4HUVA

Crystal structure of h2db-npm6w
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 67
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huvA01
4KK8C 1X5YA 5HY9A 3C09C 3CDCA 5F6HJ 4LOUD 4KY1L 1IGCL 1XT5A 1A2YA 5CEZD 4JGJA 4X7SH 1SJEA 2W65B 1LP9F 5IVXF 5KVFH 4BYHA 5DTFB 1J87A 4NM8H 5T3XH 5T1MB 1JPTH 2DLIA 1NUFA 4JM2A 3SE3A 1TJGH 1KEML 1NCCH 1YDPA 4JPVL 1H3PH 4XNMA 4GBXB 5EOQH 3W81A 1UWXK 3ZKXC 4M6NL 4G8FA 3AY4A 2W92A 3C60A 1D9KA 5HGHB 4M6AA 1MJ8L 3TJEH 4MGXA 5IM7B 5E7BA 3SE4C 5BS0E 5GGRA 3ARTA 5J9PA 1WWBX 2UWEA 1BMGA 4X4YA 1I8IA 2PR4L 1X7QB 2G60L 1JI2A 1UCBH 4ZFZA 2FBJL 3HZVA 4HKBB 3VWJD 4IS6A 4BQCA 3SDAC 4DN3H 5SWQB 2P5ED 3A67L 5CEXA 5I2IA 3NZHH 2NR6D 3KJ4B 5FUZH 1NCUA 4FQJH 5JOPE 1SYSA 5EIIA 1CE6A 4Z7QE 2DQJL 4YBQD 35C8L 2Z0BA 1C5CL 2QQQA 1CZ8L 2XQYK 3Q6FB 4KJYA 1W2KT 1PZ5A 3TVMC 1DEEB 4L3EA 2CR3A 2VOTA 3E0GA 3RZCA 1PYWB 5J89A 3SE8H 2OK0L 1T21B 1GC1L 3NAAH 2KDGA 4NHUA 3QEHA 3Q6FA 2EDDA 3ARBC 4WI5A 3B3IA 4JDZA 1QKZL 1ODAA 4LCCC 3NACH 4J3SA 2JCCF 4XI5D 1QKZH 4OLVH 4XBPA 1XGPA 3H0TB 1UM5H 2BVOA 1Z9MA 3H3PL 4NFDA 4O9HH 5AEAA 3THML 1IZKA 3BAEH 3GMMA 1QOKA 3HCVB 1A7QH 1DTUA 4JHAH 5T5FH 4P5KA 4D3CL 1KN4L 2JJSA 1RU9L 4HT1L 3BPOB 4QRTB 4JQIL 3AGVA 3OR7B 3ZTJH 5DMIH 2JCCA 1HHIB 1QBMH 3QXDA 4FXGB 1UACL 2RFXB 4Z7VB 1X5HA 3U83A 3MO1B 3U0PB 4AENB 2F54A 2NXYC 5SWSA 4QRPA 3DVIA 5JIPA 5F1NB 5IR1A 1QLRA 2YXFA 3EGSB 3EO0A 2XA3A 1JTPA 3D9AL 3RPIB 1OQOA 1U8OA 4NGHH 2ZG2A 5LAXB 5CMAA 1WFNA 5ADPL 2CDFB 4EN3A 3ULVH 3ECBA 4KQ4L 4IDLA 1LDPL 4JG0H 4R2GC 2MMXA 3V4UL 1C16A 3PGCA 3BHBB 3RI5F 1HK6A 1LDPH 2DQHL 4EUPB 1W72B 3OX8B 3G6JE 4AZ8A 2AGJL 4ZAKB 2YD9A 5IVZA 2FLBT 4NC1C 3BZDA 3WUWA 1T22B 1VGEL 1CFQA 5JR1H 1BHGA 5K9OB 3KPQB 4X5WA 1AE6L 1QLFB 2QQNH 5SWSE 3RWEA 1AR2A 3HI6L 1G9MH 3VFUB 4I48B 4H8WC 4NHUB 2DIJA 2JCCE 1G9ML 1S7UA 2G2RB 4K8RC 4RWYL 1NCTA 3UTQA 3RKPA 5GSRB 5E8NB 5MP6L 1GGCH 5HPOA 5CZVL 1NGPL 1L9MA 1SYVB 1VSCA 4U7MA 2ARWA 3CSGA 1OGTA 4I77H 4MNQB 2LTQC 5KVEL 4HUMB 6CGTA 1VACB 3B9KB 5IMOB 2FEDD 2SEBB 3RWDA 4DAGL 1OPGH 3VWJB 5C0BD 1QBLH 3KPRE 3MR9B 4YC2C 2BNQE 5ACZB 3MCLH 5JQ6H 4JFXB 1E4XI 5IK3A 4PLOB 1JJUA 4QRRD 2NY1C 4W4OA 3T1FA 2DYPB 4WFHE 3QCUL 1GOHA 1FG2A 1OAQH 3DV4A 5I19H 1MCEA 1BOYA 4DN4L 3VFOB 4DEPB 5I1GL 3KLHC 3EO1A 5D1XA 1FZJA 4DKFL 3VU2A 3PQYE 5LWYL 1QFUL 1YYMH 3G08B 1NAKL 2EYRA 2Z8RA 4PGEB 1OLLA 2DLHA 2X9YA 4Z78B 4JM2B 3MA9H 4LQFL 2XXCB 4KROD 3W9EA 1FFQA 1VKXA 4XBGB 2E9WA 5DLML 1RURH 2VXSL 3V79C 3WS6A 3HR6A 1MUJB 3L3OA 3OAYK 4LCCB 2EDBA 2CRYA 3JZ7A 5EPMB 1LO3L 3KLSA 4D94A 2R0ZH 4GAYB 4OGXL 3DJ9A 1CVSC 3OKOA 1JWUA 3IKCB 1P69B 3ARDB 4HWBH 2J7LA 2OI9C 4W68A 2VDKL 4Z77A 3NCCB 4JFHD 2YC1B 3C5ZD 3BPNC 2EYSB 4N5EC 3V4PL 5TF1L 1R6VA 2VXUL 2XZCL 3UTOA 3LDBC 4PJBE 1NBZB 1J1XH 5HDQL 3RVXD 1W72H 3JVGC 1UQSB 4OZIF 2OJEB 3MLRL 4U2ZA 4HCRA 1OGTB 2DB8A 3D69A 5F7DB 2CDGA 4G43B 4MJ2A 1TFHA 3BVNB 3VFNB 4E42B 5IQ7H 4L3CA 5D2NB 1AKJB 3D2UD 1RIUH 3BX7C 3UROR 2Z35B 1KT2B 3MGTB 4OUUA 1MPAL 5J7CC 5DJZA 4ZUUA 5DMYA 5GISH 3TVMA 4QRRE 1MI5D 3V7AG 3VGFA 4N8VG 4OIIH 3OG6B 1OSZB 1RUAH 2BMKB 4W70A 5SV4A 4FFWC 4RZCB 3UZEA 4ZTPL 1HHHA 4NSKB 1A02N 1EERB 1S5IH 2BK8A 3U6RB 2YR3A 5DQ9B 3WJLA 1N6QL 4LIQL 4MD5A 1KXVC 3GRWL 4L5FH 1OAYH 2DLFH 1QR1A 4IOSD 5ITFB 2D7QA 5E99H 5CUSL 2BSTB 2UZYB 2WANA 4FQPA 4M7KH 4DGYH 3MV9D 4GW1B 2NCMA 4UBDD 5DRZA 2A73A 3EHBD 3BI9X 3FTGB 3RVTD 5CUSH 5C0EA 3M17B 3MJ8B 4Y4KC 1OP3K 5F7YC 5AG9A 3I75B 1MY5A 4NT6A 3ARFA 5LAXA 1T2QH 1YJDC 4MSWA 1IGJA 3VE0A 3H9ZA 3OZ9H 1L8JA 4KKLD 3VFPA 4OTXL 2AVGA 4ETYA 1T2QL 1LQVA 5IJVB 1FFPA 3CSYB 3MC0A 2CXKA 1TMCA 4FZ8L 1AQKH 1F8TH 4KTEH 1EJOH 1TDQA 1TITA 2VDOL 4Y5VA 5CZXD 1BBDH 2CK0L 2XTJE 5BZDB 1A1OB 3D6GA 4ZUTA 1OAXH 5SWZA 2OTWB 3CFEB 5FKPB 1S7WA 3KDMA 4OCRH 5JLZB 4N0FB 3QUYD 4YE4H 1VEPA 2FHFA 3NA9H 1JN6A 3LQAC 4MA3A 3OJVC 4ZAKA 4RMTA 4Y4HD 3DNKA 2B4CH 5EU6E 1Z0MA 3OKLA 4AM0B 5ICZA 1QSEB 3BJLA 1B0RA 3P0VH 1DBJH 4P46A 2Y23A 4K8RD 2O26U 2VR9A 3SOBH 3QDHA 1YNKL 4WI2A 5B39B 4MAUH 3AU1B 3RJDA 2NNAB 4U0RB 5ACZA 1NBVH 1E4WH 5DEZA 3MREA 3Q6GH 3OF6A 3UTSB 5GS2D 1BF2A 3VWJA 2WWMC 4P2RD 3TBVB 5KS9B 4AENA 1NBVL 4X9GA 2GJZB 2XTJC 1KCSL 4DZ8A 5FA3A 5I1CH 4OJFH 4NQDD 1TZIA 1BZ9A 1FNLA 5IV2B 3BKCH 2IQ9L 1FRGL 4ZXBB 1TQBB 3WUWG 1NC4A 4YXLL 5ISZD 4YHZH 4U6HB 2VIRB 4XXDB 3CXDH 5T3ZD 3QUMB 4TULL 3D0LA 5AUMA 3RDTB 1B4JL 3LH2L 3WS3B 4PRHE 5D7IF 3M07A 1MJUL 1U6AH 3IXAA 1NCWL 1ZA6B 3FQTA 3RVVD 3O8XA 2BERA 1E27A 3VXOA 5TF0A 5INCB 1T22A 1P4IH 5L8KB 1VFAA 1VADA 1M05B 2X41A 4QRRA 3HKFA 5GGTH 3T0EA 5D1QC 5EO0A 3ZHLA 5JHDA 3V0VB 5LCVH 5B39A 5C0IA 2VE6A 4Z7VF 1OP9A 3OJ2C 3RZCD 1ROWA 2IF7A 2DQGL 4YK4C 1C7TA 3NCJH 3HE6B 2XN9A 4WW2F 4GKSB 4JRXB 4LOUC 2ADFH 2B1HH 3O81A 5D1ZB 3B5TA 1DVFC 3MLZH 4LPUA 5I2IB 4YIQA 3MO1A 1OTUD 3U0PA 4TVPH 3SO3B 3HI5H 4PJBA 1F13A 2YXMA 5IEKA 3H6JA 2A83A 2JCCB 2Z31D 2XQBL 2FLRT 3F6LA 3LKNB 3SCMB 2UUDK 5JW4R 4XP5L 1BM3H 3T4AA 1VEMA 4OGAD 4PJHF 3DLQR 3HUJE 4Z7UB 4XC1L 2F8XC 2NX5A 1ZVSB 5I1KL 4XPHL 1IGIH 4KJWD 4WCYH 2A9NL 4PGZA 4DKEH 2ZOLB 3PF2A 4IIQC 5HHNB 4WCYL 2GKIA 4HDIA 4NQEB 4Z0XB 4Z18A 2VN7A 3CCHB 4FQJL 5FF6A 3G5VB 3OB0H 3WIHA 1H3XA 2VUOA 2OJZH 4F7PA 3DBXA 5J4MA 4DZBA 2HRLA 5LGHL 5JTWA 3UP1A 2C1PB 4NOBA 5GXBB 4M7LH 4KK5C 4L9LB 2OJZL 4PLJC 1G6RH 3TF7A 1CXHA 2BHZA 5J0BA 4PRAA 4JFQB 3CK0L 2CSPA 5BZWB 2AJUH 3AY4C 5JOFA 1BJMA 4ZO6A 2ZSVB 5E7FA 4Z7VE 1GJIA 5FHBH 4XVUC 3MRHA 1DL7H 2MCPH 4OQTA 5E8EA 4HF5H 3TBTB 2ICEA 1T5WA 1XH3B 1UGNA 1BEYH 1WWWX 4FA8A 3EOYG 4ZDHA 1A9EA 5EH1A 3KPRA 1UWEH 3E6HA 3FO2A 5HHME 3NZ8B 4PJAE 3I2CH 3L9RA 5ENWA 1WIPA 5C6WH 4TTGA 3IJHB 3KYAA 1KT2A 3OB0K 3VXUA 5T33L 5MHSE 1JE6A 4ZFZB 4EZMA 2R69L 3HC4L 2HP4A 3MV01 1U8HA 2ZG1A 2J8OA 4HH9B 5E5MB 4WUUE 4N0YL 4QCIB 3QO0B 4P2OD 3TZVD 4N9OB 1TQBC 4HKZB 1P2CB 5B3JF 4UDUB 2NX5B 4FG6C 1B2WL 1ZE3C 5HYIA 4P2CG 3EYFB 4I18A 5E6ID 4ZUWB 4NUGH 4BFIB 3EIFA 3GJEA 1UCTA 5I16B 1T7VA 3LKSB 3DROA 4K7FA 2IAMB 2JB6B 1F58H 5E94A 1JGEA 4JO4L 3PP4L 4WHTA 4MLSA 4NQSA 4Z9KB 4QYOB 5HY9B 4MA1B 2YPVH 2DTMH 4F8TA 3HE6A 3BH9B 1ADQL 4CBPA 4MJ6B 4LKXA 4UTAH 4LSSH 3CZFB 3VXMA 3D87B 4D9QD 4BZ2L 1JHTB 2UYLB 1KBGL 2O5XL 4H26B 3TA3B 3LQMA 4NM8L 2LAAA 4OIAA 5ALBL 1G7QA 2NY3D 3ILPA 4LPTA 1DUZB 5DD1L 1DQQA 4L9DA 1XGQB 3FB5B 4XC3L 3QNYB 1T04B 1NPUA 4PGEA 4MXQA 4QRPE 4MJIE 2XT1B 1YEKL 3O2DL 5TQ2H 4OM1L 2YD7A 4PRIA 4NQXA 3B9EA 3RDTA 2R2EA 4GUPA 4NNXB 4AEHL 3NZHL 5C8JA 4JFXA 1KLGA 4YH6A 3FOMB 3WFBL 3O8XD 5I1EL 3HG1D 5DJ6B 4DFIA 4WEUD 3PHSA 2XN9B 3EAKA 4JQXC 3RVVC 5C6TL 3CPLA 4C56D 2DKMA 3KWWA 3GIZL 4KJQC 3NIFF 5BRZB 2W9DH 2DMBA 3MLRH 3IT8D 3M8OL 3W11D 4G3YH 3ZKMC 2OS7A 4X8XA 4Y1AB 2NY4D 3QG6B 3QQ4B 4M1GL 2YZ1A 1P7QB 1NMAH 2VQ1B 3QHFL 4P4RA 4F15B 5E8NA 5T1LD 4HC1A 4YLQT 2NY1D 1A0QH 3ILQD 4A2LA 4XCCH 3TNNA 4XWGH 3NOIA 4ISVA 4UQ2B 3KPMA 3WFHA 2VTFA 5E00A 3V5KA 4Y5XB 5GJSL 2ZWLT 1IEBB 2OL3A 3OF6D 4YUEH 2F53E 4YHIB 2NW2A 2GIYA 3S3JA 2V17H 1WICA 1N4XL 1BBJA 4TOYH 1BQHA 4Y4KA 4YDLC 1PG7X 1MELA 4AL8H 2GAZB 2APBA 4JY6A 1BWMA 2E8ZA 1WIUA 2ZUTA 2PXYA 3QDMB 1G9MC 3CXHK 3IFPA 5SWZB 4LSPH 1J1PH 3RWJB 3DPBA 4IRSC 4F7TA 4Y8AA 1RK1A 4YDVB 4K94H 3I6KB 1T1XA 4DOHB 1TZHA 4OFYD 1UB5A 4HFUL 4XH2B 5FEBA 1MF2H 3P9LA 3O3AB 2XN9D 4QGYA 4HGWB 5IJVA 3WLWD 4XCNA 1RUQH 1MF2L 3FT4B 1RJCA 3OZ9L 1CDHA 3FFDA 4KQ4H 3KPSE 1QBAA 2LU4A 4V1DD 1BJ1H 1GZPB 4YEEA 3GMOB 4M02A 4YFLF 2AJXH 2QBWA 5CHNB 1NL0H 3OKLB 2X09A 4FFEX 4CL7A 5KS9F 4PJ8C 5DEGB 3MGAA 1BP3B 3KNBB 2NW3A 2R29L 2W59A 4PJDA 4TSAH 1BFOB 1K8IA 5L2KD 5I8KL 3LQAH 2ZUVA 4BH7B 4GG8A 4ZFFB 5A2JH 4YBQC 3MUHL 3CFBA 2D7PA 1R5IA 5DJXB 4HKXA 4N8VA 5BW7C 4RNRA 3A0OA 4ZUVA 1T21A 4KK9C 3VGEA 4CJ0A 1DEEA 1WZKA 4LPWA 4M93B 4ZNCD 3SOBL 2EH8H 3VFPB 5E99L 3MV9E 3RWFB 1NANI 5HHXL 1GH7A 3L1OH 5HPMA 1CGSH 1U92B 3ARFB 1P84K 2VUYA 5GIRB 2OTUB 4PRNA 5B21A 3HE7D 1NFIA 4JCLA 4WFGE 1YPZB 1TTUA 1D5ZA 5CGTA 5SWQA 1NSNH 4K23H 4N1EA 2Z93A 5E2WH 1S3KH 1NGZB 4NQVB 3QIWC 4HWZA 1Z9LA 2R8SL 4PRIB 4LSDA 3UC0L 1A3RL 2EYTB 4BK4A 2Z91B 1MFBH 2JELL 1JWUB 3BGFC 3OB8A 3MTRA 5IFJB 3TYFB 1OSZA 1RZIA 1CLOH 4OV5B 3V6OE 4WFHD 4BJLA 1T04A 4X4ZA 4ZTOL 4JFOA 1ZV5A 2FB4L 3ZYOA 3FFCA 1WISA 4JFDE 4S1RL 4LSUH 3VG0L 5HYFA 4PJXA 4LSTL 2NY4B 4R8WH 2R0ZL 5C0BE 3TBWB 3WNLA 1WBZA 2UYLA 3MGOA 4G9FE 4LSTH 1QUNA 4LMQE 1K4CB 4XP6L 1GVIA 4MD0A 4HWBA 1ORQB 5T3ZH 2HTLD 5DJDA 4RAHA 5FYKU 4DGIL 2VR4A 1RK0B 3MXWL 5I18H 1MVUB 2IADB 2FWOA 3TO4D 2IJ0C 4WGWB 3MJ7A 1HI6B 3S37X 1AHWC 3NFSH 1DJSA 3KYKH 1W72L 5DURD 2ADJB 5AAMA 4YO0A 3HS0B 4JFDB 5EBLA 1RZGA 5E8OA 1XR9A 4PJIB 3GSNL 12E8L 1MFEL 2WWMD 4NUJB 4OBSA 1HINL 1AR1C 2WUBH 3ZZ1A 3B9KA 2YRLA 4NQCA 1J11A 1CGUA 12E8H 1MFEH 5AWNL 4U4BA 3DMMB 2AK1H 4Y19B 4UV4H 3T0DA 5JUEL 2FJGA 1T3FA 4XVTH 3X11A 3KYNB 4NBZB 5IB3B 3MRDB 2H6PB 2XFXB 4GS7B 3BPNB 1IGFH 5GQBA 1UCBL 1RUAL 3VFGH 2OSLB 5JORB 5MEQA 1P9MA 3ULVF 1C12B 3ZSTA 3OGCA 3JVGA 4G6KL 3KPSD 3F7RA 2BNQD 4BA8A 5LGHH 3WLBB 3O3EB 3GBML 4O58H 4O2CB 5LXGL 4R97B 3DECA 5ICYB 1IT9H 4XNUL 5DA0B 1U0QA 5IB4B 3NCYP 5L0QB 2DYPA 4EXPX 1Y0LB 4RAUA 2PTUA 3F7YB 2BVYA 5DSCA 3CFJB 2QQLL 5BS0B 4LSQL 1BGXL 3GK8H 2BSSB 4ODSH 4U1IA 5DJAA 2VDQL 3MJ9A 4LHQB 2R2HB 5EZLA 5H37G 3NIGF 3OV6A 2E3VA 4PG9A 1BFVH 3EYVA 1MCOH 3QRGL 2NX5D 1ERNA 2X6MA 1JPFA 1ZLVK 3QRGH 2OQJA 3NGBB 4I0KA 4LL9A 4P2QA 3I2CL 3KYMB 4GH7B 5ADOH 3VG9C 2XQBH 4MMXC 1Q72H 3ZE1E 1F42A 3ULUL 1T0NA 4XP5H 3DURB 3NPSC 3V9FA 1Q72L 3FZUD 4EN3D 1AHWA 2PW2A 1QFHA 1MFAL 1XIWB 4HIIB 4PJEB 2CUMA 4JHAL 3V0WL 3PJSB 2R0KH 3LKNA 1FH5H 2J5LB 1Z3GL 4KC3B 2DLGA 3RVWD 3MRRB 3GNMH 3AMKA 1YY8B 2IANA 2E9JA 4RBPH 2F19H 3A6BH 5EORH 3VFTA 3MV7E 3PHQA 3GNML 4TN9A 1CR9L 4Z0BH 4HGMA 4OAWA 4P5TC 4GKSA 1F4WH 3L5IA 4ORGA 1S7XB 3DO7A 4PLJD 3HE7B 3VG9B 1MLCB 3HMXL 5CFHA 3PNWB 3IDGB 4PJCA 4PB9H 5D7LD 2ZUSA 2F53B 3HRZB 3HMXH 3ARSA 2JKXA 2VE6B 1UZ8A 3CK0H 5D70H 1UFUA 2X89A 3BPLC 1EJ6A 3OAUL 5HSFA 2DI7A 2LAGB 1P7KA 1JNLH 4YFEA 5M95B 5FUOL 1A47A 4CADB 2AGJH 5HDBE 5D2LF 1KPUB 1CF8L 1KJ2B 4QRPD 4W6XB 4P5MA 4UB0H 1F4HA 1T4KB 3WDIA 3EFDL 4PLKC 2I60H 4S1QL 5DS8B 5HHOE 2CGRL 1MNUH 3LPWA 5T33H 4OZHF 1E4XH 4N0UB 1DCLA 1OF2A 4LSRL 5IHUH 3BP7A 3DYOA 3GGWA 3KAAA 2BVOB 3MMEB 5F7WC 2OX5A 3JV4A 3GUTA 2D03L 4DGVL 2K9UA 5ICXB 3BQUB 1BZ9B 1XGYH 1P6AB 4YFDB 3UTTB 5FUZL 2F5AH 2YKLL 3LB6D 3MA7A 1Q0YH 4CADA 4M48L 4X9IA 1J8HE 1JK8A 5C2UB 4UNUA 2F5BL 4YWGL 4YQXL 5C0CE 5GRUL 4G42B 3TVMD 2ESVA 1PKQA 3L3JB 3QG7H 3P30H 3RY6C 3QH3A 3BKMH 5HDBF 2RQ8A 4WI9A 2Y36L 5J8OA 3VGDA 1Q1JH 3WD5L 3IFOB 3VRIA 3L3HB 1IKNA 3SE8L 2OK0H 1K9TA 4K3JL 5F7FA 5F89A 4LU5L 1KTKE 1TVHA 2DWEB 3E6FB 2FO4A 4ORGB 3R06A 3PWPA 5D7IA 4TVPL 1YEDB 5BS0D 1F6AB 1MRCH 1QFWH 4NIKB 5KVFL 3NACL 1KCUL 5FGCE 5T3XL 2UZXB 3MRRA 3UJTH 1DQDH 3TLRA 5HHPA 3QHZL 5D1ZC 3MV8D 2AEQL 1SY6A 5I0ZA 1MIMH 4PJEA 3ET9F 1XIWA 2VDPL 1DBAH 3PWJA 2YUZA 4GXUM 1EXUA 1F2QA 1JF1A 4G8FB 1IAKB 3GSOB 3JV5A 2YA1A 5KVDH 2IH3B 4S0UC 3MXVL 3IJSB 4MVBA 1J18A 4XCFL 3MV9A 3RPKA 1CS6A 4Q9CA 2G5BA 4JRYD 5GRVK 3L5WA 4ODBD 3KYMA 5DZLA 1GIGL 4UU9B 1FE8H 4MAYA 4IOFC 1JPFB 2WQRA 4HMCA 2Q6WA 1J1OL 5IEHB 4L4VE 3EO9L 5EOTB 3BN9C 4QEGA 2QSTA 4B7IA 1G0XA 4J6RH 3HZMA 4NBYB 1K85A 5IGXL 1AIFA 1MI5A 3NCMA 1CICA 4JFDD 5GS1B 1X5KA 5B4MD 3G5XB 4JM2C 3SE3C 5DC9B 4B50A 4JREB 4MD5B 1IEAA 1I7TB 3RL1A 2VRAA 5EBMB 5FECA 3ZKMD 5TDPB 2AXFB 4F7MA 2UZIH 2FX9H 3VRJA 1WV7T 4NM4L 3TP4A 2UZIL 1EFXB 4JZJB 2P45B 2EEAA 2QQKH 3ZE2F 3V6ZA 2KKQA 3O3BA 3TPUE 1KOAA 3BZEB 5D1QD 5FO8A 2DQFB 3G5ZB 3VXRE 4APQD 4FQCL 4JQXA 4RFOL 2Q1EA 4X7TB 3LEXA 2W60A 3DXAA 4S1SH 4XPAH 5E6ZA 3P0YL 2BY0A 4K71C 1WZ1L 4NUGL 1EGJH 5IP4A 1NGQL 1JHKL 1UQSA 4NCDA 2VZSA 2JF1A 4HSQA 3DX6A 3DXAE 5CGYD 5C0FA 1FNAA 5D9SB 4PJDF 1TCRA 3QXWA 2NXYB 1DVFB 1HI6A 4TUKH 3WO3B 3WIIL 4DVBA 1CG9A 4GRWB 1BVLA 2YMXL 1Z6JT 1U91B 1M1SA 4R26L 3KHQA 3UXFA 1N6UA 1HSBB 1FC1A 3MRNB 4UTBL 5D6DC 3O6KL 2BXYA 3SKJH 2JJSC 1OGAB 5LGJB 2E9BA 2CLVA 3MUGB 4GG6E 3NMEA 5GRYA 5T3ZE 1WBZB 2PW1B 1A6AA 3IDNB 4MDJA 1BX2B 4L8DB 4HJGB 4PJXB 1FLTX 4PJGE 4EQ2A 4XVSH 4JCMA 5HBBA 2LE9A 4R4BA 3W9EB 5C07E 5DEFA 1AQDB 1KC5L 4LRNL 3ARED 4OCRL 4X6CF 4PV9B 2GK2A 4CNIA 4CN4A 2VMFA 3B83A 3CU1A 5JPMA 1HXYA 4OV6F 4X6EB 5EU4B 3D18B 4JDVA 3X14B 1JIBA 3MNZA 1ZLSL 4WHYH 2GTZA 4NQDA 4FOMA 1BVKA 3QUKB 3GJFB 7FABL 1AXTH 1I1YB 4G8IA 1XGRB 4YR6A 2EDQA 2X4SB 3MUJA 1B6UA 3JWDH 4LLYA 5K9KB 3F8UB 3BD3A 4HWBL 5F7MC 3Q2CA 4Z95H 4FQLL 4X98A 3ZDYF 7FABH 1ZVYA 4XMLH 3FOLA 2VDKH 4L8SA 3QXAA 3BPOC 5I1EH 3CXHJ 1KENH 5D7JA 1EZVX 1DQMH 4PJCF 4WNQB 4YHPA 1NFIB 1KTDB 1L6XA 1X5IA 3ARDD 5DQDH 2NMSA 5HYSG 1BVZA 1N0LA 4M61A 5GGSY 1W8OA 3K3QA 4ESKA 2YHGA 2P8MB 1JGLL 2Z9TA 3NIDE 1RJZA 3EYSH 2J5LC 4UOW1 3U9UB 5I1CL 1A6WH 1Z5LA 4RGMC 2GSIB 1DQJB 2AK1L 3ES6B 3Q0HA 3H42L 1INEH 3B6SA 4RDQG 1HH9B 3HNTL 4CDGC 4RNRB 3VDAA 4XGZA 4XNXH 1ZVHA 2IBZX 2R0LH 4F57H 1GZQA 3N9GH 3VRLF 2DL9A 4XNXL 3BDBA 1CI5A 3LN9A 1ZXQA 4A6YB 3U2SA 1BFOA 1SM3H 1I85C 2CKBB 4PJ9D 5C0CA 5I76B 2VXTH 4ONHB 4GJTB 4TTDD 3WDJA 4EUPA 2CIIB 5KVGH 4PY8J 1OAYL 1A7PH 2DLFL 5CHNA 4PJ5D 1QNZL 3U7YL 4HWEL 3OKKB 1EFXD 3ECBB 2Z92B 3QZWG 3FCTB 4H5SA 1UJTA 4I13B 4JKPH 3S5LA 3QEUB 4LF3A 5L2KA 3MRQA 5DK2A 4RGOH 5EUKA 4ZUSB 4WW2C 2PUQT 1CFSB 1EFQA 1IM9D 4GBXD 2YPLE 4D9RE 2IBBA 5FDWA 2LTQB 2ZCLH 4RGOL 1AC0A 5D1XC 3IGAB 5ABDE 1UJ3A 1UB5B 3KXFA 2AV1A 2FECI 1FL3A 2EC8A 1CD1B 2FECL 3BP6B 2R1XA 2EEDA 3ZTNL 2YD8A 3S35H 3WJJA 4EBQH 1LEGA 4QXGL 2CDEB 3S36L 1S9VB 4U6YB 4P99A 4F33A 3LKQA 1T0MB 4ODWB 1MSPA 4UV4L 1AGDB 4ELMA 4KJPC 4O02H 5C7XH 1FZMB 1A6VL 2GY7B 1EEYB 2E6PA 4P57A 2AK4E 5I8OL 1JZ7A 1SBSL 3W5MA 4ZO9A 1CFVH 1MCWW 4YHMH 2DMCA 3TNNB 3JV6B 2ZUYA 1SBSH 4YHKH 3UZQA 4Q58C 4ZTPH 6FABH 2J2ZA 1ZEAH 4YHML 4NO0B 4MXQD 2V2WB 4YHKL 3DO3A 3RBSA 5CD3B 3DETD 4PRPE 5D71H 1OQXA 1KJMB 5BQ7B 4OLWL 4LSQH 1FG9C 4C83B 2ENYA 1NFDE 2NY0B 3MSPA 3VGBA 3LEVL 3CPLB 1D6EA 5EU7C 4FQ1H 1JZ3A 5GS0D 4RMSA 4JFFB 3C60C 3DUUB 2Q20A 1RUML 2FO1A 3S36X 1S3KL 3WNMA 1XCTA 4HX1B 2AP2A 4H25A 3RX5A 2P46B 4H0IA 3OKNB 2GSGB 4JEGB 1R3JB 3OXSA 4MCZB 5DA4A 1T2XA 4F2MB 3HZKB 4HLJA 4X4YB 2VABA 3OL2A 5ETUA 4DW2H 1BIIB 4QOKD 1IGMH 5EUOA 5AZ2L 1WT5C 2BNUB 1I8LA 1S78D 1NJ9A 3G6JB 5L8JB 1KPVB 2ZNWA 4U1SB 4L4TE 5DI8A 3VD7A 5D8JH 1RQ5A 4Y0GA 3CIQA 4KKCC 3U46A 3BXNA 1OTTC 5AD0B 1S9WB 5C09D 3TBYA 4XCEA 4HIXH 4DCQB 2DN7A 4NWTL 2FL5B 1MCFA 2EDRA 1YY9D 3CUPB 5DFVC 1AO7A 4HIXL 3RVWC 4HS8H 2ORBH 3TIEB 1YEIL 3MBED 4XRCB 4NKMB 4QT5B 3R8BB 4H1LA 2PYEB 1S7QB 3ARGD 4M4PA 4DGIH 1GXEA 3BDYL 2XY2A 2QEJA 3BEWA 1KCRH 3BZFA 1QP1A 5IKCB 2NY5H 4QYOA 4CU8A 5C9KA 5C08A 1C5BL 1BD2E 1MJ7L 5TDOA 3DX9A 2GJJA 3BP5A 3F7PC 4JDTL 1YEGH 3IDMB 5E2JA 3PWVB 4XX1E 2QKIA 3LS5L 5DRXB 4CAGA 1EGJA 1NCCL 4JPVH 2WUBL 4X0KB 3JWDC 2H2SC 2J8UF 4NO5A 3LS5H 3O4LD 2G9HB 2IG2H 5CJ8A 2IQ9H 1FL6B 1BM3L 3OKDB 1G9NL 4JO1L 4XVTL 2Q86A 3SBWC 5F8QC 1PW3A 4PLKD 4FNLL 1NAMB 3ZT6A 15C8L 2IALA 3GI9L 3E3QE 5C86A 4B5EA 2YEZB 1FNEA 1VHPA 1YZZA 3VFGL 2AERT 3PABA 3K8LA 3QDGA 1MJUH 4LP4A 4TYUA 2X4PB 2PR4H 5EO1B 5T1LA 1I1AC 3WL9B 4U6TA 2JB5L 1IAOB 1GGIL 5IF0A 2VR5A 3S6CA 3MCKB 3RWHA 5CWSA 5C07B 2P8PB 5DK0B 4HJ0D 4G6AC 5HYJA 3D0VB 4GKZA 4N8CH 5DMKA 32C2A 4PJXE 2X9WA 4NO0D 3QI9C 3WFEH 3GHEH 1EAPB 2WIIB 5FUCE 4OZIB 1K5NB 1X5LA 3VD9A 1NDMB 5F97E 2X40A 2X44D 2XNAA 3H9HB 5I75C 1OCWL 4K3JH 5FHBL 4P9HC 4PJ7B 4OZHE 1K3IA 5A3IC 2H45A 1BEYL 4XP4L 4AMKL 1H15A 2D31B 3RDTD 1AP2A 1ZHBA 4FQXC 3RU8H 2P5WB 4QHMB 2FR4A 4JM2F 4Z0XA 1KCLA 2ATKB 2MKWA 3K46A 1N59B 3O45A 5TPWH 4HIHA 5HYQA 4KAQH 3H8NA 3I50H 5GRVL 1ZT4B 3FT3A 3BP4A 4EOWH 1R24A 4RBPK 5DYOA 4N0YH 1DBAL 4R3SA 1AGBB 2DWDB 5FYJD 1CLYL 3PV6B 4IM8A 1TNMA 4I9WD 4QNPF 2QHLA 4XZUB 4ODUA 5EU3B 1NGQH 2WLYA 2GQHA 4BQ6A 1KUMA 5IG7A 4ODTL 4JQIH 5BJTB 5LBSH 4LLQB 3QXUA 5ILTL 5IT2H 3QQ3A 2ICES 4L4TA 3KJ6L 1FNSL 3VFVB 5HD8D 4X99A 5E2TH 1BIHA 1ZHNB 1YMMA 4J3VA 4PJHB 1EEZA 3P73A 3T2NH 5IFAH 1HH6A 2P5EE 2JK5A 4LASL 2EECA 4MXQC 4OF6A 4X6FB 3D85B 5DT1L 2F74B 3FT2B 1GOFA 4JQVA 1NEZA 3VCLA 5IUSA 2FJHA 5K9JL 1KBGH 2BZDA 3ULVC 4Z6AT 1A1NB 4FZEH 3CFKA 1LE9B 5CINL 3DRTA 5DFWH 1JYWA 2X4TB 3RWIA 1CGXA 1CDUA 4S0SD 4BELD 5L9DL 3DX7A 2P8LB 1DDHA 4MWFA 4ZMAT 2GITB 1C08A 4FQQA 2CKBL 3UMTA 3TF7C 4OZ4A 4LEXH 1LK2B 3BMWA 1TLKA 4P46C 3O11A 1EIBA 5L0QC 3VXRD 3JWDL 3LZFH 3ARBB 5I17B 2HT4C 1U58A 3T0VA 4S0TD 4ZQKB 1ES0A 1WZ1H 4AH2A 2F5AL 2YKLH 5IV2A 4HXAL 4DAGH 4CN6A 3Q3GB 5EC2A 1OWRM 2BSRA 5CP7B 3QEQB 1HOCA 1TNNA 4XP9L 5GRUH 3LQZA 4HXAH 4QY8B 2FCBA 4OKDA 2EIZA 3C5ZB 4JO2H 5TE7H 1A22B 3HMXA 3O6FB 4LCWD 2AJ3B 1MCHA 2ZG3A 4R0LC 3PDGA 3QA3B 4MCYA 2BVQB 2PO6D 1HZHL 2CO6B 1JGUH 5JQ6L 3MACL 1YPZF 1X5GA 3PGFL 5D6CB 4BSJA 1KIRA 4U1GC 5H35A 1NAKH 2R1WB 4PIRF 1NFDB 4IJ3B 4LBEA 2E7LC 4PJ5A 5DJ2A 3CVIH 2YPLA 1DLHB 4KV5E 1WWCA 1EPFA 2I5YH 1BJ8A 3I6LE 1T20A 4H20H 1G9EA 2DIBA 1SJXA 1OARH 1CIUA 3FFCD 2KL6A 1FYHB 3MRMB 4S2SB 4J1UA 5CBEA 1MHPL 3GMNB 4U1KA 5FO9A 4OZFG 2P5WE 4P2QD 4XBEL 4RIRB 4ZSOE 4D9LH 1Q9LA 1U8JB 3F5WB 2VITB 3MV8E 5EO9B 4QHKI 4GXVH 4XHJC 5H94B 2ERJB 4U1GB 3W2DH 3QNXA 3MLXH 4N8PA 3OXRA 3ELAT 2GI7A 4WU7A 1OTSD 4XPGL 4QTIL 1TETL 2DM4A 3WNPA 3F65A 3H9SD 4F58L 3C6SB 4ZOCA 1I7ZA 1T1ZA 4F15C 2DI8A 4P9ML 1YN7A 5DVNA 1L7TH 1ZSDB 3LSOA 4K8RH 4L1HA 5I1LB 3FJTA 4L4VB 4XP1H 4OFPA 3MBEA 4GW5B 3QHFH 1QSEE 4JR9L 4NRYB 3U6RA 3NFPA 1TXKA 3GBLA 3HLAA 3QFDA 3HNTH 1A6VH 1F4XL 4MXVF 3HB3D 1P1ZA 4JR9H 1IEHA 2R23B 5I1AB 5HYSB 3FO9B 3PV7A 4K07A 3F7VA 2AEPL 1NLDH 5DMJB 5INDA 5I9QB 3W0WB 4RFNB 3O3DB 5DQJB 3DUSA 1CFVL 3AMLA 1IGFL 4PBXA 4ZS7L 4TTDC 4HEME 2QADB 6FABL 1BFSA 2OI9A 5FO7A 4ZSOA 1T1WA 4PD4K 1ZA3A 3LDBB 3PQYB 1NC4D 4LSPL 4Q74A 1QNZH 2FIRT 3ULUE 4DUWA 3PWPD 3I02A 1FO0L 2DBJA 2OR7A 2QQLH 1T5XA 5LKNA 2IH1A 1YECH 4YNYA 2C5DC 3GK8L 1KPRA 2XZQH 3OAZK 4WUUA 2KQNA 1J5OH 1CT8B 3LD8C 5IVXA 1U41A 2FEEI 3O6KH 3UJJH 5I1HL 1IAOA 3JV0A 4NBXB 4GS7C 2HJKB 4HIEB 5HHMA 2VDOH 2AJXL 5JMOC 3UC0H 4M8QA 43CAA 4BSVA 2VC2H 1K8DA 1YMMD 1MFDL 2D7OA 4XPBL 3VI4E 3IAPA 3NTCL 5BOZG 3F58H 4OZHB 1BBDL 1RD6A 4JRXE 4ZXBC 1KC5H 5C08D 4L8CA 3NTCH 1WTLA 2C9AA 2C26A 4UT6L 3MYZA 2E7LE 1NMBL 3WE6B 1FZOB 1U8IB 1H5BA 1IJ9A 3H3KA 1KELH 3SKOA 2J6EL 1MRFL 4LCUA 4YBLB 3VFOA 3QJFA 1M7IA 5D2NC 1G7JA 4LEOA 1KELL 3AS3A 4LHUA 5DD3L 1DUYA 5FGCB 5CILH 3SDXB 5LQBH 4WIQA 3TO4C 5K33A 1DQML 3UPRB 2BHYA 4Y19E 4LLWA 5IK3B 4OLWH 1IGCH 1U8KA 1DBJL 5GS0C 1JWMB 1TVBB 3SBWA 3I9GL 2VJXA 2YD4A 1DEDA 5F7LB 3WEXB 1U3JA 2NX5E 1L0QA 3QNZA 3L95B 5GPRA 5J57B 3ULSB 4WW1A 1H5BC 2P43B 4OLZH 5MERA 1JYNA 1CGWA 4KKAD 3IXTB 4JZNA 3QIBB 1HILA 5EU7E 5IJKA 2EDLA 3TWCL 1UB6B 4M6NH 2HLFD 2A6KA 5JA9A 1CN4A 1S78C 4E5XA 4C54A 2PYFA 1UVQB 1M6OB 3CDGB 1ZHKA 3BWAA 3HMWL 3UTZA 1EEUA 4ZAKC 4ZOAA 5L2JA 4IMLA 1AGEA 1CFQB 1LE5B 4KKBC 5MENB 3IDYB 2IAMD 4CMMB 1AGFA 3KPPA 4IRJC 2GHWB 4J3TA 5E2UL 5AYUH 2V5TA 3CH8A 3ZT7A 5JOPD 2ED7A 4NRXB 2P7TB 3GSUB 4I5BA 4LSVL 1FNGA 4QWWC 1IAIH 1CCZA 4O5LH 3S4SG 1MIEL 1SEQL 2W9EH 1HSAB 2H26A 3NAAL 1MWAB 1OY3B 4PRHA 1EUTA 1Q38A 2ADFL 2B1HL 4BSWB 2BVPA 3MXWH 4O5LL 4JDTH 1TJIL 1NGWA 1D5BA 4LKCA 3FHQA 3PL6D 5C92A 5F8RC 4LU5H 1LEIA 1A7RL 4HLZG 3RU8L 3NFSL 4MQXC 1IRAY 4FQIL 1S5HA 4HWNA 4KTDH 1T7ZA 2LU7A 4FQ2H 4P48A 3NPZB 3QDAA 3IDYC 4WDIA 2YUVA 1BAFL 1M7DB 4FQ2L 1L4IA 3BZ4A 3K4AA 4U3XA 2Q87A 3L6FA 4P2OA 3TZVA 5GRWA 4MNGB 1CDJA 1U3HD 4PTTA 15C8H 2VDPH 5L88L 1U8MB 1MQKL 2PTTB 1Q9OA 2H32H 4C57C 3L3KB 4KWUA 4MVBD 4DUVA 3B2UC 1R5WB 5JIHA 5L88H 3VJ6A 5ESAB 2DQIL 4Z7OE 5CEZH 3UYRL 4XCFH 2GUOB 1KLFA 2GK0B 3U4EB 2DQEL 4AEIH 3DOSA 5C0NC 2JB5H 4HC1H 4IHOB 5EN2A 1SJHB 3VXTB 2DQEH 1QSZA 2G75B 4EIGB 1AY1H 2V5MA 3GMQB 2OXHA 5FDWB 4E41E 3O0RL 4M7JL 1J0HA 5F9WB 1V7NH 3SKMB 4YDIH 1LK3H 4J6RL 3O0RH 2Z92A 3QI9D 4PJFA 3RL2B 3MROA 4NPYA 1FJ1B 1OCWH 4R6UA 5GGSB 4FZEL 2ZUXA 4J3XA 3HPLB 5CJ5A 2LABA 4YFLI 2FEEL 3MLYL 4AMKH 2FRGP 2ZUWA 3FQUA 3PHOA 2X70A 1FNFA 3E2HA 5F1IB 4QXUH 1BD2A 3O6LH 4LIQE 2YN5A 3G04B 1DN2A 2XA8H 3BJ91 1B4RA 3EOAB 3AAZA 3ARVA 4WW2A 4JVWA 4GAFB 4RGNB 4PJEF 3E1F1 1N0XH 2H3NA 5DRNA 1PQZB 3EJJX 2FJFB 1DN0B 1AO7E 4JM4H 4GBXA 3G6AB 2IANE 5JO5A 5KVEH 8FABB 5E0QA 3AM8C 2YWYA 4NZRH 1EGJL 1NCNA 3VFWB 1A4JB 3FQXB 1KIPA 3GMRB 2F19L 1RZKH 4JN2A 3CH1B 1JV5A 1PG7L 1RZFL 2DTML 4PGDB 3CMOH 3QCTH 5CKGA 1ZGLA 4FRWA 3KR3L 3LPGA 2PNDA 1I8LC 5JZ7C 4PB9L 3U48A 4X7SL 2YPVL 4WFEE 1ADQH 3BIKB 4JY4B 1EDQA 3NFNB 3SDDB 3CAFA 3KLDA 2AJSL 2N7BA 1D7FA 5HGBA 1HXYB 4X7FC 2DTSA 1NCBL 1KB9J 5BXFB 3CNKA 1PG7W 5DD1H 3BKJH 5E1AB 4L8CB 2JIXD 2UVEA 1DQLH 1E4XL 2F8OA 3QUZB 5JDSA 4HJGA 4P2RB 1VFBB 4OGXH 2YSSB 3IDUA 5LJYH 3UBXA 3MRKB 4U1HA 3U30C 1UZ6F 2EDHA 4EI5B 4GRLC 4A2MA 3JTTA 4X80H 2HFFA 1SEBA 1UC6A 1IFHL 1D5XB 3BSZL 3MQIA 4LNRB 5FGSA 5HHVL 1TETH 2VXUH 4PPTA 1MFNA 4N9GA 5KOMC 3G9AB 3MZGB 3I6GB 4GOSA 5GRJH 4QTHA 3QFJA 3X13B 3P11H 2RCSL 4H8WL 4Q2ZB 5FOBA 5MEPA 3W5NA 3TJHA 1Y6KR 3AS1A 2HLAA 1E4JA 4DTGL 4XMKL 1HIML 3AREA 1SVZA 1DBKH 2V2TA 1L0XA 3V8CA 3PQYA 3H42H 3QDJB 3NN8A 3NH7H 4WJ5A 1V3JA 1T1WB 1HQ4A 3QIBD 1S9YA 4UDTB 2I07B 2ED9A 4Y7MA 2DS4A 5DJCB 4H20L 3B8YA 3JWOH 3KPTA 5FO8B 3EKCA 1I9RH 4R7DB 4ZS7H 3OKMA 4F9LA 4UT7L 4R0LA 4XT1C 1EO5A 2BNQA 2I9LA 3O3DA 1FGVL 4ODVL 5EBWB 5BXFA 4R7NB 1RHHA 2H9GB 4G9DB 4XBEH 4AG4L 1MRDH 3VI3F 2HFEB 3C2SA 2X4OB 3KYOA 3WN5C 4KJPD 2J88L 2VSCA 2I25N 1J8KA 2YA0A 3WMSA 3NFPB 1KG0A 1QRND 5KSBB 4M43L 2O61B 4I4WB 1IEAB 3HAEH 2K7QA 3FO1B 3HPJA 3BMVA 4TSBH 4EIZC 5HGAA 4M43H 2CUHA 3RAJL 4QRQA 1KB5A 2XKNA 4DEPC 3ARRA 4JVPA 2BCKA 5F7NC 3SO3C 1YQVH 1F3JB 3IS0X 2YK1L 3D39D 1FVEB 1BLNA 1MHHB 1NGYB 1D5XA 2YMXH 5A16B 3FN0H 1YQ2A 4RMVA 4X9HA 1YNTA 4QOKB 5IW3A 2VL5B 3FN0L 3VFWA 4C56A 1F4YL 2AKRB 4PV8B 3C5JB 1KNOB 2OMNA 5F70A 2P5EB 5GGTA 1AH1A 4GSDH 4D0BB 3G6DL 1N8ZB 2PYEE 3CLEH 3NCBB 1KSRA 4QHNA 2XWJB 1UG9A 2FX9L 4I2XB 3DV6B 2BY2A 4Y4FB 1YJDL 3WFDH 5FHAL 1AE6H 4RA0C 4U1MB 3QR2A 5KZCD 3U0WL 4UT6H 3TYGH 4G6FB 3BISA 2BFVL 4V3DB 3G04A 4S2SA 4EKXA 4MXWH 3QJHB 4U1LB 4Y89A 3CC5A 4MA8H 3BIKA 4JY4A 4RWYH 4I8DA 4MJIB 4P9HH 3MFGB 1DBBL 4AIXA 2ICWB 1LP9A 4HD9A 2VLMD 3RNKB 4E9LA 4OZGE 3MRCA 4RFOH 3TFKA 2F54E 2G5RA 4MDIB 2X4RA 3EHBC 1J7VR 4KKCD 1OTTD 3AUVA 1U3HA 4ZS6C 5A2LH 4R9HA 4R90L 5HHMD 1GPOH 4PJGA 1QPXA 2AJ3A 5CGMA 2N4IA 3N1MC 3ZO0A 4FQXB 1TENA 4V1DB 1ETZA 1FV1A 2V6HA 5JW4Q 3RKDD 1G7HA 1VFOA 3C5ZA 1JGLH 1AJ7L 1BD2D 2V9QA 4LRIA 1ND0A 5DF0A 4G6AD 3SDYH 2AV7B 3HUJF 1BQUA 4MJ4A 2WIMA 2VLRE 3PGDB 5F6IC 3SKJL 3SJVD 1NSNL 1YN6B 3MV8B 4K23L 4PP8C 1X5AA 4M9OA 4K9EL 3KPSA 5A1AA 3NIDF 1IKFH 2MSPA 2DAVA 4WVRA 4B53A 1MHEA 5EC1B 1MAJA 1OARL 3WIFB 2E27H 5TGBA 5J1TC 3ZLQC 2IPTH 2VKXA 5I1IH 1P6FA 2C3GA 3FQUB 3PHOB 2GCYA 4FTVA 5IFHL 1AXIB 1CE1L 4JO3L 3S98A 5JXEA 5FXCH 4QLRA 3WHE1 1PKOA 2HT2C 3DGGA 3GSRA 4PTUB 1A1MA 2H32A 4WO4C 3EDKA 2QHRL 4PJFB 3RL2A 1M71A 4RA3A 2GJ6B 5F9JB 2NZ9D 3SKMA 5I1DA 1O0VA 3HFMH 3EFFB 2F53A 3HRZA 3TPUA 1UXWA 1MCPH 25C8L 1FO0A 3MLVL 4LPYA 1GC1C 4ZFOA 1A7RH 5CCKL 5GGRY 4FTVE 2ARJB 5DJ8B 4RISH 5EZJB 3ROOB 1QSFB 5IHBA 5HJ3A 1I3UA 5B38A 3HG1A 1A21A 3TWCH 4EBQL 1QEWB 3LS4H 4M1DH 1JGDA 4HK0A 5D7SH 1AXSB 3HPJB 2WP3O 1G9NH 4JO1H 3B43A 1K4DA 3ARBD 4ZAKD 4HPYL 3RWCB 1OP5K 5JUEH 3GB7A 1JNJA 4IIQB 3WHXB 5M7QA 1T03H 4F57L 4G9DA 3HNVL 1J0IA 2D2OA 5KTEH 3ZE0E 2X89D 4OIIL 2Y5TA 3BGAA 3D1MC 2W1NA 3ARWA 3LD8B 1V5JA 2ATKA 4YDJB 5GS3A 4JZNB 3V5HB 4F9PC 2BVPB 1AGCB 4LIQH 5ID0B 3JTCA 3CGTA 1VEOA 1HQRB 2FIKB 4EI5D 1HHJB 4IOIA 4YDIL 4K2UL 4X4ME 5E9DB 5K93A 3V52H 4DGYL 2ZCKH 1JWSB 4Q9BA 3C9NB 1A7PL 4OZGA 5FCUL 3SCMD 3SGDH 4LSVH 2ZNXA 3R4DA 3ZKNC 1LP9E 2JJTC 2RGSA 4LLWB 2ZCKL 3TCXA 4OFVA 1I3RB 2HN7A 1S7SA 1TQCC 3L5XL 3TN0D 3MFFA 4HS3A 2FIKA 1DVFD 3IB4A 4P2RE 5FB8A 4GRWH 5IW6A 1U8PA 4YPJA 1GAFH 3UJJL 1HXMA 5E08H 4OTXH 4GRMB 1K2DB 1I8KA 1U8LA 1U95A 1GAFL 4K3HA 1CD9B 5FKAA 4RFEA 3KHOA 4LDOB 5BRZE 1FZOA 1U8IA 4P3CL 2MTPA 5FGBC 3MRGA 5JORA 5MEQB 1G0DA 4P23B 2X4PA 4QNPE 3O9WB 5E6IA 1IGML 4DFHA 3GB7B 3D39B 4IRSA 1PY4A 5EU6D 3ULVD 1CDGA 4EOWL 2RIKA 3RWCA 3T09A 2IFGA 1YC7A 1UH2A 2HJLB 2CUIA 4I3SH 3GHBL 1J8HA 2V7NA 4XCYA 3E8UL 3L7FB 4K55A 2E7CA 3V0WH 1QRNB 3GHBH 4NQCB 1G1CA 1GL4B 4YHLL 3LKRA 1RFDL 4XXCA 4G80B 1PBYA 5HJ3B 1JMXA 1Z0NA 1JFQH 4XNQB 4HC1L 1OD7A 4JJ5A 1TTFA 3ZE0F 2ORBL 2BVUA 4MQTB 5IMLA 4KKNA 4HFWB 4LCYA 4NOFA 3IDMA 1I4FB 4JZOB 1KCRL 3HAEA 3VXUE 3ULVL 5BRZD 3I02B 3M1BB 1MJ7H 5HGGS 4AQ1B 5KBNC 3L3IB 4BZ2H 5IMLB 5J13B 3F7QA 3C9NA 5FUCC 1OHQA 3UDWA 5B22A 4F9PA 1CFBA 3WE6A 2VISA 1FCGA 3QIWB 1XF2A 2D0GA 3DGGB 1XIWC 2N7AA 4YAQB 5EIVA 5KSUA 1A64A 3BKJL 2BY1A 4G5ZL 5D96C 1WFTA 4BUHA 8FABA 3P9MB 1QA9A 5I8EB 3U7WL 4XPFL 5TGBB 1NLBL 3M45A 3GSWB 3VXSB 3RIFF 1LO4H 2O5YL 1MNUL 3WHXA 1DP0A 3TJHD 4GAGH 5AZ2H 2D4DA 3KLAA 2ZSWA 4Z7NE 4X80L 2IQAA 1KACB 3MV7A 1D6VH 4RFEB 5CJXA 4PJ7F 1Q0YL 3QUYB 1OAUL 1AXSA 1CT8A 3L3GA 1R3JA 1KCVL 5E4EC 2P24A 4OF0A 3SPVB 4WUUB 5KSAA 3E3QC 1XCTB 5J6GA 4RMQA 4FABH 1IL1A 1Q8MA 2A6JA 2VO5A 3SDAB 4XP9H 5F21B 2Q8BH 1PG7H 5KJRH 3P11L 2FX7H 5DJ8A 1QSED 4QRUB 3M8OH 5D96B 2NY2D 3HUJA 4Y4FC 3I85A 3MLUH 5CBAB 1QBLL 3MRJA 1DANU 2HT2D 3MLPA 3NCJL 3BKML 3BH8A 3TPUB 3EFFA 1OTSC 5E9DE 4UUJB 3IVKB 2VWEE 5H94A 3C6LA 4PJGF 3MRFB 2BNRA 4U6XA 3PIQA 2C4XA 4JFHE 2IEPA 1HWGB 3CVIL 4KK6C 4G6ML 1JPTL 2AXGB 1INDH 3C2AL 1IGIL 1JYVA 5ELIA 3J8F7 4HLZH 3GEWB 4FNLH 4WGVB 4P5TA 2W0FA 4XVUD 5J1AA 2GTWB 4LLAA 4GRLD 3T0EE 4IRZL 1YYLH 2Y5EA 4H88H 3T8XA 1SBBA 4KVCL 4D9LL 1JGVH 1RJYB 1ZANL 5DD6A 4DK6A 4X6CA 2ZPKH 5HD8C 1JNHB 1GZPA 2YRPA 2YK1H 2OL3L 1X4XA 2J8UB 5BMFL 4M7JH 4OKVA 5ESVA 3V4PH 3V5DB 4Y4HB 4QTIH 2BOCA 4HUUB 3U9PH 5DURB 2BCKB 1ZHLA 1CFSA 1P7HL 1II4E 4QY8A 4LMQI 1IBGL 1N7MH 5EOCH 4JG0L 3V4UH 3QDJD 2Q7YA 1U8JA 2C3HA 5D93C 5D7LB 2CLRA 4P23D 4DTGH 4PJ8A 5DT1H 2VH5L 4ZQKA 2BOBB 4CGTA 1X4YA 3O2WL 4ELKB 3QDMA 3O4OB 3QQNA 1QHOA 3BRDA 2A74A 1UWEL 1XGTA 4JANA 5C0CB 3U0WH 1AKJD 1F4XH 4KKLC 2A6JB 4R0LB 4ZYKA 4XMPL 5DJ2B 2B0SH 4Q6IB 5EA0L 5ESQA 3BUYB 2Y72A 4PJFE 4BKLB 2X4TA 5C0DB 4G6JH 5IB1A 3ERYA 4G9FA 4PDCE 2XTLA 2V2TB 2VLRB 5BO1H 3GMPB 3PL6C 3O6FA 3FFCE 2XKUA 4Q2ZA 5FOBB 1I9IL 4V3EB 1NKRA 3U7AA 1TVDA 4EDWH 5SWZE 4YAQA 4PP2A 1FNSH 1AD9B 2PYED 3L95A 5B8CC 2VISB 3QIWA 3KS0H 1Q9KA 4UOJA 3LKPB 2B5IB 4YHPB 4P5TD 1WT5A 3K7UA 5JDJA 3KPLB 4CMHB 4L8SB 3GMLA 4PJ8D 1CXIA 1K6QH 2HRPH 4JG1L 2EKSA 2O61A 1AQKL 4DKFH 3QT2A 5DGQA 1QFWM 1YMHB 2QLVB 4JN1H 3QBTB 1UM4L 5TH2A 3JBG7 3KPOB 2GT9B 4NN5B 3BYYA 1FL5B 1CL7H 5DHYA 1XF4B 1Q0XL 4R7DA 4QXTA 1U8QA 4WI7A 3MJGX 3F12B 4Y5YA 2QHRH 1XF3B 1Q0XH 3RX8A 4YXKL 2EDNA 1JHLH 2D31A 2V7NB 3PDDA 1A8JH 2VLKA 4HZLA 4M03A 5HHQA 3VXPB 4NQCD 4YXKH 4P4KC 2D7MA 3T65B 4GXVL 2NY4C 5T3ZL 4X4MA 1IFHH 4LVHC 3VI3E 4XVJL 3T0WA 3DVNA 2Y4SA 2FD6H 2ZKHL 3MLVH 3H9YA 4OSUL 2NY0D 2HJKA 2XTJB 5JIIA 3VFVA 4NQTA 2APVA 4HBCH 1IL1B 1GYAA 3P9WB 2I27N 4HPOL 2FD6L 2XZCH 2ZKHH 3X13A 2W9DL 3DYMA 3CH1A 5KG9A 2DL2A 5DUBB 3WNOA 4HPOH 1DR9A 2Z8SA 3QIWD 3LRSB 3LS4L 2IPUK 4M1DL 1INEL 4XPTL 4I18B 3U36B 3VXUD 3WNKA 3P77B 3V7AE 4BFBD 1M4KA 4XCCL 4D0CB 5J11C 4XWGL 4EI5A 4K9EH 4X8JA 1QA9B 4FFYH 3CX2A 3HG1E 3JWNC 4HH9A 4MQXD 4HUWB 2C3VB 1NLDL 5CIPA 5LWYH 1RJLB 2WK2A 5F3BB 4TSCL 4LHUG 3DTXB 2FR4B 5I1IL 5GISL 4W6WB 1N4XH 4TOYL 1XCQA 4TSCH 2E7MA 4QXTB 5KSAD 4ODXA 4OZFA 4WJ5B 5F9OH 1N5AA 3TO4A 1JYXA 5I73B 3CZJA 3F7VB 4MS8D 5IB5A 1T83A 4LLDB 2DQDL 1X5XA 4IMKA 3HR5A 2QR0A 4UIKH 5F9OL 5JZ7D 1G7PB 5TDNB 1N5YL 5GGTL 3HI1A 4ELKA 1B0GB 3HHRB 3P77A 2Y6SC 3RIAK 2XICA 2DQDH 2GYSA 3ARGA 4N0UE 4GW5A 2P49B 1RUQL 4PYGA 4OZGF 4NJAH 1UXSA 3INUH 2GFBB 1HCVA 2R1YB 5IQ9B 2ICWJ 3LKPA 4UT9H 1IARB 5CEZE 3RGVB 2E7LA 3WL9A 1JVKA 1JV5B 4BK5A 1BZ7A 1I8MB 2AXHA 1GGTA 4OLXL 3T4YA 4XP1L 1C7SA 1LO5A 1LO0L 4QF1B 3IJSA 2ADIA 3WFDL 2VLRA 4XPBH 5B3JE 4HV8A 3O9WA 5E6IB 1OB1B 5F9JA 1G7IA 1RIUL 4G9FB 1JTTA 1Z3GH 4KRLB 2HVKB 4O02L 4MAYC 2A6DA 5C7XL 5FYKE 4BKLA 4TVSa 3HNVH 5BVPL 4U1KB 5FO9B 2QL1A 4WDIB 1Z9OA 3L7EB 4XNYH 3LN4B 3PWNA 4Z0BL 3BT2L 1GGUA 3DUUA 4BUGA 3MRLB 4PRDB 4WUKL 3LOWA 4FG6D 1ZEAL 4L8BB 1YN6A 4JAMB 2Y7QA 4FQHB 5ANMB 5BQ7A 4NRXA 1A9BA 5D7LA 5DD5L 3QH3B 1RUMH 1JNLL 1MCBA 5C0AB 4PY8I 2AJUL 5T3XD 1ZHLB 3V0AC 1RIHL 5JXED 3BXNB 4FQ1L 5ESVB 3VXME 2K7PA 3PWLA 5F3HB 2ZUQB 3GMPA 5JPNA 5IHZB 3O8XB 1JNHA 5A2IH 4IMLB 3O6FC 4MJ5B 2NTFB 4Y1AE 1NJ9B 4Q0XH 1FYTA 1IKFL 2Z31A 4J8RA 4N0CA 2HVKA 4GAGL 2W9LA 1A6TA 1MREH 4OCNC 3RTQD 1C8PA 5E4IA 3FONA 5EBGA 3CVHA 1OB1A 4MNHB 4I18C 3RNKA 5B8CA 4ZYKB 4F33B 3LIZL 4Y2DC 4KFZC 1MHCB 1MWAL 1M7DA 3QJHA 3RNQA 1J86A 1GGBH 1FSKC 2QSCH 3NGBC 4Z7NF 3MCG1 2P44B 1W0VB 1OSPH 3K1KC 1YEFH 4Y1AD 5DD3H 2HMIC 2C4FT 3HC3H 1UZ6E 4G8GA 1G7MA 5C0JB 1JZ4A 3C8HA 4JFEA 4PJAA 1I7RB 4KUCF 5C9JB 5B38G 5IHLB 2VL5A 3S4SB 1UEYA 4ODHH 3TH2T 3C08L 1EH9A 2ED8A 1YNTB 2IPUG 1MY7A 3D3VA 4MD4A 2GUOA 2P48B 3W11C 3EOTH 3PHQB 3VXRB 5I75B 5TE6L 3BKCL 3DI3B 4PJ5E 4MNHA 4OD2B 5SX4H 2F54D 5EU3A 3KPSB 4MVBC 4ETQA 1A7NH 1QZ1A 4L29B 1G9NC 3QEQD 4EUPH 2HWZL 1FYTB 2WNGA 2AXGA 1CK0H 4KVCH 3CJJA 3WBDA 4QHUA 1JGVL 2HWZH 3PDOA 4JPKL 1JRHH 1OAKH 4Y5XC 3GM0A 4NKOA 1DBML 2AJYL 4RMWA 1OM3L 3BGMA 3PIQB 5F9AC 3A67H 1T89C 3UAJD 3WFBH 3QIBA 1UXSB 5KSUB 1I8KB 1U8LB 4KGJA 4GRMA 3C5SA 4MB3A 4KMQA 1B9ZA 1KPRB 1HEZA 3NABL 1EUUA 2Y7QB 1S8DB 2VLLB 3BPCB 5GRJL 2R2BB 2R2HA 3OAYH 1HHGA 2XNAB 3H9HA 3TO2B 3QUXB 1T7XA 5DSCB 2DOCA 4OZGB 3TO4B 1HIMH 1FDLL 3FQWA 1A6ZB 2W0PA 2DD8H 4YR6B 3HC0A 4L3ED 3DX8B 1WZLA 4HUVA 1F11A 1OVZA 3MNZB 4PG2C 3U4BL 4POZD 3HZYB 2XN9E 1FIEA 4KI5C 2EDYA 1NUDA 3SO5A 4KPHL 3BGMB 5F7KC 5GJSH 4XNQA 5CIPB 2EKJA 1CU4H 1R5VA 3AS2A 1SEBB 1UH3A 3N85L 1I3VA 3DVGB 3VWKB 3C2AH 4I0PC 1IAII 3VXSA 4M62H 4XCYB 3N85H 3EJZD 4NKDB 2P5EA 3P0YH 4XPHH 1AI1L 3D69B 3C6LC 4ETQB 2VXVL 3X3GL 5ILTH 1MCNA 2MQCA 2Q8AL 2LU3A 4P2YA 5ID1B 5I1LA 3BN9D 1MJJA 3RY6A 1YN7B 4WNQA 4QRQB 5CJBA 2A77L 2DMKA 3QXAB 1T66C 5B4MC 3QCTL 1HXMB 3IFLL 4XAKE 2PO6A 1U3YA 1GSMA 3GSNB 5C9JA 4MNQE 3FQWB 5SX4I 4QGTA 5T1DL 3GJFA 1YEEH 1JPGB 2NZ9C 1K4CA 3GSXA 4CN1A 2WBKA 1NKOA 1HHKB 2VLJA 1RHHB 4FXKA 4UB0L 4OIBA 3MGOB 4M7ZC 5ID0A 1UKTA 4PR5A 3QXVA 3TN0B 5C09B 4YC2B 4BH8B 3QUML 4OZIE 5L6YL 4OZHA 5A2KH 5FYJL 5L9DH 5IOPB 2BFVH 4Z78A 1T20B 2XA8L 3REWB 2WBJD 2R4SH 2NQCA 1ZLSH 4RX4A 4NYLA 3FO9A 2CKBH 4IIQA 1KTLB 1CIDA 1TCMA 3GKWL 3GFUA 3X3FL 1OAUH 4C4KO 2MNUA 4WW2B 5FM5M 3LRSA 4TVPD 4UINL 3T1FB 2B20A 3QFJB 1ITCA 3GDBA 1JGDB 4RGND 3H9SA 4H25B 5IJKC 4PRBB 4I0PA 2IPKB 3SDXF 2ATPB 3HE6D 1I3RA 3IF1B 1KJVA 3D2UA 5EZJA 3ROOA 3WXVH 4X6BB 1IC4L 2NLJB 3OR6B 4WWID 3RI5K 3UPCA 1IC5L 3QIUD 3BPCA 4Z76B 2A9ML 4PJAB 5C0JA 4HG4K 1VFBA 2HRPL 3P4MA 1CD8A 4JG1H 3PL6B 4WWKA 2A9MH 3MRCB 1R3LA 4DKDC 4KUZL 5KSBF 3D25B 4JPWH 3J7HA 1UKSA 1LD9B 2AJSH 2H8PB 4JN1L 5DZOA 3VXTA 3AFLA 2AEQH 4MQSB 3BW9A 4JRYE 3Q48A 5HI5D 1IILE 2E27L 4GG6F 1QLFA 1XGTB 1ED3B 1PD6A 2R23A 5I1AA 3WO4B 1VPOL 5FAAA 5DUMH 1JPSL 5H8DA 4GRLB 4M5YL 5SV3A 3F6IA 2H8PA 4L29A 1RURL 3WIFA 5T5NG 3MXVH 4KXZI 4RX4D 5DUML 1RIVH 1SY6L 3V6FB 3GMLB 2FO4B 2NTSP 3GKZA 3VXQB 4JM2D 1CDIA 4X9BA 3FONB 1R3KB 1KIRB 1SY6H 4M3JA 1ZSDA 3LSOB 4JKWA 3BH8B 5FYLD 1EZVY 2CD0A 3H7BA 4JN2B 3MLXL 4Q7DA 2NLJA 1AFVL 2I26N 3IRPX 5A16A 1YC8A 2ZOKA 2V9RA 5IGXH 1KJVB 5TF1H 2LFGA 2DQJH 1RJYA 4ENEC 4M6OH 4PRBA 4G8GB 4LKCB 4PJGB 4KU1A 3U0TA 2IH3A 2P24B 3HN3A 2HG5A 4R96A 3JTSA 2E6QA 3MRBB 5HYJD 4M1GH 5EUOE 2NY2B 5HDLA 4YBLC 4MDIA 1B0GA 3NCEB 3ARBA 2YD5A 4P5KB 3DSFH 1F2XK 5DVOA 5IB5B 5I8KH 4ZODA 1JF6A 5BVPH 3F62A 3B2VL 4GRWE 5F1IA 3NVQA 4OGYL 4WI8A 3JWOL 4FQQB 1C08B 4XBPB 4YUEL 2GW5A 2V5YA 4N5ED 4J3WA 4UT7H 2CMRL 4I3RH 1NFDA 2MJWA 3CX5K 4X6DF 3IDIA 5F3BA 2B1AL 4U1MA 4ISVB 4HKJB 3VXSD 4POUB 2FHBA 4MJ5A 4PRPA 1LGVA 2NY7L 4HV8B 1J1PL 2C1OB 1JNNH 3TJHC 1HHKA 5IHZA 1EO7A 2B2XL 3V52L 2VQ1A 1GPOL 2N56A 1G7HB 3U9UA 3C6LD 3V2AR 3IDGA 4NN5C 1FO0H 3CDYA 1J0KA 2HYMA 2J8UA 1YQVL 2XWTA 2IMMA 2E9IA 5CLWA 1BZ7B 1I8MA 5I1HH 4UOW0 5KG9B 1ITBB 1H0DA 5EIIB 4JJ5B 4WEBH 4TUJA 5FA4A 1S7VB 1IQDA 1QSVA 2EE9A 2IFFH 1K6QL 4J4PC 4PBWD 2VC2L 3ARUA 4ELME 3ARXA 3CD4A 3VXQA 1KTLA 1E6JL 1A3RH 3HA0A 1LP9B 5J1AB 5F7HA 2ICWA 4FZ8H 3ARGB 3OMZA 4G8IB 1IZJA 1G7JB 1J8HD 1I1AB 1ZTXH 3MV7D 4PGBA 3VXNB 3GM8A 2BC4A 1I85A 1A3LH 4HUKB 5IVXE 3TN0A 1K3ZA 3F12A 4CKVX 5IFHH 5JR1L 4OZFB 3O45B 2ILLA 1N59A 2QQNL 4RMRA 4PRHD 3BRFA 1WCQA 3A6BL 5EORL 1K2DA 2BC4B 3BKYH 1ZHBB 3HZYA 1SJEB 3M1BA 3T2PA 5CZXC 5E56A 5HGDB 1F4WL 5IW6B 4F8QA 1DLFH 1LO5B 2PW1A 3OAZH 4Z76A 3DX9B 3WFCH 2WBJC 3QDJA 3CZFA 5MP6H 4HJJH 3MRJB 1UH4A 1NGPH 4D0CA 1NANH 1U36A 5GGQH 3S5LG 4X6BA 3LB6C 4NO3A 3O41A 1JWSA 2DJSA 2NXYD 1LVEA 2IGFL 2R1YA 4I0PB 5FIEA 5GGVH 5IQ9A 3BD4A 3VFTB 1OL0A 4LLQA 1U93A 5DHVB 1MCQA 5DMKB 3SPVA 3SGJC 5IG7B 3C8KB 3CU7A 2P4AB 4XI5C 3RTQB 5TE6H 2ID5A 2Y9RT 3NIGE 4NKOB 2IBGA 5TE4H 4PJ9C 3PV6A 1QG3A 2UY6A 3HR5B 4HAGA 3PDOB 1UVQA 4LLDA 4Y4HC 4PGJA 3VWKA 1Y18A 4HPYH 2H9GA 4DN4H 3O6FD 1ONQB 2G60H 2H2PD 1H3GA 2EE2A 3REWA 3IRZA 4LSRH 4YHZL 3VXPA 5GGUB 1WEJL 4LAQH 1UB6A 1XCQB 2D3VA 5IROC 1B4JH 5DJCA 5ACMA 1H15B 4TNWF 4P59H 4WW1B 3DX8A 3VG0H 2AABH 3UO1H 1FZKA 4OD1H 1P4IL 5SWZD 4O58L 3SCMC 2VAAB 1E28B 2A74B 3AREB 1IAIL 1ZK9A 3C8DA 1XR8A 1DE4B 4RAUB 4R2GD 3TN0C 4IOIB 3GSNA 5TDOB 3MLUL 1MCRA 3LRHA 3HC3L 3QJFB 1ORQA 4N0CC 3SKOB 4JRWA 4UAOC 4JFZL 1VENA 4GO6B 1T7YA 4OB5H 1ZGLB 4YZFF 3B9KD 4LNRA 1AD9A 5ID1A 5CD5C 1A3QA 4HMDA 1CL7I 3DETC 2FNBA 4Y2DA 3SKNA 3MLZL 1UM5L 3H3PH 1Q94A 4FTVB 4OI8A 2HFTA 3T65A 3HI5L 5F88A 3UJIH 4XCEB 5DMGD 4CRPA 4F7EB 2IALB 5HHQB 1TPXC 4YDKH 1IAKA 3TYFA 4U1SA 2ZP0T 2OZ4H 4JJHA 4OQ1A 1G84A 4P2OB 3TZVB 3IS1X 1XEDA 4FP8H 4QRSA 3MRGB 1A6TB 2W38A 2OZ4L 3NPSB 3WYRA 2HTKD 3IDXH 4MD4B 3BN3B 3PWVA 1CR9H 3KJ6H 5JHLL 1P7QD 2IMNA 1BF8A 5HI3D 1A6ZA 4KDVA 4MS8A 3U1SL 3QUXA 3NABH 3T2NL 1TVHB 2DWEA 3G6JF 4KMTH 5EIQA 1WF5A 3MOBH 5D6CA 5FCUH 1UWXH 2M26A 4OF5A 1HQRA 5I74C 4PGDA 1FLRL 2AQ3A 1A1MB 2H32B 2CLRB 1JRHI 4OF3A 3KLHD 4FMFA 2X05A 4FQXD 2VB5A 3V5HA 1ZAGA 3C87A 4JLRA 4IEFB 4QXUL 1Z9SA 3TA3D 1VGEH 2BJML 3KGRA 4OI7A 1MHCA 2VWEC 2NY6C 5CSZB 4HF5L 2V5SA 1S9WA 3OJMB 1VADB 4TNVF 3SQBA 3WFZA 5J56B 3QUMH 1SQ2N 4PJFF 4WO4B 4MS8C 5D2LA 1NEUA 1E27B 5IB2B 4POZC 1URLA 1WQVT 2DIAA 4CVZA 3QFJD 1K4DB 4XMPH 2A6DB 4YX2L 4OD2A 1I1FA 2EDOA 5IB2A 2HG5B 1N8ZA 1MWAH 2HKHL 1T0MA 1FIGH 4ODWA 5I8EA 2W0KA 3P9MA 4G6FD 4HWUA 4OFKA 3SDXE 1LEGB 5F88B 2HKHH 4XNZB 3C5ZC 5GS0L 3QWQB 4JLRB 3T4YB 4NZTL 5TE7L 4Y2DB 2YBRB 3CMOL 5GGSA 1L0YA 2VNCA 4ZFOB 1S5HB 1WFOA 4PJ7E 3DRTB 3WXVL 1LEKB 1BLNB 1YEFL 2CXGA 3O9WC 5IWLA 1PLGL 4TUKL 1KB5L 4PJ8B 3MRPA 5FM5O 5CS7A 1PY9A 3MRFA 1IQWL 4NKIH 1PJ9A 3MX0A 3UPRA 4NO0A 3UTPE 3N1FC 1I1AD 3OKKA 5E6IC 1GCFA 4WTZG 1EEZB 4OKVB 1JCKA 5J13C 4UTAL 4GMSH 3RUGE 4ZNEA 3ARZA 3FB7B 5CBEB 1NBQA 1H3PL 5ESAA 3QULB 4CJ1A 1EEYA 5D7IE 3CDFA 5DEGA 1FRGH 2XWJA 2FH6A 3GI9H 2OL3B 1I1FB 3RGVC 4LRNH 5C70A 4P5TB 4NCC2 2R4SL 2X4NB 4YXLH 1T7WA 4D0BA 1J8HB 4LPCA 4UQ2A 2VDML 5GGUA 4Y5VB 5KANI 1OGAA 2XRAH 3DRQB 2ESVE 5I8CB 2YOCA 5LVEA 3S97C 4BZYA 3VD5A 1X6NA 4NQED 4HUNB 4XVJH 2OL3H 3LV3A 1ETZB 1FV1B 5DJ0B 1PVHA 1F45A 2X2YA 4XH2A 1AP2B 1INQB 2F5BH 4QHLA 4YQXH 4YWGH 5HDQH 2VAJA 1A9BB 4P23C 5CEYA 1RSFA 3QDGE 4GMTH 5HHOB 5EOCL 2Y6SD 1NC2B 3HE6C 2AW2A 2R39A 5D5ME 3O41B 5BV7H 2MQ0A 4KV5F 1R0AH 3DVNB 3KPNA 1FZKB 4LLYB 5K9KA 2BNQB 2CRIA 4X7TA 4LCYB 5EZIL 4ODXB 2YSSA 3LCYA 3EYUL 2VN4A 5BOPA 1B0WA 3BOVA 1BPVA 5C09A 1KCUH 5L7XL 1RUPL 3BZEA 2CMRH 4I3RL 4Y4FA 4M62L 4JKLA 5EA0H 1ONQA 1RUPH 1A7OL 1OWWA 1JPSH 2GT9A 2WY3A 3QDGB 1SMOA 1AD0B 1MIML 2VZ1A 4I9WE 5DR5L 5JNYB 4M7LT 4LP5A 4S1SL 3ILQC 2O93L 2AI0L 2C7UA 2EE6A 3QZWA 2FJGB 3U36A 4MZ2A 2EKSB 2YWZA 1MCDA 4HW6A 3EDFA 3SKNB 3C8KA 5C3TA 2YD2A 4LQ1A 4CVUA 1ZANH 5B38B 2XACC 1GIGH 4GFTB 1S7VA 1FVEA 1YEJL 3O2VH 4NGHL 4HFUH 2WWKO 1J5OL 1MJJB 3S35X 5CP3A 1KF9B 3LKSA 3EZ8A 2BRQA 4ONFL 4XB8A 3U9PL 3DARA 5T5NF 2A2QT 2HJFB 4LASH 4BFIA 1I7RA 3EJYD 4KTEL 1XF5B 4XWOC 1DE4A 3ZTNH 3QISA 1W8NA 3BWUC 5EU4A 1XF3A 1V7ML 2YRZA 2FEDC 4Y5VC 3T0XA 4GSDL 4ZG1A 1U8QB 5C2BL 4G80A 3JUYA 3TIEA 4ERSH 4ZPVA 1FL5A 1H3TA 3N1GC 1D5IL 4ERSL 4P9HL 5ECJE 1CDBA 4DCQA 1RJLA 2C3VA 3E2HB 4NN7C 2B0SL 2C3WA 3UCRA 4P4KD 1KXQE 5IBLC 1JHLL 5FV2A 2H1PL 4LKXB 1GGCL 4ZFGL 4GG6B 1A14H 4KJWC 4R90H 5MHSD 4I77L 1YA5A 5EUOB 2XKSA 4NRYA 4RRPG 4MAUL 4TUJB 1EAPA 4KI1A 1CXLA 1HEZB 3JTSB 2JB6A 3I9GH 4HBCL 3U0TB 5JPNB 4QXWA 5D2LE 4YXHL 4G7YH 4HUUA 4MA1C 1P5VA 4HULB 3WO4C 1MLBA 3ALPA 3VMOA 4J4PD 1EAJA 1H3WM 3TESA 3EYSL 4RGMB 4C83A 3VJ6B 2CH8A 1FNEB 5BCAA 4OGAC 1KFAL 5HGDA 1QFUH 4HZLB 5I1DB 4Q0XL 1FBIH 1MCJA 1TJHL 4P49A 4J2XA 3N9GL 4Z7OF 1MFBL 3KXFE 3BEVA 3HE7C 3VFUA 4Q9RL 2PN5A 5D4QA 4JREC 4YGVA 1CL7L 3QAZC 1SM3L 4Q9RH 4PRID 3MRMA 3FQNA 3NFNA 4UNVA 4NPYB 3ZL4L 1FCCA 5ALCL 5FECB 2OZ4A 1LE9A 2WP3T 3O2DH 5TQ2L 1YEDA 1G7MB 1WBXB 5KVGL 2DM7A 4R96B 3OX8A 2ADIB 3WFCL 1FFOB 4MMZC 3P73B 2J3SA 2EO1A 4F7PB 1TJIH 3MUY1 1KENL 5HVGB 2DF3A 2BVQA 1WIOA 2XWTB 3D2UB 3IF1A 4Z7QF 1PGRB 4CMMA 5C6TH 4Y5YC 3V6OA 5EU6B 2F54B 1R3KA 5MENA 3F5WA 4LFHG 3MRQB 4F9LC 1DN0A 4FFWD 3LEYL 3V6FA 3GSNH 4JFEE 3QUYA 3CVHB 4HXBH 1F3DH 4F37K 3KXFD 4U05A 2UUDH 5I1KH 1T6WA 5D7SL 4GRLA 5J11B 3GSRB 4PTUA 2JJWA 3LMJL 2R0LL 3O11B 1R24B 5DYOB 4NYLB 4GLRI 3BW9B 1NC4B 1OAZL 1MAML 3V6BR 4ONOA 5KOVC 5EB9A 5HYQB 2BDNL 1DLHA 5EC1A 2AK4D 4BH8A 1D5BB 1OAZH 2P8LA 4WTZA 3UPAA 3UO1L 5A2FA 4LBEB 1KLUA 3D5OF 1P4BH 2EH7H 3OTTA 4UUJA 3IVKA 4ZPVB 3D3VD 4L8SC 1J0JA 3CFKB 3ALXA 1P4BL 2EH7L 3QUZC 5E70A 4U1IB 5DJAB 4NQDE 1YECL 3T3PE 3FKUS 4Z7WE 2APXA 4K94L 2EDKA 3U79A 4W81A 3BQUC 3MRLA 4Y1AA 2X1WL 2ATPA 3SHSA 5E08L 4FQXA 1I4FA 1M05A 3KG5A 4NJAL 5IMKB 5ISZA 2ZOKB 4IHOA 4WEBL 3QEQA 4WI6A 2FGZA 5CWSB 5C07A 2XG5A 4PJDE 3LVEA 3QQ3B 3U4BH 4OF7A 5IROA 3B9KC 1ZGLM 2ZSWB 5D7LE 4QXGH 1KJ2L 1RUKH 4OCWH 1J0ZA 4GG6A 2GTWA 4I3SL 3I50L 1X7QA 2A1WH 4NNXA 1EK3A 3ULUH 2BSED 1B3JA 1MQ8A 3FMGL 1S9VA 3IFNL 4U6YA 4ODUB 4BM7A 4CDHA 5GGRB 2VLKB 4YHLH 1Q94B 2EXWC 1HILB 2HFEA 3DVGA 5HI4D 3BP4B 4MNQD 5JA8B 2HLFC 3BKYL 4MNGE 2DKUA 1RZGB 5E8OB 3S3SA 5FKAB 3K4DA 2EXYC 4R4BB 1RFDH 1U8KB 2XTJD 4P2QB 4QHMA 3ZDXF 3P2TA 1R3LB 5CLTA 4XX1G 2W65A 2GJ6D 3KR3H 3OWEA 5D7JD 1N3NA 4YNYB 5E2TL 4HS3B 1YPZE 4C56B 4OD3H 5AG8A 1CXKA 2NY6B 3HUJB 5HHXH 5IBTL 3ORJA 1ZA3B 3EYQC 4O2CA 4J23A 4Z7WF 1NCBH 2OCFD 5BJTA 4G5ZH 1DVFA 3VD4A 5HGAB 2DM2A 4I4WA 3FFCB 1C12A 5KSBA 2O5YH 5IIEA 5A43C 2MKLC 3G6AA 1JZ2A 4OV5A 4TULH 1P2CA 1AD0A 3HMWH 2F15A 1MREL 3LEXB 4NN6C 4P23A 3HNSH 3HLAB 3QFDB 3WS6C 1LO4L 4CUCA 4IRSD 4QCIA 3I3DA 5IHUL 2E5EA 1MI5E 4RAVB 2WQ8A 4IDJH 4N90E 4NQVA 5EWIL 4ZTOH 3WSQL 4L4VA 1S9YB 4UDTA 2G9HA 4S1RH 1RY7B 4HX1A 2V7HB 1WLHA 4OCSL 1H3VA 4J3UA 5DRZB 2JTDA 3OHXB 1T1ZB 1XH3A 3KPNB 3QEGH 3FB7A 2Z31C 1HHGB 2XXMB 3UDWC 2IADA 1R0AL 2CRMA 1NMAL 4LLVA 1S8DA 2VLLA 4HCRH 3BFOA 2ESVD 1A0QL 4EVNA 2VITA 1WJ3A 1VCAA 5EZIH 4YDJA 4FQIH 4XP4H 3MRPB 3OGCB 2FGWH 2J12B 4TQEH 3LV3B 5DJ0A 4YHYC 5DHYB 1KN2L 1BAFH 4KUZH 4KPHH 2EICA 1PDKA 1R5IB 4WFFD 2MCG1 3DMMC 5E8DH 3S8WA 2V17L 5TH2B 4I0PD 3DRQA 1MFCL 2F58L 3PABB 3PWPE 1P1ZB 2FL5A 4UU9A 3ULUD 4U3HA 1BX2A 1MRDL 4JFOB 4AL8L 3UBXB 1MFCH 4NKDA 2OR9L 3TM6A 3G08A 4G9FD 3T1WA 2YPLB 43CAB 3T8XB 2AI0H 3MBEB 5DI8B 1AI1H 1PQZA 4L1DA 1EXUB 3EUUA 4JB9L 4UILL 4NO5B 4PJIA 3X17A 5DZNA 5FA4B 1FG2B 1HN1A 1YYLL 4HEPG 4UV7L 3RAJH 4Q6IC 2YUXA 1QSFA 2VDRH 5CKAA 5A40E 3DYPA 2W07A 4HUVB 4M7LL 4U49A 2ZPKL 5IMKA 1HYSD 3MFFB 5K9QI 4FN0A 5DXWA 1J1OH 1MCWM 4PGCA 5EUOF 4DKAA 4MQ7A 5T1DH 3K0WA 4OLYL 1VA9A 1MWAA 4XRCA 2HTLC 2K1MA 2DQHH 1HHJA 3CLEL 4JAMA 4KQ3H 5DJYB 1UM6L 5C0DA 2X4RB 2XY1A 5I9QC 1KLUB 1ZT7B 5IW1B 2HFGL 4NWUL 1TQCB 1UM6H 3KJ4C 4LDLB 4QRUA 3VMPA 5MI0C 2VLKD 4ZO8A 4G42A 4D0DB 1F90L 4PP1C 2YA2A 3V95A 2DDQL 3DUSB 5KANG 1UA6L 2DJUA 4RQQA 4G59A 4OLUL 5JIKA 1U42A 5KSAB 2R69H 3HC4H 1KGCD 3L7EA 3QWRA 4JVUA 3QQ9C 5L2JB 5KS9E 2H3NB 3BQUA 1N0XL 5E00B 1X3DA 4OQTH 4K71B 1I9EA 4M1CD 1QACA 5DC0A 3UX9B 3JV4B 2Z31B 4J8RB 3VDCA 3AAZB 3T0BA 5T3XE 3GSQA 4XXDA 1A1NA 4F2MA 4PJCE 2NY3C 5CZVH 4ZXBD 5AZEL 3FT2A 4N0CD 1QLEH 3PWLB 1I9IH 5F3HA 1NFDF 5JW4N 3L1OL 3SDCC 4EDWL 1RZKL 3MOAL 2P1YA 3VA2C 1T4KA 4M93C 4G7YL 1H8OA 2P8MA 1D6EB 3WIHH 5HI4C 3EGSA 1Q9WB 3EO0B 1AJ7H 4WY7H 1LEIB 1EO8H 1QQDB 3B5HA 4XTRD 3P9LB 3QP3A 2VLJE 4FXGA 4YHOH 1KFAH 1NUNB 3VRLE 2UY7A 1WBXA 1OW0A 4B7LA 1DUYB 2EIBA 2R2EB 4GUPB 3EJYC 4LCWE 1UM4H 3N0PB 5C0CD 1MEXL 2PXYB 4QKXB 3FQNB 2WINA 2IPTL 2CRZA 1E4KA 3QB7C 1KEMH 4ONGH 3FAWA 2L4OA 1IMHC 1MCKA 2C4FU 4CNIB 4LSUL 2WAHA 4NP4H 4PJDB 3OKMB 1YEKH 4OFIA 3BEVB 4QRSB 1O7VA 2I60L 4S1QH 3R06B 3ZL4H 4PJ5B 5JMRA 2I07A 1RIVL 3BZ4B 2FBJH 2XRAL 4HK3N 1U2HA 5FCSH 2Q3AA 1KXTB 4M8QB 4YEFA 1EHAA 1VFUA 3B9AA 3MLSH 4HJJL 3EDDA 1FFPB 1BREA 3CSYA 4B0MM 3VH8G 1C5CH 4HGWA 2A0LD 1U95B 1V3LA 3ME0A 3JWOC 4IRJD 1JL8A 5DUBA 5C0AA 1N2RA 1H3UA 5DGRA 2V5RA 3FO1A 3OKYA 2DQCH 4AH2B 3MLWH