4NQXA

Crystal structure of hla a*0101 in complex with np44-s7n, an 9-mer influenza epitope
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Preexisting CD8+ T-cell immunity to the H7N9 influenza A virus varies across ethnicities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 70
structure length 274
sequence length 274
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqxA01
4JFEE 4DW2L 2VDKL 1VFAA 4KRPD 3SE8L 3P11L 1V5JA 2GTZA 5EOTB 5JOFA 4RWHA 3DJ9A 4PTUA 1AGCB 5I6XB 4YHPA 1MIMH 5SWZE 5I1LB 1CICD 4P3CH 1YNKL 5BRZD 5A1AA 3L5HA 3PDGA 4X8JA 4WI5A 5TQ0H 3SDXF 3WFEL 1ZXQA 4M62H 4PJIA 4AENB 4Q9RL 2CDFA 3MBEB 1C08B 3GSQA 4Y4FD 1I9EA 4FTVE 3LVEA 3P4OA 3HI5H 1Q0YL 5GHWL 3QAZB 5HHVH 4KZDL 2W9EL 3Q3GA 1NANH 3MLZH 1BLNA 4NJ9L 3T0ED 1CDYA 4C54A 3QUKA 2KBGA 4JFZH 4H1LG 4KK6C 3O6FD 5D1XD 3NAAH 3C60D 1GOFA 3SHSA 3QFJE 4P2OA 2PCPA 2A73B 43C9A 5FYKD 3T77B 5D7IA 5E9DA 4GS7B 3LV3B 4P46C 4JKWA 3BKJH 5DJ0B 4RISH 2BY0A 4ZPVB 3TN0B 4RSVA 1FFOB 4PJDB 4S0TD 4TNVK 5KOMC 1SEQL 1RPQA 1X5KA 4K71C 2VLRE 2P5EB 3VRLF 4XH2B 4NGHL 1N2RA 1F11B 1BPVA 1KIQB 1DFBH 3K4AA 3ZTJG 2AEPL 2IPKB 5HDLA 4MAUL 3LIZH 1MAJA 4NKIH 3U9PL 3VGFA 5FO8A 5C8JA 1CD0A 1WCQA 1L8JA 4RGMC 1NFDF 4WWID 2HRPL 2I24N 3FONA 5D2NA 1JN6B 1QNZH 4TUJB 1ND0A 4LCYB 1T89C 1BHGA 1OARH 3ZDZF 3P30H 4DAGL 5DD5L 3EYSL 1P1ZB 4I0PC 5FAAA 4WNQB 1RIUL 2UWEB 3RY6C 5E2VH 3T3PF 5MENE 5FCUL 4ISVB 3QNZA 1CFSB 3W0WB 1GZPB 1T1YB 5GPRA 4U49A 2D03H 4X9FA 4P46D 5CGTA 4PJGE 5J13B 5IEKB 1NAMA 5EZIL 4X6CE 1JMZA 1QKZL 3VE0A 4DK6A 4PGEA 1FL3A 1CXLA 3PL6C 1FNHA 4S1SL 1FNAA 1TQBB 4XXDB 4J8RB 4M1CC 1YEEH 3B2UC 4FFZL 4LFHD 4HKZA 4NHUE 3PABA 3OZ9L 4R4BB 2X4NA 1RSFA 3SDCB 5K9OB 1QP1A 2F8VA 1MRFH 3WV0A 2IEPA 2QADB 4O2FB 2R0KH 1EBPA 4HZLA 2VLME 2FZ3A 4Z18A 3QUML 5AAWA 5LGJA 1N0LA 1J8HD 2EDWA 4QHKI 3BP5B 3SGDI 1MCNA 4HJGB 4I0PD 1EEZB 1NCWL 1YYMH 3ARBC 1QPPA 3RI5F 5IIEB 3OJMB 1KCVL 3H9SE 1KELL 4ZFZA 1HEZA 5CEXA 4YZFE 3QDGD 1MI5B 4WUKH 4Z7UA 1KTKE 4KTDL 1HN1A 1JF5A 3X11A 5EU5A 3KPRB 3IVKB 1RVFH 3MOAL 4XBPB 1B2WL 1Q9KA 4PJCA 4QXUL 3QHFH 4JFXB 3EOYG 3UX9B 4EI5A 4Z5RA 3LN4B 3TYFB 4NQDE 1P4LA 4U7KA 4OCXL 4M8QA 2HT4C 4UOW0 1BD2A 5ESVA 3WO4C 1JWUB 2NY0C 3BPCA 1Q0XL 3HTLX 4L8BA 4M1CD 5GGUB 3B2UD 2APWA 4H8WL 2EDNA 4YX2L 3MACH 3HNVL 4L1DA 3GB7B 2MQ0A 5SX4H 2Y1VA 3I3EA 1E0OB 4MA7H 1N5AB 2BC4A 3QO0A 1R3IH 5EUOE 5I71C 5DEGB 2BHYA 2VDOL 1CN4A 1A6WH 1SBSL 4NQUA 4BUHA 1M7IB 3GJFB 2WUCL 1EEQA 4TPRL 3O4OB 3L7EB 4HH9A 2DQTH 3C5JB 5IMMA 3ARBD 4X7TB 3L3GB 3BAEL 3FO2A 5IB3B 3UYOD 1U93B 2AW2A 4CW1B 1R3LB 1F13A 3D87B 5A2JH 3FFDB 4JJHA 4OLXH 3B5TA 1CBVL 1FVCB 2GITA 5E7BA 4JO2L 3MRCB 4JY6B 4L4VA 3LKPA 1EFXD 2ZKHL 1FBIL 4OIIL 3T4YB 3WUWG 4YAQA 2HT4D 1C7TA 3FO1B 1DE4B 1A1OB 5HBBA 5ERWA 3U0PB 2CKBH 2BZDA 2NY0D 4RFEB 3SKUD 4MCYB 2XRAH 1NGYB 3DIFB 4JFPB 3UTPD 4CDHA 4OTXH 3I02A 1SJEB 2H1PH 3MUHL 5FFLA 2BVPA 2DQDH 5FA3B 4X4YB 1MLCB 3QI9C 2NY2D 5AEAA 1HHGA 4K9EC 4MS8D 4GG8B 3S96B 1NCCH 4JQVC 5TE6H 3DUUA 4HUNB 3QCTL 3LSOB 1FQ9C 2JELL 1K5NB 4CVWA 5DT1H 1OGTB 4H25B 1VGEH 3GRWH 2V7NB 3SKNA 1FNFA 3UP1A 3CVIH 4ZS6C 2OTWB 1TZHA 3V4PL 4O5LH 1AGFA 2HVJA 5DQDH 3RGHA 2DQEH 5I30L 1GGBH 2FGZA 2GSGA 3GI9L 1QSEE 3BP6A 3WO3B 2FJGA 3MRJB 2G5BB 3EGSB 1KTDB 4OGAC 2FYYA 4LGPB 5ESQB 4OLZL 4GG6E 2BNRB 3F5WB 1FGNH 3MNZB 4ZO6A 3KJ6H 2VDLH 1MCPL 2CLZB 4P4KC 5ANME 3RJQB 3MRQA 1LEIA 4NNXA 1H8NA 5HYSB 1V8HA 1XF3B 2CXKA 3QFJA 4M6OH 5C6PB 5KANI 3T4AA 1S9XA 4UT7H 2KQMA 1FO0A 3LPWA 2VDML 5J56B 5FECA 3RTQC 5C2UB 4U1KB 5GS3A 1CLZH 3DRQB 4ZFOB 1RUAL 3BKYL 3HUJA 3GIZL 4JO1H 1VFUA 2YR3A 3WXWL 5JLZB 1LVEA 4PIRF 4I18A 4JKLA 4HKBB 2V7HB 1ERNA 3BQUB 5FO7A 4FQ2L 1BJMA 2DWDB 3TF7A 5TE7L 3MRDB 3VXMB 5I66A 1J5OL 4E41B 1KB9J 3JBG7 4ZS6D 5HYQA 5F9JB 1UKQA 1EHXA 3LEYH 2P8MB 3U7YH 1OP3K 2H45A 4HWUA 4XC3H 4DVBB 4L4TB 5FV1L 5FM8A 3O8XC 4JRXE 1MFBH 3K81A 2DQCH 1VACA 3MLVH 4R8WH 2BNUA 2GEEA 1AXIB 1Q8MA 1B0WA 4EOWL 1A7OH 4QKXB 5DURB 2VXQH 4KAQH 4AL8H 5C08D 4X99A 2BSSA 2XZQH 4ZXBA 5E5MA 5FDWA 4P4KD 2V9QA 1KLGB 1HI6A 2B5IB 1PGRB 1T3FB 1UG9A 4GAJL 1CR9L 3B8YA 1A6ZB 2C3VA 3BWUC 5HVFB 4HIIA 1S7QA 4L29B 5F7EH 5C1MB 3MLUL 5JNYA 3RUGE 1KT2A 3L6FB 1IGTB 5IMKA 4EDXA 3UPCA 3ERYA 5ADPH 5EDXA 1JNHA 3RZWA 3TNMA 4O9HH 1JTPA 4NO3A 3PQYD 4G8FB 5F1KC 5HYJA 4IIQB 4PY8I 4PJHF 4CN6A 4I5BA 1EZVY 1MIML 4F80A 2LE9A 5KJRL 4P3CL 2F74B 1GC1L 2J3SA 1ZLWH 1EO5A 4YDVA 2HLFD 1UM4H 5TQ0L 3CD4A 1I9JH 4MDJA 2GTWA 4M62L 5C07B 4KRLB 3T2OA 4P9HC 3O8XD 4MYWB 1AE6H 4ZFOL 3IJYA 1U8IA 1D5BB 1R3HA 5CEZH 3HI5L 4H5SB 5HHVL 4H1LH 2ENYA 4TSBL 1IGML 2BRRH 3BWAB 4MVBA 4XNZC 1FDLH 4LKCB 1XR9A 3E6FA 5IB1B 2P8PB 3OKDB 3HPJA 4JFZL 1WBZA 4GAYA 3NAAL 2FBJH 3BD3A 2KKQA 2ICWI 1UH2A 1Y0LB 4MMXC 5JO5A 4PLKC 1Q1JH 4A6YB 1S7RA 1YEDA 4RFOH 3DI2B 5JHDA 3BGMB 1RJZA 5IOPB 3BIAX 4RISL 3MPCA 5DK2A 1RZGA 4J3WA 1OD7A 4NKDA 4QOKA 2ZCHH 2W92A 3HMXH 3F58H 3AS3A 3BYTA 2PN5A 4LOUD 1IGJB 4RNRA 5DR5L 5IBTL 3EDFA 4KFZC 3UPAA 5BV7H 1UZ6E 2PR4L 1DFBL 2Y07H 3LOWA 4OFYD 3IRPX 3LIZL 4NKIL 4QRSB 1JGEB 3U1SH 4PRPD 5D7LA 5KSVA 4HFUH 3VA2C 5IHUH 4UIKL 2IH3A 3H9YA 1QLFA 2E27H 2YD3A 3BXNB 1QNZL 1OARL 3K2UH 4FZEH 4M7KH 4L8SB 2FLRT 3X3GH 2WBJA 3EO0B 3P30L 4M7ZB 3RL1B 3D3VE 3N50A 2X09A 1R5IA 2R1WA 1UVQA 3R06B 4KI5E 2Z8RA 1PD6A 3GSXA 4KUCF 4IRJA 1WZLA 4G42A 1S7SA 4OLWH 5E2VL 5HHNA 1P84K 4L3EB 3RZCB 4G8GA 3KXFE 1VFBB 3BEVA 4LVNB 4EN3C 5D8JH 5B8CC 4OKVA 4U4BA 3TH4T 4PLKD 5FKPB 5L8JB 5E4EC 3FZUD 4G3YH 3E2HA 1XCQB 2WUBH 2V2XA 2WIIA 4MHHI 4UINH 4YDIL 4YQXH 1FZMA 1B0RB 4NQSB 3IXTB 4JVPA 4MAYA 1W72B 1MCKA 3ZKNC 1A3QA 3UTSE 2ZNWA 1JNLH 1KCLA 1NGXB 4F33A 5ID0A 1S9VB 1WVZA 4XHQA 4OV5B 2PW1B 5HI5D 1UJTA 3RL2B 4NCC2 1JVKA 4Q6IC 3U4EA 5CD3A 5IFHL 3IGAA 3VCLB 2OZ4H 4WO4B 5JW5B 1CGSH 4XAWH 5E95B 1J87A 2DWEA 2YWYA 1B4JL 3G5VA 2N4IA 1KIPB 4AQOA 3B43A 3BT2H 3GSOB 3MNWB 1KUMA 4ZSOE 4YIQA 4F7PB 4RX4A 1XEDA 2LVEA 4ZUSB 4DOHB 3IFLH 1N5YH 3ALPA 4P2QA 2H32A 1BZ7B 3PHOA 2HFFB 5AD0A 3W39A 1U58A 2VLJD 4ZUUA 4MNGE 1K2DA 1YYML 5H35B 4WU7A 1IC1A 4ZUWB 2JTDA 5DJAA 1MUJB 4WUKL 3VWJB 5T3XD 3FN0H 3FRPA 3T8XB 5AZ2H 4EN3D 5F6IB 4CBPA 1JHTB 1RVFL 1I9RL 1L7IH 2PYEB 4HS8L 2XY2A 1N7MH 1N8ZB 3WS6A 3LKOA 4R3SA 1FIGH 2XFXB 1G7MA 2IAND 2WBKA 2CD0A 2F54E 3ZKND 5ANMA 1I3GH 4MQTB 4FOMA 1OTSD 1S7VA 3PGFH 1BOGA 4NBYB 4ENEC 3F7QA 4JZOA 5I1GH 2NZIA 1CFQA 3C9NB 3V5KA 4OAWB 4X0KA 2HJKA 1W72L 5EBWB 4ZOCA 2QV2A 4ZDHB 4YR6A 1T7ZA 1U91A 3CX5K 2IWGA 4WV1A 5DA4A 1SM3H 1A6WL 2RJMA 1F6FB 3K7UA 4HK3N 2NNAA 1T1XA 4G8IB 2NLJA 1AH1A 4NKMB 2EE2A 1I7UA 2HYMA 4JR9L 1PX4A 4MD0A 4YWGL 3DRTA 3G6DL 3VFSA 4OT1H 3LMJH 4JHZA 1MWAB 4UUJA 2AJ3B 3RAJH 5DSCB 5BS0B 4ZUTB 4OLXL 2CIKA 3SCMA 4F7EB 4S10A 3UC0H 1OSZA 2WM0A 4OB5H 3MGTA 1G9EA 5C2BH 1GL4B 3T0VA 5C0DB 1LD9A 1T0PB 3QUYC 4F15C 1AO7E 2CKBL 3E3QE 3VXQA 3X3FH 3QEQB 2CK0L 2FD6L 3OF6D 3C2AH 3PNWB 4OTXL 2H1PL 2AV1B 4Y19E 2DQDL 3P0VH 2CLVB 2PW2B 3GJFK 3QQ4A 1RZJC 3C8KB 3MV7B 2OI9B 4V3EB 1BVKB 4GMTH 4U1HA 3WIHH 3MNVA 4ELMF 4TVPD 5DT1L 4HIHB 1RAMA 4U6HA 4CMMA 3KLHD 3D2UB 4KDWA 3CVIL 3S3PA 3TV3L 4HCRA 5I1AB 1GXEA 5DQDL 2X4OA 2EXWD 3D25A 4QYOB 3ARED 1GGBL 2OL3A 5D96B 5E70A 4CU6A 5CAYB 1HH6A 4LCWB 5J12C 3NN8B 2ESVB 1MHCB 5DHVB 5I2IB 1WFTA 1FGNL 3KJ6L 4LLYA 2FEEL 3O3BA 4Q6YA 5EIIB 1A5FH 2AGJH 4X98B 1T5XB 2J5LB 1V7NL 4P4RA 3OPZL 5HPOA 4JM2F 1IM9B 3QUYD 1QHPA 1MWAL 4QHLB 4HUWB 4P57A 3PWPD 2FX9L 4NRXB 4M6OL 5CD5D 4R4FH 5FM4A 2VABB 1XH3A 3LN9A 3DHJA 2X4SA 4DZBB 4JGUA 3GSVB 1FZOB 1FYTE 4BFGA 4OF3A 5IUSA 3V8CA 2DQGH 1CLZL 5GZOC 5E99H 1VB9A 4JO1L 2GW5A 2P7TB 1AI1H 1YN7A 1H3XA 4PP1D 2FJHB 4YHML 1FFPB 2VOTA 4WI9A 5HI4C 3JV6A 5HDOA 1JGUH 4YXKH 3KPPA 3F7VA 3KYMB 2Z35B 5F1IB 1IQDA 1BWMA 4JFHE 1UXSB 3LEYL 2VB5A 3U7YL 5BVPL 5HGDA 4XC3L 3ET9F 3C08H 3S34H 5C0IB 3MLVL 2DQCL 2LU3A 4R8WL 5T1KA 5I73B 3KYNA 5FHBH 1G7LA 3PDOB 8CGTA 4PS4H 1I1AA 3FOMA 4AEFA 3AFLA 1A7OL 4NFDA 2VXQL 4KAQL 3RWHB 3OKLB 5GQBA 2XZQL 2ZZUT 4ZPTB 3D3VA 2YXMA 3PWNA 1LEGB 2BOCA 5IB4B 1AKJA 5JUEH 4X6FA 4HIEB 5BV7B 1ZHBA 2LTQC 3VFWA 1XF5A 1OW0C 3RWJB 1EHAA 5A16B 1F4XL 3H6JA 4XP9H 1CIUA 3A6CH 43CAA 5ADPL 1RZ8A 1W0WB 5I1JH 5ICYB 4KMQA 2X4PA 4U6YA 5GZOD 4RMVA 2FX7L 1BVLB 3CFEA 4HV8A 4CNIA 5AZEH 4ODUA 4BSVB 4N0RA 3DETC 3UTSA 5F8QC 2XZCH 4RFNC 1NGPH 2RB8A 3NOIA 2ZPKL 3IFNL 1DQTA 4PRHE 3RWFA 1ZKAA 3ZDXF 2MNUA 1YMMA 1UM4L 4KI5C 1I9JL 3ZKSD 3QH3B 1AHWB 4P5KB 5GRJH 1AE6L 3B6SA 1A4JA 2DQUH 5B39B 4DK3A 3VXOB 3SKMA 4PJIF 3DXAD 5BZDA 1NC2D 3FQNB 3TO4C 1OGAB 1E6JH 2BRRL 2R0ZH 2ARJQ 5J4MA 5KSBE 2ICEA 4GRMB 1YEHH 2Y5TA 2P49B 3TCLB 3FT2A 5L2KA 3G04A 1UACH 2FBJL 1KXTB 3U79A 4ETYA 3HZMB 3ZYIA 2FX8H 4DEPB 1Q1JL 1CDBA 4PG9B 4RFOL 3EYOB 1Z9SA 1JZ5A 4KJWC 2X1OA 1IT9H 2A0LC 4OCWH 5DDHB 4JGMA 1KPVB 4GRWE 2ZCHL 5DQJA 1UB5B 3HMXL 1RY7B 5SWSE 3DETD 2AJUH 5BV7L 1QYGH 4IS6A 4J4PA 1CE1H 2VLKE 2RCSL 2AJVH 1TVDA 4GKOA 3V6OE 1TITA 4LDOB 4NBZB 3U1SL 5BW7C 3FQWA 4CJ1A 5C0CD 3SBWC 2E27L 2IPUG 1K4CB 3K1KC 1II4E 1NAKL 5JW4M 1VKXA 3K2UL 4FZEL 4M7KL 1FV1A 2YD9A 3MMEB 3TO4D 4EUPB 3NZ8B 1NGWA 3X12B 3ULUE 1IM3A 2PYFB 4WW2F 4DKFL 3Q6FB 3HE7D 3IDYB 4X7SH 3QIWB 3M1BB 3GUTA 4N0YL 4OLWL 3REVB 5DJ2B 4NDMA 3S5LA 1BQUA 2VXTL 5IROC 3D85B 4LCCB 4WFGE 5D8JL 3ARFA 1OP5K 5EO0B 3TA3A 4UINL 1CD1A 4YQXL 2H41A 5KS9A 1P7HL 4KJWD 1PEZA 1FFNB 3NGBC 4J3VA 4NZJA 3MJ6A 1U2HA 5ETUB 2E8YA 5IF0A 5LCVL 4D2NA 1NGZB 3FHQA 4M8VA 5C6WH 4PJEA 3IKCA 5BZWA 4P5TC 3DX6B 4JLRA 1NLDH 4JDTH 1QFOA 1BP3B 2EIZA 1CGSL 1I8KB 2ARWA 4XAWL 2E7LC 4BZ1L 2YRLA 4ONOA 1BEYH 4JB9H 3AMLA 5FYJU 1C5DB 5K9KB 4AH2B 2IPUK 5SV4A 3AVEA 3VD3A 5IB5B 1HHJA 1KV3A 3VG9B 2EZ0C 1F3JA 3IFLL 1NC4B 2BNQD 3GNMH 5E6IA 2VISA 5E08L 1A0QL 4J3XA 1T21A 5DTFA 5DHYA 1GCFA 1AQDB 4G7VL 1K8DA 1TJIH 4U33A 2P5WE 4POUB 4E5XA 1Z9LA 1ZV5A 3FN0L 1IVLA 1ONQA 5AZ2L 3E3QC 5HHMB 4OFPA 2WZPD 4JGJA 1DTUA 2G2RB 5C9KA 1L7IL 1CCZA 2X2YA 3JV4B 4XVJL 3TWCH 2DBLH 1BECA 2XPGB 5I8CB 1FIGL 3D9AH 3SO3C 4ZNCD 5KN5B 4NQXA 4OFVA 5GIRA 3B9DA 3DPBA 1CD8A 1JYNA 1U8OA 5CMAB 2OP4H 3DBXB 4YGVA 1I3GL 4P5TD 5D1QB 2PTUA 3PWJA 5KVGH 3PGFL 5I9QC 4RDQG 4N68A 2DM7A 3OGCA 1CICA 1Z5LA 5BRZA 5I1GL 1IARB 2NY7H 2Q20A 4FFEX 2Z4QB 4ETQB 4N90D 3AU1B 1ZMYA 2YPLE 2GSIA 3D39E 2EZ0D 4JFDD 3MUGB 3T65A 2VDQH 4NYLA 5LQBH 2Z8SA 4LIQH 5EZLA 3RY5A 2QQQA 4JHBA 4U1MA 3TT3L 1SM3L 1OB1B 2ZUXA 4Y4FA 4PJ5B 1CQYA 1EK3A 1JYVA 2JLLA 1YY8A 5ACZA 4MNHB 3T0EA 4W81A 5HHQB 1G84A 4NQEB 4OT1L 3TO2B 4LVHB 1T0MB 4HWZB 2ATPA 3B9KB 3O6FA 5D1XA 1EGJA 3C60A 5JORB 5SWQA 4YFLF 5L8LB 2OSLB 5D5MA 3U30C 4Q97A 4QTHB 2GIYA 3QJFB 2UYLB 3CVHB 4HW6A 1TQCC 2GK0A 3UC0L 1JGLH 3S3SA 4OB5L 1CD9B 1HSBB 2H9GA 4YBQD 4HUVB 3BJLA 3MLSH 1OM3L 4OCYH 4HFWB 3X3FL 2DLTA 4XP5H 3C2AL 3RWEA 2DL2A 2XWTA 4FQIH 3P0VL 2F58L 1XZ0B 3L3JA 4MXVF 2ADIB 1CT8B 2CRMA 4E0RA 3MJGX 3QUZB 2YD2A 5D1ZC 1M71A 5AWNL 1FN4B 1QRNE 3WIHL 5F7DB 3FL7A 4HUXB 4L8DB 4PJAA 3OB8A 2HT3C 2CO6B 3FT3A 2WW8A 4KJPC 5C08E 5E8PB 2ZJSH 3J7HA 3U2SB 5LBSL 2EIEA 4NRYA 1DSFH 4FG6C 1JF1B 1J8KA 5FF6A 1NSNH 4Z76B 4N0FA 2Q87A 3E8UL 5CJ5A 5IWLC 1JYXA 1VFAB 1LDSA 4LPXA 2GTZB 1T7YA 2VXVH 4HHAA 5JOFB 1K3ZA 4PTUB 1A5FL 1JPGA 2AGJL 3CDGA 5DWUH 1OD9A 5KSBA 4P46A 1TXKA 2YKLH 2B4CC 1QO3A 2X41A 3VJ6A 2XTJD 1NUFA 4GUPA 5F44A 4PJIB 1KYOK 4R4FL 3KWWA 1WUNT 4ZYKA 2CDFB 3ZTNL 3MRPA 5DC9B 2W65B 2F53E 2BJMH 3CVHL 2D7QA 3MJ8A 4NN5B 1QVOA 2DQGL 5LGKA 3Q3GB 5E99L 1BLNB 5D1ZD 4FNLH 5LJYH 4U0QB 3DMMC 3QDJD 3QUKB 5E03A 2HT3D 3U46A 1JGUL 4XPAL 4KJPD 4WEUD 1G9ML 1T89A 3VXTA 1M6OA 1YEFH 4P2OB 5FOBA 1KN4H 2PCPB 2BVOA 3L5IA 3Q5YA 3EHBD 4U1LB 5GS1A 3TZVC 43C9B 1J8HA 3C08L 3TPKA 4ONFH 5D7IB 5E9DB 4FG6D 4I0PA 3S34L 5INDA 4UMGA 3VRIA 2K9UA 2NX5D 4HLJA 3O3EA 2R0WH 3EYVA 1DEEA 3QDGA 4PS4L 4TUKH 3VH8G 4OLYL 4QHUB 1MHHA 1BM3H 1RK1A 3PP4H 4JKKA 4B7LA 3RGVB 4R90H 1YJDH 3O6LH 1RZKH 1HKFA 4NNPL 5ICZA 2YD1A 3WHE0 3E6HA 1H0DA 4QWWC 2VZ3A 4G6AC 3KPSD 2W0FA 3O4LB 5C8JB 2DYPD 1T7XA 3FAWA 3LKSA 2I60H 3FONB 5D2NB 3UJIH 5ACLA 4XP9L 3A6CL 1ND0B 3LB6C 4MZ3A 4ERSH 5I1JL 2WIMA 1S7TA 4N8VA 3NPSB 3MC0A 2DI9A 4D8PA 1D9KC 1B90A 2XZCL 5BOPA 1NGPL 5IBUB 2K1MA 3BGFC 1JCKA 3QNZB 4JCMA 1FZKA 1A3LH 5E5UB 1TDQA 5BJTA 2PXYD 4KMLB 3HRZA 5F7KC 1A14H 1URLA 3VGHA 5GRJL 3AY4C 1GGYA 3ARBA 4LMQI 2DQUL 2XI9A 5ELIA 5I74C 5F3BA 1NAMB 2X9YA 3H9ZA 3VE0B 2R0ZL 4YC2B 5E5RB 4PGEB 1FL3B 1JIBA 1YEHL 2WANA 4JJ5A 4C56E 1ZA3A 4R97B 1NANI 3BJ91 3FB6A 3ZDYF 5BVJA 4AM0A 3BP7A 1P5VA 3K8MA 3PE9A 4HKZB 4QWWD 4G6AD 2R2BB 1EFXA 2FX8L 4RWYH 2X4NB 1XGQB 3RDTC 3VFMA 2YN3A 1CFNB 3O2DA 4OZGA 5DF0A 5J9PA 1IT9L 3D69A 3LB6D 4WI4A 3V4VH 2B1HH 1IE5A 2FZ3B 1FE8H 3F12B 5IW6A 5LGJB 4IBLT 1D9KD 3BO8A 1V7MH 4MS8A 2AJUL 4TQEH 1D6EB 3JTTA 5C09B 1QYGL 4OZFG 3W9EA 3EYFA 5CEXB 1HEZB 2FR4A 2AJVL 5DQ9A 1A3RH 4Z7UB 5KVDH 1JFQH 3OAUH 3X11B 3WE6A 5EU5B 3HR5A 1BX2A 5F9DC 4ALAH 3C09B 5T3XE 4PJCB 1Q9KB 1X5IA 2IQ9H 4XT1C 2A6JB 4Z5RB 3TFKC 1KXVC 2VITA 1I85C 5DK3A 1BD2B 5KVFH 4FXKA 2CUMA 4HT1H 4M6NH 4X7SL 1VADB 1JMXA 3BPCB 4XPHL 2G60H 4A2LA 2APTA 4L8BB 2Z91A 2C1OA 2FHFA 4QRUA 3KPTA 2IJ0C 3EDDA 3OJVC 1L6ZA 1WGOA 2B1AH 3DO3A 5IK3A 1NAML 4BZ2H 1ZGLM 3O3UN 2BC4B 5TE4L 5DFVD 1HHKA 4XRCA 2HFEA 4YHKH 3ZKQD 1CZ8H 3ARVA 2NXYC 4HH9B 5IMMB 3QA3A 4JQVA 1LP9E 4JDTL 3FO2B 4OCMC 1BEYL 3F7PC 5C0GA 4JG0H 4P2RE 4JG1H 5JQHC 3QXDA 2H32H 4B5EA 3IS1X 1JZ3A 4Y1AE 3JWOC 3T04D 1CYGA 5DFWH 2NY5H 5D71L 3GMRA 3KHOA 4L4VB 2OTUB 1ZTXL 3V52H 4LNVA 1OTUC 4YAQB 5C08A 4Y4KB 1DDHA 4GO6B 3MOQA 3NFSH 2X9WA 3HFMH 4P4KA 1JYWA 2BVPB 3RPKA 1U8QA 1KJMA 3KPNA 5EBMA 3HLAA 2E7HA 4JFEB 3DUUB 3TWCL 5J11B 2DBLL 3MRHA 3OX8A 3D9AL 3FRUA 4OIBA 2EH7H 2ICES 5ENWA 5E2WH 5FO9A 5J06A 2I9LA 3EJJX 4RA3A 3SKNB 4DUVA 1TZHB 3PQYA 2NXYD 2HVJB 1E28A 1U3HB 4PBVC 5KVGL 4FQHA 3L5WA 2GSGB 4NCC1 4OBSA 2C7UB 5D70H 5ID1A 4RDQF 2FYYB 2DDQL 2Y9RT 3EOAB 1P69B 2BOBA 2D31B 2VDQL 4KDTC 3O8XA 3KJ4B 5LQBL 1ZEAH 4LIQL 4D9QD 5CEZD 5SX4I 1IAIH 3MRQB 2AABH 1LEIB 2NCMA 1AGBA 4NNXB 1KCGC 4S0UC 2WWMC 2CXGA 3MLTA 2F5BL 2AEIT 4EBQH 5TF0A 5I17A 3VXNA 3F7YA 4WFEE 3QFJB 3G08A 2E6QA 3SKJL 4NO5B 4LRIC 3T4AB 1S9XB 4H26A 4NT6A 4Z7QE 1FO0B 5IFAL 3QXUA 5FECB 2AK4E 2X40A 3ZKMC 4PPTA 3GIVA 4EIZC 3HUJB 1QEWA 1JGLL 3EO1A 1ZSDA 5FO7B 2C26A 2V2TA 1CIDA 3TVMD 1CK0H 4MZ2A 5I66B 3J8F7 3CLEL 3MLSL 2VLRB 4HXBH 1QFWM 1UJ3C 3C6LC 5HYQB 4XCEA 4PJDE 1REIA 1O5DT 4XP5L 5FDYA 5A2LH 2AXGA 4JFFE 2P5EE 3QJHA 4FQIL 2BNUB 2VKWA 3OKMA 4OFYA 4TSAH 2FL5A 3MJ9A 2NW2A 4O4YH 5HGAA 1J05A 4PRPA 3UYRH 4X99B 2BSSB 5FV2A 1XF4A 4KUCD 3A0OA 3L3KA 4RIRA 4HCRH 1X4ZA 4MD4A 3FQTA 1KLUA 2DN7A 3GJEA 1HI6B 3B3IB 3QPXL 2ZJSL 2OL3H 2HAZA 3MOBH 1LO2L 1S8DA 2C3VB 5MENB 4PFEA 4HIIB 1F8TL 5KSAC 5J1AB 2EDOA 5JNYB 1NSNL 1JL8A 3OKNA 5FKAA 2UWEE 1QRKA 5IMKB 5EFIB 3G6JA 1RJLA 2EDXA 1JNHB 3TNMB 3R0MA 3CZJA 4PJGB 4NO3B 2DAVA 2MOVA 3W0WE 2VXVL 5HYJB 4X6CB 2MHAA 1P4BH 4I5BB 5DWUL 2VL4A 5A2KH 5I0DA 2YKLL 3BRGC 4QF1B 3HZKA 5EU7E 4GXVH 4YDVB 5CJQH 2FEEI 4U7SA 4Y16C 4MDJB 3OBAA 1FO0L 25C8H 2GTWB 5DUBA 3HCVA 4JY4A 4NHUB 1HILA 1SJXA 4HGMA 1NCAH 4TVSa 3IJYB 2LU7A 4XGZA 3BKCL 5D6DC 2BJML 1U8IB 4FFYL 1EDQA 5D7JC 5DD6A 4MJ2A 4FNLL 1MCWW 1XR9B 1T0NB 3E6FB 4PRNA 4P0DA 3HPJB 3P4NA 1WBZB 3RJDA 4XAKD 1G7QA 4RBPH 2CMRL 1JNJA 4N8CH 5IHBA 1JK8B 1F4WL 2FCBA 1X44A 3OXRA 3DTXB 3NA9H 3RVTC 1WAAA 4XC1H 3MRGA 4KHTH 1NBQA 2VLJA 3RWDA 4ONFL 4XTRC 5KSAD 1S7RB 1YEDB 3TIEA 5J89A 5GS0H 3FJTA 5H8DA 3RNQA 2R0WL 4X80L 5HTSA 4TUKL 5DK2B 1RZGB 1JHLL 4RMRA 4QOKB 3CDFA 4NKDB 4TRPL 5EC1A 3RHWF 3QCVH 4EN3A 1WEJH 2EDHA 1NEZB 3PP4L 3ZSSA 3AS0A 3QRFM 4G7YH 1ZE3C 2PO6C 3KPRE 1YJDL 3O6LL 1KCRH 4RNRB 1RZKL 2HVKA 1T22A 2NY4B 5LVEA 5DK0A 5IESH 5TJWK 3T3ME 2IANA 4HUKB 5FGSA 3GM0A 4Y16D 1X5AA 2X70B 5D7LB 5KSVB 1ZHKB 2ERJB 2IH3B 5FK9A 5F93C 2HKFH 1QLFB 3VXUD 2I60L 3Q1SH 1IKFH 4Q6IA 2GFBA 3UJIL 5DJ8B 4LSDA 2GAZA 3PGCA 3AB0C 1PFCA 2IPTL 1FNGB 2WBJB 5D7JD 2XKNA 3GI8H 1R5IB 2R1WB 1UVQB 3BZEA 4XI5C 2GJ6D 4HQQH 3GSXB 4IRJB 5AUMA 3RIAF 5IV2A 4ZTOH 4G42B 1S7SB 5JIPA 2XZAH 3BEVB 1EO7A 1A3LL 4LP5A 3FQXA 3RVTD 3WN5C 35C8H 4M93B 1A14L 4HMCA 3FFCD 3EYUH 2V2XB 3MCKA 5TDPA 3OJ2C 1T6WA 4RMWA 1KEGL 4ORZC 3S8WA 4UILH 4F33B 4JE4B 5ID0B 2PO6D 2XZZA 1CTNA 1D7FA 4O58H 3U4EB 2BVYA 3LHPH 3STZA 5CD3B 3IGAB 3KLDA 3KPOA 4R96B 1ZHLA 2DWEB 3G5VB 5L88H 3ISWA 3NH7H 5C0BD 4PRAA 1PVHA 4YIQB 4PREB 3TBTB 3VG0H 4OGZA 4PRBA 3OF6A 4P2QB 3V4VL 1H3VA 2B1HL 1D5ZA 1FE8L 1GPOH 2H32B 4PJ8D 5GJSH 2XT1B 3PHOB 3KPQA 4OZFH 4OFIA 1I7TB 1V7ML 4ZUUB 4XI5D 1MQKL 1K2DB 1NGQH 1NUGA 4YDLC 3VXSD 4WU7B 2RR3A 5T3ZH 2Z92A 1YDPA 5DJAB 4MCZA 2N1KA 1A3RL 4LHUG 4R2GB 4PBXA 1QSEB 1RURH 2JIXD 4Z78B 2AK1H 1CDJA 3RA7H 3AREA 4C59B 2IQ9L 3ROLA 3LKOB 4R3SB 4JM2D 2DIBA 3H7BA 4Y5VC 5ANMB 4PDCE 5KVFL 2BVQB 3D0VA 4HT1L 2BNRE 4EJ1C 4NP4L 1RHHB 2G60L 3O3DA 4XPGH 3VFGH 5INCA 1S7VB 2C3GA 1DL7H 3SDXE 4JZOB 2B1AL 4WHYH 5IMLA 3V5KB 4X0KB 2L0DA 5I6XC 3QUYA 4BZ2L 3M8OH 4OJFL 3PWPA 3Q2CA 4DVRH 5E8OA 4YR6B 2H6PA 4LMQE 4DZ8A 5J6HA 1U91B 4YDKH 3HG1D 3CU7A 1Q38A 4YHKL 5TFSH 3V79C 3DOSA 2NW3A 2NNAB 1T1XB 2NLJB 5EA0H 4LAQH 1CL7H 1DZBA 3MBEC 1I7UB 1MCLA 4DQOH 3VFSB 4W68A 3S36H 4GW5A 2APXA 4JG0L 4RGNB 4UUJB 3IJHB 4JFYA 4JQIH 3VXME 5EG6C 4E41E 4JG1L 5CJBA 4Z7VA 3ARYA 1A6TB 2EDTA 4L4TE 2CIKB 3WMSA 4HG4J 4QY8B 1OSZB 1PKQA 3V5DA 2C3WA 2NY5L 3MGTB 3OXSA 3DUSA 2N56A 1LD9B 3V52L 4GS7C 3VXQB 4X6BA 2OM5A 3NFSL 4MX7A 5HYEA 1U8MA 1A1MA 4P23C 3RBGA 5I0ZA 2DQIH 1LO5A 4JQXC 3QQ4B 1F90H 4KMTL 2L7JA 4K23L 1NFDE 1FL6A 3CDYA 4OLUH 5C0AD 5E94A 4U1HB 3MNVB 2C4FU 4F7TA 3ZDZE 1KB9K 1BFVH 5DMIL 1A2YA 4U6HB 3TBWA 4V1DE 2G9HA 2X4OB 3X17A 1CG9A 1M4KA 1UQSA 1D5XA 2OL3B 4LLWB 3IDGA 4QRRD 1R5WA 5I18H 1PJ9A 4WW2C 4XZUA 1WSST 2VUOA 4POZC 3K8KA 3O3BB 1RZFH 4KJQC 1BAFH 3FCTA 1IAIL 4JREB 4P4RB 2AABL 2MPAH 2WSKA 3EJZC 3DXAA 1PLGL 1NC2A 4AJ0A 3JXAA 2Y23A 5DMKA 1YEIH 1WJ3A 1TZGL 5HHOD 5J13C 4WJ5A 1XH3B 3HS0B 3HI1A 3Q6GL 3GEWB 5EOQH 1XT5A 3OB0K 2XTJE 4P23D 5FYKH 2YS4A 2ZCKH 1A6UH 1TQBC 2QBWA 2JJSC 1MF2H 4KKBC 3UMTA 3D48R 3OG4B 3QRGH 3V6FA 2ZUYA 2A6DA 1QBBA 1CK0L 4YFDB 3KPPB 3F7VB 3RX5A 1S3KH 1WCBA 1IQDB 4HXBL 3SDCC 4KK5C 5ISZD 2AEQH 4EEEA 1AIFA 2P46B 1U41A 4F9PA 2A1WH 4NJAH 2QADC 2FB4H 5CBEA 5T1KB 3KYNB 1G7LB 4W6YB 4BK5A 1I1AB 3FOMB 2YPVL 4O4YL 2C4FT 3UYRL 2X1QA 3D1MC 5C0CA 4HMDA 4POZD 2UZXB 4HCRL 3D3VB 4KJQD 3PWNB 2BOCB 1U3YA 3EJZD 4G6JH 2OL3L 1AKJB 4PJAF 3MOBL 4X6FB 3TO4A 3ZYZA 1MJUH 4PV8A 3KXFB 3SGJC 3VFWB 3HE7A 1XF5B 5HD8C 4N0CC 3LQZB 1VHPA 43CAB 4L3EE 2QR0A 4O51A 5ABDE 1RZ8B 3RY4A 1N6UA 4P5MB 3WBDA 1WISA 4U6YB 3G5XB 3G5ZA 4B0MM 4ODUB 4Y8AA 4BFEA 1Q94A 1P4BL 4HUUA 2CUIA 3UTSB 1J0JA 1NMCB 3RWFB 4OCNC 4GXVL 5JZ7D 2KL6A 5CJQL 5FXCH 3H0TA 3SDCD 1YMMB 4C58B 4DGVH 2Q8BL 2QADD 3V7AG 1NCAL 2G75A 3O2VL 2HG5A 1R0AH 1A4JB 4JPWH 3FQUA 3SKMB 1LQVA 5BZDB 4D9RD 3O4OC 4JFQA 1ZHNB 5FHAL 5BW7A 4M7LH 2ICEB 3SBWA 2Y5TB 4I9WE 4HPOH 1XR8A 2BNQA 5I1DA 5LAXA 4LLDA 4N8CL 2BMKA 5LWYH 4NM8H 1Q72H 3NA9L 4XC1L 1H3TA 4R6UA 5MI0C 4KHTL 3CPLB 3WFZA 1YUHA 1I1YA 3CX5J 1CGWA 3RIFK 2XA8H 1RUKH 1RIHH 1U6AH 1V05A 5KOVC 4HIXH 4BH8A 3QCVL 3QXWA 1WEJL 4K7PY 4N0UA 2IALA 1EBAA 4G7YL 4LSRH 1AY1H 4UZGA 2F54B 2JF1A 2EEDA 3FO0L 5MHSD 1KCRL 3CZFA 4NC2B 1TTUA 1MNUH 1T83A 5J1TC 1SQ2N 1BJ8A 1GGIH 4GSDH 3TEUA 2AV7B 4YEFA 3FQWB 4M43L 5IBLC 5KZCD 4P5TA 2NXZC 5FUCE 2CIIA 1IKFL 4IMLB 2DLEA 4KDVA 2E7LA 1VKXB 3UZQA 3C5SA 5GGRA 1FV1B 5K93A 3VU2A 2VMFA 3GI8L 4MJ6A 3QZWA 4Z77B 5BMFH 1NGWB 1IM3B 3FO9A 3NIFF 4LF3A 1A7RH 1UXWA 4OI8A 3NCBB 2H2SC 4HQQL 4JFDA 5EORH 3GUTB 4U6XA 4ZTOL 4OGXH 1IGYA 4NDMB 3S5LB 2BX5A 3CLFL 5A3IC 2XZAL 3QWQB 5E0QA 2DS4A 1YPZF 3CFIC 4NM4H 2VC2H 1TZIA 3EYUL 1NKOA 3TA3B 1G7IA 5KS9B 4UI2A 5IF0B 1EO8H 5DO2C 1GC1C 2OQJB 3PGDA 4UILL 4PJEB 3IKCB 5BS0E 1DBAH 3F6IA 5BZWB 3T08A 1F4YH 4O58L 1KJ3L 4JLRB 1MVUA 5FGBC 3GK8L 2VDRH 3CFCH 5JIKA 4U2ZA 1QBML 4J6RH 4N5EC 2X1PA 5EZOH 3NH7L 4GKZA 3O2DH 4BFIA 2E5EA 4LEXH 4LP4A 4Y19B 4OD1L 5IBLD 3VG0L 2JJWA 1I4FA 2NXZD 3QEQE 1F97A 1F3JB 3VI4F 1GRWA 5E6IB 3RPIA 4DWHA 4U3HA 2R2EA 4HWBH 5GJSL 2OMBA 2VISB 3VA6A 1T21B 5DTFB 3IETA 5DHYB 1NKRA 4Y5XC 3BFOA 3MV7E 1NGQL 3K8LA 1S9YA 2H2SD 1K8DB 2W60B 4XBEH 2P48B 2DIAA 1MFDH 4X7DC 1L0YA 4E5XB 5A3ID 1ONQB 1CWVA 4QRPD 1RURL 1IAOA 1OT2A 2AK1L 4NUJA 4WI3A 1LK3H 4UV7H 4AEHH 1G1YA 4LCWE 4NQXB 5CSZA 5GIRB 3VFOA 4JDZA 3EOTH 1U8OB 5MP6H 4KRPB 3HB3D 4YEEA 3P77A 3PWJB 1A9EA 4Y4HD 5CEYA 1OWWA 3B2VL 4K2UH 1DL7L 3OGCB 1CICB 1Z5LB 1HQ4A 4N5ED 2X4QA 1A7NH 5BRZB 2NQCA 3BDYH 3LKQA 5EU6D 2GSIB 4DVRL 1DUZA 3T65B 1E27B 1MEXL 4JN2B 4YDKL 3DHMA 2E9WA 3BIBX 4OCRH 1A7BA 5EZLB 5TFSL 4U1MB 4K9EH 3QIUD 4LSVL 4Y4FB 1N64H 2MKWA 3LD8C 5EA0L 4LAQL 1CL7L 1YY8B 5D1ZA 3B9EA 5ACZB 4G9FE 3T0EB 1OAZH 1TCMA 5E6ZA 3QDJA 3ZKXB 1IGCH 2AJYL 3HC3L 3MV8D 2J8UA 3O6FB 5D1XB 4JQIL 3C60B 1EAPB 5EO9A 3QDAA 1BF2A 3OR7A 3IF1B 1VEMA 4IOSD 5D5MB 1SHMA 3A67H 4R0LA 2GK0B 3VI3F 1XGPB 3B5HA 2FRGP 3CCHA 2NX5A 2H9GB 2WY3A 5JPNA 3MR9A 4CN4A 4JRYE 5IWLA 4KV5F 2ITCA 3GKZA 4YNYA 1TETL 3MROB 4Y88A 5EOCH 1L0QA 3MODH 5I15H 2OJZH 2Q7YA 3AMKA 3RWEB 5BQ7A 5KAQG 3OB0H 2V9TA 2XWTB 1X7QB 3L3JB 2DQIL 3BPNC 4HD9A 3I2CH 2QQLH 5DRZA 1FNLA 4E0RB 2AJSH 3BIKA 3KPSA 5GGQL 1AXSA 1M71B 3WNNA 1VSCA 2XQBH 2DYPA 3QUXC 4HWEH 2R69L 4Z0XA 3FT3B 4PJFA 5IM7A 4ZTPH 2F5AL 1BFVL 4OZ4A 1RUPH 5C07D 4LPUA 4BQ6A 2A83A 2VXSH 5E4IA 3QEHB 4NRYB 3HPLA 3O11A 1PG7H 4WHCA 5C0RH 4GAFB 1J9CT 4L8SC 1ZLSH 2ADJA 5FF6B 2JJVA 4M7ZC 5I18L 4N0FB 3SE4C 5LXGH 1QFPA 3C5ZD 3W9DB 1IAIM 3BW9A 1C16A 3BEWA 2PXYA 4HHAB 3RZCC 3OKOA 2AEWA 3CDGB 4HGWB 5KSBB 1BAFL 1G6RH 2GY7B 1CE6A 1ZVSA 4WGVB 1ADQA 3S4SG 3GMLA 1QO3B 2VN4A 5IHZB 4IRSD 1YEIL 3VJ6B 3WLBA 5IVXA 4YDJB 1EGJL 4GUPB 4OD2B 5IW1B 4ZYKB 1L9NA 1IC7L 4YFLI 5DD0H 3MRPB 2HP4A 5EOQL 3ZSTA 1QZ1A 2O5ZH 1A7QH 5FYKL 2ZCKL 1WWBX 4X83A 1A6UL 1QVOB 5M94B 4EQ3A 1MF2L 4D3CH 1WICA 4GRWB 4WO4C 4ZS7L 1C5CH 2A6IB 5H37G 3QUXD 4J12A 3U46B 2R1XA 1S3KL 3B8SA 5CZVH 3VXTB 3MLRH 1M6OB 3EKCA 2AEQL 4PJBA 5FOBB 5GS1B 2A1WL 4NJAL 1D9KA 1J8HB 1MIEL 1B6UA 4RRPG 1TNMA 3BUYA 2FB4L 4I0PB 3VRIB 5INDB 1IQWH 3JTCA 2DD8H 4KKLC 3EYVB 1DEEB 4KROB 4P9HH 3GRWA 3RVUC 3IYLW 4UU9A 1MHHB 2YMXH 1RK1B 5F9OL 3JZ7A 1G9NL 3VWJC 3AY4A 3ARXA 4DN3H 1PQZA 5HVWA 1WIOA 4G6JL 5ICZB 1H0DB 1R5VA 3IFOA 1CS6A 1MJUL 5CJXC 4EDWH 1K6QH 4WI7A 1LQSR 3FMGH 1U2CA 4WTZA 5C0FB 1UWGH 2DQFA 3LKSB 3ESVF 3O6KL 4WHDA 3W5MA 4MA8H 1R3KB 4N8VB 4NZDA 4UT6H 5FUCC 4M7JH 1GH7A 1S7UA 4JDVA 5DVMA 3G6JF 4D8PB 4WO4D 3RVXC 3QG6A 2NY6D 1IILE 4F9LC 3CMOH 2BY3A 4DGVL 1FZKB 3C87A 3ROOA 3EFDH 1MCWM 3RWCA 3P73A 4OBRA 3HRZB 3EO9L 1R0AL 3ARBB 4LQFL 1DLHA 4NZUH 3SJVD 5F3BB 4KKLD 3IDJA 2ZNXA 4XCYA 4N9GA 1MJ7H 3OR6A 4M7LL 5B38A 2B2XH 4UDTA 4HK0A 4JJ5B 2OCFD 4HPOL 2JE8A 3VWJD 4IMKC 4NHCH 3FB6B 3BKML 1SYSA 4Q74A 5D93B 3BP7B 4AM0B 4PG2C 1Q72L 1ZANL 2PYED 5DC4B 4UV4L 1I85A 3I6GA 3VFMB 2NY3D 3WO4B 2XA8L 2NY0B 4OZGB 4AIZA 2D7TH 1RIHL 5J9PB 3QEGH 1U6AL 3OAYH 2W0KA 1F58H 3MV9D 4HKXB 4OD3H 5IW6B 1FFQA 5HHME 2NY2B 4APQD 4PB0H 3BO8B 4PJHA 3RVXD 4NO2A 2V17H 3IDUA 5H2BA 1MNUL 3JTTB 4URTB 3IDIA 1HXMA 3EYFB 2FR4B 4BH7B 2ZSVA 5I71B 3FB5A 5AYUL 1GGIL 4GSDL 3NA4A 3U36A 5DQ9B 2O93L 1H9VA 4LSQH 3WE6B 3HR5B 1BX2B 1KTRL 2A9NH 2AQ1A 3JWNC 3UPRA 2ADFH 5JDJA 1MCBA 1E6OH 5EU3A 4TULL 5EUOF 4S1RH 2VQ1A 2ZG3A 2VITB 1ZWIA 5KSUA 4AMKL 1A7RL 4FXKB 5K9JL 5EORL 4I3RH 3IS0X 4OGXL 1S5HA 2E6JA 3S6CA 2Z91B 2C1OB 1RK0B 4QRUB 4PJ5E 5CSBA 2R2HA 4NM4L 4FN0A 4Q2ZA 1VDGA 5IK3B 2J5LC 1PG7X 4YJZL 1UFUA 4NQEE 5ILTH 1HHKB 1YYLH 4XRCB 2HFEB 5JOPD 1KPRA 3AAZA 3WHXA 1CU4H 2EIDA 4IHOA 3CSBA 1DBAL 4D0BA 1F4YL 3HC4H 3QA3B 5EBGA 4AK1A 2JB6A 2VDRL 3CFJB 3CFCL 1JUFA 4CU7A 2X1XR 4J6RL 5C0GB 3TVMA 1XGYH 3MLXL 3O2DL 1N4XH 4LEXL 4QO1A 3EJYC 5F3HA 3MCG1 5KW9L 2CDGA 3QXDB 5LG1A 4M3KB 3ARDC 1MFEH 3GSNA 1FHGA 1VPOH 2DJUA 5GISL 3TCXA 4MXQD 3EZJB 4TVPH 5I76A 4O2CA 5C08B 4XBEL 1J88A 1DDHB 5I73C 1OAKH 1NMBH 1G7JA 4MQSB 3WLWC 3WFBH 4LVOB 2Z31C 4WI8A 2QKIA 1L4IA 1ZT4A 4HLZG 1U8QB 4MB4A 1KJMB 3KPNB 5EBMB 4F8TA 4GG6F 3M07A 1BQHG 3HLAB 1JF6A 1LK3L 1I8IA 3OX8B 1AQKH 3FRUB 4UV7L 1AFVH 5ENWB 4AEHL 4LRIA 2EC9U 3Q0HA 3VDAA 2I9LB 3LPFA 3VDCA 3EOTL 5GSRA 1WZMA 5MP6L 3VXRD 2XXCB 3U83A 3WNKA 4P49A 3PQYB 1CF8H 2DKSA 2E3VA 4K2UL 1NBZA 4QHNA 3T09A 1A7NL 4DGYH 3QXTA 3BDYL 1ZGLA 1UJ3A 3CIQA 5DEFA 3EJYD 4D0CA 4MNQD 4PJIE 3ARDD 4FA8A 3O8XB 1IFHH 1DUYA 2OZ4A 1RZJH 1BZ9A 4WHTA 5TGBA 4K9EL 4GKNA 3LRHA 4IDLA 1CFBA 1AGBB 1AHWC 4U2YA 4XX1E 5J1SC 4Z7WA 3MLTB 5JR1H 1U8NA 4OF5A 5I17B 1OAZL 3VXNB 3F7YB 1FNSH 3G08B 4L9LC 4TTDC 3WLWD 2DTSA 4NFCA 2Z31D 1IGCL 5M7QA 5HGHB 4NT6B 2FJFA 2HLAA 3QQNA 5HHOE 1NBYA 1T03H 3GIVB 1TJHH 4X6DA 4XMPL 5CUSH 2ORBL 1QEWB 1V3LA 3P4MA 5GS0D 4Y8DC 5KSAA 3B9AA 3EO1B 5D7IE 5E9DE 4U1JB 4ODSH 2GQHA 2V2TB 3VGBA 4KHXH 2VSCA 4PJXA 4DEPC 3DROA 4NCDA 4XCEB 1QTYT 1NDGA 5EOCL 4Z8FH 5I15L 2OJZL 3SGKC 4AEIH 2V5TA 3LKRA 3TIDA 2AXGB 3RUGF 1AGEA 3QJHB 3I3BA 5KAQF 1W8NA 2YD7A 3OKMB 3I2CL 2QQLL 3QP3A 1FH5H 2FL5B 2AJSL 2YUZA 4YHOH 4Y16A 2NW2B 1J05B 4PRPB 3HAEB 1BQSA 1JPST 4KQ4H 3U4BH 4WFFE 5JW4N 4U05A 5IKCA 2XQBL 1XF4B 1IEBA 4ONHA 3L3KB 1WWCA 4HWEL 2FSEA 4RIRB 1LEKA 4MD4B 3VXUA 4AIOA 5D2NE 4JY5H 2A9MH 3FQTB 1OT1A 1KLUB 4ZTPL 4YHLL 3GJEB 1BFOA 1RUPL 1Z9OA 5DJCA 3S35H 5D7JA 1S8DB 2VNCA 1P9MC 3MA9H 4R4NC 1PG7L 3KVQA 2GJ6A 1ZLSL 1LE9A 5FKAB 1MPAH 3UCRA 5LXGL 1RJLB 4PBWD 2VYRE 3IDYC 1MFCL 2DQJH 3QIWC 1IEAA 1ZVHA 3FFCA 2MHAB 4TUOA 2CR6A 4HPYH 4LCCC 5AAMA 3HKFA 1DJSA 3NTCH 1PZ5A 2EH8H 2RFXA 1E4XH 3DV4A 2J6EA 5DUBB 1IAII 1NL0L 3HCVB 4JY4B 1ORSB 2PO6A 1HILB 3WUWA 4EI6A 2RGSA 4FZ8H 1W0VA 3LRGA 3OKEA 4XCCH 5DD0L 2P44B 1V3MA 4XGZB 2O5ZL 2JCCA 1A7QL 4ZD3L 2RAMA 4LCUB 3DECA 5DD6B 4LQ1A 4D3CL 5C0BA 1KPUA 4PRNB 5SX5H 4S0SD 3P4NB 3KLSA 4ELMA 1NCBH 1AR1D 1UZ6F 1QSFD 3MLRL 1CFTA 3OXRB 3VG9C 2ITDA 2ZOLB 3IXAB 3V0WH 5JMRA 4JZNA 1NUDA 2XY1A 3MRGB 3RWDB 5CP3H 3KDMA 3WJJC 1JHKH 3MJ9L 4Q0XH 5DUPH 3VXSA 5T3ZD 4M6AA 1IQWL 2DD8L 2ILLA 5CWSA 4I2XA 4P9HL 2J2ZA 3RWGA 4HAFA 1EUUA 4Z7UE 5EC1B 3WN5A 1NH6A 2JIXA 4KI5F 5FOJA 4PJCE 2AXHA 1T22B 4YE4H 5CS7A 2YPKB 1Q9LA 4JM2A 2IANB 4UAOB 4PGDA 2EEBA 1KENH 4EDWL 2YUXA 2LFGA 4OM1H 1BD2E 3KLAA 5FK9B 1NQBA 1UWGL 3ARFD 4Q6IB 5T5FH 2GFBB 2NR6C 4R7NA 2GAZB 4I4WA 3TH2T 3PGCB 1OF2B 1T1WB 1UWXH 4MA8L 5D1QC 1H3GA 4UT6L 4M7JL 1S78C 2XKNB 3G9VA 5GGVY 3BZEB 3SQOH 5AUMB 5E2UL 3DLQR 5F9AC 5IV2B 1T7WA 4U31A 1UYWH 3HG1A 5A2FA 1EA9C 1LP9B 2MQ3A 2X7LA 3FQXB 5JIHA 3EFDL 3JV5A 2PNDA 2Q3ZA 3IJSA 4LIQE 1X3DA 4C4KO 4Y2DC 3VD5A 3GBML 1M7DA 5TDPB 4XHJC 4XNYH 1J86A 5DRXA 1IEHA 1ZLVH 4XVSH 5DS8A 4NQVA 1HIMH 3WIFA 2B2XL 4L5FH 4M5YH 4PRID 4NHCL 5ICXA 3ARWA 3KPOB 1ZHLB 1YQ2A 1I9IH 4UNVA 1P5UA 1T4KA 4BYHA 4L4VE 1IC4H 1DQDH 5CINH 1OLZA 3WFDH 4Y5VA 5J8OA 4M9PA 3THMH 2R4SH 4PRBB 4MXVE 2D7TL 4WFHE 2NR6D 3QEGL 1NFIA 2OTPA 1F58L 2VDNH 4OD3L 4GRLD 4KUZH 1D5ZB 5D1QD 2Z8WC 1G9MC 5EOTA 1EJ6A 4PB0L 5EBLA 4P3DB 5C0AA 3T2NH 2V17L 3ZLQC 1Z2KA 1YDPB 1UGNA 1ROWA 1ZK9A 3QUZC 4MCZB 4XCNA 1WV7T 1NCTA 1FRGH 5F7NC 4LSQL 3SPVB 1MLBA 3VFTB 4U6VH 5JTWA 4MHHG 2Y7QA 3AREB 4Y2DD 2ADFL 3ROLB 4XHJD 3UJJH 4S1RL 4QRRA 3NZHL 3SE9H 1E4JA 3H7BB 2CGRH 4NKOA 3D0VB 5HGBB 4I3RL 5FIEA 4TOYH 4UBDC 5INCB 1A21A 3UDWC 4ODVH 5FYJD 4QEGA 1CDUA 5IMLB 2DQHH 4F15B 3LV3A 3BVNA 4K3DH 1OY3B 5HHOA 2AK4B 2GI7A 5E8OB 1BOYA 5ILTL 2H6PB 4DZ8B 4K8RC 5J6HB 2C4XA 3VFNA 2ZUWA 1CU4L 2NW3B 4Z9KB 4P23A 4JQXA 4YHIA 1M1SA 4YBHA 2KZ1B 1IGFH 3HC4L 3HUJE 2UZYB 1F11A 5ACMA 5K33A 4NN5C 2PF6A 2MQCA 1JGDA 5GJTL 2Q8AL 2QQNH 3OHXA 4GW5B 1K9TA 1N4XL 4JFYB 3QUMB 3X14A 5GRVK 4JFFB 4Z7VB 3AS2A 5ISZA 1JRHH 4JO3L 4LPYA 4X6EA 2DBJA 4FQLL 3MV8E 4LLUB 3O45A 1KGCE 1PKQB 1VPOL 3V5DB 3OXSB 4EXKA 3T0WA 3DUSB 3UBXG 1J0YA 2I07A 4YBLB 2CUHA 4TVPL 2KDGA 1FNEA 4WW2A 3WJLC 3RWIA 4WNQA 3B5GA 4DGIH 2GHWB 3BMWA 4M6ML 3WFBL 1J7VR 4PD4K 3ARSA 1RHFA 4WI6A 2XXMB 1U8MB 5L9DH 1NMAH 5DD1H 1A1MB 5JW4R 1OWRM 1LO5B 2EEAA 3RGVC 4KK6D 1DN0B 4J3SA 1FL6B 4KPHL 5I16A 1TMCA 3CNKA 3ARTA 5E94B 1AQKL 2EYTA 5D7KE 4K8RD 4K94C 3I6LD 1A2YB 3VXPA 2UUDH 3TBWB 5GRZA 2MFNA 1GYAA 4XXCC 1U92A 1MELA 2G9HB 2OXGA 2HMIC 5HYJE 1CF8L 3PIQA 1CG9B 5D2NC 4R9HA 1D5XB 3IDGB 3S88L 1R5WB 4WUUD 1Q9OA 3ZE0E 3MA7A 3SDCA 5K9OA 4XZUB 3LRSA 1IFHL 5ESAB 4KTYA 4NKQB 2QJDA 1HDMA 3FCTB 5DZLA 3DXAB 4OZHA 1NC2B 2B8OT 1FGVL 4I13B 2YN5A 3PHQA 3NCJH 3ZDYE 4G6KH 1EVTC 3UJTH 4H0HB 1FNSL 4WJ5B 4U1NA 2CH8A 3HI1B 3HN3A 4YC2C 1CL7I 1JP5A 4HUMB 3C2SA 5HYFA 1T03L 1YA5A 1MRDH 2J4WH 3RGVD 4GQ9H 2J8UF 4PLOB 3SGJA 2LTQB 3LQAL 2AS5M 1NCDH 2HRLA 1W8OA 5JHDE 3V6FB 4ODSL 3TYFA 2P42B 4Z7OF 1CXHA 1Z0MA 4KHXL 2C3HA 1WCBB 4K3EL 5ECJE 4IJ3B 3O4LD 4QOKE 3OSKA 1AIFB 1JWUA 6CGTA 4Z8FL 1I75A 1T1ZA 2B4CH 1J1XH 2V5MA 4AEIL 4NQCD 2DKUA 5CBEB 5JOEA 3PL6D 4LCIL 3BMVA 4PP2A 1U8LA 4KK8C 1MH5B 1CXKA 2O5XH 4YHOL 1YEJH 4OFDA 2P24B 2YD6A 3U4BL 5D7LE 1UH3A 2HTLC 2QL1A 1YECL 2A9ML 4JY5L 4BSJA 5LGHH 1QSVA 1M7IA 2UZIH 2V9RA 3S35L 3KNBA 3GSUA 3TO4B 4PJFF 2V2WB 2UY6A 4PV8B 3C09C 1IMHC 1H3PL 3CX2A 1U93A 5C0EA 1YEGH 32C2B 4OKDA 5FUZH 3HE7B 3TBVB 3TT1H 1MPAL 2XN9D 2QR0B 4O51B 2CKNA 4G8GE 3PXJA 3L3OA 1ZT1A 2DQJL 2FGWH 5DRNB 3G5ZB 1ADQH 1Q94B 4HUUB 4M03A 3VD4A 4HPYL 3L5XH 3MRCA 3UXFA 4HK3J 4HBCL 3NTCL 5E8DH 2BVUA 1PSKH 3H0TB 3U0PA 2EH8L 3QDMD 1HYRC 1E4XL 1MCDA 2HTKC 1NGYA 2VKXA 1MAMH 2G75B 4XCCL 2HG5B 2VTFA 3FQUB 5FA3A 5IVXF 3TYGL 3MRFA 1VCAA 4KK8D 1F2QA 4L3CA 2CJUH 3GKWH 4YHYB 5C09D 3UTTD 1GIGH 1XR8B 4KKCC 4P2QE 5LAXB 4ZNEA 1UT9A 2BMKB 4GMSL 3V0WL 3ULVC 3G6AA 4LHUD 4YO0A 1YUHB 1I1YB 1KFAL 3WKMH 1F6AA 4Q0XL 5DUPL 3AROA 1OVZA 4PJBF 4N1CA 3EGSA 1A9BA 4PV9B 5ESQA 5J6GA 4BH8B 1EERB 3F5WA 4QXWA 4Y4KC 3MNZA 3QNXA 4QRPA 4N0UB 2FO4B 2XG4A 5EH1A 5TDNA 1BIIA 1H15A 3NCCB 5ALCH 3SDDB 3CZFB 3LY6A 4H88L 1MFAH 3I85A 5EZJA 3ARUA 1XF3A 1KBGH 2KUTA 1UCTA 4OM1L 1NPUA 3STBA 1A1NA 2HTKD 4P5TB 3SDXB 4GXUN 5I19H 2CIIB 3DO7A 4G5ZH 3PWUA 5FGBA 1U95A 4Y4HA 1RULH 3KYKH 1RIVH 3C5SB 1BBDL 2C5DC 5GGRB 6FABH 4N5EA 2VR9A 1E4WH 5T5NG 3DVNA 1U3HC 3CXHK 2W9DH 1SEBA 3QZWB 5EU6A 4FFWC 3FO9B 4LF3B 4LVEA 1UXWB 3SQOL 5DD3H 3FQRA 3QI9D 4JFDB 3VW3H 4U6XB 4GQPH 1UYWL 4ZAKB 1IGYB 4G6MH 2JKXA 3QIUA 5EPMA 3ULVD 4WW1A 3L5JA 4Y5XA 3MRLA 1TZIB 5EWIH 3MYJA 1DBKH 3DUHA 2NY1C 2BXYA 4Y7MA 2IBGA 4N1HB 3WEXB 4XNYL 4WEBH 3MV8A 4RGNE 4XVSL 4HS3A 4Y4KD 3PGDB 4L5FL 1SBBA 4M5YL 3R8QA 1NDMB 3QB7C 4OGAD 5JOPE 1MVUB 4Q9QL 2GCYB 1I9IL 1T3FA 1TPXC 2FO1A 2IH1A 1A6ZA 2Q3AA 4OZIA 4GKZB 1IC4L 1DQDL 4JFED 5CINL 2VJXA 3L7FB 3VGAB 3THML 3TF7C 3HE6C 1I4FB 3CJJA 1CXFA 1NFDB 1CVSC 2VDNL 3RPIB 5SWZD 4KUZL 5I9QB 4N1EA 1C7SA 2R2EB 1D5MA 1IKNC 2LV4A 1KCUH 1FYHB 3IETB 2KQNA 5E2TH 1NFKA 4FFWD 4Y89A 5E7FA 4V1DB 1HSAA 3RTQD 3DSNA 3U6RA 4CVXA 1MY5A 3IFPA 4DCQB 2B39A 3MFFA 4FTVD 3AC0A 4HS6B 5C07A 1IAOB 3TESA 3ETBF 4NUJB 2XWJA 1U42A 4HG4K 2BSRA 5GSVA 4TNVF 4JO4H 2NY1D 2BXZA 4K7FA 3UJJL 4PGZA 3VFOB 5CSZB 2APVA 4JDZB 3SE9L 3C6SA 1BBJA 3CFKA 4AIXA 3C5ZA 1KCSH 3F65A 2CGRL 3JWOH 5IB1A 2P8PA 1XGTA 2EE9A 4TOYL 1A9EB 3MLZL 5DJ6A 4OI7A 4WU5B 3P9MA 5CEYB 2HT2C 2X4UB 4ODVL 1HQ4B 2RHEA 2X4QB 1EMTH 2VQTA 3JWDC 4TNWK 3DSFH 4A6YA 1Z6JT 2DQHL 4MD5A 4IRSA 4K3DL 3IU4H 3GMMA 2XTJB 3HE6D 1DLFH 2P8LB 1DUZB 3BGMA 3SY0B 2VLRD 1JZ8A 2X10A 3U48A 3KHQA 3FOLA 1X4YA 4NNYA 4OQTH 3BKJL 3O41B 2ATKA 5DRWB 4B41A 5C6TH 1EVUA 1IGFL 1IGJA 5D1ZB 4CADA 3QDJB 3QUXA 3ZTJH 4M1GH 4ZMAT 3PWLA 4MVBC 1LO4H 3S37H 3GSNH 3R8BB 3OR7B 1JRHL 2UV3A 5L2JA 3GHBH 3OL2A 2EDEA 4R0LB 4G6FD 5MEOA 3OAZK 4WVRA 1LK2B 3CCHB 3W82A 3UZVB 3PP3K 5L0QC 5E1AA 3SE4A 5MEND 3MRIA 3MR9B 4KKAC 1WFUA 2XWBA 2ITCB 3WFCH 4YNYB 3T1WA 2FH6A 1J12A 1I8MB 2Q7YB 2J8OA 5BQ7B 4BJLA 3IT8D 5IMOA 4X9BA 5DD1L 4GBXC 1J1OH 2YK1H 2YBRA 3K74B 2NTSP 4MJ5B 5D9SA 1QQDA 1G0XA 3BIKB 1AXSB 1XCQA 4Y5YC 1SY6A 2NY4C 3IDMA 3VMNA 3OV6A 3EBAA 4JHAH 4NQSA 3EDJA 3S9DB 5FUOH 5IM7B 3NCYS 2D03L 1VESA 3BPOB 5DJXB 4OZ4B 1UM5H 2ERJC 2PW1A 3RL2A 4XPTH 2A83B 1M7XA 3VCLA 3IB4A 4WO4A 1Z0NA 1ZS8B 3O11B 1CI5A 2QSVA 3L3HA 2ADJB 1U8PA 2WBJC 3LS4H 2VLMD 5JDSA 1YMME 1YEEL 1C16B 4IRJC 3BEWB 2PXYB 3EOBA 3OKOB 2BFVH 3ARGB 4EKXA 1BZ7A 1ZOXA 2XTLA 2HFFA 1F02I 3H9SD 2IMNA 3SJVA 1ZVSB 3GMLB 4KKAD 1MRFL 1TTFA 2EKJA 1K85A 2DJ4A 3PJSA 2ZSWA 12E8H 2R0KL 3NCJL 3WLBB 1KF9B 4X4MA 3UJTL 4E42B 5A43C 1MHPH 1IC5H 3VWJA 4Z7WF 5L2KE 3ZMRA 4GBXD 4M9OA 5CBAB 4JAMB 3C8DA 4NQDD 1MRDL 2J4WL 3V0VA 2PYEA 4GQ9L 3RKPA 2HKHH 5CJXA 3PHSA 2CKBB 2NY4D 1NCDL 4QLRA 1P2CB 4NWUH 5BCAA 4K3JH 5HHPB 4X6DF 1LDPH 2R1XB 2WLYA 1L7TH 1PBYA 3MV9A 3LS5H 4GW1B 3QHFL 3EDEA 3GMOB 4DUWA 2CDEA 4APQA 2B4CL 1J1XL 2AAVA 1T7VA 1D9KB 4PJXF 2WINA 1QSFE 3BUYB 2GUOA 1A47A 2AXJA 3C9NA 4OAWA 1JPSH 1Y6KR 3D0LB 1CDCA 5F6HJ 2VZVA 5FYLH 3F6LA 3MACL 1CGUA 2ZOKA 3V4UH 2YD4A 3MRBA 5M95B 2VRAA 1BJ1J 4OLEA 4R2GC 1PQZB 4MA7L 4JPIA 1R5VB 2M8XA 3V9FA 3IAGC 4I0KA 1R3IL 1TVHA 4NC1E 4LBEA 3WS6C 1MHEA 3BH9A 5FUZL 4PJ7A 3TT1L 3F7RA 1F3RB 2DQFB 5FM5M 5JXEC 2DQTL 4P2CG 2FIKA 3ILQC 5DUMH 3ZE2E 3ILPB 2FGWL 5AG8A 4JDVB 1ADQL 4DKDC 5BXFA 3QG6B 5KS9E 5E8DL 2J6EH 3DX8A 2R29H 2KH2B 1PSKL 4EVNA 2FHBA 1U0QA 3ROOB 4PJEE 3RWCB 3P73B 3PNWA 2UVEA 1MAML 4OQ1A 2AV1A 1DLHB 5DYOA 3MRMA 3IDJB 4XCYB 4N9GB 2XRAL 3R1GH 2JCCF 5B38B 1QFWH 4UDTB 4ENED 4HK0B 4WGWB 2VR5A 5L7XH 2DL9A 1NCCL 1QSED 5TE6L 3SDYH 3UO1H 4MXQA 4UQ2A 5F1NA 5GGRY 1VGEL 1KJVB 3I6GB 3WKML 3GRWL 3CFDA 2CRIA 1OP3H 4AIZB 4O5LL 5JXED 4AT6A 1MHCA 2OJEA 2HJFB 4LDEB 3HR6A 2DQEL 5DHVA 3P11H 1X6NA 5KVMC 4X98A 2N7BA 4LARH 3QT2A 4PJHB 5ALCL 4NO2B 5DJYA 1PKOA 4AG4H 5H2BB 3IDIB 4TN9A 1ORQA 1MFAL 2DLIA 2ZSVB 1LILA 3FB5B 2KPNA 2IAMC 2VDLL 3U36B 1KBGL 5HYSG 2YOCA 3VXRA 2VABA 4Q9RH 5I19L 2WBWB 4G5ZL 1HWHB 1U8HA 3UPRB 1RULL 5EU3B 1RIVL 1Q0YH 2W9EH 1E4WL 5BRZE 3L9RA 2DOCA 2W9DL 1P4IH 4UT7L 4X9GA 5KSUB 2WP3T 5DD3L 3VW3L 4MNQA 1MRCH 1SJHA 1GZQB 2D0HA 3ARDA 1S5HB 2Z35A 3FB7B 4G6ML 4JRXD 1C1EH 4G9FB 2JJTC 4RMSA 4H1LB 1CXEA 2R2HB 3BP4B 5EWIL 3T0EE 1HCFX 5DI8B 2Z31A 1N0XH 4WEBL 3NIGF 1KPRB 3AAZB 3WHXB 2H2PC 2J12B 5HDQH 4IHOB 1MFBL 5HDBE 3VH8A 4D0BB 4ZPTA 3TJHC 5D5ME 2FWOA 3TNNA 4JRYB 5FYKE 4PLJC 1QUNA 5CZXC 2JB6B 4AL8L 3TJEH 4OUUA 1JUFB 2AEPH 4XP6H 4MAUH 3SN6N 2IAMD 3STLA 3TVMB 3U9PH 1PX3A 1L9MA 5F3HB 1PY4A 2CDGB 2EDDA 5A16A 2HRPH 4XNQA 3GSNB 1S9WA 2A2QT 5GRUH 5F7EL 5HPMA 1YEKH 1CDHA 1KCUL 1KIUA 3V5HB 2DM2A 5E2TL 3QSKB 3TC9A 4O2CB 3NCMA 4F58H 2QSQA 4O9HL 1RIUH 5K59F 4PJAE 3ESUF 2CR3A 1WBYA 2QKIB 5FEBA 1ZT4B 5DLMH 2HFGH 5HI4D 4P5KA 3QR2A 1FSKC 5B39A 4TTGA 3VXOA 1I8IB 4L9LA 1JPTH 3PP3H 5EZIH 2EIBA 2XQYG 2VAAB 2HJLA 5GSRB 2H2PD 4LDLB 1KCSL 3TCLA 3TJHD 5CEZL 4LL9A 1S7XA 3R0NA 4KZEH 3QFDA 2ID5A 4PLJD 1FDLL 1WIUA 1NBZB 4QHNB 2SEBA 4QRTA 4HJ0C 3DSFL 1ZGLB 1WT5C 1NMCC 3SOBH 4D0CB 1DLFL 1GJIA 3SGKA 1JWMB 1DUYB 1BZ9B 4WHTB 3F8UB 1LHZA 3MXVH 2YUWA 2A6KA 5C6TL 3V6ZA 4Z7WB 2I9TA 2M26A 4ODWA 1U8NB 4PJDF 2CRZA 1KCVH 1KELH 4OFKA 1T20A 3BESR 4KJYB 3F58L 2R56H 1QSFA 1N59B 4OZFA 1LO4L 3GSNL 1NBYB 2RBLA 1LNUA 1LO3H 2Y07L 3GHBL 4X6DB 1YNTA 2XQYK 1K4CA 1P9MA 1B2WH 1J8HE 3P4MB 4KI5D 5KSAB 4IEFB 4N5UA 3E0GA 3O9WC 1HQRB 3MMEA 4HFUL 4FMFA 5IHUL 4MJID 3KXFD 3X12A 1H8OA 4PJXB 3QDGE 4XMKH 3HC0A 3V6BR 4KTEH 3DROB 3WFCL 2YC1A 1N6VA 2Q7NA 1NDGB 1NCNA 3X3GL 2D7OA 3LKRB 3ARZA 1P7QD 3TIDB 4LCCA 4HJ0D 1J1OL 1DQQB 3HNVH 1FLTX 3MO1A 2UVFA 4Y16B 4NO0D 3NACH 3A6BH 2X44D 4JHAL 4ONHB 5IKCB 3RI5K 2FSEB 5FUOL 3VXUB 2VDOH 4G3YL 5FB8A 3T2PA 1BFOB 2WUBL 3VFVB 5DJCB 2A0LD 1UB6B 4XPTL 5JQ6H 4M61A 1BMGA 4JVUA 1JNLL 3EAKA 1LE9B 3N1GC 3DURB 5HI3C 2NTFA 4W4OA 2DLHA 3LDBC 4NC1C 1XIWB 4XWGH 5KTEH 1INDH 4LHJB 2OZ4L 4MDIA 3M17A 4NFBA 5B21A 3UAJC 1MAKA 1HOCA 3MBXH 1IEAB 2BFVL 3FFCB 3BT2L 4K07A 3WJJA 5HGGS 3QIBB 3O9WD 4JO2H 3ORJA 2AVGA 2DLGA 4XNXH 5I8OH 1N5YL 5I75B 3TA3C 2O61B 5IVZA 2RFXB 4OZHF 3HZYA 3WUWB 2EDFA 1IC5L 4RQQB 2X42A 4EI6B 4PRIA 1W0VB 4PP8C 3EUUA 5C3TA 1JBJA 1CDGA 2F54D 2HKHL 1Y18A 1KPUB 3QCTH 5IFJB 4HC1A 4NWUL 1ZA6B 4GW4A 1LDPL 4OZGE 4BKLA 4ELMB 4V2CB 4CDGC 1L7TL 3UTPE 1N7ML 4GRLA 4PJ8B 1CFTB 5D1QA 2ITDB 1VFMA 2EO9A 4JZNB 3AXLA 1MQ8A 5I30H 3KDMB 4G43A 3GI9H 3T1FA 3VXSB 5HI3D 2Z93A 5CWSB 4I2XB 5F89B 2IBZX 3RWGB 3SE3C 3UAJD 4S1DC 3WN5B 4HEME 4XVTH 4KI1A 1MCPH 3GJFH 3V4UL 2Q86B 4Y2DA 2QTEA 5F7FA 2VO5A 2GY5A 3UZEA 4JM2B 4PJ9C 5HY9A 4PGDB 1CDIA 1FPTH 4MNHA 1RUMH 3LKNA 4I1NB 3KLAB 1A7PH 5T1MB 4FQXB 2NMSA 3CMGA 2VDMH 1T80A 4R7NB 3NFNB 4I4WB 4NN6C 4KRPC 1VERA 1IJ9A 3LMJL 4QTHA 3WIIH 2D9CA 3HMWH 1AO7D 3RAJL 5DC0A 3RQ3A 3GZKA 1HSBA 3WD5H 4FQ2H 1CICC 4U1IA 2IQAA 3GGWA 2ZUQB 2J6EL 1FVDA 1J5OH 3HG1B 4Y19D 3MREA 3P2TA 2X7LB 4L8CA 1LE5A 4G8EA 2GK2A 5C2BL 3IJSB 4QHKJ 1DP0A 1EZVX 3CH1A 3EFFA 5IQ7H 2ADIA 1E4XI 1KG0A 2YEZA 5DRXB 1HZHH 3QWOA 4QT5A 7CGTA 5DS8B 4NQVB 3T0EC 3WIFB 1HXYB 1QFWL 2VZOA 3VI3E 3ZKXC 5DJDA 2VIRA 5L7XL 5D1XC 5ICXB 1X5LA 4FHBD 3SDYL 4GMTL 4PJ9D 1T4KB 5HVHB 1HKLH 1ZT7B 4Y5VB 3MLUH 3MZGB 4NQTA 1NFIB 4J2XA 3IDNA 1MCIA 3UDWA 2VXUH 5IVNA 5JPMA 5EBLB 1IZJA 1FG9C 4LARL 5C0AB 4J23A 4AG4L 4KC3B 5KJRH 1GC1H 3IU3A 3RBSA 4HDIA 1FYTD 5D7SH 4XCNB 4YHPB 1LMKA 3T0AA 2APFA 1MFNA 1MLBB 3PQYE 4LSSH 4M5ZH 2Y7QB 5EC2A 2W65A 1QD0A 4J1UA 4X8JB 4K3GA 3WUZA 5E00A 1G9NC 4QRRB 4WUUA 5AYQA 4JZJC 4TSBH 1QR1A 1D5IH 1IGMH 1P4IL 3CSGA 4JFHD 3GSQB 5CIPA 4NKOB 1G6VK 4I3SH 1MRCL 3P4OB 2EDKA 1AI1L 1GSMA 1C1EL 3O2WH 1IAMA 1MCHA 2L4OA 4U1LA 5CHNA 2DMBA 4YXKL 4I3GA 3V95A 3BVNB 3WJLA 5HHOB 4C83A 1FAIH 1N0XL 3VFNB 4QHUA 5HDQL 4P23B 5E8NA 4YHIB 3RGVA 5FHBL 4DTGH 3RY6A 3BPLB 1BQLH 3QULA 5DR5H 5IBTH 2PR4H 3TJEL 1JGDB 4QCIA 3OHXB 4XP6L 1HHIA 1ZLWK 3X14B 3KPLA 1N2RB 2CPCA 1S5IH 4XXCA 3O4LA 4UIKH 3ULSA 5ISZB 4X6EB 1HNFA 4BQ9A 4OZIF 5JUEL 3O45B 3GMQA 4NQCA 5GRUL 3L3IA 5FO8B 3P0YH 3VWKC 1YEKL 3PL6A 3MUZ1 4PRHD 4X5LA 5KVEH 2DLFH 4J7RA 2I07B 3QEUA 5GS1C 3WYRA 2XG5A 4XNMA 2VUYA 3V6OC 1SVZA 1TVBA 1FNEB 2D3VA 2F8OA 2R1YA 4WW2B 3RWIB 4PRPE 4F58L 4KROC 4FXLA 5AZEL 3DMMD 5DLML 4OF8A 4GFTB 4JM4H 3U0TA 2HFGL 3ZYOA 1YPZA 3ULUC 5DVOA 1TMCB 5I16B 2FECL 4O00A 4LEOA 4YDIH 5IR1A 2EYTB 5B39G 1JPTL 2X4TA 2FEDC 4PTTA 3D6GA 3TZVD 5D2LA 1X6LA 2XN9A 3G6JE 3VXPB 3MXWH 4AZ8A 1U92B 1KIRA 5GS2D 3PIQB 5IFHH 4KZEL 4YFEA 1E6JL 4LNRA 3LPGA 4WWKC 4NSKA 4A6YH 3WNLA 2FNBA 1EHNA 1B4JH 2QSTA 2R2BA 1FJ1A 1Q9OB 3BSZH 3MA7B 1XGQA 1UACL 3QDMA 3SOBL 1CFNA 4ZG1A 1G7HA 3CU1A 4LSTH 2XA3A 5I8EA 3V7AE 4ESKA 1RU9H 1WK0A 5SWSD 1OP5H 3TBSA 3LRSB 4C55A 3PABB 3F12A 3VWKD 1HDMB 4UT9H 2YSSA 2VLKD 3MXVL 3SKOA 2Y5EA 4OZHB 1D6EA 4XWOC 4OCWL 3PHQB 4MLIA 3HA0A 4HZLB 5C09A 2BP3A 4U1NB 3UTTA 4KROD 1A4KA 2R56L 4HWBA 3NBNA 1ED3A 1LO3L 2EDRA 3SDAC 1I9RH 4HS8H 4ZFZB 1CE1L 1F45A 2OMNA 1WAAE 3ULUD 2Q6WA 3DYMA 1J0HA 4LHUA 4OCSH 4F8QA 2VLJE 2WAHA 1MCSA 3IRZA 1F4AA 2A6JA 5D93C 2FEDD 3NIDF 1JRHI 4XP1H 4EUPG 4XMKL 4LGRB 4KTEL 2A74A 4WFGD 1VADA 4EI5B 5HHXH 4X5WA 3DV6A 4PY8J 1T1ZB 1P4LB 4WWKD 4M8QB 5F8RC 3T0DA 2EKSA 5IG7A 5ESVB 2NY2C 4PP2B 1SY6H 1U8LB 2IANE 2P45B 4MS8C 1W72H 4RMUA 2VDPH 3NACL 5KZCB 3A6BL 2W1NA 1ZLUK 1L6XA 3RDTD 5EULV 5IP4A 3KNBB 3GSUB 1HNGA 3ALXA 3QO0B 5JQ6L 4XWOD 4JR9H 5GGSA 4BUGA 4WY7H 4YWGH 3G6DH 3H3KA 5C0EB 3QI9A 1XGRA 2VL5A 4YGAB 1NLDL 4XWGL 5KTEL 4P48A 3L3OB 2ICWJ 1INDL 5ITBH 1ZT1B 3SDAD 1ACYH 1INQA 1MCQA 3GM8A 2VZSA 3MBXL 4JB9L 4KVNH 2FDBP 1T04A 4PRDA 4KRNA 5MI0B 1PAMA 5CZKA 3QQ3A 1V3KA 3MJ7A 2P5WD 2Z9TA 2OTUA 5CP7A 4XNXL 5I8OL 4YPGA 1I7RA 3GNML 4LLVA 2XKUA 4F2MA 4Y4KA 2CK0H 2FD6H 2J88H 2GITB 3TFKD 4LLMA 2H3NA 3LKPB 1T2XA 2HA1A 1KNOA 3DYOA 1UEMA 5ERWB 3MRFB 1CLOH 1YY9C 1TJIL 1U8KA 4L3CB 2GYSA 4JFEA 4NBXB 3I02B 2FLBT 4LPWA 1ETZA 4CMHB 4XB7A 2NXZB 1HHGB 2BVEA 5SWZA 4U3XA 3TV3H 2CLRA 3DX9A 3BZFA 4XBGA 1U3HA 4QRQA 3MLYH 3G6AB 4YO0B 2YPLD 3D39D 3U9UA 1F6AB 5F70A 3RTQA 2OP4L 2C7UA 5J7CC 1AGFB 1WWAX 4TVPE 1A9BB 1IZKA 3MSPA 3EOAA 3CH8A 5J6GB 2AXFA 2D31A 4KK9C 4FTVA 1GAFH 3QNXB 4QRPB 5B4MC 5MEQA 3BP6B 4XVTL 1QBAA 5TDNB 4G59A 2FJGB 4LVOC 1BIIB 2NY7L 1H15B 1V7NH 2PKDA 5KG9A 3OPZH 4M3JA 4Z7NE 2VE6A 5EZJB 3ME0A 1FPTL 1MWAH 1H3UA 1RUML 2FX9H 1S7WA 1A1NB 1A7PL 1XAUA 4NO5A 3CC5A 2VZTA 3DO7B 1OTUD 1P7KA 1G6RA 2VQUA 3PWUB 4KRMB 1U95B 4Y4HB 4PJ7F 1YY9D 1GVIA 3DVNB 3WIIL 5B3NA 1SEBB 3HMWL 3JV0A 4YHMH 5EU6B 4PD4J 4OIAA 3MGOA 3DX7A 3FQRB 3HE6A 3WD5L 5JXAH 3PWPE 2VLRA 2HLFC 2IBZY 3MQIA 4PGBA 1IKNA 3QIUB 2E7MA 5EPMB 1LWRA 4I18B 1AJ7H 4WW1B 5BVPH 4Y5XB 3DGCR 3MRLB 1QG3A 3OQ3B 3MYJB 5IQ7L 5F1SA 1QRND 2DI7A 3CXDH 4OCYL 3MV11 4QGTA 1HZHL 3MV8B 4KK9D 5JW4Q 4HS3B 5IJKC 5B4MD 4Z7VE 4HSQA 1VACB 3X13A 4ZQKA 1Z3GH 5EO1A 1PY9A 3B3IA 1PKQE 2EYSA 1JZ6A 2IH1B 2VN7A 4OZIB 5MENA 4ZXBB 1HKLL 5E5MB 5FDWB 1TIUA 5J1AA 5DHVH 1XCTA 4GJTB 4BK4A 5EOCJ 1F4XH 2WWMD 5EFIA 1S7QB 4PJGA 1D5MB 1DSFL 5T1LD 3AGVA 1EV2E 2FX7H 1KT2B 4X6CA 3H3BC 2VXUL 4EDXB 4LOUC 5F9WC 4PY7A 1HSAB 1FORH 2ZPKH 3D18A 2IF7A 3DYPA 3IFNH 4QF1A 3ZKMD 3U6RB 4MLSA 4CVXB 1QLEH 4D94A 1R24A 5D7SL 2B7DT 1KC5H 2DIJA 3IFPB 2F53D 3MFFB 1OAQH 5DVNA 4NHUA 5CSGA 3LD8B 3DNKA 4JN1H 2XWJB 5CJ8A 2Q76A 4LSSL 4M5ZL 2BSRB 5GSVB 3BISA 4UNUA 3C6LD 2ZUVA 4FP8H 3FB8A 4FRWA 3QPQC 4K7FB 1PDKA 1MCOH 1D5IL 4XX1G 4GLRH 3VD9A 3C6SB 1BBJB 3CFKB 3VFRA 4LKXA 1T0NA 3C5ZB 3O81A 4I3SL 4Z6AT 1R3HB