HA 3GUTA 1JUFA 3HNSH 2O5XH 4HLJA 5I66B 3OL2A 2D0HA 4JFXB 4Y4FD 3PWNB 5J4MA 5HPOA 5GGRY 4R4FH 1CICD 1Z5LB 1P4BL 4Z7NE 2ZSWB 1FNSL 5IQ7L 3QSKB 3UPRB 1WEJH 3RNKB 3IFLH 1GGCL 1QSEB 1I8KB 3V5DB 2Q8AH 3QG7L 4MCYA 1YMMA 2Q76B 2VIRB 4OD3L 4WHYG 3PIQA 3BMWA 1DDHA 4JPVH 2Z92B 2ZPKL 3EJZD 5SWQB 3T65A 3UC0H 4NQEE 1HNGA 3KYKH 3RZCB 4LVNC 3KXFA 5E4EB 4GSDH 5E6YA 5EZLA 4EUPB 5IVXB 1U8OA 1U3JA 3MGTA 5JMRA 3SDCB 3LQZB 1PKOA 2CRIA 3BP7A 3BRFA 3VFTA 1EFXA 2C4XA 5DI8B 4LIQL 1NL0H 1UH2A 1P84K 1GPOL 5FCUH 1HHKA 4GBXD 3BW9A 3S37H 5JQ6H 3S96A 2JB6B 3LKPA 3D39D 3O4OB 3FRPA 1U8LB 1F97A 2R0LH 4XTRC 5DTFA 5BZWA 1UM6H 5KG9A 3BEWA 4Z7OF 5F7EL 2WNGA 3O4LD 2XZCL 4X6CA 4MVBD 3EJJX 4XPFL 2R23A 4C4KT 3VFVA 5HVGB 5ISZB 3O0RL 3RWEB 4CN6A 1HI6A 2C3VA 2ADGA 3RTQB 4R7DA 2HP4A 5ICZB 1U3YA 4OZFH 2DLEA 3HNTH 4JKPL 3T3PE 3KG5A 5LBSH 3CU7A 1FNHA 2FX8H 4XC1H 5I2IA 4NUJA 1INDL 2GI7A 3QUZA 3TVMB 2JJSA 4OLUH 4LCCB 5KS9B 4W6YB 5J3HC 4L8CA 4NKDA 4JRXD 5LGJA 2PCPA 4PY7B 1J8HA 3GSNB 4S1RL 4XAKE 3WSQH 4LEXL 4K8RL 2EZ0C 3IU3B 3GSNL 4EEEA 1PBYA 1TJIH 5SX4I 4KMLB 2DL9A 2OQJA 5CJOH 1C12B 4PUBH 5E70A 2OP4H 3UTPE 5I9QC 4FFVD 4K7FB 3BP6A 5EULV 1OW0C 3U9UA 1S7UA 1JHLL 5DS8B 1A6PA 3ZL4H 3WKML 3RA7H 3QXAB 1NFDA 3U7WH 1OT1A 2F53D 1AGEB 3G04A 4OFYA 4OTXH 3TT3L 1UWEL 1Q38A 1YEIL 3BPLC 3KPQB 5C0RL 1QLFA 5KTEH 5I18H 2RFXB 4TVPL 4O2CA 3VFNA 5KSVB 2Y4SA 4PGZA 5KVDH 1VFUA 3FZUC 1NAMH 2E5EA 4KVNL 4I0CC 5EN2A 1MFAL 3O9WA 2XWBB 2ADIA 1BZ9B 4K3DL 5T3XL 1ZKAA 3MYJB 1MCEA 2LAAA 1UEMA 4LLQB 5T1LD 2H8PA 1QSEE 1HQRB 1II4E 3FOLA 2XZQH 3NFPB 4NHCH 5GISH 2P7TB 4IIQA 5IB4A 5BW7C 4NZTL 3IJYB 4WO4C 3SN6N 3O6KH 2ZUXA 3GBNL 2C3HA 5BMFL 4N9GA 3K46A 2ZG3A 3RVWD 3CVHB 4J1UA 2X4PA 1ZHNA 4TUOB 5EOTA 5DFVD 1BD2A 1SEQH 2I26N 5HYJA 3TV3H 3L5XH 1X5ZA 4ZYKB 3TZVA 3C5ZD 43CAB 4HUWB 4LIQE 4XPGH 2KH2B 1NFIB 3FRPG 4HS3B 3ULSB 3WFCH 3WXWH 5F1IA 3S34H 3IRPX 1NCBL 1I7UA 1XF3A 1DVFC 4X8JB 2XZZA 4ZFOL 1JK8B 1CD9B 3F7VB 1Z9SA 2BSTB 3BZ4A 2UZYB 4JN1L 4AEEA 2B1AL 1QLRB 1UJ3C 1UG9A 4MNQB 5J1TC 2OR7A 5ISZE 4H5SA 5GIRA 1U93A 4XP1H 3T08A 5JHLH 1N5YH 3VGHA 1WJ3A 4HMDA 12E8H 4XNMB 1LE5B 1A1OB 3F58H 3QBTB 5DQJA 2V2TA 4GAGH 3IFPA 3SE4C 2DD8H 2VL5B 1F3DJ 2E6PA 3B6SB 1Y0LB 5KS9E 3GMNA 3N1FC 4HG4K 1PZ5B 3REWA 1FV1A 5LCVH 4ZMAT 3HE6A 4NFBA 3FB8A 1MI5D 5FA3B 1TCRA 2VZSA 1BIIA 4P4RA 1OP3H 2JIXB 3MRRA 5E6IB 3QJFA 5HXMA 1T2XA 1CDIA 3L9RB 1AH1A 4ODXB 5JDSB 1OARH 1CDJA 4XBGA 1RY7B 4HUMB 4QTHB 1QHOA 4HJGA 2YUVA 4YHIB 2DIAA 4ZUVA 1I85A 3WFHB 5C8JB 5CAYB 2X4NA 4TVPE 3ULVL 3ILPA 3VFOA 1ZT7B 4P2CG 1WIOA 3QDJB 3Q6FB 4GXVH 3MO1A 3DGGA 5T3XE 3CX5J 3MCKA 4M5YH 4GKOA 4JFEA 2IWGA 4QRQA 3MJ9L 4G8FB 4PLNC 2BNUB 4LVHC 1HEZB 1P6AB 1QNZH 5GGTL 4KJQC 1W72B 3W81A 1JTTA 2AJVH 4FFEX 3JTSB 1W72L 3MXWH 2XIDA 1PGRB 2FWOA 1PX3A 5C0BB 3REVB 5DJDA 4LPTA 3ARVA 2XKNB 4IDJL 2EEBA 1WT5A 4ACPA 2DWDA 1U2CA 3SKNB 4BZYA 5L2JB 4GW1A 5E08L 3H9SB 5J3HD 4BKLA 4L4VD 3U0PB 1W0WA 1IC5H 3WLBB 2EZ0D 5C0DA 4XVTH 1S9KC 5ESQB 2A1WL 3FCTB 4JZNA 3VWJD 1BM3L 5IMKA 1J05A 4UDUA 2P5WB 3CFCL 2J12B 4TQEL 3SQBA 2VXUL 1MJJA 4PBXA 1JZ5A 4R97C 4XPHH 3NCYS 4HS6B 5D6CB 3CZFA 4P3DA 1NKRA 3ARBA 3WJLA 4MNQE 1N59B 2Y72A 1MCSA 4G7VH 5GRXG 1QRNE 4LSRH 5IMOB 4LLUA 3FZUD 1YNKH 1KPVA 3ZKMD 4D3CH 4JJ5A 4U7KA 4KMTH 3DVGA 3BPNC 4YUEL 4FHBD 3RP1A 3NA9L 3K0WA 4WTZA 3RUGF 3AS0A 5FUOL 2KPNA 1MFDH 3IFOB 4PDCE 5C0IA 4WO4D 2EO1A 4Q6IA 4WW2B 1N8ZA 4P5MA 4HJJH 5JO5B 3DLQR 5BRZD 5M94B 5J0BA 3S3PA 2NY7H 5E5UB 4S1QH 5FHBL 4X99B 3RVXC 4M1CD 4Y2DA 2WBKA 4L3CB 2ATKA 1ACZA 3JXAA 4Z5RB 1TIUA 1C1EH 4JPIA 3SCMA 1DBBL 1H0DA 4KZEL 1D5XB 1QLEL 1YYML 1YEKL 1L9NA 1RZ8B 1Z0NA 3ULVE 1B2WL 5DD5L 4HWZB 4PJAB 4U1MA 3MLRH 4PRNA 5CMAB 3MZGB 5DMIL 3GJFK 4JFFB 2YZ1A 3SE3A 1JGUL 1XEDA 4WY7H 4DKFL 1DVFD 1UXSA 2DJ4A 3MLSH 3LD8B 4KTEL 1QACA 1KTRL 3LEVL 1NEUA 3BQUC 3QUZC 1XIWC 4B53A 4OB5L 2JJSC 5C7XH 5C0BE 4UZGA 3H42H 2EE2A 3IF1A 2OXHA 2LVCA 4O5LH 2V5MA 3IKCB 2BSRB 5EC1B 3O3EA 3R8QA 4I77H 3ZMRA 5EA0H 2Z0BA 2EXYC 1V3KA 5KVMC 4XNUH 1K9TA 4NQSA 3ROOB 1L0YA 1MCDA 2GFBA 4YAQA 2H32A 2HG5B 3H3PL 3ARSA 1YEGH 5F7YC 2ICCA 4Y5XA 2GYSA 4QY8A 2UYLA 5KANI 4WJ5B 2K7PA 1A4KB 4KI5D 2P5WE 5E8NB 1G9MH 4J3SA 1WBZB 5EWIH 3JZ7A 4Y1AD 4G8IB 1MCQA 4NZRH 5F93C 4G6KH 5FA4A 1LO0L 1V3LA 3NFSH 1MELA 1QFWI 4G59A 3O9WC 3IFNH 4JHAH 5FO8A 5I1HH 2FHCA 1Y18A 2VKXA 3O41B 1WBXA 4LLWA 1D5MB 2IGFL 1ZHLB 3QP3A 3AS3A 4RISL 3BEVB 2K7QA 4WTZG 4DCQA 4NNXA 4ZTOH 2CLRB 2FB4L 5DK3A 3S37X 4PJIF 2YPLD 4UBDC 4AL8L 4ODWB 3FT2A 1HSBA 3VFRB 4BYHA 3IVKA 4XT1C 4KJQD 4PRHA 4PRPA 4UINL 3LEYL 4IJ3B 5F9WB 1NGWB 4PR5A 2Y23A 2UWEB 4A6YA 2F58H 3IS1X 5D6DA 3LKNA 3TZVC 5D1XC 4OUUA 1TETH 2ENSA 2NY6B 2EC9U 2XWTA 3JSSA 4N0CC 3UJJH 4FFZL 1FO0B 1B4JL 3NPZB 2NNAA 1U8PB 2ZOKA 1FO0L 5DRZA 3QDHA 2GAZA 3HG1B 4ZODA 4PLKC 4H25A 1OSZB 2BOBA 3OXRA 1YEJL 4PJAE 4OLXL 2DM4A 1CVSC 1F13A 4R7NB 1AO7A 4L4TB 3ZDXF 1D9KA 4N90D 1NGXB 3WFEL 4R90H 4KQ4H 3VWKB 2XT1B 3N06B 5DJXB 4CNIB 4I48B 2NZIA 1EZVX 2NW3B 5DUPH 1JYWA 4IRJB 1AI1L 2J88L 2YXFA 3G5ZA 1RZ7L 3I85A 3QCUL 2EE9A 2R9HC 5D5MF 3RPIA 1IAKA 1JGVH 3LKRA 1FPTL 4G9FD 4E41D 2WP3T 4PLJC 3B9VA 1M7XA 2FZ3A 3HE6C 2YD4A 4GRWH 4GAYA 4WUUB 3TBTB 3GMQB 1AIFB 1ZLVK 2XNAA 4F57H 5MEQB 1FORH 4XNZC 5JXAH 3STZB 4FG6C 4G6JH 2R0WH 3R4DA 2ZWLT 3RKDC 4KQ3H 4BH7A 5EFIA 3TIDB 3H7BB 1R3HA 5ICYA 2DTML 3EO1B 2OTUA 4XNYL 3GSQB 5FGRA 2A9MH 4XCEA 3RVXD 3V6ZB 2YS4A 2FJFA 5GGQL 4JR9H 2VSDA 3V4PH 4OM1H 2ZUYA 5F6HI 1F3RB 4PJDB 4HWEL 1KJ3L 3QNXB 5IMLB 2OZ4A 2OI9A 1IM3A 5L8KB 4YHNB 2V9TA 3QIBA 4U0RB 2VXVL 1N6QH 1OL0A 2A83B 5TE6L 4BZ1H 2W60B 3WIHA 1I8IA 4GRLB 4P46A 4P9HH 1JV5A 3CMOL 3F6LA 4P3WA 1AE6H 3S9DB 4YBHA 1BLNA 4HWUA 1MJ7H 2DL2A 5SX5K 1JZ8A 2Z9TA 2A38A 2RQ8A 1DQQA 3BQUD 4LHUB 1S8DA 1QR1A 1XIWD 3PQYB 4KRPB 2UZXB 3LAFA 2UWEE 2EEAA 3BUYB 3GK8L 5FM4A 5IT2H 4GMTL 3IT8D 3PJSA 1M05A 4LK4A 1KLGA 3WJJC 1R3IL 2QKIB 4OLVH 4PJFB 1OAXL 5EBLA 1T4KA 3RNQB 4MJ6B 1S7VA 2F74B 2W07A 3SDYL 4MLSA 1NANH 3EFDL 2CDEB 2VR4A 3QFJB 5HHVL 3T2QA 4IS6A 1IAIM 4Z78B 2D31A 5DYOB 1VGKB 1EVTC 2OMNA 2X4TB 2NY0C 5E5RB 3HR5A 4CJ1A 1E4XI 1YNLL 3IDJA 5IG7A 1KF9B 1P4BH 1VEPA 2ESVB 1FNSH 3VRIB 5IQ7H 1Q9OB 5HHNB 5IWLA 1GGCH 3SKOB 4DN3L 3VXTA 1FG2B 1EEZA 4D0BB 5HPMA 5EU6E 4GXUN 1WZ1L 3O9WD 4X7FC 4V1DB 4G42A 1PD6A 2VDOL 4M9OA 5HVFB 3O8XB 4XP9L 4Y19A 5DRXA 1WUNT 2ZPKH 1U2HA 2ZCHH 4LPCA 1WWAX 1K8DA 3T77B 5AG9A 3S5LB 1YDPA 4HF5H 1H5BB 4Q6IC 5C07B 5MEOB 1T5WA 3MLWL 4BZ2L 1QO3B 4WUUE 5IIEB 5EZIH 3WS6A 2YPKA 2GJZA 1ORSB 3DVIA 4EUPH 4R0LA 2GK0B 1J0ZA 1Q9LA 1VCAA 1WFUA 2YEZB 3QXWA 5HHMD 1AKJA 3MNVB 4LIQH 5MEND 1GPOH 1HHHA 4H26B 1PX4A 1LK2A 4QRSB 2WWKT 3BAEH 4NO3A 2CRYA 4X5WA 5D1XD 1UXWA 1TPXC 2GHWB 5H8DA 4WFGE 4N0CD 4X9IA 1A8JH 5F7EH 5JR1L 2XZCH 2GJ6B 1K4DA 3NTCH 4XPFH 2DKMA 3GHBL 3WS3B 1JGDB 3O0RH 2H9GB 1OAYL 4U2ZA 2WANA 4PLKD 1EHXA 2WZPD 4N1CA 4JN2B 3HUJF 3AREA 3P9MA 2VLRB 1IGTA 4JKPH 4OCWL 3MFGB 3MFFB 3D3VD 5K9QI 3FL7A 1KB5B 4QXWA 1INDH 1IEHA 1L7TL 1JF1B 3I50L 4LDOB 1KB5L 1A2YB 3GSRA 3V5KA 1VACB 2VH5L 4WTWA 2ID5A 4NN6C 1P5VA 4S1RH 5C6WH 3LDBC 4LEXH 4K8RH 3GSNH 1WLHA 3BPCB 3E0GA 5DK0B 2R9HD 3MXVL 1OGAE 2WBWB 3LKOB 3IXTA 5ITFA 2IAMB 4DGVL 2J8OA 3DX8B 4RGNC 3SGKA 5DMGC 5HDBE 1JHLH 3HE6D 5F9JA 3WKMH 1F00I 5E8EB 1RJZB 1EDQA 3TT3H 3K1KC 1UWEH 3M1BB 5DUBB 1RZGA 1YEIH 2CKBB 3H0TA 4YC2C 5C0RH 3QDAA 1MWAB 3QFJE 2X4RB 2CKBL 4FG6D 2IH1A 1MWAL 3CDCA 1HOCB 1G9MC 3KAAA 2VZOA 4NQCA 3RKDD 3TFKC 3VI4E 4K3EH 3MRGB 3FT3B 4OIIL 3EYFA 4KVNH 4I5BB 3MLXL 2FATL 3RX8A 4K3DH 3U30B 5T3XH 3BH9A 1KV3A 5ITBL 3IAGC 2VLJE 1NC4D 2DI8A 1EEYB 1XZ0A 5C9KA 2EC8A 1OTUD 4NZTH 4YXHH 2P8MA 4V1DE 3ARUA 3V6OA 3GBNH 5BMFH 5IW6A 2GUOA 2I24N 1WAAE 4BJLA 3TO2B 1IGFH 3D0VB 3G6JF 2EDXA 2B5IB 3LPWA 3QUYC 4WDIA 3LVEA 4K55A 4JM2F 4Z7VB 5ACZA 3CVHH 1T1XA 2YOCA 3JUYA 1IC4H 5J6GA 1A3LH 1KG0B 4XCCL 5C07E 5C0EA 4TULL 1MAKA 4J3WA 3KPRE 1XGTA 3TBYA 3RBSA 4QRRA 1FIGL 4PJ5E 3QXDB 2W91A 1GGTA 4Z7UB 5D2LB 2XG4A 2Q8BL 5I71C 3OKDA 4ZQKA 1NCBH 4Y2OA 1R0AL 4FXGA 3VXRD 4AH2B 5DVNA 5E8OA 4R2GC 3O3UN 4JN1H 1ZGLM 2E9JA 2B1AH 3MV11 3BP5B 3QB7C 1KJMB 4PJEA 3IDGA 4PJGF 3E6HA 2NXYC 5HYSA 3UTSB 4GG8A 2NY0D 5JOFA 3MROA 3NIGF 4MAYA 3C9NB 2YD1A 5EZOH 2ZUQC 1DANU 1ZS8B 2ERJC 2BCKA 5FK9B 1UB6A 5ENWB 5BVJA 3OTTA 3RWJA 1T89A 2VAAB 4MJIE 4L9LA 4EQ3A 3RWCA 3VFUA 3WLWD 4OIBA 4E5XA 4C54A 3OWEA 4NZUH 2PW1B 4MAUH 1RMFL 3BKML 1OD9A 1P4LB 4YGVA 2PXYC 2BY1A 4FQIL 1J1PL 5DJZA 5I1LA 4FZEL 2I07B 1V3JA 3HRZB 3SDAA 2Z91A 5A1AA 5HBBA 3L3JB 3ULVH 4JZOA 5F8QC 3OAYH 4M8QB 2NY4B 1I7RB 5E94A 3LOWA 4ZOAA 1D6EB 1AGDB 1S9VA 2VITB 5EBMA 1MRCL 2OI9C 4YLQT 1NBQA 5I8OL 1H8SA 2ZNXA 3MJ9H 2PW2B 4YR6B 5GGTH 1QQDB 2ZG1A 3EOAB 2VDML 5E2VL 3ARGC 3W9DB 4ZNCD 2F8VA 1W72H 4MXVF 1ETZB 4N8CL 4ZS7L 3N9GL 4TUKL 3GB7B 3B9KA 4IDJH 2ENYA 4POZD 4MXQA 3ES6A 2QSQA 4DAGH 3UYOD 4NN5B 1QOKA 2QQKL 1J86A 3JTTA 2D7TL 4I3RL 1KIQA 5SWSB 3TPKA 2CXGA 3BKYH 2LABA 5F44A 1U91A 4H20L 1MHHB 1CDHA 1TZIA 4NO0B 5D2LE 1LEKB 3DHJA 4EXPX 1BM3H 1DE4B 3S98A 3ZTJG 1YEDB 4RGND 2P8LB 3CFCH 3R0MA 2IMNA 5C0NC 1IAOB 3CFJB 5DMGD 3MGOA 3QG6B 3CSYA 4TQEH 4X6FA 1I9RL 1VADB 5MEPB 3U4EA 4LNVA 2VXUH 1J5OL 1T21A 4KWUA 4WHCA 3X13A 2PYFB 3H2WA 1MREL 2DQGL 4ZS6C 4E42B 4ODUB 5HYSG 2Q1EA 2HFEB 5F89B 5AUMA 3WN5C 1FNEB 5HJ3B 2VWEC 2DRUA 5IWLC 1LP9E 3UTSE 3TFKD 1XF2B 4GKZB 2YD9A 2VOTA 4EN3A 1PEZA 3M07A 3NA9H 2BNRD 3ULUC 4X4YB 2VXTL 2F54D 3RQ3A 2Z31B 5FUOH 1UVQB 1EFQA 1NJ9A 3B5GA 1X6NA 1NEZB 1NCAL 1U8QA 2AXFB 3QEUA 3BO8B 4JB9L 3WS6C 1P1ZB 3GO1L 3OKNA 4PRAB 3QUYD 4M43L 5FHBH 2FBJH 2CLVB 5I16B 2XN9B 4BQ9A 1DBBH 3KNBA 1G6RB 3IJHA 1ZHBA 3GJEB 1QLEH 1YYMH 1YEKH 2FIKA 4KTDL 4DUWA 1RHHA 1B2WH 5DD5H 1R24A 2OTWB 1JZ4A 4Y4KB 2UUDH 3FFCD 4U1IA 4IOFC 5DMIH 3KJ4B 2VRAA 1JGUH 4L3AA 3E6FA 5LGKA 4DKFH 1CK0L 2IANA 4OZHA 2XA8L 1P4IL 2E7MA 3AROA 4RX4D 2AXJA 3AREC 4NN7B 4R2GD 3QUKB 4KTEH 1NCDL 5T3ZH 1ZLSL 4EBQL 3LEVH 5L7XL 4XBPA 4OB5H 4L3EB 4OI7A 2Y06L 5I30L 2HRLA 3RWIA 2NXYD 3H6JA 4JKWA 3C2SA 4QOKB 4XGZA 4ODHL 3TVMC 3GHEL 1XGUB 2E7BA 2PO6B 1Q94B 1VPOL 3MV8E 4K8RC 3ZKNC 4FQXB 2R2EA 3U48A 5BXFA 5GSRB 5SWSE 5I1DA 3H3PH 2X4QA 3L6FA 2APVA 3MYZA 4LDLB 1JWSA 4H0GA 4PJ9A 3SDDB 2NY5C 4NQED 5A2FA 2WWMD 3L1OL 3UTQA 3GFUA 4U6YB 4PJHA 3X17A 3GSUA 2PXYD 2AJUL 4RFOH 1NBZA 3FOMA 4YEFA 1UCTA 5J1SC 1LO0H 1ED3B 5C92A 1IGIL 5H37G 5LJYH 4R96A 3O3AA 2DI7A 4I4WB 3P0GB 1UM5L 2IGFH 1PLGL 3RHWK 4J3XA 4RISH 2G2RA 1A1MA 1EPFA 2V9QA 4OLZL 5I75C 2BDNL 4RIRB 1KT2B 1FZOA 2BOCA 2FB4H 3KPPA 3DO7A 4HFWB 5F1NA 1TZHA 5EH1A 2GTZB 4AL8H 2PYEE 4HV8A 4LKCA 1UWXH 4N1EA 4I18A 3WFBL 4UINH 3ARGD 3LEYH 4OFPA 5CSBA 2FRGP 1WITA 3PNWB 4U6HA 4LAQH 3GKWL 2BVQA 3ZZ1A 1DLHB 1IGML 4PRDB 1Q9WB 4V2BA 3VD4A 1GC1L 4N5EC 4FFZH 4HXAL 1F90L 1B4JH 1JFQL 1WZKA 4MD5A 4HFUL 4XAKD 1FO0H 3FQRA 1S7TB 3UTPD 3QH3B 4J23A 2H3NA 4OLXH 3UPAA 4MQ7A 3PHQA 1X5JA 3ZLQC 2EYRA 1DQJA 1SVZA 5C0ND 2FO4A 3WFEH 1JP5A 7FABL 4TTDD 4AENA 3DWTA 2VXSL 4JFZL 1G7LB 1P7KA 3STBA 4ZS6D 4EDWL 1AI1H 2J88H 1K3IA 2HVJA 1RZ7H 3GSVB 2R1WB 2KQMA 3QCUH 3Q3GB 4I9WE 3U6RB 1BBDL 1GOFA 5FCSH 1FPTH 5EDXA 3N1PC 5IQ9A 1ITCA 1CDUA 2A6IB 4D8PA 4P2RE 3TN0C 5DD1L 3EYVB 3QWRA 1QSED 1I1CA 1B4RA 4N1HB 3ULUD 5IEKA 1VFAB 4QXGL 3UEZA 5FUCE 3HRPA 4ZPTB 3O11A 2X4OA 4HH9B 4F2MB 4P57A 5FGBA 3TBWB 4NIKB 4RAUB 4QRUA 3SDAC 1AQDA 2DTMH 1WBYB 2VR5A 4FZ8L 1R3JA 4BSVB 5GGQH 5F9OL 1ZTXL 1VERA 3TNMA 3ARPA 2R1YB 3I75B 5EUOF 4OJFL 3F5WA 3WDJA 2CIKB 5BCAA 4HWEH 4OFIA 1KJ3H 2AK4B 3CH8A 2ICES 3OBAA 1NMAL 4W6XB 4LKXA 2VXVH 1HHGA 5GS0C 4CL7A 4IOFD 5C08E 5TE6H 4PJ7A 1CWVA 1DN0A 1FVEB 4LSQL 5EO9B 3CMOH 1FZKA 1HDMB 1QFWL 4HJ0C 1K4CA 5ISZD 1U8NB 1SEBA 2FECI 4MXQC 3RTQD 4FTVB 2GEEA 1F4AA 2X1XR 3KYAA 2VQ1A 5HGDB 1NKOA 5IJKA 2C3GA 4X4XA 3E2HB 3GK8H 1A9BB 4MX7A 4PJBB 2OL3B 2IG2L 5EOCJ 1R3IH 3TVMD 1F6LL 4EKXA 3O6FA 2OL3L 1OAXH 3O2DH 1CL7I 2VDQL 43C9A 4MMZC 1KCKA 4K8RD 3ZKND 1DEDA 3SDYH 3EFDH 2MFNA 1HHJA 1SBBA 5HHVH 1FVCA 4D9QE 2J5LB 1Y6NR 4C56E 2IPKA 3CC5A 4GW5B 1YQVH 4OCNC 1YNLH 2DQEL 5M7QA 1P53A 3GMRA 1SJVA 3L3GA 1R5VA 3PV7A 4I0PC 5ICXB 1AGCA 2GITA 2BMKA 4OCRL 3L7FB 5FYKE 3VXPB 3FO9B 4BFIA 4DN3H 4DUXA 2LU7A 4TVPD 5I8KL 1A6TB 1WZ1H 4NUGL 4O00A 5KSAB 1MLBB 3V8CA 5D9SA 1A9EA 3BPOB 4XP9H 5DRWA 5T3XD 2A9NL 3BHBB 2DQJL 2VN7A 4ZUWA 2D7MA 2NX5A 4M7ZC 1JFMA 5FYLL 1X5LA 5AZ2L 3MLWH 4BZ2H 2XYCA 1R3KA 5E7BA 2HRPL 3AMKA 3RJQB 3EGSB 4K9EC 5KOVC 1TVBB 2JJTA 1KGCE 4WW1A 5KAQF 3V5HB 3VI3E 3VE0B 2BC4A 4PJ5A 1TVHA 5CEZL 4Z7QF 5DJAA 3X3FL 2WK2A 3FO0L 5HHOB 2VL4A 1N0XL 1IGJB 2AXGA 3GSOB 5JR1H 3D25B 4N5ED 3TJHA 3GHBH 1U8IA 1CFNA 3KPOA 2AK4E 4F7EA 3SGDH 1C7SA 1OAYH 1ORQB 1KIPA 1LE9B 4RMTA 4PTTA 4KI5F 1WVZA 5FOBB 1KCUL 1IRAY 1M6OB 1T04A 3SJVB 3STLA 2EYSB 1T66C 5ESVB 4OCWH 5DHYB 3DETC 4NKIL 1TLKA 1CLCA 1U42A 3HMWL 4HUUB 1HCVA 3I50H 1LO5B 1KB5H 1EERB 1KN4L 2DQIL 4MNQD 4N0UB 4HC1L 4LNRA 5IB3B 4O2EA 3DX6B 5CJXA 4RGMC 3VDBA 3QNYB 4LASH 1QRND 3RVTC 4FTVE 3MRLA 1SYVB 3MXVH 5IB5A 3JV6B 1D3CA 4DGVH 4MJIA 5FGSA 3IDNA 4V3DB 3T0EB 1JN6B 2VQUA 5EU3B 5ECJE 1EO5A 3TN0D 3U0WL 1IC1A 1CFSB 5ID0B 1KOAA 3SPVA 3ZHDA 3DGCR 3FB7A 1G84A 3E8UL 3H8NA 3FONA 4LSSL 2CKBH 1ZVSB 4PJHF 1MWAH 2VISB 1AD9B 3LKQB 3PWLB 2YHGA 4OIIH 5KSUA 3SDAD 1JZ7A 3MLXH 2FATH 4Q7DA 2L7UA 2Q7NA 2ZKHL 4H8WL 1J9CT 3WHXA 2BSSA 5BZDB 2R39A 2R2BA 3ULVD 4HIJA 5I0ZA 3DPBA 1XF4B 4QRPA 1E4XL 1ZWIA 3CK0H 5GS0D 3HCVA 4NSKA 4P2QB 5CGYD 3DUUA 4Z8FL 1A02N 1RZIA 3L5HA 4GS7B 3QEQA 4QNPE 4YX2L 4KRLB 5EZJA 2UVEA 5FYLE 1EGJL 3DV6A 3H9HB 3ZHKA 4XCCH 1LGVA 4EDXB 4TULH 4HJ0D 1UQSA 2HN7B 3TWCL 1F11B 2ADJB 4IJ3C 5F9WC 3VCLA 5FDWA 5JOPE 3KPSA 3GMPA 1S7WA 5C0BD 5L8LB 5K9JL 2VDNH 2Q8BH 5GRJL 5GGRB 2NY3C 3HI5H 4PPTA 5FO7A 1F42A 2JK5A 2DYPD 1JGLL 2YC1A 2KUTA 1R0AH 4OF3A 4U1LB 1JHTB 5HHOE 4DFIA 1ZSDB 3H9ZA 3WL9B 2CDGA 4UNTA 2DLFL 3F8UB 4WEUD 3WO4C 1YJDH 1JNHA 4WU7B 2YPVL 1FFPB 5GQBA 1T1YA 3ARFB 3MOAL 4NBZB 1A1NB 4M3KB 2Z8RA 3DXAA 4CKVX 2P5WD 1OLZA 4NWTL 5DWUL 3SJVE 1I4FB 1FNLA 1NGYB 4U6XA 3VWKC 4I0PD 1BFVL 1PQZA 5F7DB 3K81A 1NLBL 3I6KA 4IRJC 4Y5VA 2AGJL 4JGMA 4MA3B 2V2WB 4N0UE 4ZUTA 4HDIA 1G7PA 4GG6F 4P4KA 3ZE0E 1BOGB 3LRSA 4LF3A 1PDKA 5DLML 3GIVA 3BZFB 3HFML 1RMFH 3BKMH 4IRSA 4UV7L 4EVNA 2VE6A 3NABL 4KTYA 3T0EE 3VG9B 1JGEB 3VW3L 4FQIH 1MHCB 1FFRA 1J1PH 1P2CA 2IALA 5FGBC 3ZYZA 3HPLB 2R4RL 4FZEH 1D5ZB 5DSCA 3HZKA 5SX4H 1IQWH 2WBJB 2RBLA 4HEPG 5GHWL 2CR3A 3PGCA 4NT6B 2NPLX 2Z4QA 3BWAA 1MRCH 1N26A 2CO7B 4BQ8A 3C60B 5KJRL 5HY9A 3MRQA 4HKZB 5TPWL 1F2QA 5I8OH 1RPQA 4YXLL 4Z7WA 3ABZA 4R4NC 3HE7A 4QHMB 3CFEA 2VDMH 5E2VH 1CT8B 2N7AA 1JZ6A 1KB9K 2WINB 4D0DA 4OZ4A 3MNWA 1HXMA 4N8CH 4ZS7H 3N9GH 2FR4A 4GRLC 4TUKH 5L0QB 2VLLA 4P2QE 4JY5L 3RIFF 2R4SL 4DEPC 1T66D 4YPGA 3DETD 4LBEA 5ERWA 4Z76A 4PV8B 5D7IF 4R4BA 3P77A 1TMCB 2QQKH 4Z95H 4HWBA 4I3RH 4J2XA 4F33B 2X70A 3FO1A 4LP5A 3LSOB 2FO1A 3O6FC 2A73A 1RFDL 3QQ3B 4H20H 3RVTD 3MJ7A 3SOBL 2RR3A 4JQVA 4HEME 4OQTA 3A6BL 1JF6A 1ZXQA 1OT2A 3IETB 4Y89A 4JAMA 4XRCA 3ALWA 4LCYB 4KJPD 4OZGF 5IR1A 1J5OH 5KSBA 1I9RH 4JFYB 3HTLX 2OSLB 4JY6B 2P48B 2YBRB 3C8KB 4MDIA 1MREH 2DQGH 5IV2B 5FXCH 1OTTD 4NO2A 2YKLL 1QA9B 2BY0A 3MV9B 1ONQA 3VH8B 2JCCF 4PRIA 3EZ8A 5ANMA 5JHDB 4GRMA 4M1DL 4HMCA 1M71B 4NDMB 3NIDF 4OQ1A 3BWUC 5IEHA 1KCLA 3MRFA 4KZDL 3G08A 3OJVC 3O8XC 4BH8B 4MD0A 4PJCA 2I9TA 1NCAH 3NACL 4JB9H 4LDEB 4UILL 3GO1H 4LPXA 1T1ZA 1BPVA 3OB8A 3C5SB 3ECBB 3VXMB 2HJFB 3KWWA 3N0PB 4M43H 4AY0A 3HLAB 5K59E 1MJUL 1RJLB 4Q2ZA 2R69L 4FQ1L 1TQBB 1PKQB 3VFMB 2H26B 1GZQB 2Q6WB 3W0WE 5C0CA 4KTDH 1G6RH 3VD5A 2ARJB 4PGEB 4P9MH 2LFGA 5D96B 3VFPB 4HIHA 5FKAB 4ALAL 5FM8A 5I76A 3T2OA 3ILQC 3OB0H 3IXAB 1G7JA 1JL8A 3BH8B 4RWYL 4JVPA 1NGZB 1CK0H 2XV6B 1QSVA 4FFWC 2XA8H 2G60L 2X7LA 3UROR 4JO4L 4U3CA 3BIKA 1OB1A 1TDQA 2F19L 5D93B 5GRZA 1ULVA 3O6ML 4EBQH 4O4YL 3NN8A 5L7XH 2Y06H 5I30H 5HYQB 5HHPB 1CGTA 5DFWH 2VLKA 4JRWA 2AW2A 4PD4K 2VABA 4PGDA 3KDMB 4ODHH 3GHEH 4F7MA 4RWHA 3VWKD 4OCYL 5AYQA 1VPOH 1SMOA 5IK3A 5EU6D 4IRJD 3QQNA 4HIIB 3ZKQD 4JQXA 4HBCH 1TQCC 5J9PB 3FQWB 3VXQB 3DRTB 3U46B 4G8GA 3F12A 4NJAL 3EYQC 3LV3B 1WIPA 1K5NA 1XR9A 2ITDA 1EUTA 3RGVC 3JWOC 3L1OH 3RWGA 4LLMB 2YN5A 4YBLC 3ZHLA 2M8XA 5DEFA 4WUUD 3QZWB 2MKWA 2AJUH 1HH9B 3TT1H 1U58A 2XFXA 3IDIA 1AY1L 1DR9A 4NOBA 3L5JA 1ES0B 1FL3A 1IGIH 3B83A 1MUJA 2DQFA 1YY8B 4IRZL 3VFWA 3MV9E 3DX9A 3RVUD 3T0VA 4WI6A 1NCUA 1UM5H 1PLGH 3IDYB 2AJ3B 4XNQB 3UDWA 1S5IL 5KW9L 4WFGD 3I02B 2BDNH 4DZ8B 3EFFA 4QHNA 4JRXB 4X5XB 5FO9B 3R1GL 2VN4A 4Y5YA 1C08B 1V7ML 1VFMA 3U82B 4R4ND 3SDXF 3MGAA 4HHAA 3TM6A 5E95B 2EDNA 3WFBH 3LMJL 5TFSL 2W92A 5I66A 1TNMA 3GKWH 2RGSA 4GRLD 1ZHKB 4JFXA 5T1DH 3IAPA 3P4OB 3ARZA 3VXME 4O02L 3PGDA 4YDVA 3OKOA 4PS4L 1IGMH 4I2XA 3HHRB 3UPRA 5DA0B 1GC1H 3ME0A 4HXAH 1F90H 1KJVB 1PKQE 2CLZB 1JFQH 4F80A 1U92B 2VIRA 3QUXA 1IC7L 4KRPD 5GRVK 1MHPL 1OGAD 2J7LA 1UH3A 1BGXL 3HI1B 1CS6A 2Z92A 5DVKA 1AD0B 1P69B 1L9MA 5LKNA 4N0FB 2E6QA 5CBEB 1VGEL 4NKOB 3OXSB 7FABH 5IVXA 2VXSH 3SDCA 1NAKL 3DX7B 2V6HA 3QIWB 4EDWH 3QFJD 4WEMB 2A6DA 1NMBL 4LGPB 3K2UL 3FB6B 4URTB 4HCRL 4YHOL 1BBDH 2PNDA 5I8CA 3QHTC 3UYRL 2D9QB 4YGAB 1XCTB 1U8LA 2H6PA 3ZSTA 1FNAA 3C6LA 5DD1H 2VLJD 3C5ZB 1WV7T 1F8TH 5CWSA 4IRSC 3KJ6L 4QXGH 4V1DD 1XCQA 2R1XA 1H3VA 2NX5D 3O8XD 3L3IB 3EO9L 3KLAA 3PE9A 5ICZA 1I9JL 5DJ2B 5DDHB 5E56A 4TRPH 2ATPB 5EU7E 4ZD3L 4PBWD 3TBVB 2V5RA 3OR6B 1URLA 1YPZB 3OGOE 3QCTL 4FZ8H 4NCDA 5C07D 5CHNA 5I6XB 5F9OH 4JDTH 1ZTXH 3KPRD 5JW4Q 4LCCA 4G8EA 4OJFH 4PJ5D 4PY7A 3ARQA 3THML 3GSNA 3MRHB 4M48L 4WFHE 1AGFB 3IU3A 5HYEA 1NMAH 2DQCL 1C12A 1KNOA 1IM9B 3HE7C 3ILQD 3T2PA 4K7FA 4Z7WF 3T3MF 5E03A 5HDQL 3OKEB 5C09B 3MPCA 4LSQH 1D5IH 2XPGA 1J18A 4IMKA 3JUZA 3MRBB 3QXAA 5ESAB 4FMKA 4FFWD 1A7QL 3PWPE 2WM0A 4J4PD 1AGEA 4R8WL 1MI5B 3KPQA 4LPWA 1DQDL 3B9AA 4S0SD 5JPNA 2C4FU 1U0QA 2GW5A 2QSVA 5DJ6A 3QT2A 4JO2L 4LVNB 2IG2H 1BZ9A 4HK0B 2EECA 4Z18A 2P8PA 3DI3B 3CCHB 2CDFA 2OL3H 5JW4N 4LRNH 2VDQH 1HQRA 2HTLC 4MJID 2P7TA 3CSBA 1MHEA 2J8UB 1QEWB 1OLLA 3ARRA 3LN9A 1G1YA 1S9WA 3KGRA 4OT1L 3EYQD 1XF1A 3CVHA 3MA9H 3QULB 2DQEH 3RGVD 1DQML 3RL2B 4GKSB 3HZVB 1KTDA 1Z0MA 5B8CA 4OCRH 4NC2B 3HZYB 5I8EB 4EIZC 2FL5B 3IGAB 2E27L 5I8KH 2PETA 1T6VN 3AAZB 4JO3L 3HR6A 2ZCKH 5A2LH 2DIBA 1IJ9A 1NFIA 4OSUL 1ZGLP 4MSWB 3R06A 5F72S 1PSKL 1UA6L 2A9NH 2DQJH 3VMOA 1BVLB 4X8JA 3CNKA 4RFNC 4LQFL 4JKMA 2O61B 4AMKL 4L4VB 5FYLH 2GT9B 3F7VA 1KXTB 5AZ2H 5AZEL 5IHZB 2BSTA 2ORBL 1BF8A 2I9LA 2HRPH 1OWRM 3P0YL 3QUMA 4YHKL 6FABL 1FN4B 2J1KA 1VKXB 2B7DT 3A67L 5JPMB 5I9QB 4HUVA 4Z7NF 1BZ7B 1INQB 3DSNA 1RU9L 4ONGL 4JE4B 1LE5A 2K1MA 4Y16B 3QXVA 3RZWA 3WIFB 1U8MB 2ZJSL 5CEZH 1YPZE 5EUKB 3X3FH 1BJ8A 1VHPA 4GQ9H 2J2ZA 3FO0H 3MBEB 3PF2A 2FJHB 3B3IB 3BPLB 4EIGB 2MCPL 4JGJA 3LN5B 2EDHA 5FA3A 3T2NL 4GRWF 5IM7B 2CO6B 1M7IA 2JIXA 5E6IA 3TYFB 3NCJL 2EH7L 1JZ2A 1BBJA 4A2LA 2W9LA 5JDSA 4NKIH 1IL1A 2YXMA 1CLYL 5C09E 1NDGA 2AP2A 3HMWH 5DHVH 1A6UL 2PUQT 1FHGA 4QEGA 5TQ2L 2C26A 4X6BB 3T1FB 4AG4L 1KN4H 2DQIH 4WO4B 4MNGA 1U9KA 1U95B 4HC1H 1B0RB 3WFHA 3UPCA 2APWA 4BK4A 5BRZB 1CDCA 5KN5B 2AEQL 1HHIA 2OJEB 3UTSD 5IGXL 3KPLA 3QDJA 3Q6FA 4L29A 4JQXC 1VENA 5FM5O 2P1YA 3D9AL 1EBAA 2GJJA 3U0WH 1SMAA 4JKKA 4LLDB 3WHE0 5GGTA 2BNUA 5FUCC 1HEZA 1HH6B 2FECL 1W2KT 2WLZA 3ARXA 4IRSD 1GJIA 3T3PF 1KCSL 4Z0BL 2IBBA 1XGPA 3JTSA 4K7PH 2FH6A 3E8UH 4LSSH 1VFBB 1CQYA 1JBJA 4FQQB 1TZGL 3FQXB 5F8RC 3G9AB 3QIUB 4LHQB 5CEYB 4G43A 4HULB 1CFVL 1D6VL 2CUHA 1CL7L 3JV4B 4M6OL 3L95A 5BOPA 2ZKHH 4H8WH 1UJ3B 4RMVA 5DJYB 5L2JA 2Y7QA 5KVGL 4OKDA 3H9SA 3OJDB 4U3XA 2FGZA 1QKZL 1FZJA 1P84J 3OR7A 4DW2L 4ELMA 1BWMA 2EH8L 5FOJA 3TO4C 5A2JH 3TF7C 2YSSA 1E4XH 5ESQA 3FCTA 4LOUC 4WWKA 4Y5YC 1OF2B 4OZIB 1MIML 1NSNL 3HE7D 4Z8FH 4K3HA 4YX2H 4C83A 4YDLC 1MCLA 5IW3A 4M7LT 1JWMA 1NUFA 1AHWC 4JM4L 4FS0A 3TWCH 4HS6A 5GGSA 1N59A 2WV3A 5DEZA 1NBVL 4Z6AT 2GSIB 3DECA 5K9JH 5E00B 5GRJH 5IMOA 2DLIA 5MHSE 2LVEA 1DN2A 4FXLA 1GC1C 3QUXC 5B21A 5J1AB 1UGNA 1I8LC 1JGLH 3MV8D 1RIHL 3S97C 1C5DB 4FRWA 3E3QA 1EK3A 4NRZA 3BGMB 1RJCA 5SWSD 2HTLD 1YNTA 2C1OA 2YPVH 1MIEL 3MOAH 4NRYB 1RV6X 2EDLA 2X4UA 1FNGA 1Q9KB 1QFUL 2OM5A 4NWTH 5IVXF 5CFHA 5DWUH 2X5PA 4WI5A 4ORGB 1BFVH 4L3CA 2APTA 4LVHB 4LQ1A 1A6AA 1NLBH 4OGYL 2AGJH 3UTZA 4YHPB 1D5XA 1T20A 3AU1B 4YWGL 1RZ8A 4XMPL 5EPMB 1NCTA 4HWZA 1X9QA 3QDMB 5F7LB 2FEDC 5DLMH 4JFFA 4LVOC 2VSCA 4JZJA 3HFMH 5GJTL 5JOEA 3DMMA 4M61B 4UV7H 3NABH 3VW3H 2J3SA 2PYED 2CMRL 1TJHL 1UM4L 2VUOA 5FM5M 2ICEB 4N8VA 2R4RH 1YN6B 5FF6B 3DVNB 4K3JL 5GHWH 3VXOA 2AERT 5HVHB 4NO5B 5I74C 4U1HB 3TA3C 2IBZX 3U83A 5KS9F 3GUTB 2BSRA 3T4AA 1KC5H 5KJRH 4CW1B 5D7JA 4R97B 5TPWH 1U41A 4X6DA 4YXLH 5GSVB 2VDPL 5J12C 3KYNA 3F6IA 1HKFA 4G9FB 4IMKC 4MCYB 4CVXA 3PWVA 4MZ2A 4RDQG 3BRGC 4WJ5A 4K2UL 2K3TA 4JY5H 1A4KA 4OZIE 2R4SH 5E8NA 4X9FA 2D9CA 4CU6A 3T65B 4UDTB 5JDJA 5IVZA 1KXVC 3TH2T 2VLKD 1QSFA 4QLRA 3KXFB 2YA2A 5EZLB 5F1OB 3U1SL 4I9WD 3MGTB 3SOBH 1NPUA 1MRFL 1ZHLA 3A6BH 4P2RD 4DKAA 1HHKB 2BJML 3C6SB 4HS8L 1EXUB 3RY6C 2F8XC 4HG4J 2YWYA 5BZWB 5DTFB 2GTWB 3VFRA 2LTQB 5BV7C 4X6CB 2YKLH 2R23B 1NGWA 3O2VL 1HI6B 4JFHE 3ARYA 3R8BB 2ADGB 4OD1L 4BFBD 4M1DH 2DM7A 3F7QA 2B1HL 2R15A 3KLHC 4JVWA 4YDIL 3M8OH 2EDWA 3BYYA 3RY4A 3BQUB 3V0WL 1U8PA 5I2IB 4KZDH 3QUZB 1XIWB 3GBLA 4DZBB 2HFTA 3HG1A 1N6UA 4L8CB 2BNQE 5HGAA 3V79C 4NKDB 3TO4D 1OSZA 3CGTA 5C08D 3NACH 1J8HB 3QDME 1OPGL 1A6VL 4UILH 4R7NA 4LOUD 1LEGB 1RD6A 4N8VG 5MERA 4KUCD 4NM4L 4YDJA 1MJUH 1MNUL 2EE3A 3WXVL 2R69H 3U9UB 4ZNEE 1S7UB 2NW3A 4KFZC 4NBXB 2W9EL 2DQHL 1EUUA 1NFDB 4YHYC 3G04B 4ALAH 1EMTL 2BP3A 5J56B 1FRGH 3U4AA 4UIMB 3OG6B 1BEYL 3VFNB 2PR4L 3QUXD 4RWYH 4RFEB 1LNUA 2Y07L 1BJMA 1EX0A 4MS8C 1G0DA 4XP5H 3SE9L 7CGTA 1C7TA 2G60H 2BZDA 2O26U 3O9WB 4JO4H 2W0FA 4XXDA 2F19H 3MBXL 1H3GA 4D9QD 3O6MH 2EIZA 3STZA 4O4YH 4C56D 2H8PB 5EORL 2NQCA 5KZCD 4IIQB 5ABDE 4EQ2A 1NC2D 1YMME 3QDGA 3WFZA 5IB4B 3LHPL 3TIDA 3MRIA 5SWZA 5CCKL 3C08L 4N9GB 3V6ZA 1KSRA 5FYKD 5TDOB 4S1SL 3ULVF 4OCYH 2W0PA 4ZUUB 2X4PB 1ZHNB 5E9DA 5EOTB 1R5IA 3M17A 3VRJB 4GAJL 2B8OT 1CCZA 3KXFE 5MENB 3QNXA 5IMLA 1N7ML 1F3DH 3TZVB 4NJAH 5D1XB 4LCUA 2IFFH 2FEDD 1DEEB 3P73B 3T0EC 5A3ID 4U6VL 1XH3A 3W11C 2YZ8A 5DVLA 2Q3AA 3A6OA 1AY1H 1QUNA 3NFNA 4Q97A 1KGCD 4X5LA 4X6CE 2MOVA 4LHUA 3PQYA 4IRZH 3GBML 3D3VB 4H5SB 4PG2C 1HKLL 1IKNA 1U93B 1T03L 3TA3D 3FN3A 3D1MC 1S5IH 4KJWC 2XTLA 3O2DA 2QKIA 1IZJA 3V2AR 4PJFA 4C4KO 3R1GH 2XI9A 1V7MH 2F74A 1KJ2B 3BGAA 2AK4D 3WEXB 3S8WA 2CDEA 5D72L 5LG1A 1KJ2L 4R3SB 5BS0A 4Z78A 1FJ1B 5DYOA 3GMNB 1VGKA 3LMJH 5TFSH 2XICA 2X4TA 3REWB 4Q9RL 3S3JA 1J8HE 5F7MC 3HE6B 2QSTA 1BIIB 3TBSB 4P4RB 4PS4H 2ESVA 4DOHB 1I9IL 3VRIA 3QJFB 3OQ3B 4MYWB 3SY0A 3EOTL 3SKOA 4LARH 1FFOA 4GKNA 1OSPL 4XNZB 4PB9L 4F9LA 4XBGB 1IC7H 1NFDE 2B4CL 1A5FL 3CLFL 1MHPH 4HJGB 2GIYA 4ZUVB 2YN3A 1BGXH 2GQHA 3CFIC 1HE7A 4KJYB 3VFOB 1PZUB 3P0VL 3T77A 4MQXD 2UY7A 1OP5K 3S5LA 32C2B 3L3KA 1H5BA 1CXFA 2F5BL 4HK3N 3RBGA 5TE4L 2VDLL 1QO3A 1MFEL 1YMHB 1JJUA 3DGGB 1ORSA 1NAKH 4WW2F 5IHBA 1VA9A 2GK0A 5DQ9B 5AWNL 1NMBH 2YEZA 3K2UH 4HCRH 2G75A 4YHOH 2OX5A 3KR3L 4H26A 5TDNB 1QPXA 4QRSA 1A4JA 4CMHC 1G9EA 3OAUL 4JDZB 5JIIA 3QISA 5BVPL 1RZJC 4JDVA 3WE6A 1HCFX 5DJDB 3KLHD 5DMYA 3V7AE 4NQDA 3DSFH 2GJ6A 5GZNC 4PJAF 4W70A 1BD2E 4JZJC 1NGPL 1W0YT 4KKNA 4U7MA 3KJ6H 1JGDA 4V2CB 1A3RL 5HYJE 1GZPA 4GW1B 1N5AB 4C57C 1W0WB 3EO9H 1I9JH 1J87A 3NGBC 2VLRA 5B38A 4WU5A 3VXRB 5FYLD 2YA0A 4ZD3H 1M1SA 3LPFA 3HA0A 3QCTH 1KB5A 5IMKB 2VXQL 1J05B 4UDUB 3K8KA 3ARDC 1T7YA 5J57B 5IFJA 4LHUG 1VACA 5EU5B 4CADB 5JOPD 4X7SL 3THMH 2P4AB 4M48H 3TCXA 5D7JC 2NY0B 4YIQB 3BPCA 4TSBL 5DK0A 2FSEA 2DQCH 4DTGL 3CZFB 1MLCB 3PHOA 3LKOA 2X4SA 2IAMA 4Y4HC 3IB4A 3DX8A 3C60C 1GGIL 5ADOH 4AJ0A 5IROA 5HDQH 4LLUB 1KPVB 4MS8D 5IBTL 1RJZA 1A7QH 3IU4L 5D5ME 2FLBT 3RVVD 1GL4B 5F6IC 3VXUA 1MWAA 1BQLL 4K71C 4M9PA 3LRHA 1F6FB 2GY7B 1HOCA 1DQDH 3SJVD 1U8KA 3FT3A 5C0IB 3UJIL 4JO2H 4OBSA 4Q6IB 3ZDZF 4I5BA 1N8ZB 4P5MB 4FNLL 1P9MC 4XB7A 4DOHE 3VGGA 4XHJC 4NHUB 5DK2B 4XXCC 1UEYA 2ATKB 5H94B 4JPIB 2MHAA 2F5AL 1W8NA 4J3UA 1H0DB 2CD0A 3S5LG 4OT1H 3TO2A 2WUBL 5TF0A 1TPXB 2BVOA 1T0NB 3T0ED 4U1MB 4Z7VA 1DQMH 4LGSB 5E5MB 3W11D 3OKKA 1KG0A 4Q6YA 4MB3A 4YHML 2UWEF 5TJWK 1T5XA 4JFEE 2E27H 4RZCA 2WY3A 4Y8AA 4JO3H 3VXSA 4Z7UA 4OSUH 2ZOLB 4M5ZL 1MF2L 4QXUL 3PXHA 1LK3L 3VFSA 1PSKH 1UA6H 4XP4L 4HK3J 4LQFH 3IF1B 5AZEH 2ORBH 1E6JL 4X7TB 3O3EB 2Y25A 3LDBB 3P0YH 3BP5A 4YHKH 1KJMA 3A67H 1HZHL 5B38G 4NQSB 3ARWA 4P5TC 4J8RB 4ZUSA 4YAQB 4RGNB 4P2QD 1RU9H 2XA3A 3QPQD 4ONGH 4Z77B 2AI0L 3C9NA 3V6FA 2ZJSH 2HFFB 2LU3A 4QY8B 2UYLB 4HWNA 4JQIL 1MOEA 2C3XA 5B39A 4TOYL 5FK9A 3UBXA 2D7NA 3OGCB 4YC2B 2MCPH 2VAAA 3HMXA 3UYPA 5D1ZA 4HPOL 4YEEA 5LWYL 3D85A 4BQ6A 2EXWC 3T2NH 1KENH 4ZSOA 2N56A 4ONHA 1EJ6A 4Y88A 5JTWA 5FO8B 2BSED 1OCWL 3B8YA 4PJXB 3VGEA 1EJOL 2M26A 3NCJH 2PW1A 2RB8A 2BNRB 1CXKA 2EH7H 1B0GA 1WBXB 4LLWB 2FNBA 4F7PA 2EDOA 1CLYH 2F54B 2E9BA 5C9JA 1A6UH 1XFPA 4DCQB 5L2KA 4NNXB 2HFGL 3K74B 5TQ2H 3TYGH 1HQ4A 3OX8B 4AG4H 3PG2A 4O51A 3ARFD 3FT2B 3L3JA 1HSBB 2AEQH 3VGFA 4XWGL 3IVKB 3QUYB 4M8QA 5IGXH 3IDUA 4PRPB 1D6EA 3OF6D 1AGDA 2NYYD 1UB5A 4PR5B 5I1CL 1NBYB 2AV1B 5GZOC 3ALPA 2AK1L 3NZ8B 3AY4C 4PJDF 5DGQA 4A6YL 5E2UH 5ALCL 4ETQA 4APQC 4F58L 4OF7A 4R9HA 4BQCA 2XWTB 3DRQB 5H35B 4FQHB 2HLAB 2I5YL 3EOAA 3W2DL 4Q0XL 1KCSH 4Z0BH 5I71B 5I0DA 3SQOL 5HGHA 4KK5C 1PEWA 5EU7C 5H2BA 4H25B 1X3DA 1EAPB 2NLJB 4JRYA 3GB7A 5IBLC 4DK3A 3OXRB 1LO4L 1MJ8L 1CFVH 1D6VH 4R2GB 1CL7H 4M6OH 3ARDD 3W0WD 4MNHB 4F3FB 5FKPA 5C0GB 1IKNC 1KCRL 4S11A 4JFPA 1QKZH 4DW2H 2NXYB 4LU5L 5I1EL 2EH8H 3JWDC 5HDBF 4JFDA 4NO0A 1ZT4A 3D2UA 1LEKA 3IDYC 3G5ZB 4PJFF 2ZUQB 1DE4A 1MIMH 1NSNH 4Y4HD 1GAFL 2CIIA 2P8LA 3C60D 2ERJB 3RPIB 3LKRB 1IAOA 4M03A 5MEPA 3A6CL 3VMNA 4JM4H 5DXWA 1FAKT 3V4UL 4WHYH 1XAUA 3VI4F 4GAYB 2O5YL 2DOCA 3B5HA 4ZG1A 4NQEB 1N6VA 5IOPA 1NBVH 5HJ3A 2VZ3A 2XNAB 3MLUL 2BVEA 2DMKA 2PXYB 2DF3A 5B39G 3UBXG 4GKZA 3JVGA 6CGTA 4U4BA 3OAZH 5EFIB 4YHZL 1CDGA 1RIHH 4QO1A 1R3HB 5ICYB 2OTUB 1NUGA 4ZO6A 3RIFK 5ELIA 4XCEB 5EOCL 3BIBX 4E9LA 2FJFB 1U3HC 4B50A 4ODSL 2AXFA 1MIEH 3BO8A 3FQUB 1P1ZA 2CRZA 3S35L 2OI9B 1QFUH 4ONFL 1ZANL 3WNKA 2QQQA 3QIBB 1A14L 4OF6A 1I1AC 2CLVA 5I16A 1QR4A 3EO0B 1I8IB 4P46B 2XN9A 3C87A 1XGQA 3WIHL 5J13B 1JV5B 4OGYH 1G6RA 4ZAKA 3QI9C 3MV9D 4YWGH 4XMPH 1BLNB 1JWUA 3PL6C 5D2NE 1IGCH 4Y4KA 5TGBA 3WIIL 5E1HB 1DQQB 1ERNA 4PRHE 1QBLL 4PRPE 5BQ7B 1QR1B 3TH3T 5GJTH 4U6TA 4N9OB 4WENB 4NWUL 2CMRH 3PJSB 1M05B 1TJHH 1KLGB 4M6ML 1UM4H 1C5BL 4WI8A 1T4KB 2AEWA 1E28A 1NCCL 4K3JH 4L3EA 4HKXA 5I1KL 3FFDB 4P5TD 3FN0L 3VXMD 5GGSY 4KKAC 4XHQA 1SJHB 1A3QA 3HR5B 2PO6A 1Q94A 1AO7E 5IG7B 4M7LL 4FQXA 1PG7L 2VDPH 3W39A 3WN5B 3WNLA 2NTFB 5F88B 5IROC 5T1KD 2QEJA 4P2OC 3VXTB 5CJQL 3BVNA 3O3BA 4Q9CA 5HPMB 2EXWD 3EDFA 1H3TA 1V3MA 1F6AB 4K2UH 5C70A 3BX7C 5DRXB 4H88L 3T0DA 4FQLL 1E4JA 3ULUL 1K8DB 3QDGD 4TUJB 3RUGA 1YDPB 3BGFB 1VB9A 2WLYA 5CZVL 3MCG1 5GJSL 5IUSA 5SWZD 3U1SH 2YPKB 2GJZB 3I3BA 4I4WA 4NFCA 5LXGL 1OP3K 4YPJA 1Q9LB 1MRFH 3MJ8A 3GDBA 3QR2A 4ODVH 4WV1A 4RIRA 3BRDA 1OM3L 2BJMH 5GZOD 4KK6D 4HFWA 4NO3B 4APQD 2X05A 2GTZA 1KBGL 1UXWB 3SBWC 2AJSL 1DBAL 1PW3A 4YE4L 1RUQL 1A7NL 1UKTA 3KPMB 4KAQL 1X5HA 4Z7VF 3PNWA 1FE8L 3O2VH 4M62L 4P23A 4KK5D 1ZAGA 4JVUA 4L8DA 5IBLD 2HH0L 3EOYG 5E8PA 5J89A 1B88A 4MJ2A 1I1FA 2B1HH 3AREB 4YDIH 4LL9A 1CFQB 2E7LA 2L7JA 4Z7UF 5D2LF 1OD7A 2HAZA 3V0WH 4WFHD 5HYIA 2DI9A 5CJ5A 1BVKB 1G9NC 3V5KB 1WISA 4JHWL 3QH3A 4XPAL 1OPGH 3PP3H 1A6VH 5JA8B 1KACB 2F9BT 3F65A 4TN9A 3D0LA 4ISVB 3OHXB 3IXTB 4NM4H 5ITFB 3PWPD 2SEBA 5EC2A 3W9EB 3WXVH 3HS0A 5L6YL 2YR3A 3DNKA 1G7LA 1YC8A 3VFGL 3L7EA 5F9JB 1XR8B 2YRPA 2W9EH 4LVEA 1B6DA 3GSVA 1IEBB 4G6ML 2R1WA 1INEL 1RZGB 2NY5L 3H0TB 4Y16C 1EMTH 1FFNA 5D1ZC 1BEYH 2A6IA 3AB0C 2PR4H 3MBEC 4NQCB 3EYVA 2W65B 1FH5L 3PDOA 2XRAL 3EYFB 2DM2A 1QFWM 3V8OA 1DLFH 3FB5B 3BH9B 5E1AA 3MBXH 1VFAA 1U3HD 2VWEE 5CP7A 1RK1A 1XGRB 2JLLA 2YD7A 5I75B 4V3EB 4RSVA 4RAUA 4M00A 3MRKB 4M4PA 5AAMA 1W0VB 2D0GA 5IW6B 2GUOB 2HKHL 3DHMA 3NPSC 1IBGL 4OKVA 4Y19E 4ZDHB 5CCKH 1I1AD 3C08H 4WDIB 4RAVB 3ULUE 3UX9B 4PJIA 1UACL 4S1SH 25C8L 3MA7B 1RULL 3QIWD 4GAJH 5J6GB 1S7QB 3QQ4A 3QI9D 3M45A 1RI8A 4KKLD 3GMOA 5C3LD 9CGTA 2X1QA 1NMCC 4I3GA 3PL6D 1KCVL 3TBYB 4ENED 4QXTA 4QRRB 3LQAL 3LS4L 4P5KA 4U6VH 1FVEA 3OKDB 5EO9A 2VYRE 4MQSB 1HDMA 3FMGL 3U36A 3VDCA 5B4MC 2DIJA 2NY1C 4FXGB 2R2HB 3A0OA 3SKMA 1Y6MR 4ZFOB 3GBMH 4HT1L 3QIUC 5C0AA 1WC7B 1HKLH 1N2RA 3E6HB 4D9RE 1T03H 4KKAD 5HYSB 4XP6L 1DBJH 2AJZB 3MROB 4MAYB 4UU9B 4RMWA 3Q6GL 1QRNB 4M7KL 5FV2A 2BCKB 5D72H 1KJ2H 1UB6B 3MLTB 4P2OD 5EU4B 5D5MA 1IM9D 1JPFA 4GW5A 4Q9RH 3H7LA 4PJ8A 3TN0B 1L6ZA 4N5UA 3RWCB 5C09D 5ICXA 1W8OA 3VXUD 3SGJA 4E5XB 4F9PA 1AXSA 2OJZL 4FXKA 5ALBH 1T7WA 1I9IH 2XZAL 2C7UB 2FEEI 3EOTH 3BN9C 1IGYA 3VXPA 1EBPA 1OSPH 4PB9H 5DJZB 4DGIL 1QYGL 1A6TA 5KSAA 1A6WL 5CIPB 2B4CH 1MLBA 1A5FH 3CLFH 2ZUVA 3SDAB 3C09C 4CBPA 3P0VH 3FQTA 2GSGA 4ZO9A 3VGBA 5E94B 4L8BA 4NQCE 2F5BH 3V95A 5EBMB 1MFEH 3I2CL 3NZHL 1JYVA 1H3UA 3MSPA 2DKUA 4OFKA 4ZFFA 5AWNH 3Q0HA 1TVBA 5CEXB 4WHDA 4LCWA 4PRBA 4TVSa 1MQKL 5GS0L 4XTRD 3KR3H 4NQVA 3HAEA 4ZAKC 3OAUH 5C2BL 5I73C 3V6OE 2VNCA 3TJEL 3V4VL 3QCVH 5HHXL 1K2DA 1FYTA 1IGJA 4J3TA 3V7AG 1LDSA 3D25A 3RDTA 3ES6B 1VEOA 2FJGB 1NGPH 3JTCA 1T22B 2X89A 2H2PC 5ADPH 5C6TH 3JTTB 3D87B 4CN1A 1KIQB 4N0YL 1DBKH 1F45A 5HYFA 5FOBA 3LN4B 2Q3ZA 4QRRE 2BK8A 2DYPB 5ILTL 1R3LB 4DGYL 1U91B 4FQ2L 2OMBA 1TZIB 2EYSA 5ESVA 1PY9A 4S10A 5D7LA 2VXQH 4QHKJ 4BK5A 4NZDA 4XCYB 3CSYB 1P7QD 1M4KA 3DIFA 5F9DC 3U4EB 4LSVL 3X13B 5HDLA 5DRNA 1X5KA 3QWOB 5HVHC 4TSBH 1SYVA 4DTGH 5MHSD 4Y16D 4I0PB 1NH6A 3PWJB 4KC3B 4PJEE 1YUHB 2XG5A 4QF1A 4LLVA 1GGIH 3N1MC 5D1ZD 5EU3A 2JE8A 3MBED 1CFSA 5IBTH 3IU4H 2P5EE 1QBAA 4N8PA 5ID0A 2X09A 3TIEB 1BX2A 4YFDB 3T0XA 3UMTA 3MV7A 1BQLH 1EO8L 4F7TA 1IQDA 2VISA 3MC0A 4ZPVA 3GI9H 1NJ9B 3GKZA 4M7ZB 3TCLA 3UJIH 2YD3A 5IF0B 4FNLH 5EIVA 5AYUL 4WV1C 2JB5L 4K9EL 1XF4A 4XH2A 2F5AH 3GEWB 3GI8H 1ZHBB 3ZT5A 1RHHB 3BXNB 2WUBH 3HC3H 4HMEA 4KUCF 1R24B 2Y5TA 1AGBA 2C1PB 4U1IB 3H9HA 2LTQC 3E6FB 2Y5EA 4EDXA 3R0NA 2ZUTA 2HN7A 4YHMH 1N3NB 1F11A 1MQ8A 2IANB 2NY1D 5JQHC 2YD5A 3HAEG 2APXA 2EDTA 5JORB 2YUZA 4M5ZH 1MF2H 3QIUD 4QXUH 3HUJA 4HUXB 1LK3H 1HNFA 4XP4H 4XMLL 3RWIB 1I1YB 1KFAL 4U05A 1EVUA 1ZSDA 1E6JH 4XGZB 2OBGA 1SJEA 3X14A 4RGMB 4WU7A 1HZHH 1UJTA 1FNFA 1OP9A 1J7VR 5BXFB 5I1DB 3MREA 4OV5A 1I4FA 1JWSB 4JFQA 1NGYA 2R0ZL 4IDLA 4MCZB 4JQIH 3MUZ1 3UTQB 4TOYH 3KYOB 3F7PC 2Q7YB 4RMRA 1DFBL 1QP1A 3FOMB 4RMUA 4HPOH 4IEFB 2HVKA 4EI5A 2QQLL 4HX1B 3MLZL 1OCWH 1EJOH 2HT2C 2ZZUT 5BO1H 1CDYA 2BX5A 1S78C 3VA2C 3BOVA 1JGEA 4S0TD 1SM3L 4UIKL 2G2RB 1U36A 1MSPA 4LSUL 3LEXB 2BOCB 2HFGH 2VR9A 4U2YA 3VI3F 3ZKXB 2P24A 5F1NB 4PGJA 2WBJA 4IIQC 1JPSH 4HV8B 4LKCB 4XWGH 4XCFH 4NT6A 4LFHG 4JFHD 1S9XA 5I1IL 2XOTA 4CU7A 1CFBA 3G6JA 1D7FA 4H0HB 4JM2A 5I1CH 5D2NA 3NAAL 5DEGA 2AK1H 1Q0XL 2BVQB 1JI1A 5ALCH 3C8DA 4F58H 1BOYA 1OQOA 1HK6A 1O5DT 1D5BA 4H1LB 3U2SB 1FYHB 4QHMA 2AJXL 2BNQD 2I5YH 3IFLL 4OAWB 3W2DH 4Q0XH 1EHNA 2H2PD 2Q8AL 3QDMD 2NY3B 4MD5B 1SY6A 5L88H 4FFYL 3ALXA 5DGRA 1BMGA 1K8IA 4HW6A 2H3NB 1LO4H 1MJ8H 3FKUS 1KLUA 4XCNA 4KMQA 1H3PL 4MQ7B 1JMXA 5CINH 3PHQB 3WO4B 1MFCL 3DYOA 1TMCA 3IDMA 1V7NL 2FO4B 3SKJL 2IANE 4OZHE 4IHOA 3LSOA 4FQJH 4LU5H 5I1EH 1LMKA 4PJBF 4PJGA 3NH7L 1HXYA 1ZE3C 5EIIA 2HVJB 3IETA 1MEXL 1J12A 1GAFH 5IKCB 2COQA 4G80B 5JQ6L 5EU6B 3ROLB 3A6CH 4CMMA 4JFYA 3SGEI 4UAOC 4JY6A 4DVRH 2YBRA 2A6KB 4KDTA 3V4UH 4PJ8C 3CUPA 2O5YH 2QSCL 1F02I 1R5WB 5DR5L 1QA9A 1YMMD 2HT3C 1QD0A 5IEKB 3MLUH 3DYMA 4YNYA 3NCMA 3O11B 5JHDA 4P57B 1LEIA 1M71A 4KKCC 1GIGL 4YHZH 3EOBB 1AQDB 4QYOB 3TC9A 2B4CC 3KXFD 4PJHE 3QHFL 3MOQA 5CD5C 5FYJU 3TNMB 4JPWL 4QNPF 3HB3C 4ODSH 4NBYB 3D18A 1I85C 3FRUA 2PTTB 3EDEA 3WCYA 3CAFA 1EFXD 3S35H 5DJCA 4ONFH 1ZANH 4LKXB 4AEIL 2HJFA 3LS5L 1A14H 2N4IA 1WCBA 3QJHA 4DWHA 5JW4R 3PV6B 4PJ7B 2MJWA 1UWGL 1MCWM 4WEBL 3WIHH 2H26A 1GZQA 3P11H 3GMMA 4HBQA 2JF1A 5TDPB 2Q6WA 2HTKC 4O2FA 3BD3A 2JJVA 3KHOA 3GGWB 1K4CB 4PGEA 4Y4FA 1NGQL 2V7NB 2QBWA 5FKAA 3MUGB 3WIIH 4DEPB 1CICA 2FH8A 3MODL 1QBLH 4L1HA 5I18L 2VC2L 3BP4A 5TH2B 4NNPH 3BH8A 3CX2A 2VQ1B 5KVDL 1AJ7H 3GNML 4XVUC 4NWUH 1WT5C 4PYGA 3RPKA 3QUZD 4M6MH 3BT2L 1C5BH 1OGAB 2MQCA 3DVFA 3O6FB 3L5IA 5MP6L 43C9B 5GS2H 4HZLA 1J8HD 4NP4L 4ORZC 1OY3B 1UCBL 3TPUA 5I1KH 1SBSL 1CXLA 2YD2A 1HHJB 1FVCB 2EXYD 3FN0H 4J3VA 1H3XA 5INCA 4C59B 2IPKB 3KDMA 3CC5B 2V17L 1LDPL 4PIRF 1G0YR 4M7LH 3ZE0F 5I1AB 3MRJB 3L3GB 1R5VB 4QTIL 1AGCB 3NIFE 2GITB 1PG7H 1SEQL 2BMKB 3EW3B 5DJ8B 3FQWA 3L5XL 3CDFA 3MJ6A 4GBXA 3DRTA 4OFYD 4UMGA 3VXQA 4BFIB 5AAWA 3ARBC 3D39A 4W4OA 5CJQH 5DO2C 3WJLC 3OV6A 2AV7B 1FGNL 3LV3A 1KN2L 4P2YA 2VLJB 2HT2D 3O4LA 2UV3A 3QG7H 4L1DA 3QZWA 4H88H 4FQLH 3ULUH 4GUPA 4ZUWB 4CVWA 4OD3H 1DUYB 2NX5B 4WI7A 4M93C 2IJ0C 5I1JL 5CZVH 5GJSH 1R3KB 3MR9A 3AM8A 5KBNC 2BXZA 3RX5A 5FAAA 1RZFL 5CP3A 5LXGH 3WO3B 4XZUB 3QAZC 2NTSP 4CVZA 4UBDD 4WW1B 4XNQA 3KPRB 5J06A 2BC4B 1OM3H 2P45B 4JRXA 1L4IA 4PJ5B 5JIHA 4I1NB 1JNNL 1BD2D 1P6FA 1TVHB 4Y2DC 5K9KA 1KBGH 4JFOA 5DJAB 2AJSH 2DD8L 3SCMC 5HYJD 1G7IA 4MWFA 3DYPA 3VJ6A 1DBAH 3OAYK 4YE4H 1RUQH 1A7NH 1WTGT 5TE7L 3TZVD 3SE8L 4KAQH 1F58L 3CD4A 5JIPA 1FE8H 2ED9A 1U8IB 4M62H 1CFNB 5HSFA 4F7EB 1KIPB 5D1QA 3VXNA 3Q5YA 4C55A 4PTTB 2HH0H 3SE3C 1X5XA 2E7CA 1T04B 2F53A 2I25N 4B7LA 3LPGA 1QRKA 4PJ7E 2CLZA 4NNYB 1A7BA 2UY6A 1U92A 3GSWA 1QVOA 4JHWH 2HJKA 2NZ9C 4LNRB 4O2EB 4XPAH 3MRLB 5T1LA 1X4XA 4GH7B 5IB5B 1F3JB 4N0FA 5CBEA 3RL1A 4MJIB 3OXSA 3IDNB 1MAML 1TQCB 1KB9J 1MFBL 2CK0L 3VFGH 5I19L 3K4DA 4HCRA 4PP2B 5K93A 1T0MB 3FB6A 4G6MH 4PLJD 2HT3D 1ADQA 3RRQA 1INEH 3CDYA 4HPYL 3RGVB 2NY5H 4YBLB 4S1DC 3FONB 3JWOL 3O6LL 4Y5XC 5EO1B 1XCTA 1HILB 5F1SA 1Z9MA 1FH5H 4KKCD 3C5ZA 4EI5C 2XRAH 5KSUB 1S7SA 5CGTA 4TVPH 5CD5D 2BSSB 3K8LA 3HB3D 2R2BB 3L3IA 1MFAH 5K59F 4HIJB 2IPUK 2XY1A 3QZWG 1MH5B 4QRPB 2ATPA 4NQXA 5E99L 1ZWIB 3CFKA 3OR6A 2HKHH 1IBGH 4NSKB 3DUUB 5E6ZA 4OF5A 1UACH 2NXZC 3W5MA 1RZIB 1WF5A 4BUGA 25C8H 4JFED 1RULH 1KIRA 3DROB 2NX5E 2VMFA 4JM2C 5D2NC 3B5TA 5E2WL 2HTKD 1BJ1J 4TTGA 2CUMA 1UQSB 1KCVH 2A0LC 2YRZA 3DUSB 3KPSB 4PG9A 3GMPB 4TYUA 5LAXB 5D6DC 3LQAH 1XF5A 2EIBA 3LS4H 3OKEA 1IE5A 5FO7B 5C3TA 2I27N 4XVUD 3S88L 3OJMB 4QRTA 2JK5B 5JIKA 2F8OA 1MI5A 2YC1B 35C8L 3MRDA 2UUDK 1G7QB 2CDGB 2Z8SA 5FYKU 3P4NA 3ZTJH 5D7LD 1YQ2A 4HT1H 1T1YB 4BM7A 4NPYB 3DXAB 1D9KC 4XP6H 4J7RA 4HUKB 2Y6SC 4NCC1 5CILL 1LP9B 3Q6GH 4M6AA 4M7KH 2J8UA 4AT6B 3DV4A 4ZXBA 1QFPA 1QEWA 3I6KB 4LAJH 1YEFL 3ARBD 5DO2D 3O3DB 2P5EA 4ZUTB 3N50A 3B2VL 1G7PB 4YHLL 3HC4L 2X1OA 4LF3B 2MSPA 4X7DC 2OJZH 4GKSA 4HLZG 1FL6A 3BZEA 4IRSB 4EVNB 2VE6B 3BSZL 3EUUA 1H15B 2IALB 1P2CB 4OV6F 4DGIH 3QRFM 1QYGH 3QO0B 1A6WH 3SO5A 4PD4J 3HZKB 5CIPH 3IJSA 4ZOBA 1KELL 4MSWA 3WDHA 4HSQA 1ZGLA 3PGCB 3RWHB 1BVLA 5EIQA 1YY9C 4HKJA 3H42L 3GZKA 1F4WL 4L4VA 5D7SL 2GT9A 2QHRL 1IT9L 2Z4QB 5IHZA 3I2CH 4Y2DD 3NCEB 1Z3GL 3NZHH 4I77L 1JTPA 5EUOA 1U6AL 3UO1L 3AXLB 2O5ZL 3SCMD 4PLOB 3F62A 4MDJB 1VKXA 3VWJA 5JPMA 2FYYB 3PHSA 1INQA 3HE7B 1MQKH 5GS0H 3CFEB 2XTJB 3QIBC 1OW0A 4CN4A 5FYJL 4OGZA 3MLVL 5DVMA 3WIFA 4D0DB 4OZ4B 4QRPE 5C2BH 2V2XA 1U8MA 3RWFB 2FR4B 3TJEH 4P46C 3V4VH 2VLLB 4Y4FC 5HHXH 1NLDL 5J13C 2IFGA 1CICC 1UWXK 3QEQE 5BOZG 4LBEB 5ERWB 3MRPB 3P77B 4XPTL 2X42A 4N0YH 2X70B 4HWBL 2NZ9D 4A2MA 3IFNL 2MMXA 5ILTH 3TYFA 4DGYH 3MV8B 2A73B 3KPSE 1T80A 4N0RA 1FCCA 2ICWA 3RIAF 5E08H 2ZG2A 4WNQA 5DJ0A 5T5NF 4OQTL 3QFDA 5I1GL 4JAMB 5BW7A 1FSKC 3VG0L 5IR1B 5KSBB 1EV2E 1U95A 2A1WH 3G6AB 2YUXA 3WUWA 4LSVH 3RWDA 3WV0A 3K2MC 4CJ0A 3OPZL 4AM0B 4WHTB 4NO2B 2BVUA 2IBGA 1ONQB 5CUSL 2W9DL 4Y0GA 3DXAE 4E0RA 4UT6L 4PREA 4LLDA 5ANMB 5H37H 1K6QL 4EI5D 1CLZL 1DUZA 2LV4A 1HH6A 5IW1A 4CU8A 4M3JA 1IEAA 3CIQA 2XWJB 3MRFB 1EO8H 3G08B 4FQQA 1RK0A 2V5YA 1DVFA 3FQXA 4YUEH 2O93L 4MD0B 4PJCB 4RFNB 2XXCB 5C86A 2G5RA 2PYEB 3DOSA 3AM8C 4HIXL 2APBA 4XX1G 1J0YA 3S35X 2V5TA 1BREA 3BGFC 1AR1C 2NXZD 3KWWB 4WFEE 5DJYA 3E1F1 5AYUH 1JPGB 4JM2D 2JB5H 4K9EH 4Q2ZB 4R0LC 1CYGA 4WUKL 5D70L 1JNLL 1YYLL 4IMLA 4PRHD 4PRPD 2A0LD 2VZVA 1OF2A 5KVEL 1M7DA 3G6DL 4HIHB 2EDYA 2FEEL 2VO5A 4FFVC 4ODTL 4KZEH 2DLGA 1G7JB 1X5FA 4NKMA 2AJYL 5D1QC 4WCYL 3GM8A 4CUCA 3PWUA 3O2WL 4Z7WE 3T3ME 1OB1B 2GSIA 3C5JA 4L8SA 5FYJE 2XTJE 4Y1AA 2QR0A 1OGTB 1J11A 4MQTB 4XMLH 1AO7D 4KQ3L 5GRWA 2VLKB 1D9KD 3CFDA 1KFAH 2VABB 3WUZA 4I13B 4PGDB 4OD2B 3CVIL 5DMKA 4F7MB 5BJTA 5CBAA 2HLFC 2X40A 1JCKA 1SYSA 1WZLA 4ODBD 4XMKL 5IK3B 4P2RB 1PG7X 1F4HA 5JLZB 3GJFB 5TF1L 2YPLA 4G8GB 3F12B 1T3FB 2Z35A 2UZIL 1K5NB 3SGKC 2R0ZH 1XR9B 1I3RA 2ITDB 3WUWG 3K8MA 1UZ6F 1F2XK 5DEFB 4YHPA 1DFBH 4KV5F 3DO3A 3AU1A 5KSBE 1AE6L 1U58B 2XFXB 3IDIB 4GMSL 4JREC 1I8MB 2JKXA 2BRRL 2QQLH 1MUJB 4PV9A 4Z0XB 3WFDL 3VFWB 3DX9B 4M61A 4U1KB 1YY9D 2NY2C 2WSKA 1A47A 4PRIE 1SM3H 4UIKH 5ANME 3FT4B 3KPNA 4LSUH 2ICEA 3PABA 3EFFB 4QHNB 3TO4B 1YN6A 5C08B 2KBGA 4Y5YB 3MLYL 3V6BR 1OAQL 3RU8L 1YPZF 4HHAB 3Q5TA 5I1IH 1RUKL 1T7ZA 2YUWA 5E2TL 3V6OC 3QIBD 5FECA 1QBML 1YEEL 4PJCE 2QHLA 1O0VA 2Q86B 4YDLB 1CIDA 1AHWB 5DURB 3NAAH 4M4RA 4CW1A 1Q0XH 4P46D 4X7EC 1J88A 1S5HB 4NQTA 4X9GA 2JJUA 3PGDB 15C8L 4YDVB 5GSVA 3OKOB 4I2XB 4RBPH 1MCRA 2VKWA 5KAQG 3KLSA 2AJXH 1HWHB 1N0LA 1UZ8A 4CGTA 4H1LH 1PYWA 1CIUA 3X11A 4E41A 4G9FA 3TESA 3G9VA 3LQAC 5C0CE 3QUXB 4FFYH 1MCWW 1RVFL 2ZCHL 8FABA 1H3PH 1NUDA 1ROWA 4UDTA 1MFCH 4GRWE 4CDHA 4C56B 4HF5L 2BVPB 1V7NH 5GS2D 1YEJH 3QRGL 5KZCB 2BXYA 3SKJH 1NC2B 5EZIL 4JLRA 4OI8A 5GS1A 3NH7H 2A6DB 3UTTA 2EDDA 3HZMA 1MEXH 4Z9KB 5FYKL 4ZXBC 4MAYC 3C6SA 2FX7L 1EXUA 5I8CB 2VLKE 2YK1L 3BAEL 2J8UF 5ID1A 2W38A 2H6PB 2GTWA 2EICA 1RSFA 3C6LB 1ND0A 3BMVA 3K1DA 1DZBA 1T89C 2QSCH 1IVLA 4GXUM 3NTCL 4GG6A 5DR5H 1X6LA 1WGOA 3P9LB 4LVOB 5CWSB 1ZOXA 4L9LC 1XCQB 2R1XB 3FQNB 3UBXI 3BDYL 4Y19D 1YZZA 2WIIA 4G8GE 3KLAB 4OFVA 3QO1A 1GIGH 5CJ8A 4MJ5B 3UCRA 1AR1D 3CDGA 3BQUA 3QHFH 4OZFA 3KVQA 5CHNB 1XIWA 3UZQA 4DZBA 4ELKA 4G8EB 1MRDL 3CU1A 4JPWH 5ETUA 4XNYH 2EC9T 5I74B 4U33A 5FDYA 3TA3B 1AKJD 5SV4A 4YK4C 1G7MB 3G5XB 4LSPL 1LEGA 2IH3B 4AEIH 3LS5H 4POUB 3VWJC 3ZE1E 3LIZL 1KNOB 1V5JA 8CGTA 1I9EA 5J12B 1UWGH 4G3YL 4WEBH 2QADC 2J8HA 2XPGB 2A74A 5D1QD 2DWEB 5JW5B 1GGBL 5F7FA 1NGQH 5I17B 3WNPA 3GM0A 3MODH 4D9RD 5C0FA 4OM0L 4KROC 4UIMA 2VC2H 2H41A 3IS0X 3ARED 3B9KC 5JPNB 4RFEA 4K3EL 3ZKMC 3GNMH 5DJ6B 2AAVA 5D7IA 4PBVC 4YJZL 2D2OA 1HSAB 3OKLB 1NAMA 3BT2H 2P8PB 3FO2A 4I2XE 2IEPA 2CDFB 2J4WL 4PGCB 2HLFD 2HYMA 5MP6H 4GMTH 1MHEB 4NP4H 3NCYP 1UCBH 1FCGA 1SBSH 3RGHA 4YXHL 1H8OA 1S9WB 4QHLA 2JJWA 3S4SB 3N85L 4DVBA 1IGFL 2V17H 4OZGA 5TDOA 1LDPH 4ZUUA 5BV7B 3CVHL 4M1CC 5BV7L 3VRJA 4LLYA 4QTIH 1IC4L 5HHMA 1A3LL 1BFOA 1KTDB 4M1GL 4RQQB 5B8CB 5MENA 5IVXE 3PDDA 5C0JB 5D1XA 3WMSA 4AIOA 1FGNH 2JCCA 1KN2H 1RUML 1DEEA 3HC0B 3P73A 2QV2A 4N0CA 4NQCD 2R56L 1RJYA 2OXGA 1I7ZB 3R06B 2NY2D 3SHSA 4EN3C 4F8TA 4HIEA 2VDOH 3B9DA 4X4ZA 2J6EL 1OAUL 5I1JH 4X6EA 2I9LB 1A6ZB 3EHBC 1RZFH 4U1SA 3QUMB 1KPUB 3I6GB 3D3VA 3EDKA 3QUML 4XNXL 4F7CB 4HUVB 4U0QB 2E8ZA 2QQNL 3GSXA 4OZFG 5F3BB 4D0CA 4I8DA 1JNNH 2MPAL 5EZOL 4YHYB 1KJ2A 3WEXA 4R3SA 2XQYK 4OZIF 1FJ1A 5TE7H 4OLEA 3SE8H 4QRRD 1F58H 3UZVB 4U1NA 5A16A 1S9YB 4OI9A 3TBSA 5CKAA 4LMQE 4NZUL 1M7IB 5DZOA 2C3WA 4MA1C 1UH4A 4MAUL 4KI5C 4L8SC 2PKDA 1BBJB 1IL1B 3BKCL 1DL7L 1NDGB 4F37F 5GGVY 3HN3A 5K9OB 4MNGB 5DHVB 1KTLA 1PFCA 5F7KC 3G5YA 1HHIB 1L7TH 3CH1A 3ET9F 4KJYA 1NCNA 2VH5H 1NC4A 3KPLB 4ZXBD 32C2A 3GMLA 4MAYD 2Y9RT 4L29B 1YMHA 2P5ED 4QHUB 3EAKA 4LEOA 1MAMH 1ZT1B 5AD0A 1MFBH 2AEIT 2CK0H 5I19H 5DQ9A 3SO3B 1WWBX 4F8QA 5DD6B 3LKSA 4M7JL 3OZ9L 5TDNA 4HPYH 1TFHA 2ZSVB 1XGPB 4GFTB 1VEMA 3JWOH 3O6LH 4JDZA 4PJ9C 3U9PL 5F7HA 2X1WL 4KH2A 4NFDA 1DP0A 4G43B 1U8JA 4FQCL 1QZ1A 2AABL 3S36L 3L95B 4DAGL 2Y7QB 1DCLA 2DJUA 1RQ5A 4B7IA 2V7HB 1N5AA 4ELMB 1FZJB 3OR7B 5T1MB 4XAWL 4X98B 2QJDA 3MACL 3BKYL 2LQRA 3WJJA 2YSSB 3VXRA 5ITBH 4PTUA 1JF5A 5E99H 1EIBA 4WWKB 4GLRI 4NZJA 1YN7B 3ZKXC 2HT4