4NQXA

Crystal structure of hla a*0101 in complex with np44-s7n, an 9-mer influenza epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 274
sequence length 274
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqxA01
1FV1A 4M6ML 4YAQA 4RCAA 4ZPTA 1T83C 1QKZL 3T2NH 1FFRA 2EO1A 2W9EL 1A2YB 3WNPA 3RPKA 4JKWA 4A6YA 1WIPA 2XZQL 4W4OC 1CT8B 3CSGA 4MB3A 5JHDD 3IGAB 3HAEG 4XNQB 4WIQA 5CINL 3BKYL 4MSWB 3SQBA 4JEGB 1EXUB 4FABH 2C3XA 3O2DA 3DX7B 1NC4A 4ZNCD 3QISA 1BREA 1GC1C 3FO9A 2XA8L 4Q9CA 3GSWB 4WO4A 1MCSA 1GOHA 1C12B 2CR6A 1A9EB 4Y19D 5CHNB 1HXYB 5D2NE 1FH5L 3QUKB 4YBQD 1DEEA 5GGSB 3VXMD 2PETA 4F57L 3P4LA 4YHZL 1YC7A 5T1KA 4ZFGL 2K7QA 3NPZB 4GAGL 3DGCR 1I3VA 3FT4A 3P0VH 4BFBD 4MMZC 1XF1A 3WIFA 1BEYL 2RCSL 3H7BA 3I2CH 3ULVF 3F6LA 4YDIH 2R1YA 4AEFA 5I8KH 1RAMA 4HJGB 4LCIH 1OOAA 2AJSL 2X4UB 1YQ2A 2EDBA 5JO5B 1NL0H 2JIXB 1A14H 3KR3L 2F53D 2BJML 1A1OA 1AGFA 1A7NL 4PRBB 2VISB 4GSDH 5FFLA 5F6IB 4OGZA 4P3DA 5C0BD 4CMMB 4KVCL 3ABZA 2RIKA 3GIZL 4Z7WE 4F7PA 1YY8B 4Z0XB 2WWKT 2KZWA 1Z6JT 2H41A 2P5WD 1XGTB 3UYRL 3Q6FA 1GGBH 3FO2B 1F4YL 2CLZB 2NQCA 2F8XC 5F1IA 1CDGA 4OZIF 3U7WL 3H6JA 5F9JB 3MNWA 2PYEA 5BJTA 3MOQA 4AQOA 3T2QA 4PBWD 4WHYH 4IJ3B 3TBYA 4H25B 3O3BB 4PREB 3V4PL 5BRZB 3EO1A 2OL3L 5I1LB 2DQUL 4XVSL 3TO4B 4NQXA 3C6SA 3VFGH 3WXWH 5KN5A 3VGHA 3HC4H 2D7PA 3DV6A 2H3NB 2XPGB 4ALAH 3SGJC 4DVRH 5EU4A 4N1CA 4P49A 3J7HA 1GGIL 4YXHH 4FQXA 1VEOA 5CIPH 2OZ4L 5H94A 2DDQH 3GSQA 4H26B 4Y16B 5ALBH 1NC2A 3HE7C 4XI5D 4YNYA 3IJHB 5JPMB 1T6VN 3Q5TA 4PRPD 3SKJL 2BNQE 1LEGB 4M03A 1T83A 2VC2H 5EU6A 3U9PL 4W4OA 3MGTB 3U2SA 3ULSB 3GIVB 3ZO0A 2FR4A 3G5YA 4M4RA 4KGLA 3UZVB 2I5YL 1PEWA 5I71C 2BOCB 2HT3D 3CVHL 1U93A 4NCDA 1YN7B 1IEBB 4ZFOA 4XXCC 2VRAA 3RWFB 2Y6SD 4HBQA 1VFAA 4HJJL 3SCMD 1CIUA 3S34H 1H3VA 5ID0B 5F7UA 5F7FA 1OP3H 4L8DB 4WEBH 1JPGA 5CJ5A 2EECA 5F6HJ 1BAFH 2VMFA 1KTDB 5ANME 3UTSE 1A7QH 4JQIH 3W2DH 2N56A 1A1MB 1I8IA 3MZTA 1HQRB 2AJXH 2VDMH 2GW5A 1KB5H 5KSBF 4NZRH 3B9KD 2DLFH 5DR5H 3G5ZA 3PQYD 3BUYA 5C07E 4YR6A 1B6DA 4XVJH 1MJUL 3O11B 3D25B 3F7VA 3KXFA 1IFHH 3VA2C 3WO4B 1YJDC 2VKWA 4AL8H 3MLYH 1XZ0A 2PCPA 3HR6A 3K2UH 5ALCH 1RUKH 5B8CC 2DM7A 2FECI 3RAJH 5KJRL 1YA5A 2ERJB 2EKSA 1ZGLP 3IKKA 1A4KB 5C9JA 4OLXH 3BDXA 1C8PA 4PPTA 1ZHLA 2QLVB 3OKLB 3HC0A 1PFCA 1CK0H 5D7KD 3O2VH 3SE9L 3ARTA 2IH1A 3MJ6A 3UX9B 9CGTA 2XXMB 4BH7A 4PJIE 5I73C 2WP3O 5IIEA 2OSLB 5I17B 5DGRA 5I30H 2IBBA 1IGMH 1G9MH 1I9IH 3VFRA 4AEIH 3MRKB 4P23C 5TQ0H 4D9RD 3QEHB 4PTUA 25C8H 2FB4H 3VG9B 1HH9B 4LIQE 3TJEL 3GM0A 3RTQB 2DQTL 1R3HA 2EH7H 1CE1L 1R5VB 3AXLA 2BRQA 3DRTA 3V5HA 5IBUB 1QLRB 2JJUA 3QDMA 4Y0GA 3SGJA 5F88A 4AH2A 4N8CL 4NM8L 3ILQD 5CAYB 3UPCA 3BE1H 4KHTH 5ENWB 5F93C 3T2PA 2XZCH 4MD4A 4P5KA 4YHOH 3ALXA 5SWZA 4PJ9C 5ERWA 3MJ9H 1WBYA 4EUPA 4QHMB 3ES6B 4X8JA 4KRPD 4WUKL 3V5KA 1D9KA 1G6VK 4HZLA 4I2XE 3WHXA 2W59A 3TBVA 3EYVA 2NR6D 3WLBA 3MFGB 2VITB 4LPXA 4R4BB 1IC4H 1KLGA 5BV7B 4RA3A 3OAYH 1AQDB 4ZODA 5E4IA 3S88H 3IDUA 3VFPB 1TMCB 3HS0A 1CFVH 2PF6A 2AI0L 4YHKH 1UH2A 4K23H 1QD0A 3ECBB 1NCCL 3VMOA 1HNFA 5KZCD 1UA6L 1SBSH 3ZE1E 2H9GB 3TA3B 1G0XA 1GOGA 4KHXH 1QSEB 3ELAT 2NY1D 1CD8A 4NRXA 4GS7B 3VXPB 2E9JA 4HK0B 4PS4H 3X11B 4K3DL 3IJYA 3X3FH 2FSEA 1IC1A 1N6UA 1U91B 2FD6L 2GYSA 4U6HB 5HGBA 3S96B 3CPLB 2A6KA 3GNML 3EAKA 3ESUF 4PGCB 2Q76A 4P2QD 2ILLA 2R0LL 4HGWA 3TESA 2ICWA 5I1DA 3IDIB 4HAFA 3U6RA 1NLDH 1TPXC 2XWJB 4KDWA 4OT1H 4Y19E 4YHIA 2CLRA 5J11C 2CDFB 5D6CA 3BVNA 2CMRL 5B8CA 4XWGH 1WVZA 2WMPA 4LEXL 5IJVA 4QXUL 4R7DA 3A6CL 5E2VH 4UV4H 3BZEA 1FDLH 1Y18B 1PY4A 3PDOA 4CDHA 2DQEH 3ULUL 4JB9L 4HQQH 3TCLA 5FF6A 3O6LH 2V2XA 1FVCA 1T1ZA 3C8DA 1CL7H 4UAOB 3MV11 1IGCH 3RUGE 2C7UB 3IAPA 4OF3A 1AR1D 1TVHA 4QXTB 1CDBA 4JQVC 2DLGA 3ARFD 1AHWB 4JM2C 3ARBA 4OM1L 3PGDB 5IHLB 3QFDA 5I8EB 4PJEA 2XN9A 5L8KB 5FO8B 3QUZD 5C0BE 3LOWA 3DECA 4OD3H 4M48H 1T66C 5I1HH 1YPZB 3ROOA 1CG9A 1ACYH 5SWSA 5IMLA 3TN0A 1JFQL 4GG6B 1B0GB 5GGRB 1Q1JH 2P5WE 4H88H 4BUHA 5EORL 4XAWH 4I13B 5ICYB 5FKPB 3ZKXC 4XGZA 4WHCA 1FFOA 5I2IA 1SYVB 3E6HB 3EJZC 4UT7H 4XWOC 4DN4H 3P11H 1KJMA 1OSPH 1EBAA 3HZMA 2FYYA 3NIDF 4WRLA 4M8QA 4OF0A 5DJZA 1INDL 3SE3C 3FRUB 4JQXC 2IANA 5K9KB 1O5DT 1EHXA 2X4OB 2WM0A 5CEYA 1W72A 4FN0A 4KJQC 5HYSG 2FIRT 3CFDA 1A64A 3LDBB 5IHZB 1IQDA 4GUPB 1Q9LA 1E0OB 5I1CL 4RFOH 3AUVA 3JTSA 3MQIA 4NNYA 4DQOL 1Y6MR 3CZFB 3P30H 3LZFH 1AP2B 4S1QL 4Y2DC 4G5ZH 1N4XL 4YDIL 5I6XB 3OMZA 4PRPE 3GSVA 3LKSA 3P2TA 1IAMA 4GXUM 4I3RL 4LCIL 1RZJC 4AM0A 1T1XA 3NABH 2NW3A 4FXKB 1ZHBA 4P2OB 1H3PH 3S4SB 1KCSL 1PBYA 1CDYA 4M5YH 4UT9H 5DHYB 5JIHA 3MODH 3RWJA 2QQLL 3RNQA 1BFSA 4XXDA 1Q9WA 1MFDL 1NUDA 3RVXC 4N0YH 4WHDA 1LEKB 1SY6H 2DL2A 1BD2E 5I19H 5E9DD 4JN1L 1EFXD 3RVWC 2NY4D 1XGYL 4HDIB 2Y06L 1I9RH 2AV1B 3BPCB 1OP3K 4HUMB 1U8HB 5IEKB 5F7YC 5DMIH 5I66A 2FEDD 1PKQE 4FQQB 3OR7A 1DZBA 1FL6A 1E4XH 3AAZB 3VDCA 1E4KC 1H3TA 5DYOA 4QHNA 2QSTA 2ZUQC 2DLEA 3DO7A 1AXSB 3VCLB 4FFYH 4LLYA 4LCUB 3BZFA 4RMUA 2IPKA 5J12C 3G5VB 1NBVH 1VHPA 2N7AA 1PAMA 2V2TA 1X4ZA 4JRXE 2ZCHH 4JM2A 4LRIC 2VIRB 2CJUL 3HMXH 4FQ1L 1CGSH 5EPMA 4LHUD 4LPWA 4PJ8C 3OKDB 4HUKB 5FAAA 2DDQL 4OZGE 3AU1A 1U8MB 2YUZA 2WIMA 5EFIB 3W0WD 2Z8RA 1DANT 1S7WA 4QF1B 2HTKD 4G9FB 1A0QH 1NEZG 4F7CB 2B8OT 5DJXB 3VXNA 1NGZB 1KG0A 5D7KE 1QFWI 4FRWA 5L0QC 1JRHI 5DD1H 2AXHA 5JUEH 3VRIB 5ESQB 4C57C 5HHMA 4WVRA 2W65B 3O8XD 4NO5B 1AH1A 1ZWIA 5J1TC 2PXYC 2VDOL 2R2BB 1YEDB 1HN1A 4YX2L 3PWVA 4YBLB 2AABH 5TH2A 4JHWH 3SKOB 2IAMC 1UM6H 2A1WH 4NDMB 4OIIL 4HH8A 1SYSA 3SE3A 2AEPL 3GSNB 3HE6B 4JQXA 3RVVC 3BP6A 2EH8L 1KFAL 3QUMH 1WQVT 4RGNB 2VN7A 1GZQA 3S34L 2EZ0C 4QLRA 5F7DB 1CD1B 5E94A 2X9XA 4DZ8B 3RBGA 1BLNB 3TV3L 4NKMB 5DJ8B 5IB4A 5FA3B 3L3GB 4JQIL 1F5WA 3EYUL 1X5JA 1V3KA 5C0CE 4D0DB 2C9AA 2AJXL 4ODUB 5KBNC 2HJKA 4X6EA 1T22B 2DYPA 3Q1SL 4Y2DA 2EE6A 3MCLH 2BVOB 4JFXA 1K5NB 1MH5B 3RPIB 4DVBB 3HAEA 3OAYK 1NBQA 3B9DA 3CFCL 3L3KA 5DJ2B 1IFHL 3GMNB 4J7RA 1RVFH 3KYOA 1GGUA 4FG6C 1M71A 3QPXH 2CDGB 5ALCL 1YPZF 2UY6A 3RAJL 4P57A 2NY3C 5CD5D 2YD6A 2A6IB 4KK8D 2E7CA 1DQMH 2FWOB 4PJDE 3NCMA 3FT2B 4JPWH 4X8XA 1EO5A 4GG6F 1JZ7A 5LCVH 5E8PB 5FYJD 3JV6A 4C56D 5ICXB 4OB5L 1CK0L 3OR6A 4IMLA 4WWKD 1S5HA 3TZVC 1HKFA 4GLRH 3JZ7A 3UJTH 3HKFA 5LGHH 5I0ZA 5EBWA 4Z7VA 1RZ8A 4GO6B 3MRRA 5I30L 2P5EE 3HG1A 3BIAX 3QDJD 4Z95H 1IGML 4PRAA 1RJYB 4HS3B 4UOW0 1I9IL 4ZUWA 4HWNA 4IRSB 2O61B 1R3KA 3AGVA 1J18A 2ARJQ 4QYOA 3PV6A 4OGYH 2FB4L 4MNQE 1E28A 3DMMA 1A9BB 3MJ8A 3LN4B 4PFEA 1OTTC 3QG7H 5L2KA 1DLHA 5BS0B 1QYGH 4X98A 2CKBA 4QEGA 2AQ3A 2QADC 5DD6A 4HKJA 4MAYD 4LRIA 5JZ7D 1AKJD 3SGDI 5KOMC 2Z31D 1UZ6E 2PR4L 3QJFB 2X4NB 1FV1B 4YAQB 4PJ8A 4ZPTB 4KWUA 4YHOL 1E6OH 2BNRB 2BVTA 1FN4A 5SV3A 2PTUA 1INQA 1TITA 1LEIA 3CDYA 2NXZB 4OGXL 3N1FC 4ZOBA 4HIHA 1G7HB 4HCRL 2ATKA 2IADA 4L8BA 4Y1AA 3KPRE 1NC4B 4JG0L 1IVLA 2E7BA 3C60B 4HKBA 2NX5D 2PXYA 1CFVL 4WO4B 4K23L 2BXZA 4OZIE 1F3RB 4FFWC 3VW3L 1BZQK 2IAMA 1AIFA 2IGFH 3ARGD 3KNBB 3WKML 2HMID 1DEEB 5INDA 2FL5A 4JREB 3FT4B 3JTTA 4GRWB 1WC7A 3WIFB 3H7BB 4F58H 3O2WL 4YC2B 4J3TA 2GCYA 3S5LA 3TEUA 4CNIA 3HUJA 3O6MH 1LE5A 1RU9H 3AMKA 2CRYA 2M26A 4DN3H 3REVB 1ZV5A 1A1OB 3NZ8A 1P7HL 1AGFB 4EN3A 3EFDL 3VD7A 5DFTA 1T4KA 3P9LA 5IHUL 3KAAA 4P3DB 3GO1H 3QUYB 4FNLL 1CFNA 4RGMB 2E27H 4OT1L 2NY0D 3H2WA 5F9WB 4F7PB 3JWOH 4LLMA 5IQ7H 4OZFH 5DK2A 3WHE1 3QR2A 5E5MB 4XAKE 5IESH 2IMNA 3Q6FB 1GIGH 1GCFA 3O6LL 4B0MM 5F1IB 3MNWB 2PYEB 2VAAA 5BJTB 1UKQA 4K2UH 4TUKH 1RSFA 2VKXA 1F3DJ 1X3DA 2Q7YA 1S3KH 3O6FA 3IU4H 5EOQL 1AO7A 1JNJA 1ZEAH 2QV2A 3BQUC 5F3BA 3FMGL 1FFNA 3DV6B 3O6KL 5MERA 4S0SD 4M48L 2J8OA 4JY5L 1ACYL 5EU4B 4U1GC 1HQ4A 4FQXB 3BN9D 4Q7DA 3H9SE 4JR9L 1UACH 3TVMC 1ADQH 3GSQB 1UWEH 3HFMH 5KSBE 1NC2B 2V6HA 3FQNA 2E7LA 4MD0A 5GRZA 4PB0H 5HI4C 4G6JL 5EU6B 1CLZH 3EOTL 3CFEA 1J1OH 2CRMA 3QH3A 1J0HA 4JDZA 4GW5A 1KBGH 3U2SB 1FAKT 4NHCH 2FR4B 4UDTA 3G5YB 4MDJA 3T0WA 1U3ZA 4PUBH 3KPSB 3RVTD 3U0TA 1LHZA 4P99A 1BX2A 3O3UN 3MJ7A 4XRCA 2J6EL 3UTTA 1WZMA 2CK0L 4LCWD 4NT6B 4ZFOB 4P2CG 1UT9A 3RDTD 1Z9SA 5C0IA 1VFAB 3WEXB 1KELL 4RFOL 4X9BA 3DI3B 4IMKA 4JO4H 1P53A 1YZZA 5EOCJ 3D6GA 5IBTH 3LZFL 1UB5A 3Q2CA 4IRJD 4XNUH 4XBPA 3IDJA 1IGYA 2CUMA 3HNVH 3WSQH 1NSNH 1I8IB 4GRLC 3PWPD 3N0PB 3NABL 3PWUA 1H3PL 2DM3A 4WI3A 3G5ZB 4M5YL 4UT9L 4U0RC 4YR6B 1JJUA 2J8UB 4LSTL 2P8LB 4A2LA 3MODL 1CD9B 1RQ5A 3HI1A 4LSVL 3N85L 3O4LA 3HR5A 4XNMA 1CGXA 1I3GH 4LPCA 4JHAH 4MXVE 1RD6A 2DQGH 3M07A 4LVEA 1XZ0B 2PCPB 5F9DC 1PG7X 1FNSL 2IPTH 3MA7A 3JV0A 1OSZB 5IJKC 4BFGA 2EKSB 4NFDA 5C9JB 1ZHLB 3MR9A 5SX4H 3HC0B 3VG0L 2VLJD 2IH1B 4BH7B 1IAOA 2ADFL 5IIEB 1TNMA 1RMFL 1R0AH 4PP1C 2V5YA 2XNAA 5CZXC 5C1MB 1I1RA 4XPGH 4XX1G 4QT5A 1RJZB 1OM3L 5LGJA 3B2UC 4PTUB 1S8DA 1VACA 4X99A 3PGFL 4RGOH 4UV7L 3WD5H 3VGGA 5IVXA 4XBEH 4N8VG 1ZSDA 1S7XB 4I0PD 1CGSL 3NCCB 3AXLB 1CGTA 3DRTB 3BQUA 3OKYA 3T77A 1QRND 3QDMB 3MRNA 4AH2B 4Q74A 1PLGH 1SMAA 1YEHH 2P8PA 4GRWF 1W0WA 4Y4FD 4MD4B 4P5KB 35C8L 4R6UA 3TVMA 5SWZB 3F7RA 3HE7B 1WBYB 1K9TA 3V5KB 2DL9A 3NIFF 3UC0H 4N0UA 3EYVB 4U2ZA 3WLBB 3QDJE 4HLZG 3DSFH 4JHWL 2HLAA 1UKTA 1I9JL 3GFUA 3HS0B 4TQEH 3UZEA 5FEBA 5I71B 4LSRH 3QIUD 1YEEH 3CDGA 5DUML 3LQAH 4OV6F 2A6DA 2CXGA 4G80A 1U3JA 2MQ0A 5GGRY 4NRXB 2XG4A 1DSFH 3EGSA 4WHYG 1YMHA 2GJ6A 2I9TB 3MLWL 3IJYB 3BKML 4QRTA 4EKXA 5ABDE 5EIIA 2EEDA 1JPFA 4HX1A 5GZOC 4K94H 5SX5K 2A6KB 4GRLA 2NXYB 1LD9A 2Q76B 4HGWB 4MJ4A 1D6VH 2BNUA 3CFBA 2ICWB 5I1DB 5EO0A 3UPAA 4R2GC 1A7OL 3WFCH 4G8GA 5BO1H 2FHBA 2CLRB 2GJZA 5DEGB 4EJ1C 5B8CB 4KRNA 5HYSA 3E8UL 5IJKA 5IJVB 4XPAH 3E0GA 3BZEB 3DROA 4G6ML 5LGHL 3K7UA 3PDOB 2VLLB 3U46A 3OV6A 5F96H 1JHTA 2GK2A 2R9HC 3CNKA 1G0DA 2BRRH 4IOFD 2V2XB 1FVCB 1T1ZB 3LKOA 3E6FA 3VJ6A 4YEEA 3OF6A 1VENA 2B1HH 2DQDL 4HUWA 2EIEA 4XZUB 4OGYL 4C54A 5I73B 1BF2A 2D4FA 5IB2B 2Y1VA 2VSCA 2NZ9D 3RY4A 1I1FB 3QFDB 1MF2L 2XN9B 3K81A 4H1LG 3PHQA 1MAKA 1U8KA 5C70A 3ROOB 1S7SA 5SWSB 4PJAE 4AG4H 5IMLB 2BCKA 5TFSL 2CK2A 2DQCL 5EZIL 3TNNA 4LU5L 1MRDH 2ESVA 4PJGF 3QI9C 5D96C 2Z0BA 4B7IA 4ONFH 4XGZB 43C9A 1A3LL 4TVSa 3I85A 1FFOB 5I2IB 4TPRH 4F7TA 4WHTB 1KJMB 1L7IL 4BSWA 1FHGA 3G6JB 3TYFA 4OLUH 1FZOA 3WNKA 2J8UF 3BH9A 1TZHA 1L0YA 4M8QB 3DXAD 4WU7B 2XTLA 5DJZB 4L3CA 4KQ4L 4APQD 3QCTH 1MI5D 3CMGA 5J1AA 3ARDD 5CEYB 4I0CC 1W72B 4C4KT 1HDMA 3CFDB 2Q86A 1IQDB 5EU7C 2BK8A 4PBXA 5E2WL 3IDXH 4BQ6A 3JTSB 4RRPG 4NNYB 3I84A 2ENSA 5HJ3A 5CJ8A 4F58L 1MRCH 2VYRE 2BSSA 4JO2H 1NAKH 2F8OA 3GSVB 1NEZA 3O6ML 4OCYH 1RU9L 4AM0B 4DK3A 1G7IA 1W8OA 2NW3B 1NANI 3MBEC 1ZHBB 4S1SH 1DQLL 3MPCA 5D72L 1QSEE 4IDJH 3H9YA 4ZPVA 4DAGH 3NBNA 1UYWL 4PTTA 3RWJB 1IGTA 1CQKA 3RNQB 4XXDB 4X9GA 4M1GH 2OQJA 2YXFA 5IQ7L 4BZ2H 5KS9E 1OAUL 4XMLH 3OJ2C 5CP7B 2G9HB 2ZCLL 1TPXB 3I3DA 2V5TA 1BZ7B 5J11B 4MHHG 2CIKA 3B9VA 5I66B 2R69H 2WNGA 1A6AA 1FL6B 4Z7NE 3SDDC 3C5JA 2IG2L 4Z0BL 5DYOB 4WUUB 4L8CA 4QHNB 4GBXC 1DLFH 1EHLL 3OQ3B 4OUOA 5K33A 1FZJB 1T1WA 3BESR 5KVEH 3PWPE 3DO7B 1W0YT 2FO4A 3HMWL 3MLZH 1FLTX 1MFNA 1FGNH 1XT5A 1HSBA 4LLYB 4MMXC 3BZFB 2IPKB 1T21A 1EO8H 3T8XB 4KJYB 2V2TB 1FG2A 2XTJE 4JM2B 1MJJB 3VXSD 3MJGX 4CVXA 1LMKA 2B4CL 5KSAD 5EPMB 4ONHB 4UU9A 3FTGA 3HFML 2OZ4A 3CLFH 2EDFA 2ZPKH 3BP4A 3E3QE 1PZUB 3F12A 2K7PA 1ZANL 2D9QB 1J5OL 1DBMH 1KG0B 5GGQH 3U1SH 2ZUWA 1CLZL 2OR9L 3ZKXB 1KPUA 1YPZE 5DO2D 1KBGL 5HHMB 3ALPA 3KJ4C 4RFNB 4ZTPL 5T1KD 5JOEA 3S36X 5JQ6H 5EIVA 1L7TH 4GG6E 3SJVA 4GMTH 2XI9A 3PWVB 4PJHE 3V6OC 5TH2B 4X4XB 2JF1A 3CVHA 5DK0A 5C09A 1SYSB 2Q3AA 3UJJH 1RUQL 3QXAA 3IFNH 1EEQA 5CGMA 1AI1H 2ICWI 3EKCA 1ZT7A 1RIUL 4JKPH 4XVUC 5E94B 3ARYA 2FDBP 5IB4B 1XAUA 2EDOA 4R90H 5DA4A 1RFDH 1CXEA 4KDTA 2HVKB 4JRYA 1D5BB 4TSCH 3BDYH 5A2KH 2VDKL 2CO7B 3AC0A 4NSKA 2HJKB 5DRXB 5L9DL 2DYPB 4BELD 4Y2DB 3GBLA 4JFDA 2KH2B 4JFXB 2R0WH 2NW2B 3HAEB 1D5XA 3L3KB 3FJTA 3MBEA 3KYOB 4R26H 5D7LD 2V17H 1M71B 1F4XL 1OTUC 4LLWA 3LKPA 4P57B 4YK4C 3MCKA 5F1KC 3VXUA 1OPGL 5T1DL 2A73A 4L29B 3GZKA 4YQXL 2JB5H 4K3JH 3JV6B 4NBYB 4J1UA 4PRDB 4FTVA 3OR6B 1TVBA 5DC4B 4QOKA 1S5HB 3KPTA 3G6JF 5EU3B 4N1EA 2W07A 5FYJL 3FAWA 4Z7VB 4ONOA 3V95A 4RWHA 3TJHC 3MRRB 5DUPL 2VLKA 1K3IA 3HG1B 2F5BH 2AK4B 1QHPA 3SDDA 4PRAB 3FFCA 4ZUWB 4XPGL 4GBXA 1N6QH 3NFPA 2X5PA 3PV6B 4W6XB 3DMMB 2ZUQB 1E28B 1YYLH 2DB8A 4JFYA 1VESA 2PN5A 5DJ6A 2AGJH 5L2KB 1SEBA 2F54D 4XBEL 5J12B 3S36H 4X98B 4RQQA 4AEHH 4NBXB 4U1MA 1JGVL 3F5WA 5DD6B 1NJ9A 4LGSB 1PLGL 5C2BH 3QHFH 3PL6C 3OAUL 5FO9A 2C1OA 4PJ8B 3J8F7 1FN4B 3MRHB 4OI9A 5MP6H 5HSFA 1Y6KR 1T2QL 1INQB 1LEIB 5EZLB 5B3JE 4OJFH 4HIHB 2GK0B 4MB4A 4HS6A 2WBKA 3SQOL 4NQED 5L0QB 2IADB 4L8BB 4Y1AB 5HDBF 1GPOH 4P5MA 1WBXA 4TQEL 2PXYB 3K1DA 1P4IH 4G9FE 1I1AA 4XC1H 2ZJSH 2ZSWA 3N1GC 4HIJA 4LSRL 3V6OA 3MRJA 4MA8H 2IAMB 1AIFB 2W0KA 1WAAE 1AGEA 4LKXA 3K8MA 2XY1A 3V7AG 4I8DA 4K8RL 3K4ZA 4Q0XH 5INDB 5I1KH 4G8FA 3RGVD 5HVHB 2FL5B 1A7PH 1DSFL 4DFHA 3KXFD 5ITBL 2GAZA 3ORJA 3MREA 1MIMH 1MLBA 1L4IA 3MLRL 5IGXH 1WC7B 2AJYH 4JDTH 1X5HA 2GCYB 3RRQA 5F97E 1OAKL 3S5LB 4CNIB 3HUJB 3I3BA 3EYFA 5JLZA 3C09C 5LAXA 5BMFH 5HBBA 1MY5A 4EN3B 1IKFH 4JM2F 1OQOA 1NCDH 1L6XA 1T4KB 3P9LB 4Y4HA 1CFNB 1S7VA 1G7QA 4NZTH 3NA4A 3X14A 1MI5E 1A1NA 4LLMB 4QRRA 2AJVL 2Z9TA 2FJFA 2NY3B 3IDNA 1PKOA 5GJTH 2A74A 3B6SA 3GGWB 2FJHA 3AM8C 5F96L 4U7MA 1DBBH 3DIFA 3RA7L 3QG6B 4U1SA 2VJXA 3BKCL 2VAAB 2OS7A 3VXRA 1TDQA 1TQBC 3TZVB 4TULH 1NKOA 5GGTH 1CFTB 4LP5A 4QHKI 2YN3A 1QFOA 1AO7B 1ZAGA 4AIZA 3QHZL 1NFIA 2G2RA 2ZUXA 5DVOA 1JIBA 2J8HA 4MXQD 5F3BB 1D9KD 3H3PH 4E41D 1FFNB 5DRZB 2QL1A 1UG9A 1I8LC 3P0GB 2HH0L 2QQNH 2YMXH 2R4RH 1MRFH 3VWJC 5C0ND 1MRDL 2QADB 4A6YH 1F4AA 1FE8L 3VD4A 3O4OB 4FQLL 4OI8A 4UTBH 4BA8A 2LFGA 3BZ4A 5CGTA 1BM3H 5BS0E 3CFEB 5IFHL 4LSSH 1BOYA 2JLLA 3QIWD 4JDZB 2Q87A 1FSKC 2EDTA 4MDJB 4B41A 3DNKA 1BX2B 3KYKH 2I07A 3MJ7B 3GK8L 4XRCB 3C6LC 4HFWA 4NKQB 4TN9A 2FO1A 1HYRC 4HKXB 3QNZA 4HWUA 5C0IB 4N8VA 1HHHA 2B1AH 1TETH 3V52L 2HKFL 3GSXB 4Z7WA 3CX5J 4Y89A 3QIBA 4Z7VF 1FCGA 2YEZA 1J0JA 1U92A 3IDJB 1NAKL 1IGYB 1G1YA 3AS3A 3F8UB 3U4AA 4S1SL 2A9ML 4OD2B 5T1MB 1H8SA 1XR8A 3MUJA 5GHWH 4DAGL 2WQRA 4DW2L 1OAXH 5HY9A 2DQHL 3HI1B 1PQZB 4XNMB 5CKGA 1IJ9A 5IB5A 3JV5A 4GRWE 3CH1A 1QLEH 1T20A 3M8OL 4KQ3H 2GY7B 2EDDA 4ELKA 3MA7B 3QXUA 3D39D 4BYHA 1MFEH 4G7VH 4EI5C 3JUZA 2AS5M 3P77A 3FQUB 2FBJH 5DS8A 3ZT6A 3NIFE 3LEYH 1YUHA 3W9EA 4OCXH 3MR9B 3V0WH 2CQVA 3OZ9L 4QHLA 2M2DA 5L8JB 1G9MC 4KKBC 3LKQA 5DJAA 1DLFL 3AM8A 1IAOB 2APFA 2F58L 3PWLA 1WFTA 3TN0D 3O3DB 2XNAB 1PY9A 1J12A 3HB3D 8CGTA 5DVMA 5D2LA 5LGJB 2IBZY 4X99B 1S8DB 4KTDH 4PJ5D 4JFHE 1O0VA 3IFOA 4NOBA 4NQDA 5IVXB 5C6WH 5LXGH 4A2MA 3FB6A 3BQUB 3T77B 3MV7D 5CIPA 2P47B 1I8LA 1QFPA 3GBNL 3MRNB 4JVUA 2ZPKL 4MA3A 2IAND 3RWCA 1W0WB 2ID5A 3TVMB 5GGQL 4ODVH 4KUCD 2E7MA 4X4MA 4JO3H 1BQLH 2YWYA 4V1DA 2DI8A 3WN5A 4N0UB 4F3FB 4XP5L 3FQRA 4YDLB 4GMTL 1FVDA 5JXAH 5HVGB 1RZGA 4OZFG 1Y0LA 4IM8A 3GSRA 1NCBH 4NRYA 4Z8FH 4JVPA 1OAZH 4JO1H 2OR7A 5EU6E 5B3NA 5GS0H 5JW4N 4H1LA 3C6LA 2ZSVB 3CDGB 2NY6D 4JKPL 1IKNC 5CKAA 4YBQC 1IT9H 2A6DB 1YEGH 4KTEH 1QR4A 2XA3A 3IDMA 4NZJA 3EGSB 3LS4H 1FO0L 1YMHB 4JPVL 1KCRH 4QRTB 5EIIB 4OFIA 4HG4J 4OFDA 2GEEA 2QQQA 1JF5A 2BP3A 1JPFB 4HX1B 2R0WL 5K93A 3KPPA 4GRLB 5DURD 1L9NA 1RZFL 4OZHA 1LD9B 5TE6L 2C3GA 3L5HA 4R26L 1T5XB 4UOW1 3CFBB 4U0RB 5KVFL 4AEEA 5K9JL 2IC2A 4XCFH 4ZDHA 3TLRA 2IWGA 4G8GB 3DLQR 2VL5B 4O4YH 2JB5L 4BFEA 4K3JL 1JMZA 4WI6A 5CP3H 5T1LD 2I60H 1MHCA 4OF6A 4LHUG 5CZVH 4XNXL 2MCPL 1J8HA 3NAAH 4KK5C 3KXFE 3SO3C 2H2SC 4HT1H 1JHTB 4RRPA 4YBHA 3LKOB 5MI0C 3IXAA 5C71A 5J3HD 5IG7A 1I7RB 4XNYH 4HUWB 1N6QL 2BZDA 2V9TA 3CSYA 1QACA 1MUJA 4LSUH 1XIWD 4M7ZB 3L95B 3UYOD 2G5BA 1AD0A 4RZCA 4AEHL 3LPFA 4R7NA 1CDCA 3PHQB 4FFZH 2B2XL 1CICD 4NO0D 2X1QA 4LRNH 4ZO8A 2BCKB 3TNNB 4EUPH 2ESVB 5MP6L 3MJ9A 1V8HA 5TE7H 43C9B 5ID1A 1RK0A 5IW1A 4XI5C 4Q58C 4Q9BA 3GB7A 4L9LC 1KC5L 5EBLA 3JXAA 4OJFL 4F7TB 4HUUA 3BUTA 4BSWB 4HG4K 5I1IH 3K4AA 3TYFB 1HCVA 1FZOB 2VZOA 1S9YA 3BH9B 3QDME 3QZWG 5DMYA 1FLRH 2YRLA 1DCLA 4AY0A 3VH8G 5DF0A 5DTFA 5CEZD 5C7XL 1V7ML 2R1WA 4L3CB 4NO3A 1P4IL 5JHDA 2AKRA 1YEIH 4XC1L 3FN9A 4UNUA 5SWZE 2UVFA 3FONA 4MA8L 2C3VA 2HT3C 2CLVA 3O3EA 4E0RB 3V4VH 2Q86B 4S10A 5IROC 3MV8D 3IETB 2R56H 4PJBA 5IFAH 1K8DA 2VXVH 2Y6SC 3QNYA 1QOKA 4GKNA 3IAQA 2WUBL 1IKNA 5IGXL 4Q6YA 5HJ3B 2OTWB 5CJQH 4JDTL 3VXMA 4OF8A 1ONQB 2BSSB 5AUMA 2MQ3A 1TZGH 3KPNA 4XP9H 1G7IB 2ENYA 3LN9A 5BMFL 5JR1L 1A6UL 1G7LA 1WT5C 5F9OH 4XPHH 4ZPVB 4CDGC 4NP4H 1JPSH 3B9KC 1UWXK 5MEOA 3TYGL 1YJDH 5IVXF 1IGTB 4H20L 1J10A 2OJZH 2F53A 1C7SA 4R2GB 1X6LA 5CSGA 1IBGL 5GISL 4L4VD 1KN2L 2YSSA 1YYMH 1ERNA 4XMKH 5C0BA 1ND0A 1KXVC 4M7JL 2HT2D 3EUUA 2VLMD 4U31A 5GJSL 2CIKB 4JCMA 3HPLA 1I7TA 1A6AB 1DBBL 3IRPX 1GSMA 3T3PF 3A67H 3C5JB 4AK1A 1RV6X 5JHLL 2WBJA 4R96A 4L8CB 1X5LA 1T1WB 2OJEA 4N9GA 1BWMA 2FO4B 1QNZL 1RY7B 5DLMH 1V05A 4Y2OA 1HSBB 4QTHA 4HHAA 5KANG 2XFXA 2VB5A 1YEJL 2WIIA 4CVXB 5JTWA 1NLBL 4NJAH 2YMXL 3ESVF 1LO5A 5DC9B 3D39E 1EERB 4UU9B 4WU5A 2I27N 3FTGB 3RU8H 4DOHE 2YR3A 3BP4B 2HFTA 3ILQC 4JPIB 4PJEE 1BM3L 4Z7UA 2XN9E 3QI9B 5D96B 3RX7A 2IFFH 4LSSL 5TDPA 1IRAY 3PABB 5AWNL 1IEHA 5SWSE 4KRPC 5IF0B 4RMQA 4HZAA 3SJVB 2NR6C 3VRLF 2EDWA 3OJMB 4Z77B 5E99L 2DQIH 3OJDA 3KYKL 4CN4A 3CVHB 5C09B 2J6EA 2H2PD 5J6GA 2NYYC 3CXDL 3WFDL 4CUCA 3QXAB 5C08B 2PO6D 2B1AL 2W9LA 1TETL 3LCYA 3R4DA 3PJSA 2DJ4A 3GHBH 4WENB 2UYLA 1OHQA 1ZT7B 5F3HB 2E6JA 1F11B 5D70H 4QHUA 2AVGA 2IANE 3DVFA 2DI7A 2NY1C 1JV5A 4JRYB 3SCMA 4NSKB 4OLWH 1H15A 2Y72A 4HWZA 3ZKMD 3P4NA 4JFDB 5GHWL 3RKPA 3IFLL 1IAIH 5CGYD 3ALWA 2XYCA 1G6RL 1DN0A 3MBEB 3K46A 1QLEL 1TVDA 4MAUH 5GGVH 1SY6A 3B9KA 4WCYH 4LLWB 3PQYA 2ZG3A 3LKPB 4G7VL 1HI6A 5J9PA 1DQDL 3VXUB 2WP3T 1MCOH 3CX2A 3QUXD 3O6FD 2A73B 2FBJL 4U1HA 1IM9D 4HAGA 3UTQA 4F37F 3G6AB 2V7HA 2P4AB 4RAVB 4G42A 2AXGA 4OUUA 3ILPA 1WLHA 1GJIA 4J1UB 4XTRD 4K7PY 1TVBB 5HDBE 4ZG1A 2CUIA 3HI6H 4NQSA 1E4WH 4EQ2A 1HOCA 1S9XA 3EO0A 4Y4KD 5C9KA 1SJVA 4HXBH 2QJDA 3SDDB 3VGAC 3FFCB 4GBXB 4LGPB 3NFPB 2XOTA 1T04A 1AR1C 4JFYB 3BEWA 2QSCH 1C5DA 3ARFC 1SEBB 1VKXB 5LXGL 4HWBL 4X80H 1P9MC 4OLVL 1CI5A 5J13C 4U1MB 3F5WB 5J89A 2JB6A 3SOBL 3QUZC 5FYLD 2ZUTA 1NJ9B 3KPLA 4KV5E 2FRGP 5AD0A 3HN3A 1C5CH 2C1OB 2O5XH 4N5ED 4ODVL 3UTTD 3VXTA 1AGDA 3PP3H 1ETZA 5DSCA 3RI5F 4LPUA 3SN6N 4JO3L 1NMBL 3STZA 3BGAA 2ICWJ 3QEQD 1I8MB 1G7JB 4ZD3H 2VABA 4HS6B 4K55A 3MRFA 1ZGLM 2EICA 3KJ4B 1WBXB 1HIMH 4X4ZA 1WICA 4DGVL 1I3RB 3PWJA 3DETD 1O7VA 1OAZL 2ZSWB 4HIJB 4ODTL 3MRJB 2YD3A 5E24E 1AGEB 3DSNA 5HHME 1IT9L 4WI7A 4PYHA 4X9FA 5CEZH 2XQBL 3LHPH 2OCFD 1A6WH 3O4LD 4QNPE 4FQJH 1V7NL 2GAZB 3MREB 4RISH 1MLBB 5GZND 1CXKA 2NY5H 1JZ2A 3RWHB 4F7MA 4I3SL 1HZHH 4WGWB 4LLDA 5IK3A 5IWLC 1M05B 3HAEH 3ZKQD 3ZSSA 4Q6IA 3F7YA 2YC1A 4LQ1A 5JLZB 3B2VL 3HPJB 3OTTA 5LAXB 5FCUH 4NN5C 3Q0HA 4CADA 3JWOC 1IGFL 5CEZE 5D5MB 2PTTA 4O2EB 3DHJA 2JK5A 2HTLD 1DBKL 1S7VB 3SDYH 3X14B 1A1NB 4I18C 3WLWD 4P2QA 3WV0A 4MNGA 4MA7L 2VN4A 4JPKH 1JBJA 2X1OA 4YK4B 3IDNB 3MOBL 4P3WA 2FIKA 5EOTA 1TIUA 3NAAL 4NCC2 2F74B 2CKNA 4N68A 4OF5A 4X0KB 1JYXA 2A74B 3B6SB 5JNYA 2FJHB 5D1ZC 2HRPH 3BPLC 3HC3H 3DIFB 3HZKB 1EA9C 2FEDC 5DJYB 1VEMA 3VXRB 3IAGC 1LE9B 1N2RB 1MCWW 3QEGH 1XF4B 5DDHA 1JHLL 3MV9A 3ZZ1A 2MFNA 2YPVH 4LSUL 3UJIH 3IVKA 4TSBH 4MQXD 4DGIL 4AIZB 2CKBH 4DCQA 5FYKD 1XCTA 2G2RB 2VXSH 2AK1H 4U1NA 1S7QA 1AGCA 1S7RA 3NACL 1MAML 4D3CH 4Z7VE 3DVGA 1NGPL 3ARFA 4XVTH 1RIHH 3EOAA 3HG1E 4JKKA 1HH6B 1F58H 2J5LC 1XCQA 1R5WB 1JHKL 3V6FA 4I9WD 4FHBD 4DTGL 4OD1H 1HWHB 5IW6A 3CD4A 5AZ2L 2VLME 2AXJA 1AJ7H 2VE6A 3PL6B 5L2KE 2YKLL 5I1IL 2HTKC 1KIPA 3C2AL 2M1KA 3RBSA 3ARED 3FOMA 2E5EA 2KBGA 4PGJA 3D18A 3O8XC 2LU4A 1UVQA 2NY2D 4L1DA 1T3FA 3I6LD 4F15B 3CFIC 4HFWB 1Q9OA 3V4VL 2P42B 4OBSA 4GKZA 12E8L 2R56L 5IFAL 4N8VB 1HHHB 3ULVL 4RBPH 3MBXH 5JMRA 4Z7WB 2VXQH 4Y1AE 4AENB 1MREH 1EUUA 5JPNA 3I6KA 4OLYH 1QR1A 1MIEH 1U3HC 2YEZB 1U92B 3KLHD 3OGCA 3BWAA 4XP9L 4TVPH 3DOSA 2J7LA 1DBJH 4LAQL 1N8ZA 4TSAL 2W0LA 1AQKL 2OTUA 1XR8B 4WI8A 5IWLA 1Q9KA 3DHMA 1V3MA 1JPSL 2NMSA 4ISVA 5HY9B 1Q0XL 2VZUA 2OJZL 3C09B 3FT3A 4KMTL 5KSVA 5IB5B 4NZUH 3CH1B 1KUMA 5T5NG 1T20B 4QHKJ 3GI8L 4FQHA 4OZFA 4ELKB 2MKLC 4XBGA 4HK3N 5JIKA 5CD5C 1YYML 2BVEA 3HUJE 4KK8C 3P77B 4I18A 3O0RH 4TVPE 1U36A 5DD3H 3W9EB 4OCSH 3QFJD 1OGTA 2B39A 4HWEL 2XKUA 4QHLB 5E9DA 5D71H 4MJID 1EFXA 5K9OA 5L7XL 3D0LA 3LKQB 4WWKC 2MPAH 3MRGA 5EZOH 3PWLB 4ZYKA 3HI5H 3GBMH 2UUDH 4RWYL 3CUPA 4HMCA 4N9OB 5DLML 1TQBB 1IE5A 5HDLA 1JWSA 3NH7L 2PKDA 5BCAA 5D2LB 1ZLSH 2KUTA 5SWQA 1EHNA 1MJ7L 3IFOB 4NQDB 1DBAL 5CUSL 3QEUA 2ITCA 3FB6B 1NCUA 5CIPB 1NGYA 4OTXH 3WNMA 3H42H 4MAYC 4ODSL 4MA3B 5JZ7C 3RWCB 1AO7E 3ISWA 2Z31C 4PY7B 3MLXH 4TUJA 4LHUA 1WZLA 3VFMB 4Z6AT 4OF7A 1TJIL 1QFUL 5FYLH 1P4LA 3CXHK 1NFKA 3QRGL 4HPYL 4JY6B 4V1DB 2P49B 1JN6A 4RDQG 3W0WA 5ANMB 3G04A 4YUEL 4B5EA 1BWWA 4CKVX 1FVDB 3WMSA 5D5MF 5IKCA 2DQIL 1JPTL 2E7LE 1UGNA 3H0TA 4P5TA 4WTZA 1Y0LB 1FSKB 3O8XA 4OIBA 4IOIA 1U6AH 3LQAC 4LLUA 5CCKL 3GSRB 1E6JL 1I7ZA 4R0LC 2DKSA 5CSZA 1FGVH 4N1HB 4QTIH 1H5BA 3C6LB 5FUZL 3UCRA 3ARGC 1MEXH 2HMIC 2EIBA 2OP4H 3U82B 3BW9A 1JGLH 3W39A 3P9WB 3PP3K 3IDMB 1KN4H 3WO4C 4K94C 4YHPA 3UTTE 1BECA 4KKNA 5DGQA 3EW3B 1KB5B 3RWIB 2VDLH 4G6FD 5T5FH 1FIGH 1M6OB 3JV4A 2W91A 5F7EH 3UP1A 4ORZC 3KPPB 1NGQL 1EMTH 2FJGA 2PW1A 4XHJD 5FGCB 4OZHB 3TBWA 3QZWA 3GMOB 4OGAC 5E8NB 4MVBA 1BGXH 3VH8A 1IM3A 4ZDHB 3TBSA 1C1EH 4H0GA 3KJ6H 1LILA 2O5ZH 2NY0C 2VDNH 3KYAA 1MCIA 3L3JA 1F2XK 1MHCB 4J3XA 5E8OA 4EI5B 3BGFC 1J8HB 2HFGH 3HI6L 2YS4A 5F89A 2VO5A 3O4LE 3MNZA 1LVEA 2W0FA 4M1DH 5I8OH 1I1YA 4C56A 5I1EL 3IXAB 1OAQH 5IG7B 4HXAL 4QKXB 4WWKA 5FGBC 4PRNB 3BD5A 3CSYB 4I2XB 1MUJB 4YXLH 5FM5O 5DQJA 3WIHL 1CFBA 2GTZA 3QDJA 4WI4A 3M1BB 2E9WA 5C3TA 2G5BB 1AD0B 2AJUH 4JFED 4RZCB 4TTGA 4R7NB 2CIIA 4ENEC 1UJTA 4YE4L 3FQTA 5C0AD 4Z7WF 3BRFA 2DQJL 2EYSA 3I9GL 2G60L 1FVEB 4D8PA 5FYKH 3DWTA 3V6ZA 3KS0J 3UTPE 2O5XL 1BFVL 2OR8A 3BN9C 2R23A 1MFCH 1BFTA 4JJHA 4W68A 5ID1B 5E4EB 1RK0B 5MHSD 3W81A 3GB7B 1AKJA 2Z31A 5IVXE 5C0RH 3DX6A 4ZD3L 1BJMA 1MVFA 3NCYS 1YDPA 3DVIA 3W5MA 3BH8A 3QWOA 3TA3C 4WWID 2QHLA 3C8KB 2R1WB 4YO0A 1DVFD 5JHDB 2AKRB 2IALA 4ZO6A 3FONB 2YN5A 4FP8H 3X17A 2HVJA 3RVTC 2CLVB 3O3EB 2NX5A 4N0FA 4N0UE 3LHPL 1K8DB 2VXUL 3RDTC 2V9RA 3QNYB 2I26N 4Y19B 4GKNB 1CGVA 1T7VA 4YFLF 3ARGA 2IPUG 1CLOH 4ODWA 4UBDD 4B53A 4YHLH 5LQBH 3VXMB 3V4UH 5AUMB 4IRJC 2WW8A 3FO0L 3KPNB 4O2CB 1RUPH 5D1QD 1QPPA 4YXKH 4LVHC 3MXVH 5E1AA 5E6YA 2NNAA 1G7LB 5FHBL 3ZTNH 3OHXA 4FTVD 3LY6A 4UB0L 2JELL 2D0HA 3R1GH 4QOKD 4YFLI 1LO3H 3MLVL 2GJ6E 1ZHKA 1MCLA 2F53B 2XTJC 2VLKD 3NCYP 2DRUA 1YNTA 4JPKL 2C4FU 3FQXB 5ISZD 2VR4A 1SM3H 2YSSB 3KPSD 1CTOA 3W9DA 5C0BB 1ND0B 1BJ1H 2MKWA 4HFUH 1UC6A 2ZOLA 1IGIH 2HRPL 1NBYA 4HEPG 1AHWC 1I7TB 1U41A 1CF8L 3PWNA 3QXWA 3VRLE 1DR9A 2P5WB 4HIXH 3QEGL 1QO3B 4R96B 3SO3B 2OJEB 4N9GB 3LH2H 1FFQA 2Z4QA 2D03L 5E00B 5MI0B 1T6WA 2XT1B 5KOVC 1HHJA 5FGBA 4JFFA 4QTHB 5EH1A 3BRGC 3F7QA 1ORQA 1D5IL 4FFEX 2UVEA 2AQ1A 2XFXB 1I75A 2WIIB 1RIHL 5D1XA 1R6VA 1F58L 4M6MH 1LO5B 1QKZH 4OQTL 2W9EH 4I0PC 2I9LA 1QSFA 4OD1L 1N59A 2XZQH 4M5ZL 5DA0B 1UXWB 1M7DB 5HGDA 1AJ7L 1I1AD 1J0ZA 3SPVA 2X4TB 1KB9K 2IQAB 5CINH 4Z7UB 1OF2A 3BKYH 3S3PA 3KG5A 2HFFA 3ETBF 4U6XA 5TDPB 4EOWH 3RNKB 2UUDK 2A0LD 5TGBA 4KAQH 4L9LB 4OZHF 2XA8H 4PRPB 4LVNC 4H8WL 2IMMA 2ESVE 1FH5H 3V8OA 5CWSA 4MXWL 1ZA3A 3SDAD 3LV3A 5AAMA 4F57H 4P46D 4X6DA 4ZFGH 1GHFL 2QBWA 2D7NA 4PR5A 3MBXL 3PJSB 2VXQL 3QIUC 4YWGL 1BEYH 2UYLB 4E42A 2Y07H 4LCWA 1MIEL 2QQKL 1J1PH 4Y4HD 2HN7A 3P4MA 4QHUB 2BVPA 2LAGB 3RDTA 1JF1A 3VFOA 2Z8VC 1JV5B 2AJSH 4GKSA 2FATH 3SCMB 3KR3H 2BJMH 2RB8A 1H15B 1DBJL 4HWZB 4QRQA 4P9HL 1PKQB 2XWBA 3P4NB 4IRJA 4PJ7A 3HNTL 1JL8A 2X70B 3TM6A 5EUKA 3ULUD 4RMRA 1IILE 3S9DB 3GIZH 5A2IH 3PWPA 3ME0A 4NZUL 2ORBL 2NTSP 3B9KB 3PQYB 3UYRH 3FQWB 5J9PB 5KTEL 1LDSA 4KJWC 3UTQB 4U1HB 5IFJB 3OXSA 1RJCA 3U7WH 4OFYA 2V7HB 4G42B 2VWEE 2FZ3A 3GRWL 3ILPB 2GFBA 4OCSL 3ZE1F 5BVPL 4IIQC 4RFEA 5D71L 4PRID 4NQSB 5ACZA 1G9NL 1HOCB 2MPAL 3BEVA 3BSZL 1S9XB 3TIEB 3EO0B 3V4PH 1M7XA 2ZUVA 1AFVH 2OL3H 3L3HB 4IOFC 4F7EA 2DQUH 4XVSH 3INUL 2VLJA 3PUCA 4ETYA 1URLA 1FC2D 1FORL 4C83B 1RZKL 3BKJL 1QFWL 1JRHL 1T04B 4AT6A 4MHHI 3BEWB 2E9IA 1X5FA 5IMKA 2BX5A 1C5DB 1G0YR 2ADIB 1T1YA 1F8TL 3CU7A 2JB6B 4OTXL 4KC3B 3SKJH 1VFOA 3KPLB 2AV7A 2DQFA 1XF3B 4HF5L 3C87A 4I0PA 3MLXL 3VXTB 1AGDB 2YD7A 1ETZB 3U9PH 5DSCB 1QRNA 1MQKL 1NCNA 2HFEA 5FYLL 2VH5L 2YA0A 3STZB 4KROD 4Y4FA 2VABB 1X7QA 3BO8B 5HI3D 3MRFB 5TDNA 3QIBD 4KRPB 1U6AL 3OAZH 5JA8B 3PWJB 1EIBA 1Z0NA 4HJJH 4J8RB 4RMVA 4N8PA 3CFJA 2FLRT 5T3XD 8FABA 4APQC 2ED7A 1M7IA 5T3ZD 3ARDC 4Y5VC 2P46B 3QDGD 3WFEL 1NFDA 2Z8WC 2N4IA 4P23D 4PJDB 3SJVE 3ARRA 4BQ9A 3NMEA 4PY8I 2XZAL 4PGZA 3SGEH 2BVQA 3QIUA 3MYJA 3N1QC 3IU3A 5A3ID 1FO0A 1H9VA 1ES0A 4KKCD 4BSJA 4F7MB 5KZCB 1T0NB 5C09E 4LLDB 5MHSE 5IK3B 2VDLL 1TJHH 1FIGL 2NY1B 1MJUH 2VUYA 3F7YB 2YC1B 1IAKB 1NPUA 3FOLA 5F1NA 5KAQF 1CL7I 1MCNA 2VOTA 4PJ9D 5EU7E 2PTTB 2JK5B 4JRYE 1KYOJ 2HA1A 2VDNL 3MGAA 3ARVA 5CZKA 3OG6B 4P2QB 3TO2B 4JFDE 1T89A 3EDKA 1WCBA 2FIKB 4MDIA 2DKMA 4C59B 1T0PB 2L7UA 1MFAH 3RY6C 1FYTA 5JNYB 1FNFA 4GT7A 1ZLVK 1DUZA 4LLVA 5LJYH 3VXUE 5EDXA 4WJ5A 5DDHB 5CILL 3S35H 3CMOH 2DQTH 4YXLL 3EZ8A 1P4BL 3QNXA 4J3WA 4I77H 5C0FA 3IVKB 4JJ5A 3VGAB 4FTVE 5EWIL 4DCQB 4U3HA 6CGTA 3FB5B 4QOKE 2AJUL 2MHAB 2DBLL 1UADC 4U1NB 1S7QB 4UQ3B 3VFWA 4N8CH 4NM8H 5IR1A 3KLDA 4M9PA 3QDHA 3DVGB 4F33A 3ARFB 2VLKE 2EDQA 1WV7T 3EOAB 4WNQB 1XCQB 3D85D 5FYKL 1LO2L 3V6FB 5J13B 5KSAC 5HHOD 3RQ3A 3T4AA 3QUZB 1MFCL 4WUKH 5IW6B 3JTCA 4PB9H 5EA0L 1CXHA 4DJMA 1RZ7H 2B7DT 4YFEA 2AJ3B 5TJWK 3ZDXF 3IDGA 3EO9L 1J88A 1KIPB 5IM7A 3HHRB 5DVNA 3FOMB 4NC1E 3FN0H 3GEWB 3WDJA 5DO2C 2X9WA 4S1DD 2AI0H 3D18B 4FQPA 2H8PA 1BVKA 3RZCD 1QPXA 1UVQB 4PRHD 3LB6D 1T3FB 1UA6H 1ZMYA 4U7SA 5INCB 5GRUH 5H35A 4F37K 3DXAA 1Q9OB 4UT6L 1DDHB 4GKZB 5EO9B 4MD5A 1VGKA 1TXKA 5T33H 4APQA 1MCEA 5E8DL 1SJEA 4K3DH 2AERT 3B4NA 4Z9KB 4M3JA 1XGUB 3ARDA 4BH8A 3I6KB 5HD8D 2AEWA 4YHLL 1QR1B 5IEHA 3V4UL 4HS8H 3NIGF 3OGCB 3OJVC 1F6AB 3BWAB 3GNMH 1KJVB 2SEBA 2B5IC 4RGMC 3ZYOA 1RUPL 2UWEE 1T66D 3BP5A 5F9WC 2R0LH 3MTRA 1WZ1H 2OTUB 3QP3A 1E4XI 1Q9KB 4ISVB 1CIDA 3FT3B 5KSVB 2Z91A 3EJZD 2CMRH 4NN5B 3U4EB 1BBDL 1GH7A 4OZFB 4FQHB 4QXUH 3T0BA 4X7SL 4XBGB 4H5SB 3ULUH 1I3UA 2BHZA 5KG9A 3DURA 4O2FB 4GW1B 4I18B 3UEZA 3RI5K 3KLAA 4PD4K 3T1WA 1OGTB 5E9DB 2H1PH 3ZT5A 4HIXL 3MLTB 4X9HA 1EFXB 5HYJD 2NY4B 5K9OB 3D0LB 3RY6A 1BBJA 1CZ8H 3MRGB 3OPZH 1S7UA 2WLZA 4ZYKB 3BPLB 1YY9D 4QRRE 1ORSA 2YA1A 3CUPB 2AQ2A 1WJ3A 1KPRA 2XKSA 2OI9A 4U1KA 1JWSB 3UYPA 5KVGL 3ULUE 2ADJA 4X7FC 5SWQB 2LQRA 4Z78A 1JFQH 3EOBA 4M93B 3MUZ1 3FB7A 3VXRE 2G75B 2ITCB 2EDXA 5EORH 1F97A 1C16A 4NNXA 1XR9A 4PJDF 3JSSA 2VLRD 4GXVL 1NGYB 4P0DA 5GRVL 1LQSR 5AZEL 3X13A 3VGFA 3VXSA 2J5LB 2MJWA 5IVZA 3DGGA 5KSAA 4TUJB 3DTXB 1IAIM 1SJHB 5E7BA 4EOWL 1HKLL 1P4LB 1INDH 4KAQL 3W0WB 3G04B 1N5YH 5HDQL 1KT2B 2VDPH 1I9EA 2WINA 1YEFL 5IKCB 2VZTA 2A9NL 5GS0C 5FHAL 3H0TB 2K1MA 2AK4D 3O8XB 4IOIB 5ADPL 5F7NC 4RMWA 4YPJA 1FBIL 5CSZB 1I7ZB 5I1CH 1CBVL 3MV01 4DQOH 4JCLA 2UV3A 4MA1C 2GSGA 2Y07L 4S1QH 1N4XH 4NC0B 1J1PL 1VERA 3BW9B 1UZ6F 3W39B 1N64H 3RGVC 4I3RH 3SKMB 5T3XH 2FATL 5E2UL 4YHPB 4J2XA 4XX1E 5T3ZH 3L7FA 1MPAL 1KCSH 4X6CA 1U3HB 4HBCL 2W9DL 2QQLH 4GLRI 4U4BA 1DUYA 2FJGB 2PW1B 4HLZH 1MFDH 4TUOA 3TBWB 1G6RA 3W82A 4Z5RA 3OAZK 2DM2A 1UCBH 4JN1H 2RQ8A 3VH8B 1IM3B 2HYMA 2WBJD 3C5ZD 1XGYH 5FUOL 2Y06H 3TBSB 2BVUA 5JW3L 3L3JB 1A02N 4R4ND 5D7LA 3I6GB 2LAAA 5E8OB 4PLKD 4YH6A 4NKIH 3AS0A 2EC8A 3RWDA 5F89B 4WV1C 3FFDA 3O2DL 2W0FB 1J87A 4PP8C 3PHOB 1WEJL 1I1YB 1Z0MA 1AFVL 5I1JL 3CK0L 3B9AA 3F6IA 4KPHL 4DKFH 5D7IE 3UO1L 4WWKB 1LP9A 1IEAA 1D5MA 1X4YA 1JE6A 2DBJA 5KVDL 2CJUH 4U6VH 5DQJB 3P73A 4FQ1H 2GTZB 5FUCE 3QDJB 4OLZL 3LQZB 4JGJA 2EC9T 4HWBA 3AMLA 2CIIB 2PYFA 4ORGB 5DFVC 4MXQC 3AROA 3FQTB 1D9KC 4J6RL 1JGDA 2BVYA 2EYSB 3NTCH 3MMEA 4FA8A 4D8PB 2F54A 2R39A 3V6ZB 1KNOA 3VFNA 5DQ9A 4GAFB 3VD5A 5D2LE 3ZE0F 5C0NC 3T4YA 1VEPA 4MAYB 3QULA 2AAVA 4NQDE 1AKJB 2VDOH 2Z31B 3ERYA 3DX6B 4YX2H 3MUGA 2DIBA 2ZKHL 1TFHA 1YDPB 4MJ6A 4NQUA 1BMGA 3BH8B 4OIIH 1X5KA 1EGJH 1C7TA 1UXSA 3QWOB 2WWMC 3QIWC 5L6YL 3P40A 2V5SA 2AEPH 3H9ZA 3T09A 1TTUA 2EH8H 1KFAH 2X4SA 2X4QA 4H1LH 5CS7A 4NQEA 1JWMA 2Q6WA 4X4ME 1CGUA 3TV3H 1QVOA 4V1DE 5D93C 4JKLA 4X6FA 3EDJA 4R0LB 1UKSA 2FX9L 3EYUH 3GSUA 3L3DA 3VD9A 3WFZA 1RZIA 4ZQKA 3IF1B 1EJ6A 4XB7A 2NXYC 3ZE2F 3Q1SH 3ARGB 1KGCD 4MNHA 4CVZA 4ODWB 1BVLA 1TJHL 5TF1L 2KL6A 3Q5YA 3RGVA 1K8IA 1UH3A 3CFCH 2BY2A 1NCWL 4G9DB 1IGJA 3JWDH 1H3UA 2AJZB 1C08A 3L3OA 5E1AB 2NNAB 3WS3A 1FJ1A 3OHXB 3MRBA 1EO7A 3VWKD 2ZUUA 3CDFA 5IVOA 1X9QA 3T0EA 5F71A 5D7SL 4LQFH 4PRHE 5E8EB 3RL1A 2EIZA 1ZHKB 4BZYA 1TJGH 1ZGLB 2EYTA 4OB5H 4X7DC 1YNTB 3ARQA 2HWZL 5CP3A 3IJSA 3W9DB 5EUOA 1MFAL 2VERN 2ZOLB 5FGCE 4OZHE 2NY0B 3QXVA 1NBYB 2LU7A 4PJAB 2B20A 3ARBC 3PWNB 3BT2L 3BGFB 3IXTB 4FFWD 4WV1A 4UUJA 2OLDA 4M61A 2W0PA 1GC1L 2XKNA 5SV4A 3S35L 3CMOL 3QDAA 1RUML 3QWQB 3TH4T 1KTKE 3NCJH 4I77L 4O58L 3TN0C 4MCYA 4K3GA 3C9NA 1J8HE 1HHJB 3PP4H 1PW3A 1ORQB 4N90E 3HB3C 1A3QA 4L3ED 1KCVL 2PR4H 4MXVF 4YDVA 5DK3A 2YA2A 4FZ8H 4QWWC 2IFGA 2I9LB 4N0CD 1N59B 4MXQA 4E41A 2CH8A 4PB9L 4OGXH 2Y7QA 5HGDB 1J05A 3SPVB 1RZ7L 2VDQH 3F58L 4O51A 4EVNA 4HCRH 1D6EA 1OF2B 5CD3B 2HFFB 3BIKA 2BMKA 4JG0H 4UQ2A 5ILTL 1A6VH 3FN0L 4GQ9H 3E1F1 3S3JA 1HE7A 3P4OA 1J86A 1BZ9A 1KTLA 4YIQA 3VW3H 4QGTA 2ICEA 5CWSB 3WKMH 1ZA3B 1F4HA 3QIWA 4M3KB 5GRUL 3LV3B 4X6DB 4Z7QE 1RURL 4XMPH 4UTAL 5T33L 1JWUA 1KLFA 4E42B 2Y5TA 5KS9B 3O2WH 2VLRE 3VDAA 4LCWB 3QO0A 2HN7B 5JHDE 2BVPB 4HS8L 4IEFB 3RDTB 2X40A 2WAHA 3T2OA 3VFOB 3HA0A 2VAJA 5M7QA 4GKSB 1OAYL 2H45A 5JXED 4MZ2A 4QRQB 1WZ1L 3EFDH 4LASH 3MNVA 5SX4I 5CEXA 4IRJB 4PJ7B 5IHUH 4PJBE 4ZAKA 2Q3ZA 4FNLH 5LGKA 2ZG2A 5EUKB 2RJMA 2OXHA 4LVHB 5JW4Q 3FRPG 3PWPB 2BY3A 3BRDA 4EBQL 3MSPA 1KXTB 5ESVA 5HI4D 5F7LB 1R24A 3VXME 4X5XA 5I75C 3MV9D 3MXWL 1NH6A 2XTJB 1XF5A 1OARL 5I15H 2CGRH 5JMOC 1YEKH 4PJXA 4G43A 2FZ3B 1CDUA 2GFBB 2J1KA 2H1PL 4J3UA 3D39A 4RFEB 5TE4L 3JWNC 4NWUH 1I85C 1CZ8L 3BEVB 4EIZC 3OPZL 3QQ3A 2F53E 5EOQH 3WUWG 4F7EB 1R3LA 1UENA 1KIRA 3S6CA 2VLJB 1PYWA 1ZA6A 5J3HC 3FMGH 3O6KH 4JY5H 4AT6B 3U4BH 5IMKB 3EJYD 1AGBB 1XIWC 1GXEA 4ZUVA 5MEND 5DD0L 4JR9H 1T1YB 4PJHB 1GZPA 2QHRL 2BHUA 2JJWA 4PJ5A 3ZYJA 4RFNC 3CZJA 5H37H 2AV7B 1CICC 4EXPX 2F19L 4CGTA 5BW7A 4G6JH 4I0PB 1L6ZA 3EOTH 1FFPA 2X4RA 4JHZA 4KZEH 2PNDA 1QRNB 3O3AA 3MV7A 5KANI 2D31A 4HIEA 4P4KD 3FB8A 1N5YL 4Y4FB 4WW1A 5LBSL 2VDPL 3CVIH 2J6EH 3LS5L 2GTWB 2CK0H 5TDNB 2MCG1 2HJFA 1HCFX 4LVNB 3A6OA 1MJ8L 2JJTC 1OLLA 1KELH 2P7TB 4Z7UE 5IP4A 3CFJB 2P43B 2WV3A 1U8NA 8FABB 1OT2A 1M7IB 1UM5L 2NY5C 3NPSC 2BFVL 5CZXD 3TNMA 1NFDB 4GRMA 1INEL 4PJAF 4NQCD 4BUGA 1N64L 1WCQA 4KRLB 5T3XL 2BVQB 2DD8L 3QIUB 3IU3B 5T3ZL 1ES0B 2YPLD 4AZ8A 4PGBA 5GGUA 2GKIA 2HP4A 4LSTH 1P1ZA 4LSVH 3N85H 2YXMA 5EBMA 3FOLB 2CD0A 3PF2A 5F1NB 1AXTL 4J3SA 3GMPA 1FNSH 1UCBL 1U8LA 4WGVB 1DE4A 4CU8A 1NBZA 2VTFA 5IMMB 3TC9A 1KJ2H 3C8HA 2FGWL 1I4FA 3PDDA 1OL0A 3ZDXE 3VG0H 4HKZA 4L9DA 2ZNXA 4P9ML 3R0NA 5GQBA 3EDDA 3QPQD 1WCBB 4NKIL 4MDIB 5E6ID 4I48A 2VZVA 4D2NA 3DMMC 2ADFH 2HT2C 1RMFH 1KGCE 3FCTA 4MQ7A 5T1LA 4IIQB 4JHBA 4LLVB 3PQYE 4DKFL 3OL2A 5CHNA 1LO0L 1HXYA 1I85A 1OM3H 1W72L 3PGFH 1M4KA 4UV7H 4FFVC 4U6VL 3QNXB 3THML 5C0FB 4JJ5B 4MLIA 3V7AE 4JVWA 3HZYA 4R97C 3H9HA 4X6DF 1OW0A 4AMKL 3VFWB 5IR1B 2H32H 1XIWA 3NIGE 3NTCL 3C5SA 5KS9F 4C4KO 2GT9A 35C8H 2Y36L 1MHPL 4HJGA 5JO5A 3T4AB 4P5TD 4MX7B 4U1JA 3CU1A 5EB9A 1CICA 4NO0A 3V79C 1VFBA 4Z7NF 3MRMB 5ADOL 1P6FA 3KLSA 4PJ7F 4H8WC 2GQHA 5IM7B 4D9RE 1EGJL 1I9JH 3VMNA 5DHVH 2KZ1B 4PGEA 5HVHC 2H8PB 5DT1L 1JK8A 4K9EH 4Y7MA 5DUMH 5H35B 5JOPD 2JJTA 5JW4M 3KYNA 4MD5B 3D3VD 1VGKB 3LAFA 1NAMH 2GI7A 1TQCC 4APQB 5H8DA 1SJEB 2PO6C 3MLWH 1MI5B 3BKMH 3FAXA 4YLQT 2MQCA 3ARDB 4H25A 3O3BA 4PREA 4Y5VB 3UROR 4BH8B 4MVBD 4EN3C 5BRZA 5JDSA 5IEHB 2J12B 5I1LA 3VD3A 3MV8A 3BAEL 2SEBB 1ZOXA 3JWDL 2ZOKA 4IS6B 3R8QA 5J4MA 1GGCL 4WY7L 2RFXA 1A7OH 1YN6A 3QCUH 1YMMD 4GAYB 1GGYA 4U3CA 4EIGB 4LQFL 4PJHF 5CGYC 5GGSY 2Z91B 2OX5A 1TJGL 3E8UH 43CAA 3FHAA 4LNVA 3MUY1 3U7YL 4G6MH 4ZS7L 3SBWC 4OKDA 3FKUS 3QUXC 3O6FC 5FGRA 3KLAB 3GIVA 2H6PA 4POZD 3NGBC 1HHKB 3H7LA 4L4VA 2D7TL 2DQDH 4NM4L 1GYAA 1BBJB 1NDGA 1AY1L 4NRZA 1KEML 1S7UB 1EBPA 1QEWA 4P2QE 4Y4KC 3NCJL 4MNGE 3U0PA 3N50A 3T0XA 1KPRB 1MF2H 4U1KB 2WY3A 1A4JB 3PP4L 1FRGL 5HI5D 1A6PA 5AEAA 2E7LC 5KW9L 5GRJL 4C55A 3O4OC 4L8DA 4Z78B 4LBEA 4Q9RL 1CWVA 5TFSH 2DQCH 5EZIH 2Z35A 1KTDA 3FB7B 4FZ8L 1LQVA 4LU5H 1NFDF 1SVCP 1C16B 4NNXB 1KLUA 1HQRA 4A6YB 2XACC 3MV9E 2NTFA 1A3LH 5E95B 2R15A 3VXSB 1L7IH 2VDQL 5IVZB 4M6NH 4NGHL 1EK3A 3DGGB 5KSAB 1HINL 2DLIA 1XEDA 3D25A 4N5EC 1IQWL 4J4PA 1A6VL 3FO9B 4K8RD 4GQ9L 4KQ4H 2XWTA 4S1RH 4IMKC 2WINB 2DS4A 4U7KA 2EEAA 1A4KA 1OCWL 1WWCA 4CMHC 3BP7A 2X1XR 5T1KB 5FCSH 4XMPL 5E2WH 3DETC 1A21A 2GSGB 4LKCA 1REIA 2R1YB 1CU4H 3S37L 2YD2A 2D4DA 4LLQA 2PO6A 1HH9A 1DQLH 2ZUSA 3L7FB 4LPVA 5HYFA 4LASL 4X6CB 5D72H 3LQMA 1UYWH 1TZIA 5B3JF 1R5VA 5K9QG 5JOFA 1AE6H 2B5IB 2DJSA 4NHUA 1DUYB 3L9RA 4X6BA 1QLRA 3VGEA 2PUQT 1G6RB 3AY4C 1LDPL 4Z5RB 1OAUH 1NGXA 2ZCLH 3I02A 3ZE0E 4L4TD 2B0SL 2HTLC 3WNOA 3ES6A 4JFZL 2DTMH 5I15L 2CGRL 1WAAF 5ITFA 1YEKL 4LDEB 4WFFD 5D7LB 3WLWC 3GRWA 4ZUSA 2IG2H 4Z0BH 4JFFD 3K8KA 4DKAA 3S8WA 2VITA 4W6YB 3RWDB 4NWUL 1EHLH 3P0YL 3SBWA 3TBYB 3QUXA 1AQDA 3ARXA 1KIQA 1IM9A 3HMWH 1P6AB 5D1XD 3EO1B 4I5BA 1U8OA 4NQXB 4M62L 3C6SB 5KN5B 1QSFD 1LP9B 1IEAB 2M8XA 4QRPD 1D5MB 1EH9A 3U4BL 1FQ9C 4Y4KA 4PYGA 4WFGD 5IUSA 3P73B 4JN2A 4ZXBD 2B4CH 1XGQA 3OKEA 4K7PL 5E9DE 4MQXC 5IVNA 3VXPA 5H94B 4JZNA 3ZE2E 5MEQA 1NGWA 4UI2A 3X11A 5HVFB 2PYFB 4YNYB 4QRSA 2X4PA 2EDKA 3T65A 2HRLA 1JGDB 2R0ZH 1ZANH 3IDYC 5FOBA 1ITBB 3RKDD 2F54B 4YDLC 1J5OH 2O26U 1KNOB 4KZEL 2OR9H 4XH2A 1A8JH 3T4YB 4DGYH 4BM7A 1SMOA 1KJ3L 4ZTPH 3MGOA 2MSPA 4JFPA 4QXGL 4N5EA 3CVIL 4MJ6B 1U93B 1UXSB 2YRPA 2HLFD 3AREC 1DJSA 1RUQH 3QEQA 5DMKA 5IB1A 2X4SB 2XRAL 4OCMC 5I16A 1I7UA 4KXZH 3SDCD 4NQEB 2NY2C 3TJHD 1JWMB 1OD9A 3AB0B 1RIUH 1JPGB 4OSUL 2Q6WB 4F8QA 4XCYA 1QVOB 3BISA 3W0WE 4X6FB 4ZNEA 2MTPA 3L3DB 3ZT7A 1X5ZA 1SVZA 1RZIB 4ZQKB 3QJHA 2VDKH 3PDGA 4MA1B 5L9DH 4CVZB 4MNHB 1GVIA 1T2XA 1BVLB 3BUYB 4LARL 3H3KA 3RGVB 1K8IB 3QWRD 3HCVA 5B22A 5FO8A 3KLHC 3TF7C 1IGJB 3F7VB 3KXFB 4JM4L 4XP1L 5F7KC 4MQSB 4OFYD 1LGVA 5C86A 1C08B 3L3OB 5FM8A 1F4XH 1YNKL 1FJ1B 3D2UD 3MRBB 3PHSA 1B0GA 1MFBH 5FOJA 5GGRA 2NY7H 4PLOB 1OPGH 3W5NA 1LNUA 5T1DH 1GL4B 1KJ2L 3ARZA 4FS0A 4YQXH 4PLNC 3AY4A 2EIZB 1ITCA 5BVJA 2Q8AL 2EYTB 3QQ9D 1CD0A 1SYVA 5JOPE 3VE0A 2EDHA 5EUOB 5FYJH 1P84K 2ICES 4NUGL 5DUPH 4M7ZC 1P7QD 4U6TA 3VFRB 5CFHA 5A2LH 3OKNA 4WV1B 4D0BA 4TOYL 4M61B 1MSPA 2XKNB 1U8QA 2VZ3A 1KXQE 1R3HB 4U3XA 4MCYB 3C9NB 2D2OA 2FEEL 1J9CT 1BHGA 1JGVH 3V5HB 4AQ1B 2YHGA 2R8SH 4J12A 3B43A 5F88B 3L3IA 5FYJE 3FRPA 4YDVB 4C56E 3OAUH 3WNNA 1HNGA 4NNPH 3UZQA 4YFDB 5ERWB 4PIRF 4EUPB 4KDVA 1T2QH 3MRQA 1JGUL 4X8JB 3RIFK 3WHXB 1D9KB 4HZLB 3BMWA 2Y7QB 4HSQA 1J05B 4WDIA 4M4PA 4O51B 3BJ91 3TBVB 3E2HC 4X6CF 1JPST 4EVNB 4M1CD 4WI5A 1KLGB 4ZOEA 3SQOH 5ETUA 4BSVA 4M7LL 3BIKB 3B8YA 2FHCA 2BMKB 3D9AL 4UQ2B 4D0CA 1DQQA 3CAFA 6FABL 5L88H 4PGDA 1LEKA 1PDKA 2CO6B 1ZVYA 3WUWA 4KK9D 3P4OB 4QXWA 1KTLB 4K9EL 2ICEB 2AV1A 5IEKA 2OK0L 3VI4F 2MNUA 3QIWB 3AREA 2BNQD 1A3RH 4K8RH 3MLSH 5ITBH 1NAML 4UIMA 3QRFM 1JWUB 3MLRH 1S9WA 2FSEB 1A5FL 2Y5TB 1AXSA 5D93B 2J88L 2VWEC 5HGBB 5HVWA 1OAKH 4TYUA 4M7KH 5ECJE 1QBML 4YHMH 4O02H 2NX5E 4FXGA 3U6RB 5CEXB 3VWJD 4OCRH 1IL1A 2F5AL 3QCUL 3TF7A 3OKDA 1FYTD 1KCKA 4YHIB 1EHAA 3WIIH 4JLRA 1EEZA 5D6CB 3NCBB 3BVNB 4XHJC 2AJVH 4NQTA 1XFPA 5ESVB 5IV2A 1FCCA 2WUCL 4IDLA 1R24B 4FMKA 3UTSD 5IB3A 4X5XB 4R7DB 4F7CA 1TNNA 5I76A 1JYNA 3TCLB 5FF6B 1XF5B 3NCFB 1OWRM 2W65A 4NO5A 1DANU 5C07D 3RA7H 4PJXB 5FKAA 2ZUYA 3BKCH 1GGTA 5BXFA 5JIIA 1X44A 3D39B 2VQUA 1CXFA 2BSRA 1TVHB 4IRZL 5F7WC 3SKOA 4DOHB 4NDMA 3ARBB 3D1MC 1R3LB 1KIRB 3QHZH 4PJEB 3QFJA 1JZ5A 1PYWB 1HYSD 1ZA6B 4JY4A 4MJIA 4YDJA 1JNLH 2RR3A 5F7DA 1C5BL 1CG9B 2HH0H 3TN0B 4JG1H 4ZUVB 5C2UB 5HHXH 3IT8D 3ARWA 3A0OA 2XZZA 1FE8H 4ODUA 1GZPB 4FQLH 4XHQA 3MROA 4PJ5B 5C0EA 1NKRA 3UXFA 5HXMA 2BVOA 4M6NL 3HZMB 5L2JA 2VL4A 2FYYB 5ELIA 1MH5A 3OB8A 1KENL 4XCCH 1WWWX 4DVBA 1MCCA 4KKLD 4JFFE 1FFPB 3ZL4L 5A1AA 1CQYA 5IFHH 3GMNA 2IF7A 1MCPL 2P45B 1CXIA 3HRZA 4HIEB 4NJ9L 3FB8B 1U42A 3E2HA 2IANB 4NKDA 1J8KA 4WW1B 1P2CA 3AS1A 1G7MA 4S1RL 1QSFE 4V2CB 3GK8H 3N06B 2HJFB 2VQTA 3DYPA 1IC7H 2JKXA 1Q9LB 4S2SA 1AXIB 4WFGE 1S5IL 1DVFC 3V52H 4KDTC 2HKFH 4XPBL 4D9LH 2L4OA 2BXYA 1KV3A 1EPFA 5EUOF 5F1SA 5FXCH 4P2RD 1CU4L 3TNMB 1NMCC 4GRMB 3LKSB 5DMJB 1KCGC 3SKUD 2O61A 2IQ9L 3RZWA 4V2BA 1R3IL 1T1XB 3U79A 4KJPD 2A9MH 4PGBB 4BJLA 2NY6B 3QBTB 4UBDC 4X6DE 4DW2H 2FH8A 1B9ZA 1P1ZB 2DQHH 1AE6L 3F62A 3O81A 1Q9WB 1F6FB 3M8OH 4J3OC 1N5AA 3GMPB 4LCWE 3D5OF 1U8LB 1A7RH 1NBZB 2BNRA 3BIBX 5DURB 1I4FB 3WFBL 2D7OA 2DTML 2VDRH 4PLJC 1JP5A 3OR7B 4HKZB 1MLCA 5I75B 3OZ9H 1G7HA 4I0KA 4PJ7E 2D0GA 4YZFF 5CMAA 5C6PB 4I48B 1J7VR 3T3MF 2F58H 3BJLA 3C60A 3GI9L 3OGOE 3TFKD 5I9QC 3FCTB 4MQ7B 2OL3A 5T1LB 4AIXA 3DX9A 1RK1A 1TENA 2I24N 4KKAD 1BQHG 5DJDA 4UILL 4XP4H 3KNBA 4NC1C 5L8LB 4MJ5A 1N6VA 4PV9A 4JE4B 5KSUA 3MLUH 2AEQH 3HZYB 4TTDD 3H9HB 4Y5YC 5FGSA 5J1SC 1NCAH 3AU1B 3QT2A 2VZSA 1SEQL 3GBNH 3VA6A 1XIWB 4X83A 1S7WB 2EO9A 2R0ZL 3C5SB 3RVUD 3VXNB 2VLJE 3HRPA 2GT9B 1MCBA 5ACLA 5CJBA 3SKNA 3DUSA 3LVEA 4JFEA 2HKHL 4R4FH 2OBGA 3REVA 4DGYL 4U1JB 2ZCKL 1ZWIB 1CICB 4NO0B 5C0AA 4XP5H 1I1AC 1VFBB 4FQCL 3R06A 4X7EC 3QUYA 1B0RA 1T03L 4RA0C 4HIIA 1EJOL 1X5AA 2A0LC 3EDFA 4PGEB 3BP6B 5E5MA 1K6QL 4Y8DC 1K85A 4PJFA 2DICA 4KK5D 3TWCH 5C6TL 1JK8B 3LKNA 1GZQB 1S7TA 1T7WA 2H2SD 4YDKL 1QRNE 4KI5D 2D7MA 2NPLX 5M94B 4JFOA 3SDAC 2XXCB 4LHQB 4P46C 3KYNB 1DVFA 4PJXF 4M43H 4TRPL 3OKOA 1FO0H 3CC5A 4JPVH 1CS6A 1F3JA 4X6EB 4U1LA 1OP5H 1WGOA 4PG2A 3NPSB 5JDSB 1OD7A 3HLAA 4Y4HC 3MV8B 4PJEF 1RZFH 2ZOKB 5TE6H 2V5RA 1V3LA 4XPTH 1IARB 2DOCA 2DMCA 2AW2A 5KVFH 5K9JH 1VFUA 2RFXB 1NFDE 1MFBL 2NY7L 1YN6B 2VR9A 2Y4SA 5D1QA 3ULUC 5GRYA 1DL7H 2P8MA 3LKRA 5H37G 5BOZG 3TT1H 43CAB 3S5LG 4IMLB 2MCPH 4XNXH 4PP2A 3C08L 5EBWB 1RZ8B 2OM5A 5EC2A 2H6PB 1CR9H 5AYUH 1GRWA 1UM4L 4HPOL 4L4VB 2BSTA 1R3KB 2A83A 4QYOB 5ISZA 3KPSA 1QBLL 4FZEL 1NDGB 5MEPA 4NRZB 3MJ8B 1RIVL 1QEWB 1BD2D 4NT6A 1FZMA 4KUCF 5E56A 4K3EH 1DLHB 3U0PB 4HJ0D 3AFLA 1UCTA 1K3ZA 3WEXA 2CKBB 2DTSA 1MCJA 4BQCA 4X7TA 2R8SL 2B2XH 4HKJB 1FYTE 4DEPC 1I1CA 2D3VA 1MWAL 1QLFA 4LBEB 2Z35B 4PJGA 1Z5LA 4R97B 4NNPL 4Y5YA 1V5JA 5GSRA 1KLUB 2NTFB 3KGRA 3CSBA 2A6JA 1KC5H 4L5FL 4V3EB 4CN6A 2J8UA 2P8LA 2ATKB 4L1HA 5DQDH 4JRXD 4LSPL 4F15C 2JE8A 4HKBB 5L88L 3WS6C 5C7XH 1V7MH 2XWTB 1OSZA 3TT3H 4NWTH 4KROC 3MRPA 5EU5A 1KOAA 1U8IA 2UWEA 4LIQH 4HW6A 5HI3C 1A3RL 4U33A 3QIBC 2J3SA 3BP7B 3I3EA 5CJOH 3NA9L 1IAII 1RPQA 3MLSL 4JGUA 3CLEL 1PZ5A 1WWBX 2WUBH 2QSQA 3JTTB 1G84A 3SDAA 1KULA 1PVHA 4LKCB 2GSIA 1Z9MA 4P46A 3CH8A 4KV5F 3T0ED 1G7PA 5FO7A 1TQCB 4M7KL 4LLQB 5TPWL 1LE5B 2PO6B 1RJZA 3O9WD 5JR1H 1A6UH 3NZ8B 4YHML 2ED9A 1KPVA 5A3IC 1KCUL 1T80A 3DXAE 4KKCC 4O02L 1TZIB 1S7XA 4OCRL 3TYGH 4KZDL 5JOFB 4H20H 4NHUB 3RHWK 3L9RB 4X6BB 3WIIL 3D87B 4WEMB 5DK2B 1NGXB 1IBGH 4K71C 5GISH 3PXJA 5FUCC 3I02B 1FIEA 1KN2H 2EXYC 5C0CD 3BWUC 5C92A 4M7JH 4MQTB 3HE7A 5GJSH 5J8OA 3MRDA 5ITFB 4Q9QL 4HV8A 2E3VA 4ZUSB 4P2RE 5JHLH 3WJJC 5DXWA 3LMJH 1JYVA 4QNPF 3SE8L 2Q7YB 1F2QA 3QUXB 2NYYD 3FO1A 3O6FB 1KIQB 1IM9B 4OCNC 4W70A 4I5BB 1QNZH 1U8OB 3NGBB 4RNRA 1NMAL 2CUHA 4QY8A 4PRIA 1A6TA 1JNLL 5MERB 3K74B 1YEJH 2EIDA 4XXCA 2N1KA 3ARPA 4Y4KB 2VUOA 4D94A 1NLBH 4JN2B 4JG1L 1HQ4B 1JZ3A 1XGQB 3OKEB 5HHXL 5MEQB 4JZNB 5E5UB 1N26A 1NGWB 2GY5A 3FQNB 2I9TA 3D0VA 4QRSB 4MD0B 3QAZB 2X4PB 2P5ED 5DZLA 3T65B 3WN5C 5FOBB 4XCCL 2YRZA 3G6DL 3L5JA 4TNWF 3EZJB 1X5YA 4MNQD 3QCVL 4XH2B 1CYGA 1CFSA 3QH3B 4GW5B 2W60A 5AWNH 5F70A 7CGTA 3ZSTA 3VFTA 4UDTB 3MGOB 3B9EA 4GAJH 4JFPB 1S78D 1ED3A 3ULVD 3IKCA 5E99H 3U0TB 3O45A 5A40E 3UTTB 3WS6A 4KK6D 5DEGA 3CXDH 1SHMA 3WFDH 3RIAF 3VXSE 2V7NA 2P48B 4YGAB 3QEQB 1IC7L 5DMKB 5IB1B 1JUFA 3LEVL 4S1DC 5I16B 4D9LL 3RZCC 1I7UB 2VLLA 3LB6C 2J4WH 4CMHB 1UB5B 4UIKL 4XCYB 3LRHA 2Q20A 4ZAKD 4XBPB 3MRIA 4RX4D 2AXFA 3QJHB 1ZT1A 3KPRD 4LFHD 4XZUA 2EYRA 2JTDA 3PWUB 3JWDC 5IB2A 1PSKL 5HD8C 3QDGA 1I1FA 4NCC1 2ZG1A 5ICZA 3IFLH 2BHYA 1UEMA 4P23A 3HCVB 3O4LB 1G6RH 3HR5B 1WUNT 5ESAA 4JANA 1A7RL 5D7IA 1U2CA 4UNVA 1DQDH 3RWGA 3T2NL 1LNUB 4WFHD 4CJ1A 5BVJB 3DBXA 5B4MD 2VDRL 3SO5A 4KI5E 4X6CE 5E2JA 4WHTA 3LSOA 4MZ3A 4O9HH 3G6JA 3VE0B 1OWWA 5GS2D 4PJ9A 1ZKAA 4YJZL 1OP5K 4FABL 4WU7A 5E70A 3MOAH 3ZKSD 2HJLA 3WJJA 2D0FA 2RBLA 2APTA 4QT5B 1BVZA 3IFPA 3OKNB 4D0BB 2UZXB 3VI4E 1VACB 4XP4L 3B8SA 1U3YA 1U8QB 5EO1A 4XAKD