4NQXA

Crystal structure of hla a*0101 in complex with np44-s7n, an 9-mer influenza epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 70
structure length 274
sequence length 274
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqxA01
3A67L 3D69B 4OLZL 4HFUH 4ZAKB 5BXFA 1B0GB 5DUBA 5E9DE 4WFGD 1WGOA 3MCKA 4IMKA 2ZZUT 1R5WA 1YMMD 3QEUA 5GGTH 4KAQL 3TYFA 1QFPA 4X6EB 2BNRE 3PL6C 3LKPA 5EU3A 2NY2B 4Y1AA 5DJ8A 1U8MA 1QRNB 3BP7A 4X7DC 2VO5A 4YPJA 3UO1L 3OKNA 4JHBA 2OSLB 3OL2A 4XCEB 1NFDE 4TSCL 1LO5B 5FGBA 2SEBA 4LNRA 4RSVA 1G6RH 3FJTA 4NJAL 4OM0L 1CWVA 3TIDA 3TJHA 1S7UB 3M45A 3HA0A 4AQOA 2NPLX 5E4EB 3L3JA 1SM3H 1I9EA 2J5LC 4QYOB 1CBVL 5DJDA 3P11H 3T1WA 3C8KB 4IRJD 4HXAL 4NN6B 3VG0L 4KZEH 4GAJL 2HLFD 3REVA 1M6OB 2P8LB 1MFAL 2CUIA 4K8RC 4H0HB 5B3JF 1IEAB 1WFTA 4M93C 1TZGL 3MLVH 1KPVA 2VISB 1V5JA 1MRCL 3CFJB 4JFPB 3UX9B 3SE4C 3C5ZC 1S9YB 3L3IB 4JLRA 2XQBL 4KROD 3GSXA 4HV8A 3BZEA 1MAMH 3MRKA 2LU4A 4WI4A 3VFSB 2R0LH 5EU5A 2Z31C 3P77B 4UQ2B 3RIAK 4I1NB 4J6RL 1X4XA 5IB5A 3GIVB 1FIGL 3NFNA 1RD6A 4G43A 4DZBA 4OCXL 3ALXA 4H88H 2NY7L 4ONHB 2CK0H 1I7RB 3QIBD 5DK2A 1CDUA 4D94A 1DUYA 2P48B 1T1WA 3N0PB 1TNMA 1MFEH 1BQLL 2O5ZL 5ALCH 4HQQH 4JY4B 2F15A 1W0WB 1MVUA 4RNRA 1RUKL 3LS4H 3FL7A 4JPIA 3AS0A 3G04B 4HJJH 2CR6A 5SWZA 3DV6B 3P4LA 3V0VA 5FDYA 2GSIA 1BJ1H 2C3GA 5AYUH 3UTPD 4Z95L 1FNSL 1UM6H 3Q5YA 3IJYA 4U33A 2UV3A 4LPCA 1RPQA 2V7NB 3HTLX 1OP3H 3LQAC 5EC1B 5SWQA 2H6PA 5ISZE 4Z7OF 3F5WB 3HI5H 4OCSL 3VXTA 1VGEL 1FLRL 1ZHBA 3DI2B 4P9HC 5D7SH 5GS1C 4K2UH 1PGRB 3OB0H 1YMMB 2Y36H 1A1MB 5A2KH 2A74B 4GMTH 3SKMB 1J8HE 4NKMB 5J1SC 3HZYB 1CIDA 1ETZA 3MA9H 2BXYA 1BEYH 3DXAD 4LLMB 3VMNA 3BE1L 2IAMC 1CDJA 5GGUA 4R6UA 4HPYL 4YZFE 3GMQA 4JPKL 5MENE 4MZ2A 3ME0A 1MCEA 5D5MA 5ALBL 1L6ZA 4X0KB 2JCCB 4OB5L 5DC9B 3JZ7A 3NCBB 5BRZE 5B39G 3HE6A 1LO4H 2R69L 5C6TH 2GK2A 3H9SE 1T2QL 2ADIA 5FUCC 2VH5L 4OLWH 1NLDH 3MRIA 3WS6C 4WO4D 4K8RH 1KPUA 4OT1L 5DT1H 3RZCA 4IRJB 3ZKXB 2QQLH 2FJGB 2EC9U 3V79C 3T0AA 5DRZA 4OM1L 1XF2A 4NRZA 1NC4A 1JZ8A 4PJDE 3PWNA 3S35X 1H3TA 1MREH 2AJSH 3I2CL 2Q7YB 4NHUB 1I8IA 4NZRL 5IMMA 2NX5E 1GRWA 8FABB 3UJTL 5BV7C 1YEEL 4ODHH 4KROB 3FOLB 2DF3A 4U0QB 4F9LC 2RBLA 3QH3A 1RIHH 2E9IA 3DVNA 1KGCD 3BKCH 3QG6B 5BQ7A 2AEQL 2COQA 2ZOKB 4B7LA 4PJGE 5HBBA 1F6LL 1OPGL 3MMEA 1AGFA 5CIPA 5HXMA 5ITBH 3OF6A 4RX4D 3STZB 3ZDYE 2Z93B 2CDEB 3OXSB 4XP6L 5I19H 3EO9H 1NBYA 3MRLA 3U1SH 2DN7A 1RJLA 3MLRL 2YPLA 4E42B 2H2PC 5FUZH 2HVJB 5H37H 2ZUYA 3RGVC 4X9BA 3BIBX 1RZ7H 5JIHA 1WK0A 3SDXA 5E8NA 4P0DA 1PAMA 2Q76A 1TMCB 4WU5B 3VCLA 3ZT7A 3CFBB 5D7KE 3HZVA 4U3HA 4JJ5A 1P1ZB 5F6IB 1RUML 3TPUB 5EOCJ 3MACH 4BK5A 2MPAH 4JPVL 4Z0BL 1J18A 3LZFL 4U6XA 1K3IA 1N5YL 4HMCA 3QPXL 1CGUA 4PRAB 4LVNC 1N6QL 4WCYL 1WICA 3WXVL 1YN6B 3RNQB 2GCYA 3LD8B 3HPLB 4R97C 4QRRE 1FL6A 5F89B 2J8UA 4X4XA 3BKML 3MXVL 3NFPB 4L9LC 1RZKC 4WWID 1CFBA 1SHMA 5EPMA 1M71A 4S0UC 3B5TA 5I8KH 4NKOA 4FFYL 5I74B 3DXAB 1MIMH 5KVFH 2R9HC 3TA3D 2E6JA 4NO0B 3SY0A 1F3JA 3QJFA 2X4TA 3SE9H 1XAUA 1MJJB 4I3GA 1WAAF 3CXDH 2VDMH 4ZFOB 3U9UA 3HB3C 4WUKH 3MOBH 2JJWA 3MRNB 4YFLF 3TESA 5I9QC 4TVPH 2GUOA 1RAMA 3I02B 4WUUA 2GHWB 1QVOA 2OK0L 4PRNB 1PKQA 2WUBL 4WO4B 2RHEA 4CJ0A 1LEKA 4PP1D 4AQ1B 1FHGA 1YZZA 2OZ4L 3NCYS 2CDFB 3ZL4L 1T1YB 1YC7A 1QHPA 6CGTA 4NO5A 4FQCL 2CMRH 2DQEH 3ARDD 5BV7H 3KJ4C 5JR1L 2J4WH 3I84A 4IRZH 1WVZA 4NYLB 3BZ4A 3QNZB 3WIIL 4CBPA 4GW4B 3VRIA 1WQVT 3PIQB 3V4UL 2OTWA 1II4E 1AC6A 1KJMB 1QQDB 3IDXL 2R0KL 4JN2A 4MJIE 4E41D 5ICZB 4LLVA 1NPUA 3FRPA 1S7QA 2V2TB 1T4KB 3UAJD 3ZDXE 4IRSC 4G7YL 2IAND 2J6EA 1NKRA 1S7XB 4I77H 4EOWL 1OD7A 2BZDA 2YMXH 1JPSL 1AXSB 4JREB 3LV3A 3DETD 4QXUH 5HD8D 5I0DA 4D0CA 1EAJA 1DL7H 3GJEB 4C83B 2HG5B 5C9JB 1YEDA 1N4XH 3VFUA 3CLEH 4NCC1 2R8SL 4PJCB 2JK5B 4ZTOL 2YD3A 1KV3A 3GBMH 4O51B 5C1MB 1H15B 4LIQE 5IWLA 4JM2F 2FR4A 2HKHL 5H37G 3TO4C 3ZDYF 5DDHB 4FRWA 2Q86A 2XRAL 3WFBH 1XEDA 4OD2B 2DIAA 4FTVD 5LKNA 4JRXA 4X7TB 4X4ME 3SHSA 2X1PA 3O2DL 3BRGC 3JBG7 2R0ZL 4Y16D 1UB6A 5EOCL 3MLXL 2GW5A 1A6WL 3LKQB 4H20L 4G6JH 5GRVK 3D18B 3IU3B 4XWOC 4S2SB 4XPTH 4CN1A 1ZVSB 1MCQA 4FHBD 1X5IA 4L4TB 4LLAA 1FP5A 1RZKH 2HLAA 4M5YL 1CD0A 1ED3B 1HHIA 3JTSA 4FQLL 4PLOB 1S9WB 4Y5VC 3I3DA 4X7EC 3QXTA 4RBPK 5EUOE 2UY7A 4P59H 4KKBD 4OZ4B 3WE6A 1D9KA 4XP4L 2K7PA 2QJDA 2G5BA 2ILLA 3IDGA 1DTUA 2XWJA 5DSCA 5L2KE 4NO2B 4NPYA 3NABL 1G84A 1BQHG 1A7OL 4KJYB 3QUMB 2QQNH 4OCMC 4W6XB 3BESR 1A1OA 1T7VA 3R1GH 3TBSA 1A0QH 1A6AB 1T5XA 1S7RB 3NPSB 5C0RL 4Z0XA 1H0DA 5JOPE 2IADB 5E1AA 5LCVH 3S4SG 4LL9A 5DS8A 3LKRB 4XGZA 4FP8H 2VDQH 3QDAA 4YX2L 3BAEH 5GGQH 2X5PA 1M7IB 2Y72A 1LQSR 4ETQB 4JFFD 4TVSa 4NFDA 1H3VA 4HBCH 4YQXL 1GAFH 2P1YA 4TUKL 5FA4B 2P8MA 2HTKC 5DTFB 2ORBH 1FO0H 4L3ED 1C5CH 1MIEL 3ARDB 5GSVA 4OZFB 2DDQH 5FO9B 5JORB 4KI5E 2NTSP 4JFDE 4CNIB 4H5SA 4I4WB 5CSZA 2JJVA 4Z7QE 5J3HC 1K4DA 5JNYB 1ZLVH 2VZUA 4HJGA 1HHJB 3T8XA 4JCMA 4P3CL 5LXGH 1YQ2A 3MZGB 4E41B 2EH8H 3KHQA 3X11B 4NQVB 5E9DD 1CZ8L 4WTXA 3QZWG 1PG7L 1DEDA 2Q6WA 1I4FA 1YEGH 1R3KB 1YQVL 2IANB 3EO1A 2PO6A 4K3EH 1DQQB 1KACB 3SDCC 1I3GH 4ZNCD 4LHQB 4OZIE 4XNZC 5EIQA 4JVWA 3FONA 2GYSA 4KH2A 3ARGA 3C9NB 1D6VH 4OTXH 3D9AH 1KEGH 1LHZA 4GXVL 3QIWA 4RFEB 5GGRY 5ABDE 4FNLL 3ZDXF 3FB7A 3BP4A 4F7CB 2ED7A 2YD7A 4B5EA 2B4CC 3AU1A 4M61A 1NKOA 4D9LL 3TCXA 1A6UL 4FTVB 4ZODA 1A3RL 4NGHH 5GXBB 3EJZC 5LQBH 1CR9L 1DCLA 1A7PH 1NDGB 4Z8FH 3U7AA 4XBEH 4JZNB 4M1GH 4Y16B 1NGZA 3MODL 5CILH 3HRZB 4QF1A 3ALPA 3TZVD 4ZS6D 1IGIH 4WU7A 3M8OH 3SDAD 3TJHC 1ADQL 4IOSD 5IF0B 4JO2H 4PRIB 4UT6H 1ONQA 1F45A 3P4OB 2GSGB 3WD5L 1G9NL 5FECA 1LO2H 2I60H 1JNNL 3S3SA 1B6DA 3F7YA 2FL5A 1KXQE 2BSSA 5FF6A 4UNTA 4DKEH 3BDYH 2VABB 5C0AE 4N5EA 3VFWB 4ESKA 3BPCB 3TFKD 3OKDB 4NSKB 5F1IA 3DUUB 1T0MA 2FBJL 3CAFA 5D1QB 5BZDA 3KR3H 1G1YA 3KNBB 2Z92B 3KPRE 1YDPA 4K07A 3VGAC 4HW6A 2P8PA 3K2UL 4MAYA 1XR9B 4F33A 4WEBL 5CP7B 5DJAB 2Z8WC 5CS7A 4E0RB 2GK0B 3QFDA 1S7SB 1VACA 3S88L 1BZQK 3N85L 2R1YA 3SCMC 2N1KA 4FMKA 4P57B 2GTZA 1E27A 5JXAL 4Y89A 2VXVH 1YNKL 4O02H 5EDXA 3FO2B 5L6YH 4GRMA 1XCTB 4PUBL 1FPTH 5MHSE 3ETBF 1XCQB 1NCBL 4FQQA 1BF2A 4XTRD 4GRLA 2OI9B 4G9FB 3WJJC 2VLJD 3RPIB 2HKFL 5DRWA 3QQNA 3EIFA 3EYUH 3QRGH 1FE8H 4Y4HA 4I48B 3OR6B 1EMTL 3KJ6H 3ZE0E 4BQ8A 1EAPB 4OIIH 3F6IA 3ILQC 1W2KT 1J10A 4R4FH 3HR5A 4PD4J 5E9DB 2KL6A 5EUKA 2ZJSH 3I6LE 4ZSOE 5D7LE 5TFSL 4HK0B 1OD9A 3MV8D 4CJ1A 4JFYB 4WI3A 3MO1A 3B5GA 3W9EA 4WHYH 5EIIB 2QADC 3QUZA 5MEOB 3QP3A 1JRHL 4RA0C 1LK3L 1KIQB 1EGJA 1F8TL 4IJ3C 3JUYA 1N6VA 1NFDB 4OCRH 1I75A 5EB9A 3QNYA 3MROA 4EVNB 2ATPA 3CDCA 3RUGE 2X4OA 5F3HB 1U2CA 3MGOA 4M6OH 5A1AA 4PLJD 3LN4B 4JG1L 2N7AA 1I1CA 3KPPB 1MCWM 2R0WH 5BW7A 5BRZD 4WWKD 1AP2A 4EN3A 5IK3A 3QO0B 3FO9B 8CGTA 3H9SD 5C0BA 2KDGA 1YNLL 4YHIB 2F5BL 3LCYA 2FEEI 3I75B 5JXED 2ARJA 1B4JL 1LNUA 3SDAB 2HT2C 4PJEA 3TWCH 1KENL 4Q0XH 1A22B 3HE6C 3VH8B 2WBJD 3I50H 1NBQA 1T22A 4RGOH 2GJ6D 4GKZB 2DYPD 2H26B 5JIIA 1E4JA 2C3XA 5LBSL 5FYJH 2MCPL 1ZV5A 4DZ8A 1CDIA 4JFEE 3E8UL 3REWB 5KS9F 3IU4H 3VXSE 5BMFH 1IBGL 2PF6A 3OAYK 2K3TA 3DOSA 4W6WB 1HKLL 3C5SA 3RTQD 4K94C 1JI2A 2XY1A 3T77B 4XX1G 3CFEB 1OSZB 2XKUA 3HG1A 2ADGA 2VXUH 3DSFL 2B8OT 2NXZC 3QEQD 4LOUD 1QSZA 1YPZA 3JV6A 2RCSH 4JM2D 4M62L 3H9HA 1HXMA 2C7UB 3MRQA 1HOCB 2OX5A 3EZJB 1UH4A 1IGFH 5LG1A 4LCCA 5FIEA 1XIWD 4NUGL 3NTCL 1CT8B 1YEKH 5TGBB 2EO1A 1FFPB 1RUAH 1L7IH 1T80A 3N1MC 4ODXB 3QDGA 3ULSA 4J8RB 1UC6A 2EIDA 5DHVB 1H9VA 3WL9A 3F7QA 2XT1B 5HHOD 2J1KA 5FYKE 1UT9A 1B3JA 2XTJC 3DYPA 2VSDA 2DLEA 5HYQA 5C71A 2MHAA 5GGTL 1YYMH 2DJUA 4JQXC 5E94B 2ZKHH 1IGCH 4E5XA 3ULVC 5T3XE 4Z7WA 1KULA 2ZOLB 4F7MA 4HUMB 3UDWA 3L3OA 2VDPL 2NCMA 2X9WA 5ISZB 3IFLL 4MD0A 4DN3H 4W68A 2NW2B 2D03L 5E95B 2NXYC 5IBLD 4BH7A 1M1SA 3MV8B 1OSPH 1VGKA 1G6RL 1J8HB 4X7SL 2YUZA 3BHBB 1C7SA 3O45B 4ZOEA 2NR6C 3VI3F 5IP4A 2WIIA 4Y19D 5H94B 3QCVL 1G7JA 2DQDH 3U4BH 2AXJA 3WN5A 5IVXF 2VLMD 1BAFL 3GB7B 1FORL 4HIJB 1MHHA 5MENB 2Y6SC 4WHYG 1ULVA 5J11C 4OSUL 1ZGLB 1QEWA 1U8LA 1A2YA 1CE6B 1FIEA 2YWZA 3C6SB 3ROLA 3GHBH 1ERNA 3WO3B 3EYFB 3L7EB 2YEZB 5D93B 4EQ3A 4WWKB 5BRZB 4R7NB 4WIQA 4BQ6A 3MLVL 5F9OH 3S35L 4TPRL 4P2QD 5E2VL 1VDGA 3H9SB 1A9EB 4YDKH 3R4DA 5EH1A 4KKCC 4LSVL 3VJ6B 4R2GD 1XZ0B 4A2LA 1F5WA 3L3KA 5FYJE 3MLZL 1MAML 1KLGA 2W65B 2WBJB 4JFZL 3S97C 4X5XA 3HMXL 4ISVB 2DYPB 4ZNEE 1IGJB 4J4PD 3UPRA 3BGFB 2OR8A 3WLWD 1I8MB 5D71H 4H1LB 4K94H 2F74B 3PWLB 1MUJB 4YH6A 1SJHB 2RGSA 5KAQG 4H88L 3RTQB 2C4FU 4CVZB 3HI6L 4RISH 4MJID 1EDQA 1A1NA 3RVVD 1UACH 3QEQB 2DQCH 4M6NH 3CDGA 3LH2L 3MLSH 5D7IF 5DJ2A 4CVXA 1ZLWK 5ALCL 1WIUA 2VKXA 4EBQL 4KJWC 4L1HA 4DK6A 3LS4L 3V5KA 4HJJL 1H5BB 3WFCH 5GS0H 1HEZB 3BKYH 4WW2A 1XIWB 3DGCR 3EFFA 3JWOH 4JGMA 4OGYL 3DX6B 3GEWB 2JB5L 3QUKB 1JF1A 1T21B 5CWSA 5B3NA 3FCTB 1GJIA 1D5XA 3FT3A 3QG7L 1AQKH 3BH9A 1WZKA 4ZO6A 1F3RB 5J4MA 5D7SL 4UB0L 2OCFD 1A6TB 3IDIA 4NFCA 2GTWA 3KPMA 4JKKA 4X7FC 2APXA 4PFEA 1RY7B 1SQ2N 4DKFH 3LB6C 2AEIT 1EZVX 1HH6B 4QHKJ 5C0ND 3MA9L 3QDJE 1SY6L 5T3ZH 1FVCB 1BEYL 4N0CC 1JGVH 5CSBA 5A2JH 1RURH 4Y4KD 1YEJL 4GQ9H 2MSPA 4LCIH 4YBQD 3S9DB 2NNAA 4O4YL 5C3LD 1ORQA 2LAGB 4YFEA 4FABH 3CSBA 5JW3L 4I0PA 3C6LA 4L8DB 4Y19B 2P4AB 4JO1H 2WINB 3QXDB 4NWUH 5D5ME 4OLWL 5ESQA 3WUWG 4KTDL 1UXSB 3FZUD 4OF3A 4XCYB 2Q7NA 3G9VA 3KPOA 3D3VE 2APVA 3VXRE 4XAWH 3BYTA 1A6VH 4LNVA 3IETB 5T5NF 4RDQF 1OVZA 2A9NH 3LDBB 3T3PF 3TLRA 5JOPD 5HHPA 2AJSL 4P2QB 4EQ2A 4ELMA 5J9PA 4OLXL 2R15A 1DBJH 2NZ9C 4LLYA 3FB5A 3HLAA 1OHQA 4S1DD 4QHMA 3LRGA 4R2GB 5E6IA 1PLGL 3GSWA 4ZUUB 1ZT4B 5FO8B 4FQJL 2VE6B 5H35A 1OAYL 3ULUF 1Q9OB 4Y8AA 4N90D 4LVHB 1U3ZA 2PCPA 4K7PX 1EFXA 3L9RB 4P2RA 2C1PB 2Z91B 4HAFA 3FN9A 5FHBH 4WNQB 1INEH 5ITBL 5JQ6H 2W91A 4ZOBA 3V7MA 5I19L 1I9JL 1JV5A 3U1SL 2IPUG 4XAKE 3UTZB 5AD0A 3E2HA 5FUZL 4NQSA 4MJIB 4OF5A 2ZG3A 1NGWB 1C5DB 4MXWH 3OAYH 3KYMB 1HZHH 1NANI 3GFUA 1NL0L 3LRSA 5GHWL 3OR7A 3TPKA 4XRCB 2AXGB 3O3DA 3BUYB 5F96H 2J6EH 4KUCF 1S5IH 3MACL 4P5MA 5IMOA 3SDXE 3D39D 5C8JA 1IQDA 4LIQL 4X6BA 3TBWB 2PO6C 5I1CH 5ID1B 3ZE1E 1KTLB 1NJ9B 2EE2A 2W9EL 1L0QA 4FQ2H 4LU5H 4F58L 2HJKA 3ARGC 1OTSC 3D6GA 2JJTA 1T6VN 1DJSA 5FK9B 5T3ZE 2HP4A 4F80A 3O4OB 3MRHB 3SDYH 5CGTA 5DGQA 4O2FB 3G5XA 3TCLA 3K1DA 3CPLA 5INCA 3W5MA 1TNNA 1L7TH 1EZVY 3SKJH 1MCOH 3MJ7B 1D6EA 1MI5E 2P24B 2OL3H 1MIML 4X8XA 5DK0A 1PJ9A 1FVEB 2J8UE 2X7LA 4NQEA 4X9GA 3SDDD 4Y4KB 1ZGLM 4LLQB 4S0TD 4KK6C 3O41A 1DBMH 5IFHH 3KWWB 5IHZB 5FM4A 3CXDL 3UPCA 2ZSVB 4HHAB 2E27L 5CZXD 3VXMA 4YGVA 1B4RA 4ZDHA 4LASL 1JHLL 3W2DH 5CKGA 3BEWA 3IAQA 4GAYA 1KTDB 4KQ3L 2ICWJ 1I8KB 1C8PA 5DRXB 3QPQC 2A6JB 3FQTB 3KPRD 5A3IC 5HYSA 4ZOCA 3GMPB 3I3EA 5IR1B 4G6MH 4G5ZH 1O5DT 3V5HA 4B7IA 2ESVE 4DWHA 5FB8B 3PDOA 4AIZB 1DVFC 2D0HA 2DLGA 4WDIA 1WBXA 4GKOA 1PKQE 5DRNB 3T4YA 4MAYC 2UVEA 2CMRL 2DQEL 2LABA 2W9DH 1FH5H 2J4WL 4IRZL 1MQKL 2DL9A 2CUHA 4U1LB 1FFNA 3T2PA 5D1ZC 1NCDH 4Q6IB 4GKSA 1A5FL 4ALAL 1G7LB 5GJTL 4MWFB 3PWPA 2IALB 5FDWB 3G5YA 3TVMA 4OF8A 4ENED 3MRRA 1CE1L 1T2JA 3PHQA 5E2UL 1JHKL 4K7PY 2ITCB 1FVDB 3ARFD 4GFTB 2FB4H 1K4CA 4O2CA 4L3CA 1ZGLP 4GRLC 2YMXL 5EN2B 2FD6L 2FX9H 1ES0B 3DX9A 2ZSWB 4J3SA 3GUTA 4QXUL 1RFDH 3U7YL 4FQPA 4RGNC 5IQ7L 2WIMA 1Q72H 2BC4A 4HF5L 5D72L 3RHWF 1N4XL 4Y4HC 4HH8A 4LSSL 3I6LD 5D7LD 4CAGA 3MQIA 5HHQA 4DTGL 5B8CB 2RJMA 5C0GB 1ROWA 3ES6B 5ETUA 3VWKC 1FG9C 4LSRL 3NCYP 1AD0B 4JDVB 3RL2B 4OZIB 1V3KA 5I1DB 1CTNA 4OQ1A 4OKVA 5IJKC 4CMMB 3F12A 3D39B 3O8XD 4ZS7H 4UDTA 3FRPG 3VFTB 3IFNL 4FQHB 4KV5F 5C0CE 4KY1L 5GZOD 4A2MA 4P5TA 5AZ2L 4U1GC 3U2SB 4NWTL 1CVSC 3PABB 4XPTL 1AGDB 1U91B 1W0VA 2BX5A 1FC1A 3I85A 2ZUVA 3X12B 5TH2B 2Z4QA 3EOTL 3AB0B 2VXSH 5LWYH 3DO7B 3BN9C 3C5JB 4XH2A 5IM7A 3LHPH 5DFVC 3EW3B 1Z9OA 1TJIL 1G9MH 3QUYA 3HNSL 3IDJA 1BOGB 3SDDB 1HSAB 4FOMA 5DQ9A 1E4XL 3EDEA 5IJVA 1ZMYA 5T1MB 1BD2D 3BH8B 1T7WA 2BOBB 5JHDA 4HAGA 1OM3H 3W0WD 4JFED 5J1AB 1H3UA 2VSCA 1R5IA 2DQFA 4NZUH 2EDHA 5T1LA 1KBGH 3KPRB 3K2MC 5I1JH 1PBYA 1KEMH 1SVCP 4AT6B 4A6YA 2EDJA 4X99B 4H26A 2W60B 3QDMA 5F9WB 3U46A 1G7IA 1Q9LB 2A1WH 3SE3A 3MLYH 3U9PH 3T3ME 3IVKB 4URTB 2ICWB 4D8PA 1C5CL 1LEIB 5EU6D 1SMAA 4MCYB 1D5BA 1GGIL 3G6JF 2PYEE 3KYOB 4ZFZB 2ICES 1JZ4A 5E8PB 3F6LA 4N1HB 3ARRA 2NY0D 4IOIB 4WW1A 5I71C 4K3DH 1UB5B 2DLFL 3BZDA 3L1OL 4C54A 1D5IH 3TYGH 3DIFB 3VXUE 2VZVA 4WV1C 5MEQB 1AGBB 2PTUA 1YEGL 4QRQB 4GKNA 3ARFB 2BSED 3PGDA 4V1DA 3MUY1 5CMAA 5KVEH 1H8NA 3W82A 5IIEA 5IESH 4D9RE 4HLJA 3P30H 2P5WD 5IVXB 3MUHL 1KNOA 1J11A 2X4UA 4IHOA 1IILE 4ODTH 1D6VL 4IS6B 1LD9A 25C8L 2DBLH 4PJXF 1WBYB 3H7LA 3DV4A 4QRTB 5D7LB 4ZSOB 5F7NC 3UDWC 3RA7H 1UCBL 2FX7H 4V2BA 3D69A 4WVRA 1IL1B 4ZAKA 4DOHB 4KKLD 2CD0A 1B0GA 1IC5H 5I18H 4NGHL 4OIAA 5EG6C 3O8XB 4X6EA 1A7PL 1SEBB 4I18B 2A0LC 4J2XA 4XBEL 1KIUA 4M1GL 1U8QB 4YBLB 1QRNA 1EGJH 3RUGB 3AXLB 4MB4A 2KQNA 4JO2L 3ULUD 4TSBH 5FYLE 4YNYB 5DXWA 3PGFL 3V8CA 1LO2L 4XCEA 2WM0A 4HXBH 2BJML 3IB4A 4XMPL 4DKEL 3BDYL 3VWJD 2RFXA 4S1RH 4LCUB 1LP9F 4HMEA 3KR3L 4RAUB 3L3HB 4OV5B 3Q1SH 2EC9T 4KK9C 1OAZH 5CGYC 4HIHB 3C8HA 5D7IB 3TJEH 1BD2B 3C8KA 3MRMB 5EO9B 3G9AB 4Q74A 1M6OA 2P8LA 4LVOC 4JFEB 1P4IL 2BVYA 3VXSB 1IEAA 5IEHB 3QQ9D 1BQUA 4KUCD 1QSFE 4PGBB 3QAZB 3ARVA 3HKFA 2VISA 2FHFA 4K3GA 5SWSE 2XN9D 3CFJA 3WSQL 3IDYB 5ADOL 5L6YL 3L3IA 1FPTL 3S5LG 2VWEC 5FXCH 1ZTXH 1CFQA 4EIGB 4U0RB 4XI5C 4ZD3H 2WW8A 4XPHH 5HI4C 1NAMB 3VFSA 3QEGL 2C3WA 3CLFH 3MPCA 5E5RB 3P77A 5EU6B 4YJZL 1JBJA 1MFBL 4N0UE 4UOW0 5FYKL 2VDLL 1CXEA 2NY0B 4ONHA 5DJYB 4PS4H 1OQOA 2NW3A 3OG6B 3WKMH 2V2WB 4AYFA 1I7RA 3GHEH 3O0RL 4GQPH 4WW2C 4I3RH 3SQBA 5T3XL 1C16B 1KN2H 5GGSY 2R2EB 4HD9A 1P5UA 4PJ8D 1FGNH 1GGCH 3GMOB 4YHPA 1WEJL 1E4WH 1W0WA 2FH8A 1INQB 2DMKA 1UFUA 3G04A 1A47A 3DX8B 2NY1C 3DV6A 3QDJD 4M5ZL 2VQUA 3UBXI 1WUNT 3HZKB 2RQ8A 4S1SH 4RA3A 2P5WB 1OARH 2V7NA 4PJ7F 3AAZA 1BZ9B 5EC1A 4AEHL 3RBSA 43CAA 3DHMA 4P4KD 1TITA 2KQMA 5ELIA 3F5WA 2WWKO 1IAIM 4LCYA 2Y06H 1U93B 5JZ7D 2W38A 3QNXB 3OJMB 1LK2B 2KUTA 4PJ9C 1YMMA 5C92A 2D7OA 1A1MA 5DD6A 3U4EB 3V4PL 4MS8C 5KN5B 1F42A 2EIEA 4NKMA 1ZLSL 1OWRM 4PTUB 3KPQA 3HZYA 3QULA 3HI1A 3SEPA 4I0PC 3C6LC 4LLMA 5KSUB 4Q0XL 3UTSE 5D96B 3V6FB 3H6JA 4KUZL 3A6CL 3I50L 5DURD 3VXRD 1BBDH 5CEZD 3VFRA 4RGOL 5C0BE 5GRVL 4TUJB 1JZ5A 2QL1A 4R26H 1S7WB 5FYJL 3T09A 4X0KA 3MV9E 4KPHL 4J1UB 3VWJB 2AW2A 4PJEE 2H2SC 5BMFL 3J7HA 4WFFD 1A4JB 4XVTH 4F8QA 2M2DA 4MVBC 5HDBE 3F65A 3OAZK 3HAEB 2X41A 4O58H 5LGJB 2VXUL 1IKNA 2BY3A 4U1NB 3KPSE 2I5YH 4IRJA 5D7JD 2FJGA 4H25B 5E6IC 2YBRB 5IFAL 1QKZH 4W4OC 1RULL 4XNQB 4Q2ZB 2B2XL 3HG1E 4LSPH 1XGYH 2MQ0A 4ZFFB 3L5WB 5JW4N 5CHNB 5F70A 3IJHB 3VA2C 1P84J 2XN9B 1BREA 1OLLA 1UWGL 4XHJD 1K2DB 3MFFB 4NHUA 5DD5H 3WYRA 4JDZA 4D9QD 5ICXB 1Z3GH 5EZLA 8FABA 3RVUD 5C0EA 3MV7E 4YAQB 1UWEL 3VE0B 3V5DA 1MAKA 3GRWA 3G6AA 5D4QA 4JKPL 3KLDA 4U49A 3E2HC 3O6LL 4HWUA 1OCWH 4MNGB 4M7KL 5I2IB 2CXKA 2ZOKA 1RMFH 1J0IA 3B43A 1KCRH 5C08D 1IEBB 1IGCL 3QDGE 3ZE2E 4YXHH 2Z93A 2ZCLH 4X6DA 2CDEA 5IGXL 1ZA3B 5D2NB 4UMGA 4DN3L 1KN4H 3ZTNH 4E42A 1P9MA 3HUJE 1OF2B 5BOPA 1F2XK 3Q2CA 4DFHA 5GGVH 5DVMA 4PJ8B 4PJIE 2CKBB 4RFOH 1CFVH 4WU5A 1XGUB 3CFBA 2EH7L 4JFQA 3KLHD 1P1ZA 5DVOA 4OGXH 5ERWA 4M6ML 5GISH 3TPUA 2BSTB 3QDJB 4KVCH 4NO3A 1X5AA 1A7RH 4L5FH 2IH3B 2HT4C 5DEZA 3UZQA 4U7SA 3O9WD 2IGFL 1HWGB 1NGPL 4P4KB 4PRAA 1U8HB 5I6XC 3RNQA 1UKSA 1RK0B 2X89D 5KANI 3HPLA 4M7JL 4R8WL 1KSRA 4PP8C 5F89A 2MJWA 3NFPA 4NRYB 1CLZH 5K59E 3ZYZA 5EBMB 1ZWIB 3CH1A 3MRBA 4EUPH 4YDKL 3ELAT 3S3JA 3MR9B 4Q58C 4DJMA 1RVFH 1EHLH 2CGRH 1IC7H 1K5NB 5F9DC 2XA3A 3C87A 5KVGL 3LMJH 3GMNA 3MUGB 4POZC 3R8QA 4NO0A 3VXRB 5MEPA 3N06B 3VD4A 5DZNA 3CXHJ 3FFCD 3TV3H 4EEEA 4ZFOA 4K7PL 4XC3H 1IT9L 1JYNA 1QBLH 1ZE3C 1DQLH 4UQ3B 4K55A 3MRNA 5D71L 3Q6FB 1NCCH 3WO4C 3EYVA 3GJFB 3WNLA 5EZJB 3ZZ1A 3I02A 1KJ2L 1VFMA 3CZFA 2CRYA 4Q9BA 4MX7A 1KC5H 2UZIH 2Q8AH 2OR7A 4Y2DD 1SYSB 4PRNA 4JQIH 4I0CC 1MJ7H 1KFAH 4WO4A 4JR9L 1UACL 3DVGB 3DRTB 2DQCL 1CLYH 3D85D 4M6NL 5D7JB 2BDNL 4GT7A 2CDFA 4PLKC 4K3JL 2JB6B 5GS0L 1WC7A 5E8DH 3PV6B 3JWOL 3SGKC 5L8KB 2X10A 1U42A 1NCTA 2E7HA 4NYLA 3QNZA 3GI9H 4GW4A 2DRUA 3PIQA 4HKBB 1TLKA 5LVEA 2X4NA 5GRWA 3OZ9L 4QHNB 4Y4FC 1KJMA 1QQDA 3GO1H 2YA1A 1F2QA 3TP4A 1OAQL 1U3HD 4LPUA 2V2TA 5B4MC 1T4KA 5I1LB 1UQSB 5C08B 2EYTB 1S7XA 4J3WA 1EJOH 1AY1H 4RX4A 5GS3A 5J6HA 3JTCA 1CFTA 3PNWB 1HQ4B 1UM5H 2AJZB 2Z35B 4G8EB 1AXSA 3T0ED 5T3ZL 3G08B 4M48H 1PEWA 1JGVL 3F58H 3GJEA 1YJDC 3OKEB 2HG5A 4C83A 1RURL 5C9JA 3DX7A 3IF1B 1X6LA 4PJCA 1ZHKB 2JK5A 4YEEA 3BSZH 4Y5XC 4P5TC 4MQTB 2DQJL 2EDOA 4G80B 5DDHA 1OTUD 1HDMB 4UV4L 1FFRA 2ZUTA 2HRPL 4RGMC 1QG3A 4PB9H 1QFWM 2E9WA 3FQUB 3KXFD 2HWZH 3GM0A 5K9KA 1V7NH 4NWUL 4K9EC 3P0YH 1GZPB 4JN1H 2AJUH 2YD6A 3LKQA 4OUUB 4PRPE 4YBHA 5FV1L 5JHLH 3D18A 3QUYC 4RMTA 4S2SA 3P9WB 5I16B 3O2DA 1ZVSA 4GJTB 4HUKB 5IMKB 4L4TA 1A6VL 1ED3A 4PJAF 1S9WA 2D9QB 1UJ3B 5CUSH 2WUCL 1KB5H 3G6JB 4K71B 1DBJL 2GI7A 1M05B 4GBXD 4OZ4A 2DWDB 3QUXD 3X17A 1T0NB 1IFHL 2ESVB 3WNKA 5EO0A 5AG9A 1T04B 4NN5B 1CIUA 4PG2A 4NO2A 1GPOH 4UI2A 2AV7B 3FFCB 2MKLC 4KJYA 3QUMA 4TUOB 5K9OB 1CI5A 1EIBA 1KJ3L 2OR9L 3O4LE 1Z6JT 2R23A 4YUEL 5DMYA 2PYED 4Y8DC 1A6AA 1ACYL 1S7RA 2JJUA 2IADA 4FXKB 1BFVH 3LKRA 4POYA 1ZT7B 3GBNH 5J7CC 2XFXB 2VQ1B 4PJXB 1HZHL 1MCDA 3D85B 5BJTA 3IXTB 1D5ZB 4ETQA 3OAZH 1DANU 4G42A 5JO5B 1UA6L 5FA4A 1W72L 2J6EL 5DTFA 4F37K 1U58A 4X83A 3EKCA 5C0IA 1LE9B 4J3TA 1RJYB 1S5IL 4LEXH 2GJZB 4O5LH 2AEPH 3ARDA 5C07D 4OZFA 1AR1C 5FO9A 3CSGA 4CNIA 4I4WA 2DTSA 1UVQB 4FQ2L 1I1FB 4LU5L 1HHJA 1DQDH 4D2NA 5KVMC 4YO0A 1I3RB 3SJVD 5CJOL 5DO2D 1CDBA 3X3FH 5L0QB 1CQKA 4E41A 3X11A 1T89A 3IAGC 4NQVA 5D1XC 1U3HB 4KDTA 4YWGL 1V7MH 4AJ0A 3GMLB 1Q0YH 3RX7A 1A6PA 1I1AC 3KVQA 1R3LA 5F7WC 4GG6F 2CLVA 1FRGH 1DQQA 1YJDH 3SKJL 4KKAC 1MCOL 1OOAA 4KTEL 4OFDA 3T0EB 4YE4H 1LP9B 3QXUA 3DNKA 1AE6H 1FNAA 2LU7A 3VFNB 3GSNB 4X6CA 3C9NA 4J3VA 2V6HA 1DBML 5IFHL 1AKJD 4RFEA 5INDB 3ARUA 4LSQH 1I3UA 3RJDA 5DZLA 4F7CA 4HGMA 2DTMH 4FTVA 2Y9RT 2I24N 2PW2B 2VL4A 5I75C 3LSOB 4BK4A 3KXFB 1BIHA 1NDGA 3VI4E 3VXME 4JZNA 2I26N 4U1IA 4Y16A 5B21A 4NJ9L 3HRZA 3CVHL 4G6ML 4G5ZL 3ARQA 5F7EH 3RWJB 3WFDH 5ILTH 2FZ3A 5JPNA 3K81A 1U41A 5IF0A 3LQZB 5AWNH 3GSRB 4PRIA 4U1HB 2GSGA 5IHBA 1C1EL 3B9AA 4XP1H 2XWBB 1F3DJ 1QSFD 4TQEL 3EHBC 2VABA 1F4YH 4I3SH 5DJXB 3VFWA 5HYJE 2FJHB 2GFBB 2EXYC 3QUXB 3OKDA 4NSKA 4OJFH 5E08H 3JWNC 3DUUA 1F11B 3LPGA 4A6YH 5KG9B 5D1QA 1HYSC 3KNBA 4N8VA 5L7XL 2Z92A 2QHRL 1TQCB 2B1AL 3K46A 3TC9A 2VAJA 1L9NA 2M1KA 3K8KA 5HYSG 4K8RD 2VB5A 3P9LB 1KUMA 4FG6C 4E0RA 2GK0A 3WUZA 2PYEB 4KQ4L 1S7SA 3H3KA 4X6FB 2VLLA 2YR3A 2BY2A 2D4DA 2DQTH 3HMWH 4PJ7B 3C5ZD 5J89A 1Q72L 1QOKA 1X5LA 5HGGS 3FO2A 3MBEC 1MRDH 1XCTA 3BPLB 1I9RH 1U6AH 3ARTA 5I1KH 2OI9A 4G9FA 3RPIA 1HYRC 2Z31D 4LQFH 2BVEA 7FABH 2R29H 1HHGB 3F7VB 2BRRH 1BVKB 3MNVB 3VGHA 2XIDA 2W07A 3PJSB 4I48A 2D4FA 3OR6A 5DHYB 1MSPA 4OZGF 5KSBE 1XR8B 2V9TA 4ODWB 3L3GB 3RX5A 2IQ9H 4X9FA 4HS3B 4U6TA 4MNHB 1Z2KA 5E9DA 4AENB 1WV7T 2IPTL 4LCWE 3NIGF 2CRMA 3PQYE 4HK0A 3D0LB 2Y07H 3GBLA 1T03H 4JFYA 5FYLL 1WBZB 3V2AR 4OLZH 1G9ML 4LFHD 2VJXA 4H8WH 1EXUB 5EIIA 5CP3A 4YDLC 4FFVC 4RRPA 4KAQH 4X98B 3CCHA 5HSFA 1KIQA 3OKLB 2DM7A 2LQRA 3BGAA 4QGTA 1NFDA 1AKJB 1C12B 4EVNA 1KELH 5F3HA 5E4IA 1OM3L 3AGVA 3LN4A 2EDFA 3UO1H 1MH5B 5EU4A 4NQTA 3KPPA 4FZEH 4TSCH 3U4AA 3QO0A 5EBWB 3FO9A 3MJ9L 1KBGL 5JHDE 4YHIA 2VMFA 3MUZ1 4K7FB 3KPSD 2OLDA 3I75A 2CJUL 4OM0H 4Z7NE 2IAMD 5TPWL 4PGEB 4QNPF 1ZT1B 3SDAA 5I8EB 2FO1A 2A1WL 2EDLA 2VITA 3VH8A 3U9PL 1FFQA 2EDKA 1IKNC 1HI6A 3VXOB 1QSFB 5BZWB 2H26A 3WNPA 1MFDH 3CNKA 4HXAH 4MSWB 5T5FH 3VG0H 4GAJH 3BZFB 2AK4D 2UWEE 3VI4F 2WWMC 4OD3L 3REWA 1MFAH 1RI8A 4TVPD 4D3CH 1J05A 1XMWA 1OP5K 3LN9A 2J5LB 3MV11 5F3BB 2EDDA 1G7HB 5JOEA 4RIRB 2DI8A 2F53D 3CFEA 1J1PL 1J9CT 1OSZA 4G8GD 2DM2A 2BMKB 3TYGL 4PRHD 2D3VA 1MRCH 3BD5A 2R39A 1UM4H 5I73C 2XQBH 3IXAB 1A9BB 4M93B 3PP4L 5KVEL 2C7UA 2R1XB 4NUJB 2F54E 1HOCA 2P7TB 3CU1A 4DKDC 4X5LA 2BHYA 3RFZC 1CT8A 4LPTA 3C5ZB 4APQC 1NEZG 3MCG1 5TGBA 1OQXA 1FFPA 2Y5TB 1FIGH 4OCXH 2DBLL 3DYMA 2NY7H 2YSSA 4J8RA 3FB6B 4JO4L 3CC5B 5DHVA 4LQ1A 2Z31B 3DARA 1DQJB 1UCTA 3ZSTA 1QLEL 4R7DB 1OB1B 2FEEL 5C86A 1QYGL 1BQLH 2O5ZH 1I7TA 5E94A 3R8BB 1RUKH 2H2PD 4NHCL 5ISZA 1EGJL 5DEFB 3RGVD 2HJLB 4Y88A 1FNSH 2NW2A 3H0TB 1J0JA 5C3TA 1U8IB 1AQDB 4J7RA 1U9KA 5GQBA 3ZYOA 4HXBL 3MV8A 4PV8B 4R4NC 3MLTB 3WJLC 3DTXB 1J8HA 3BHBA 1VGEH 1JWSA 1FLRH 3O45A 3BX7C 1OY3B 3LD8C 5B39A 1MHPL 4W6YB 3ULVE 1BJMA 2WV3A 2W0KA 3UTSB 5DMJB 3JWDL 3GB7A 3INUL 1KIRB 4HWBL 5MENA 1J0YA 5IQ9B 4JDTH 5GS1B 3WCYA 3MV9B 3P0VH 1CE6A 4P2CG 3BE1H 3PUCA 3C6SA 1R6VA 1NMAL 2MMXA 3R06B 3EYFA 2YEZA 3FQRB 3RZWA 5BRZA 4WWKA 4HPYH 4R7NA 3ZT5A 1HXYB 2H41A 4JPKH 4YFLI 4CMHB 4CU8A 3H9SA 4HC1L 5ALBH 3KPSB 5JXEA 3L6FB 4OB5H 3VJ6A 2IAMB 3WFHA 1DEEB 1VADB 3NIDF 1XZ0A 4KI1A 4FQXC 2W65A 2WBJA 2OTPA 3RWGB 3RY5A 1X5GA 2R69H 4ISVA 4PJDA 3FO0L 2XWTB 2VH5H 4N1EA 3HB3D 1IGJA 1KCLA 4OT1H 1HSBA 3UJIH 1I8MA 4NM8L 3DURB 4H1LA 2NY4C 3HMXA 4RWYL 3PWLA 1N5AA 1AR2A 1SJHA 3RTQA 3CDFA 4Z7NF 3GHEL 4QHUB 2F53B 4I3RL 4G8GB 3D1MC 1IGTB 4PRHB 4Y5YC 3AS1A 1KN2L 3GRWH 3RWCB 5TDOB 3QEQA 2BNUB 4JZJA 5A40E 3GNML 4PJGA 1PVHA 2MCG1 1MHEB 3IGAA 2AK1L 3ARXA 1CFNB 1E4WL 4XWGL 3UJTH 1YEEH 4L4VD 3QEHB 1DBBH 1H5BA 1OGAE 3S6CA 3AS2A 2AEQH 1HEZA 1XIWA 3DX6A 3HUJB 2VC2L 1HWHB 3QUKA 2KZWA 5C6PB 1OPGH 1T21A 5BV7B 4CUCA 3FCTA 4PJIB 5ANME 5DQDL 4KHXH 5JDSA 3OGOE 4NDMA 3MLRH 2E9JA 4OFIA 3ZDZF 2E3VA 4BZYA 1A6TA 4PJAB 4IRSD 5HY9B 3WFEL 4AIOA 5IV2B 2Y5EA 4POUB 1BWMA 1HH6A 4KK8C 4P2YA 4JHAH 4LEOB 3RGVB 5SX4I 3ZLQC 1QFUL 5KSAB 1J5OL 4JPVH 1DDHB 2ENYA 4Z0BH 3KYAA 1BBDL 5TE7H 3LZFH 1JYWA 1SY6A 1N64L 1UGNA 2ZUWA 3FOMB 3QPXH 2CKNA 2PKDA 2UUDK 1XH3A 2EECA 1XF5B 3GKZA 4QGYA 2AS5M 2WNGA 3IRZA 2FIKB 2VIRB 3MRCB 4LSTL 4L8DA 4Y19A 3VFMB 4WFHD 3BKMH 1LDPL 3MXVH 2WINA 6FABH 1PKOA 4LVNB 1MFNA 4NKQB 2H45A 1QFOA 4IMLA 4XWOD 4E9LA 2JCCE 4X7CC 4FZ8L 2Q3AA 4XCYA 5T33H 1M7XA 4FFYH 3SO3C 3HRPA 4NQUA 2BNQE 4PG2C 4L9LB 4NM4H 4XNMB 1T6WA 4P2QA 4MJ2A 4WI7A 2C3VA 1URLA 2O26U 3E3QE 1Z3GL 2O93L 3VFPB 1S3KL 3NPSC 4ZUUA 5FO8A 2VE6A 3EDFA 3HCVB 1Q9OA 3VGBA 4Q9QL 5F9AC 5KVDL 3RNKB 4J4PA 5E8EB 2C1PA 2Z91A 5D6DC 2PW1B 4WY7H 5I17B 1HE7A 4WNQA 1M4KA 1KCRL 1JZ3A 5JW4Q 3ZL4H 1EH9A 4HKJB 3U0PB 5FV2A 5F71A 1KN4L 3UTZA 5IUSA 4FQCH 5JR1H 4MJIA 1DLFL 1JMXA 1NGWA 1C5DA 4MD5B 5L8LB 1MCJA 4KKNA 1JHTB 1VKXB 3KYMA 3WIIH 3TH3T 4FFWC 4OD1H 5EOTB 4RFOL 1CFVL 1OP5H 5BO1H 3V4UH 3CMOL 3FFDB 4L4VB 5MERB 2HTKD 4XT1C 4XRCA 2AXGA 3BUYA 5GISL 3IDXH 3KJ4B 4KVCL 1T89C 3UPAA 1P4BL 4L5FL 3B4NA 5I76B 1UEYA 2AJYL 5J3HD 3TBWA 5ID1A 1KTLA 2E6QA 4EOWH 1NJ9A 3EOYG 2DQGH 2FWOB 1KPRB 1A4KB 1JPSH 3SPVB 3HC0B 1XF3B 3DETC 3PWVB 5HD8C 2XA8H 5K93A 3UTPE 2GKIA 1EUTA 3L95B 2IFFL 5FK9A 2V2XA 1Q94B 3UJJH 5KJRL 4X4MA 1IAOB 3MRHA 4QWWC 2R8SH 4ZTOH 3SDCD 1W0YT 4O2FA 1CLZL 1F4HA 3WDHA 4PRPB 3MJ7A 2CGRL 1IC7L 5ID0B 1JVKA 5C7XH 1FVEA 5C0JB 1BIIB 4Y1AD 3GK8L 4Y4KA 3BDXA 4LLQA 3CUPB 5TQ2H 2J12B 3O2DH 3QRFM 1NH6A 4TOYL 4Z78B 5IHZA 1HHKB 5EOCH 4WGWB 1A6WH 1TQBC 4H20H 4HHAA 2W0PA 4TSAH 5BCAA 5EUOA 3DXAE 5EBLB 2LVEA 1NCCL 2YD8A 1UZ8B 4M5YH 4PG9B 2Q8AL 1KTDA 4FQLH 1I8KA 5L2KA 4NKDB 2A6JA 3FQTA 1G9NC 3GMPA 5IR1A 3TJHD 1RZJH 2OP4L 5JLZA 3QUMH 4PV9A 4XP4H 1H3WM 5FB8A 4AIZA 5D1QC 4TULL 2ZUQB 4Y5VB 1BVLB 2DAVA 2A6DB 5DRNA 3CFKB 3NABH 2QTEA 1A7OH 2ZCHL 4QHKI 2DJ4A 1EO5A 1JP5A 2VR9A 4OZGB 4U1LA 1UH3A 3GSVB 3QWOB 1AC0A 5C0RH 4Q6IA 3GO1L 3SOBH 1QACA 4M43L 4JY6B 4MWFA 2ARWA 4YX2H 2IALA 5F1OB 5FDWA 1YEIH 3B83A 3C2SA 3LN5B 2ZPKL 4NBZB 5HGBB 2ITCA 1FVDA 4MQSB 3K8LA 1AY1L 3SCMD 4OZFH 1XF4B 1UM5L 2OI9C 3HFML 3M1BB 5EN2A 1KG0B 5FKAB 4TUKH 4V3EB 1ES0A 2ZSWA 3VXPA 4ODUA 3FQXA 4OIBA 1HHHB 3F58L 3VGDA 2GJJA 5EFIB 4AG4L 1BQSA 1O7SA 1J86A 3RAJL 4LCWD 4FQ1H 4R3SA 3BSZL 3V6OE 4U1JB 5C0GA 5IB1B 2PTTB 5I66B 3MUJA 1EHXA 1AD0A 4JDVA 4PD4K 5B38B 3RL2A 5CJ5A 4OZIA 3PHOA 1I3VA 5I1DA 4XBPB 2DI9A 4F7EB 3TEUA 3JV0A 1CZ8H 4PB9L 4CMMA 1PG7H 5TDNB 4PJCE 2HWZL 4ONGL 1YQVH 3VFTA 2I9TB 3KDMA 4JN1L 3ILQD 3JVGC 1J7VR 5BS0D 3W39A 3U2SA 3O2VH 3PABA 3DPBA 1AGDA 1U91A 3MNZB 5C09E 1B9ZA 1AHWC 2VERN 4QRSB 1N2RA 2OM5A 5JW4R 5TH2A 4GXVH 5CUSL 5I0ZA 3SDCB 5JW5A 2R4RH 4Y2OA 3C5JA 4XNZB 1IQWL 4XCFL 1BVZA 4RCAA 2QADD 1T5WA 4YR6B 3ZTJH 4KTYA 1A6UH 5IBUB 1A3RH 1BOGA 2F58L 2FEDC 2FLRT 4MLIA 1U95B 4UUJA 1X5XA 5IHUL 4C59B 3MODH 5T1MA 3THML 3BH8A 5IHLB 1LEGB 2BOBA 5C0AA 4N9GB 1EVTC 5J1AA 1IAII 3WD5H 1G9NH 5FO7A 3A6BL 3MJ6A 2UUDH 4RMRA 4UNVA 1JNNH 3KPRA 5GRJL 3TIDB 1AD9B 5DUPL 5I30H 4YPGB 3T2NH 2HT2D 1NGQH 2W60A 4GRWF 5J8OA 3HE6D 5K9QG 4LF3B 2FBJH 2RAMA 3IVKA 5DJ0B 3U0TB 2F54D 2ICWA 2JLLA 3WDJA 4EDWL 2AEPL 1ZLUH 1LEIA 1VERA 1CD8A 4WEBH 2Z0BA 1L0XA 2DQUL 2V5MA 3KYOA 4ZFZA 3S96B 1AFVL 4WHDA 5CAYB 2R2BB 2KPNA 3S88H 1DQDL 1FSKB 1JCKA 4CKVX 1UB5A 1JNLH 2NXZD 2FCBA 4G8FA 3DIFA 3O6FA 3NZHL 2AVGA 1YNKH 5MEQA 3HC3L 1AGBA 1Q0YL 4QRQA 3ARFA 4PUBH 5IG7A 2EDQA 1FRGL 3SCMB 2VL5B 2XICA 5EU5B 2HKFH 2ICWI 4JFOA 3FAWA 4RFNC 3AY4A 4JAMB 3OF6D 4YC2C 1AE6L 5IVXA 2IANE 5DA0B 4IS6A 4OZFG 3BISA 4I0KA 4LCWB 4B50A 4ZSOA 1WBYA 4QRTA 5D7LA 4FXLA 1DUYB 1EMTH 4OAWB 2XTJD 3P4MB 3BRDA 5HDOA 3QIUB 3ULVD 2JELL 3O8XA 1SEBA 1TFHA 4CN6A 1CQYA 1JGEB 1NUNB 3MOAH 5CP3H 5DD1L 1U8QA 5B3JE 5BS0B 5CEYB 4OCYH 5HGDB 3RUGA 1JNHB 3AXLA 4ZPVA 2NXYD 4KHTH 1U2HA 5L2JB 1LK3H 4HUNB 5FGCE 4NRXB 2XG5A 2QR0B 4I9WE 4MJ6B 4GG8B 3VXTB 1KCSH 1Z9MA 4HCRA 3C60A 1FV1A 2NR6D 3CSPA 2D0GA 4U6VL 2A2QT 3QI9A 1NLBH 1BWWA 4JG1H 4OJFL 4LCUA 2NZIA 2EYSB 1U92B 4IJ3B 3OSKA 1E6OL 4PY8I 1R5VB 2Y6SD 4RAUA 2OXHA 3RKPA 3L3HA 4OV5A 3BD3A 4HIHA 3RBGA 3TT3L 3QHFH 4JM4L 5E99H 1BD2A 3MRMA 5DR5L 3RQ3A 5E2TH 4Y0GA 4JFEA 2UWEB 4JHZA 1Z0NA 2C1OB 1KENH 2QSCL 3QCUL 4OQTA 3VXSA 1K6QL 5IEHA 4D0DB 2EYRB 2DQTL 3HMWL 1BPVA 1EA9C 4PGBA 4XC1H 4JGUA 1D5MA 3RWEA 2ZUXA 4KKCD 5LBSH 4OCLC 4WUUD 2G5RA 4ZMAT 3P0GB 2MCPH 5JA9A 3E8UH 1DUZB 1F58H 3HE6B 2N56A 3LS5L 4DEPB 2ADIB 1BFTA 5E8OB 3CDYA 1OGAD 1C08B 2F54B 4PJHF 4LQFL 5CBEA 1NAMA 5I1IL 2BVUA 1RK1B 4JZJC 3WV0A 1TVHB 2BRRL 3DI3B 4Z7OE 4KGLA 4WI9A 1XF2B 2EIBA 4JFFE 3EZ8A 2WSKA 1H5BC 3HNVL 5DJYA 4UINL 3TH2T 4NOFA 2V2WA 4KXZH 4L3EE 4CVUA 2IQ9L 2OQJB 2PXYC 3NTCH 4RQQB 2QLVB 4YXLL 2R2EA 1FZMB 2VWEE 1PEZA 4KJWD 3OBAA 5DHVH 4ZXBA 2HMID 1T0PB 3Q5TA 1G7QB 1IM3B 3GMOA 4Z76A 1MLCB 1IE5A 1V3MA 3DX8A 2P47B 3UTTE 3MMEB 3BQUD 4H8WL 4HUUA 3HZKA 3QA3B 4ODBD 2P5WA 4CN4A 4XVJH 5CD3B 1RJLB 4N0YL 3WS3A 4LGRB 1KELL 2VDPH 3IFLH 2XTJB 2I25N 1U93A 4KJPC 3BW9B 3QNXA 1LK2A 2D03H 4UOW1 3S37X 3LB6D 4PBVC 1YPZF 4FZEL 1A7NL 4P2OC 2Y4SA 3ZYIA 1C5BL 3U30C 1B6UA 5KN5A 1H8SA 4N0CD 4X7SH 3KPLB 4Y7MA 3LKNB 1K3ZA 2NXYB 3VMPA 2ATKB 2AJ3B 3QCVH 3V6FA 1QFHA 2BNQD 5GS2D 3OMZA 1BAFH 2DWEB 4RRPG 5JW4M 1FORH 1MFDL 4XVUD 5T5FL 1RU9H 4OSUH 1S7WA 4G6KH 4J1UA 3VWJA 4BFGA 4X4XB 1YYLL 2BVTA 3IAPA 1A4JA 3OAUH 2VDKL 4D3CL 2AGJL 3MYJB 3GKWL 5CJXC 3AC0A 3LDBC 5EPMB 3HAEA 4Z7WF 3S35H 4TPRH 3SGDI 5E2VH 5J11B 4NKOB 1QFWI 4U1NA 4ZNEA 1X5YA 1BF8A 4EI5C 1MJ8L 4YHML 1UM4L 4LSVH 4H25A 1F3JB 1JNJA 3MLZH 1BBJA 4XNQA 4Q2ZA 4JFZH 4H1LH 3HMXH 4LVHC 4ZFFA 3VH8G 4J4PC 2NZ9D 5CHNA 2MOVA 3UBXB 4M00A 2XN9A 1CXKA 5HVGB 3UTQA 4WUUB 3MFFA 2EZ0C 4PP2A 1NUFA 4YAQA 3BIAX 3VE0A 1C7TA 3N1QC 1PW3A 3HI6H 2ZCKH 1OGAB 3HN3A 5I2IA 3OXRB 4KRMB 4JQVA 5FKPB 1B0WA 4QTIL 3LH2H 4PBWD 4L8BB 4EBQH 2XPGB 1IEBA 3WNNA 4NO5B 4MXVF 2VLJE 5ANMB 2Q20A 1ZA3A 2KZ1B 5HPOA 2X05A 1XGTB 4OGYH 1BP3B 3SBWA 3VRIB 1U0QA 1WCBB 2ADJB 2JB5H 4HGWB 4YLQT 2D7QA 4NQCD 4PJ8A 1JYXA 4G8IB 2CKBA 1V3JA 1XGUA 1QBAA 1AO7D 4ERSH 3QG7H 2QQQA 3V0WL 2BSTA 3QDJA 4UB0H 3BQUB 3NOIA 2PO6D 2IH3A 4KJQC 1WAAE 3WUWA 3MV8E 1I7UB 3CU7A 3LEYH 4P4KA 1F4WL 4JDTL 4O00A 4P46D 1U8HA 1SY6H 1MWAL 1OTSD 2GY5A 4UDUB 3ILPB 2YKLL 3P0VL 4I2XB 3AREC 4ZYKB 2FGWL 1RK0A 1BM3H 1RQ5A 2XKSA 2WK2A 3MCLH 2Q3ZA 4IM8A 1YEJH 1MWAB 3N9GL 5EC2B 1F02I 1Y6NR 4O4YH 4MQXD 2Q86B 3U36B 5EBMA 4MXQD 3PWUA 3DUSB 3MR9A 3G5ZB 4WW2F 1VB9A 4WENB 1K5NA 5JW3H 2FATH 3D3VA 4PDCE 3Q6GH 1EEZB 4KK6D 2OL3B 3MUGA 3LOWA 1AI1L 2BNQB 4DVBB 3VXRA 3P40A 4OCWL 4ONOA 4KTDH 5FYKU 4FXGA 3UJIL 4UQ3A 3Q6FA 1HHIB 3GJFA 4OGAD 4HUVB 5EZJA 5DUML 4XNUH 3EFDL 3QPQD 2GJ6E 3UTOA 5A3ID 1SYSA 5HVFB 4YHLH 1E0OB 4AH2B 4IDLA 4HUXB 3VXQB 1U8JB 1JTOA 3WE6B 4DUWA 2YN3A 1KJ2A 3HS0B 4OLXH 3VFGH 3GRWL 3DVGA 3DRTA 2X4RA 2XWJB 1DANT 1DVFD 1PLGH 5E2WL 4FQJH 1DBBL 4MAYD 1OAYH 1S9XB 2Z9TA 2JB6A 4TNVK 1NCWH 4ZFGH 1F00I 3QEQE 3EYOB 4HEPG 2BFVH 2KH2B 4KI5C 3DBXB 1FBIL 3BXNB 3JV5A 5D1ZD 3WKNA 4JPWL 1FAKT 4H1LG 1CICA 4KHXL 1I9JH 3CX5J 4QHNA 3GIZL 3QIBB 1N6UA 2VUOA 3QHZH 2AI0L 1FNLA 2ED9A 1NBZB 3B9EA 4TTGA 1NL0H 1P7KB 1FNEB 4GRLD 1UQSA 5I1LA 5C08A 2EYTA 1FG2B 5GHWH 5FM8A 3PNWA 1HQ4A 2AJZA 3FHAA 3RL1B 2Z35A 5HHOE 4EJ1C 4JHAL 4RGND 4ELMF 1YA5A 1QSED 5CSZB 4Y4HD 1K4DB 5C09D 3B9KA 4LIQH 4W81A 5TE7L 4MA7L 3CSYA 4NQCB 5FYJU 3IF1A 3LKOA 5DJ6A 1ZHKA 3O81A 2W9EH 3V52H 3VWKD 2MTPA 1AO7B 2C5DC 4ZUTB 5F7FA 3BDBA 4F58H 4G80A 4YIQB 2Q6WB 2HT3C 3L7FB 1MI5A 3FQUA 2ADFH 4YHYC 3AB0C 6FABL 1GZPA 4GRWB 4OUUA 4P46B 5T33L 2QSVA 3SQOL 5I16A 5JPMB 4Y19E 2X89A 4ZFOL 5IMKA 3G5VB 2VLME 1B90A 2VZ3A 2EXWC 3BN9D 4MQ7B 4NM4L 5ACMA 1FC2D 4AL8H 5DFVD 3G6JA 3JV4B 2E27H 2QHLA 3LQMA 5TF1L 1M05A 32C2B 1JHLH 4LASH 1T0NA 2ESVA 3HZMB 1HILB 4KQ3H 1T04A 3X13A 4M8QB 4P2QE 5FUOL 1FYTE 2AV7A 5E5MA 2YK1H 4TUOA 4WU7B 5K9OA 2VDOH 1YY9C 2BP3A 4WY7L 1CDHA 1GYAA 2IC2A 1ZS8B 2MQCA 1BFOA 4UILH 5CZKA 5DC0A 4MB3A 4HKZB 1VEOA 1ZT7A 2XFXA 2VQ1A 2LTQC 1MQKH 1T0MB 1X5JA 3O11B 3D85A 4OD1L 2J3SA 5BZDB 1DVFB 2LVCA 5BO1L 3IXTA 1D5ZA 1YDPB 2ZP0T 3WIHA 3B6SB 5JO5A 1A5FH 4KDWA 3LEVH 4ALAH 5GJTH 3O6FC 1LE9A 1RJYA 5C2BH 2GJZA 2C4XA 4I8DA 4LHUD 5DGRA 4M7LL 1VFOA 5E2UH 1CE1H 5E6YA 1JHKH 2DD8H 1FLTX 3AMKA 1W72A 1S9VB 5D1ZB 1UVQA 2CSPA 2DQGL 1I1FA 2CIIB 5HHVL 3EBAA 5EO1A 1U36A 2AV1B 2FD6H 5DD0H 3MRDB 4PTTB 4ZO9A 1I3RA 3SGJC 4XNXL 4Z9KB 3WHE0 2XA8L 3U7YH 5IQ7H 5HDQL 3PXJA 4ZUWA 2G9HB 4MJ4A 5D72H 4HF5H 1IJ9A 3BKJH 4FQQB 3UJJL 1MCLA 4HS8L 3GMLA 4LSSH 1OL0A 2PUQT 1QR1B 4U6HB 2DM3A 4DTGH 5C0CA 2O5YL 1X9QA 5JDJA 4LSRH 2B39A 3T0EA 1E28B 1LO3L 4PGCB 1LP9A 5C7XL 1QSEB 1JL8A 5A2FA 3VFNA 3NCEB 2O5XH 3GSNA 1BGXH 5C09B 1T2XA 2ICCA 5JQHC 5TQ2L 3IFNH 3LVEA 4KY1H 5GZOC 4I9WD 3VWKB 3NGBC 4UT9L 4TSAL 3QCTL 1Q1JH 2YUVA 5AZ2H 1KYOJ 3MGAA 4NWTH 1B2WH 2E6PA 3CGTA 3X3GL 2P42B 4FFZL 2A0LD 4TNWF 5J12C 3LSOA 1CCZA 3KXFA 3G6DL 2J7LA 3C60C 2XZCH 3EOTH 1TCMA 2NY3C 1QLFA 4U1GB 5GIRB 4P23A 3QI9C 5ADPL 3RWJA 1RZJL 1W8OA 5FM5O 1TJIH 4EXPX 1NMCC 3HNSH 3M17B 3QUML 5DVKA 3LQZA 3W11C 1HH9A 3GSRA 4U1HA 4Z7VF 1EHNA 4PJHB 3MREB 3CVHA 3QNYB 3TA3B 1J8KA 1N26A 1E4XH 2X4OB 5KSVB 3PDGA 4B53A 3FT4B 4DN4H 1FJ1A 5DJXA 1T20B 2FJHA 2GFBA 5ACZB 1LDSA 3QUXA 1OAKH 1AP2B 1F11A 2OTUA 4M8VA 3QAZC 5CGYD 3SOBL 2UZXB 2WY3A 2Q87A 3IDYC 1XGRB 1YEIL 2BCKB 1Y18B 2FNBA 3B8SA 3EGSB 4L1DA 5GGSA 2IMMA 2PYEA 4TRPL 4X6FA 3VA6A 4XXCA 4BUHA 1XGPB 4YK4B 4N90E 4XCCL 2XKNB 3IRPX 2YD9A 1REIA 4PJ7A 4NQDD 2HTLD 1F90L 3VXUA 5D9SA 1GGIH 2YPKB 4X9HA 1TJGH 4FQ1L 1NGXB 4XI5D 3DRQB 5HI4D 3RDTC 2X42A 4KRPC 4XXDA 2DLFH 4LKCB 3L1OH 3UTTD 1YPZB 1J1OL 1JMZA 2EE9A 3JV6B 1NSNH 3F7VA 1HHGA 4ZXBC 1KCUL 3HE7A 1PX3A 4LHUB 1UXWB 2I9LB 1BVKA 3MRQB 3ECBB 3PJSA 3NCCB 3BO8B 4MZ3A 1P4LB 4LSUL 1HNGA 1XR8A 3O2VL 4ODWA 3L3GA 4IMKC 1WTLA 4WV1B 4HS3A 3B3IB 5E6ZA 5CLTA 3D39E 4MNHA 4AENA 3E6HB 4HBQA 4XPAL 25C8H 1ORSB 2R4RL 3D0LA 2MWCA 1UCBH 2NY1D 4ZUVB 4H0IA 1WBZA 1I85A 4LLWB 2GEEA 3B9DA 4BELD 2DKSA 1EXUA 5CJQL 4E5XB 3U83A 4NZTL 2MNUA 2CLRB 4O2EB 5FGBC 4X98A 5DJZB 3OKLA 3UZEA 5FGCB 5KS9E 3SE8H 3GJFK 5EZIH 1WWCA 2IPUK 1BHGA 4PJ9D 2FIRT 4QKXB 4HCRH 2XACC 1RIUH 2RIKA 3RHWK 3PGFH 3P3YA 4XP5L 4MS8D 3B5HA 2YC1B 1CGTA 3BWAA 3OKKB 5EBWA 1LILA 2BJMH 1VFUA 3KS0J 4XBGA 4I0PD 3C6LD 1FYHB 3EOBB 3TBVB 4XMPH 5I30L 3T2NL 4K7FA 2WIIB 3S5LA 2EE3A 5EU7E 1NGQL 1JPTL 1DN0B 1G7JB 5HHXH 1PSKL 3ARSA 2EC8A 1ZT1A 4PGEA 3MJ9A 3EO0A 1MJUL 1MHHB 1IGML 2G75B 4QOKD 1RHFA 2CPCA 3VXOA 1QSFA 3MJ8B 4X4ZA 5BZWA 4OQTH 1A2YB 2RR3A 3MRGA 2H2SD 1N7ML 4MSWA 5SWSA 4NNXB 5F21B 4B41A 1K85A 4MVBD 1P4IH 1ZXQA 2CIKA 5F3BA 1G7HA 4DGYH 4RIRA 1JNLL 1JUFB 4KRNA 4MA1C 1P84K 2APWA 3DHJA 3WSQH 5IB3A 1A7QH 4PRBA 5ADOH 3TBYB 1NAMH 5D70L 4OUOA 3IXAA 1A9BA 3PWJB 4N0UA 4JFFB 3QBTB 1JZ6A 2R1XA 1EFXD 2AABL 4NUJA 1IVLA 4P2RD 5GJSL 5KBNC 3UPRB 2P7TA 4XCNB 5IVOA 2A6IA 3QWQB 2WLYA 4F2MA 3QEGH 4JQVC 4L3EB 4TTDC 1M7DB 2CLZB 4NQDB 4UOJA 3C5ZA 1N8ZB 3RKDC 1VPOL 2YD1A 2Y5TA 1MFBH 1QLRB 3VG9C 5FYKH 2VDLH 4HFWB 3VI3E 3FB6A 3CC5A 3O0RH 4OLUH 1L4IA 2X1WL 3CDGB 3UXFA 2Z31A 5IVXE 3E1F1 3UTTB 1DQJA 5HHNB 5T3XH 3IJSB 3S37L 4PJ8C 4R7DA 5AG8A 3T65B 4YHZL 4CGTA 1WEJH 2LV4A 3MOAL 1U8PB 1UG9A 3MYZA 1FGVL 4OCYL 4DOHE 4M5ZH 5DEFA 2YRPA 2HJLA 3N1PC 5CWSB 5F7DB 4KHTL 1U8IA 4YXKL 1AQDA 3B2VH 1OTTC 4AEHH 1KCSL 4PV8A 3MLTA 4ZTPH 3DTXA 2NYYC 2D2OA 3S36H 2GTWB 2HT4D 4AZ8A 1NLBL 4BA8A 5I1HL 5JZ7C 3SGDH 2DMCA 5F7KC 1LMKA 4LRNL 1IKFL 3UTSA 3DROB 1FCCA 4PJFF 3W9DB 3WEXB 4TYUA 3ULUH 1KIRA 3V4PH 3QHFL 5E99L 1ZLSH 5IQ9A 5J6GB 4X80L 5GS1A 3BEVA 3TZVB 4UAOC 5E2TL 3MV9A 3K7UA 4PJ9B 3NN8B 2NNAB 4HWBA 2PN5A 3R06A 4KUZH 3A6CH 1ORQB 3CXHK 3FQRA 3KYNB 2WP3O 1HXYA 4XC1L 2IBBA 5D7IE 1BD2E 3RZCC 1KCVL 1X4ZA 4I0PB 3KPSA 5H8DA 3HAEH 4KPHH 3W0WE 3L6FA 4JHWL 4OZHE 4EUPB 5HI5C 1F58L 1P7HL 3LY6A 4YHKL 4POZD 2IAMA 1DEEA 1VADA 4HC1A 4M9PA 2WQRA 4QOKB 4GAFB 3RWGA 4RBPH 3RY4A 1MVFA 5EBGA 1N3NB 2XWTA 2CQVA 5DEGB 4YHNB 2PR4H 3DURA 1ITCA 2E8YA 5F7MC 2D7MA 5IFAH 1RULH 3MV7A 4ELMB 2B2XH 4LLYB 4K23L 3WS6A 4QHUA 3ESVF 4BYHA 5CBAB 1IGTA 5EU6E 4PRHA 4NC1E 3RWCA 1UWGH 5TDOA 3ZKNC 4C58B 2BNUA 5GS0C 5F7HA 5H35B 1MHEA 4PLKD 3JWOC 1CICC 4M4PA 1QRKA 1UWEH 3PWPD 3QEHA 2PCPB 1EFXB 4JKPH 4P2RB 2VLJB 3O6LH 1YMHB 4M7KH 4NN7B 3HUJA 3IT8D 15C8H 1IAMA 4G3YH 5I8CB 1S9KC 4XVJL 4F9LA 4Y4FD 4PJIA 5IGXH 3E2HB 1RJCA 3NFSL 3RVXC 2LFGA 4GUPB 4HDIA 2CKBH 1DE4B 2H32B 2DIJA 2P5WE 5B4MD 3B9KC 1GGBH 4PJAA 3MRFB 5HY9A 2F9BT 5IV2A 3WFZA 4EXKA 4GW5A 2EH7H 4R90L 3V6BR 1D3CA 1RJZA 3T04D 4WJ5B 4M6MH 5IMOB 1PZ5B 4LEOA 1D7FA 3RGVA 4PB0L 3T3PE 2R4SH 2FSEB 5KSAA 4U6YB 1DDHA 5DJCB 3DWTA 3DMMD 1LWRA 4P5TD 1U8NB 3VFOB 4PJ5D 2IGFH 12E8L 3FOMA 1NGPH 2VTFA 1RU9L 4G6KL 3S36X 3KLAB 2XZZA 3ULUE 4JANB 2FIKA 2VIRA 3MRCA 3OAUL 1JGUL 5FA3B 4M7JH 4R8WH 2F8VA 3VFMA 2BVPB 5T5NG 3CK0L 4RDQG 2YXMA 5L9DH 5AAWA 4LGPB 4X6DF 3QB7C 3KHOA 3QUYD 1FYTD 5CD5C 4C55A 3NZ8B 3AROA 3BMWA 1MLBB 2D7TL 2EDRA 1KB9J 2A73B 5KVGH 1JPGA 4W70A 3GJFH 4L9LA 2GJ6B 3NAAL 4XNMA 4ZDHB 2HFGL 2BVQB 4K7PH 1IT9H 2OBGA 4NT6B 1KB5B 1TZHB 1EERB 1FL5A 5T1LD 1KJ2H 3VFPA 4NCC2 1NC2D 1YC8A 3HCVA 2ZCKL 1QZ1A 2XN9E 3QDMD 4HWZB 3V5HB 3RNKA 3HAEG 1SYVA 5E8EA 2E7LE 4ZUSB 4JR9H 3WO4B 2BK8A 2PW1A 5T1KA 2ID5A 1MFCH 3SGEI 5I17A 1TXKA 4Z77B 2BDNH 2OMBA 4JM2B 3T4YB 3NA9L 1R0AH 4HKJA 4K3JH 4OZHF 5CIPH 3U0PA 2WBKA 1BZ7B 5D2LF 5CCKL 2HJFA 4MNGE 1JTTA 3BGMB 2YXFA 2F5AL 3NIFF 1LE5B 4MD5A 2AJXL 4HPOH 1JHTA 4IDJL 5EOTA 1AGEA 2VZ1A 4GKSB 1F4XH 3FFDA 5D2NE 4L4VA 5MERA 3PWPB 3OZ9H 1HN1A 4ERSL 2HA1A 3BUTA 5HHOB 1JGLL 4F8TA 1WZ1L 3PHQB 1AR1D 1OAQH 3O6KL 5I76A 3H3PL 1OP3K 1G7MA 3MZTA 4Z18A 3RWIB 5IWLC 3LEYL 4Y4FB 2FWOA 3GUTB 1DR9A 1RZFL 1A4KA 3OB8A 3SPVA 5IW6B 3T1FB 3HC0A 2KKQA 5D1XD 4Z7VB 3HNTL 1BM3L 3MRJB 3OB0K 1KT2B 3MCLL 1I1AD 1WCQA 1Q94A 5DMKA 5HHME 1EBAA 4KKAD 1U8KA 2EDYA 2DQJH 4DGIH 1TCRB 4PRPA 3ARBA 3AFLA 4OF7A 2FATL 5ID0A 3BVNA 4UV4H 2AP2A 2HRPH 3Q6GL 3LKSB 3OKOB 1BIIA 1ZVHA 3T4AB 1YECL 3CUPA 3DMMB 4Y5XB 3C2AH 3BT2L 4P23C 4PJ5B 4Z78A 5F9JB 4JE4B 4LSDA 1HHKA 4M7ZB 1D9KC 5EBLA 3RWHB 4RGMB 3P73A 3VFVB 4L8CB 1OAXL 1GHFL 1UZ8A 1VEPA 4XNUL 4PG9A 5CEZE 3RVTC 4XH2B 5SV4A 4YHLL 5DYOB 4NKDA 4R0LB 2WUCH 3CJJA 3QHTC 1FYTB 3VFGL 1MOEA 3QUXC 3O4LA 2XTLA 2UVFA 4WFFE 3FT2B 1IFHH 5F44A 2WAHA 1S8DA 4Y5VA 3U7WL 3CFKA 3V8OA 2XY2A 4WHTB 3EHBD 1NCWL 4U7MA 1SMOA 4ZFGL 2X1OA 5M94B 2EXYD 1X7QA 1KJ3H 2BFVL 2OR9H 3O2WL 5ICYB 1ZSDB 2XI9A 3K8MA 1GVIA 4ACPA 4YUEH 4XXCC 5T1LB 3GSVA 4G6FD 3QWOA 3V7AE 1NC2B 1ACYH 3IDMB 4XMKH 2BOCB 2FO4B 1XFPA 5J1TC 3QO1A 2UYLB 1CYGA 4JY6A 4KV5E 3OQ3B 3QHZL 4FG6D 3U46B 4D9QE 3LN5A 3S8WA 3BPLC 3OGCB 1RV6X 1JFMA 4HMDA 1XF4A 3M1BA 1KG0A 5FKAA 5CEXB 1UA6H 1UADC 2MQ3A 1W72H 4NQXB 4IIQB 3V7AG 1HHHA 4XPGH 3HE7C 4QT5B 5EFIA 4L4JA 4QHLB 3MBED 5C08E 1FNHA 1TPXC 5HPMB 4KFZC 2FJFB 4OI8A 3V52L 4BFBD 3FRUB 4JKLA 5IB1A 1I1YB 5I66A 1J0HA 2Y25A 3BP6B 5CJOH 3SO5A 2M8XA 5B38A 3MRPB 2AXFA 1J12A 4XBPA 4JEGB 3D0VB 4YWGH 4LKXB 4WI5A 2ADFL 4HK3N 5TDNA 3QIWC 3TN0A 5LAXB 4XNYL 1MF2L 5IIEB 5FHAL 2I9TA 4F57L 3GSNH 1I85C 3GGWB 5HVHC 4G7VL 3FQNB 2CH8A 1KNOB 5E0QA 4KTEH 1CXFA 4WGVB 1MY5A 4HX1A 5D1XB 4IHOB 3OTTA 3MNZA 2EKSB 3OWEA 1XGQB 3DV4B 4QRSA 2AJVL 1I1AB 1G9MC 1WZMA 4AL8L 3BPNC 2EEBA 3S98A 3SDCA 1SJXA 2PTVA 1IM9D 5IROA 1HQRB 4M1DL 3B8YA 4QCIB 3RVWC 4YR6A 4GXUN 4NKIL 4JY5L 1CDCA 4FFVD 2YOCA 4YDIL 2L7UA 1ZEAH 2YD2A 1U95A 1Q0XL 3G6JE 1RZGB 1R24B 5ECJE 2YK1L 4N5EC 4NJ9H 2VDOL 3CVHH 1LEGA 1MY7A 4N1CA 4Q9CA 4N9GA 5HYJA 4UILL 3HC4L 5I75B 1IZKA 4G9DB 3EDDA 1F6AB 1C1EH 3FFCE 4TQEH 3H9YA 4JZOB 2RFXB 4G6AC 1AD9A 4N0FB 4MA3B 4YPGA 1MRFL 1TVBB 5F88B 2YZ8A 3QSKB 4X6CF 4OLYL 1LVEA 4LF3A 1UZ6F 5JUEH 3QQ4B 3KYKL 2P49B 1I9IL 5DJ0A 3LEVL 3U0TA 5L7XH 4MNQE 1NCAL 2QHRH 2B1AH 5C2BL 4PJXE 2WWMD 2VKWA 4HKXB 2DD8L 3S96A 2A83B 1GOGA 4KQ4H 2R2BA 4G6FB 1FZJB 5ITFB 3UEZA 5DD0L 1T66C 5AAMA 1WISA 1KLUB 3BKJL 1CFQB 2CO6B 4P99A 1A8JH 4PY8J 4OLVH 5IMLB 1QD0A 4U1SB 1AIFB 2A6KB 3SCMA 2VL5A 5FOJA 9CGTA 2D31B 5KSBA 4APQD 4JAMA 1KF9B 2HVKB 1ZLWH 1CDGA 2O5XL 4PJFB 1B88A 1BGXL 3MBEB 4I5BB 5F1SA 1TIUA 2NW3B 3QQ3B 4LCWA 1JN6B 3WJJA 3PQYA 1OGTA 2IFGA 4C57C 1IAIL 3T0EE 1Q1JL 4OAWA 3TIEB 4PJBE 1LP9E 1B2WL 3IFPB 3QUZC 1I1RA 3P4MA 4YHPB 1NFIB 1A02N 2IPTH 3QIUA 2XZCL 1JGEA 4C56D 1S5HB 4BQCA 1RHHB 5KS9B 3OHXA 5FYLH 5BS0A 1SEQL 5CEYA 5HGDA 1JNHA 3AAZB 5BW7C 3KXFE 3D5OF 2BY1A 43CAB 4EN3C 3QFJE 5L2JA 4NRXA 4R4ND 2YN5A 2QR0A 4MJ6A 4GG8A 1EEQA 1EVUA 1NBVL 1Z5LB 4LCYB 1IM9B 1YEHL 4DN4L 4LRIA 2VAAB 3EYSL 4UU9B 3MA7B 3JWDC 1OAKL 4YDLB 1J0KA 5TE4L 5EWIL 5JIPA 5DD6B 2EYSA 3WLBB 1U92A 3NCJL 4CMHC 3KPQB 4QRPE 1R5VA 3QULB 5EORH 3HI1B 4DKAA 3MJ9H 3DVFA 4M1CD 4MAUH 2HN7A 4MMXC 2CJUH 1LO0L 5C6WH 4HZAA 4EKXA 4NO0D 5TPWH 3VFRB 2UWEA 2C1OA 2FYYA 1S7VA 4GW1B 1ZANL 4D0DA 2EYRA 4GO6B 5HGHB 3FO1B 1NEZA 1SJEA 1CGSH 2DJSA 4CL7A 5ESVA 4HT1L 3R0NA 2ZUSA 4OI9A 5IT2L 5FFLA 1CG9A 1TJGL 4FQXD 4U1KB 4OD3H 4BH8B 1DUZA 1F3DH 1A3LL 4KK5C 5E8OA 4NBXB 2EDWA 4EDXB 1EEUA 4LCCC 1J1PH 1NFDF 1C08A 2F54A 3TNMB 3NACH 4PJ7E 1NSNL 5FOBB 1RK1A 2IPKB 5HJ3B 4RMWA 4NZDA 2NY4D 1TVHA 3EDKA 1DP0A 3VRJB 5CINH 1AGCA 1FL3A 1ZLVK 3BJ91 5IFJB 2NTFA 2YRLA 3PP4H 4P9ML 3WHXB 3MNWB 2OQJA 4JDZB 5C07E 4RQQA 5EZLB 5C0EB 5I73B 1FZMA 5AZEH 1DFBH 3V5DB 3ROOB 4PLNC 1G7QA 2XNAB 1IM3A 3G6AB 1SBBA 2XZQL 4R96A 4I13B 4U3CA 4QY8A 3SJVE 3FN0H 1MLCA 4L29B 4JO4H 3JTTB 5E00B 1P69B 2IH1B 2CDGB 4APQB 4XB7A 3QA3A 1PZUB 4ELKB 1QLEH 4X6DB 4HIEB 4P49A 1W8NA 5CD3A 1QYGH 2P5ED 1CU4L 1CK0H 3SE8L 2DQHL 5EZIL 3V4VL 3Q5OA 4NHCH 5K33A 5J57B 1S7TB 4HCRL 5KSAC 3BW9A 1RIUL 4JQXA 3WN5C 4JFQB 2OSLA 5ESAB 1LO5A 4KK8D 5ERWB 1FQ9C 4C56B 4NO3B 3LQAH 1CF8L 4QO1A 4KMQA 3DYOA 4GS7B 2OJEB 3KPLA 5HHXL 2IEPA 1MHPH 3LKNA 1S7UA 4P3DB 4PJBF 4P9HH 4DVRH 3B2UC 2ATKA 1CLOL 2AJ3A 2I07B 4Z7UE 3RIFF 3JWDH 2DWEA 2FX8L 3INUH 4QYOA 4OQTL 2DLTA 5CKAA 4HWBH 3ZKMC 5AUMB 4L4TD 2HH0L 2VXQL 3W0WB 1X3DA 2VNCA 2W1NA 4OZHB 1OW0A 3CX2A 1NMAH 5D2LB 5CZVL 3MYJA 3CH1B 3MRBB 4DGYL 3PV7A 3RWFB 4KMTL 4LDEB 5CGMA 4HC1H 5KOVC 4PYGA 4JFPA 1A7QL 1IZJA 3GMNB 3QJHB 1S9YA 2DOCA 1NAML 3DJ9A 5MEPB 2IQAB 4AMKL 2AXHA 5IEKB 4PY7B 4QEGA 1INDL 1N0LA 3FO0H 1DBAH 2DQIH 5IVZB 3UBXA 2R56L 1BECA 3EYVB 4YGAB 3CZFB 4UQ2A 3N1FC 4NM8H 3GIVA 4MX7B 3VDCA 4FQXB 3BN3B 2ED8A 4RWYH 4NP4H 4X4YB 4KWUA 2AERT 3DLQR 4YZFF 4OLUL 3BRFA 1OGAA 2FHBA 1DZBA 3OXRA 4K3HA 3RI5F 5FKPA 2NY4B 5LGKA 4ONFH 4U3XA 3GNMH 1VCAA 4L8BA 3GM8A 1JFQL 2AK1H 2XPGA 4XWGH 4CADB 4JY4A 1DSFL 3UC0L 1OWWA 1WC7B 4WEUD 5F1NB 5ANMA 2DIBA 4Y5YB 1XGTA 4OBSA 4GMSL 2B5IC 4WRLA 4FFWD 1WCBA 2ADJA 2VC2H 5MI0C 1VFAB 4HGWA 2X4NB 2MKWA 4QTHB 2NY5L 1TTGA 4UV7L 3B2VL 4G8IA 4HZLB 5JMRA 5HHMD 5DQDH 4V3DB 1ZA6B 1NUGA 4ZTPL 3E6FB 5JMOC 4PJDF 3S36L 3MTRA 3BQUA 3KPNB 5D8JL 1QFWL 5J6HB 3CFDB 1CFTB 4LLDB 3WFEH 3VU2A 2XXCB 2A74A 4WFED 2P5EB 1I7UA 3NVQA 3ULUL 4X5WB 3SKMA 3ARBC 2VLRD 5I15H 4MHHI 4WI2A 4UDUA 3ILPA 4I2XA 3DX7B 4ZYKA 1PQZB 1QFUH 4QWWD 4PJGF 1J5OH 3GMRB 4CW1B 5GZNC 5J13C 1MWAA 3OJDB 1N64H 5EC2A 3U36A 4UIKL 2D0FA 1HK6A 4XVSL 3K4DA 3DUSA 4N0CA 4ZO8A 3G5ZA 2JCCA 2R1WB 4L3AA 3C8DA 4LSTH 5K9KB 5C70A 1PYWB 1EEZA 4LFHG 2V7HB 2OL3A 3SGEH 2BNQA 4DVBA 1LDPH 5E7FA 1KCGC 1BJ8A 3I6KB 3DUHA 4PRID 4FZ8H 2PR4L 3AVEA 2N7BA 4N0RA 2NMSA 4AY0A 4HUVA 4HG4J 2ZUQC 3E3QA 2YPVH 5TQ0L 4XMLL 5IBTH 3H2WA 3ZKSD 5A16B 3VGGA 4AH2A 4HUXA