4HUVA

Crystal structure of h2db-npm6w
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 67
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huvA01
2A83A 4NO3A 1UA6L 3SHSA 5JOFB 2DI8A 3H7BB 3VE0A 1A6VH 3ME0A 4ETYA 5IG7A 3C6LB 5ITBH 2O5XL 5TF1L 4RFEB 4JFZH 2JJTA 4S1DD 4ZUUA 4NQUA 1G7JB 1JPST 4X6DE 1A64A 2BNRE 1JTPA 2GIYA 2R0LL 2JK5B 5BCAA 2FR4B 2AJ3A 1OT1A 4F2MA 3QPQC 4PJHB 1F4HA 5GRVK 4LPTA 4YDKL 3W0WD 3TYGL 1NFDB 5GIRA 1OAZL 1MJ8H 3RVTC 1LEIA 4LHUA 4LLQB 1CD9B 4XC3H 4IS6B 4K94L 5FGBA 1OSPH 5TDPA 2CIKB 2BJMH 1G0DA 1NGPL 1P7QA 4DGVL 4QRRA 2JJSC 2X09A 3KXFB 4LKXA 4YPGA 5HGBA 1IKNC 4KVCL 1FE8H 4QF1B 2NLJA 1CFNA 5IIEB 5HGAA 3K8LA 2IGFH 4OZFH 3MUY1 4PV9A 4YE4L 1BZ9B 1FJ1A 3QUMH 5K9QG 5LCVH 1J1PH 3ZTJH 4FFWD 1Q1JH 2VDML 5C92A 1P2CA 4CU6A 3PJSB 3KYOB 4WFGE 5CEYB 1DVFB 3KPPA 3VXNB 4RCAA 4OFPA 2YBRB 4ORGA 1T21A 1T1XA 5C0DB 4KI5E 5DXWA 4KKLD 2C1OB 4G8GA 4WIQA 3WFCL 1WT5A 4V2CB 1A9BA 2QHLA 1NMCC 5IROC 3ULVL 1D5IL 5DYOA 1B0GB 1EFXA 2IALA 1IQDA 2BHZA 2YSSB 2YKLH 1V05A 1WEJH 1XH3B 2X4PA 1MSPA 1Q0YL 1V8HA 3SDXA 1J8KA 2NY6C 2D9QB 1AFVL 1G7QB 1EUUA 4JN1H 3W9EA 4WV1C 3PUCA 2ADJB 4JDZB 4WCYH 2YD9A 5TFSL 3SE9H 2B2XH 3IDMA 4JM2C 4NNPL 1J1XL 4PREB 4XPAH 6FABL 1HWHB 3ZTJG 3MNVB 4LMQI 3O3BB 4PP8C 1FGNL 3TFKD 4G7YL 3IVKB 1KT2A 1GIGL 1SEBA 4IRSB 4X4ZA 4ENED 3U1SL 1V3JA 2P8MB 4JDTL 3GNMH 1IE5A 3CFDA 5J12C 2BZDA 3LQMA 3LQAL 3HE6B 2HWZL 4HJ0D 3MFFB 2B1AL 4CGTA 4FQXD 1U91A 4AIZB 5D7JA 5DR5L 1QRNE 3O9WC 4XPHL 4IIQC 3ROLA 1F58H 4L1DA 5IT2L 5I8CA 1T7XA 1M6OA 3TJEH 4QHUA 5LVEA 3E2HB 1OD9A 1Z5LB 4AEIH 4MB5A 1A7QL 1KJVB 1OAZH 1CLZH 2DIJA 4TSBH 3O3AA 4UDTB 5J1SC 3B4NA 1NGPH 4DGVH 2UY6A 3FN0L 3AB0C 4KMLB 2MHAA 4KKNA 4R4NC 1JV5A 1Y18A 3O45B 4WW1A 4XH2A 5I0DA 2QADC 4Z18A 4ALAL 3ULSB 3QUML 1YMMB 4YHLL 1U8JA 4KKAC 1BVLB 4IRJB 3G9AB 4PLKD 2AQ2A 4QXWA 2BNQA 4BFEA 4HS6A 2NZ9C 1FSKC 3DMMB 3QDMD 1YMHA 5E99H 5EN2B 3MRRA 2YPVL 3IAGC 4L3AA 4UTAL 1OY3B 1XGTA 4DN4L 2GAZA 1S9VA 43CAB 5K9KB 2CMRH 3BQUD 5F44A 4UU9B 2LVEA 1IFHL 3FT3B 3VDAA 4G8EA 4FP8H 4KZEL 3O9WA 3SBWA 1GC1L 4KU1A 1BP3B 1NL0H 3NPZB 2VO5A 1X5FA 3Q1SL 2X41A 4LEXL 5BRZD 1BBDH 4YGVA 4OT1H 3BGFC 1A6ZB 3G04A 1RK1B 2JB6A 1OTUD 4BK4A 4YAQB 2B2XL 1YY8B 1G7MB 1J1XH 3Q0HA 3ZT6A 3MV9A 5CP3A 1NPUA 5T3XD 4GRLA 1FGNH 4MAYC 1JIBA 5E8NB 1T7ZA 2ZWLT 3QHZL 2NY7L 2ZOLA 3Q3GB 4UV4L 2DBLL 1WFOA 4Z7UA 5D2NB 3MUJA 2R69L 1G7HA 3BVNA 3MRNA 1U8QB 4E41B 2APTA 3STLB 1ZLWH 1FC2D 1ZT1B 4K2UL 2XY2A 3H42H 4O9HH 1LMKA 3BWAA 5I2IA 3BEWB 5DR5H 2Q76B 5JW4M 3NCFB 2J2ZA 1RZGA 3NFSH 5J6HB 5B22A 1MUJB 1BREA 2X4QA 3JVGC 3GRWA 1A7QH 3NTCH 3LHPH 3W82A 1NMBH 4WI8A 2W1NA 5DC4B 2DM4A 3IYLW 3U0WL 5I73C 2YWZA 4OCSH 2I9TA 1UB5B 1KJ3H 3RVTD 2ICES 3WHXA 3T0AA 2W9DL 1V3MA 3PWPE 1G84A 1EBAA 1JI2A 4CW1A 2C7UB 2VQ1A 3VJ6B 4FQXB 4OUUB 3K2UH 3MJ6A 3L5HA 5IBLC 3CH1B 3MLRH 4LPYA 3BP4B 4E9LA 1DBAH 1OLLA 1ES0A 4R3SA 5HDBE 1U93A 3T3MF 5HYQB 2WV3A 2RQ8A 3V6ZB 1PBYA 4LQ1A 4FFZL 4PBVC 1HINH 5EA0H 5D6CB 3UPRA 3E2HA 1DQJB 1T0NA 4PRPB 3QXDB 1U8KB 4ZYKA 4P5KB 3LKQB 5EIIB 1T1YA 1TCMA 1Y6KR 2F74B 5FUCE 1YN6A 3BZFA 2R1XA 1F42A 4TOYL 4O5LH 5DVNA 3WFDH 4TSCL 3DTXA 4X99B 2VJXA 2QQNH 3QQ9D 2FIKA 2G2RB 3C5JA 1OTSD 2VLKA 2YD1A 4JRYB 1P53A 4O58L 2X4NB 1F3JA 1J1OH 3I9GL 3MUZ1 4JRXB 4LLAA 5EZIL 2DS4A 4KRNA 3FQNA 3WNNA 5J9PB 2IAMC 2FX7H 2M2DA 5F6IC 5DUPH 3WNOA 5KSUB 3MRGB 3BRGC 3IKCA 1VERA 4KKCC 35C8L 3N1MC 3UTPD 3LH2H 5CSBA 4KGJA 2BY3A 4BSWA 3B2VL 4F33A 2K7PA 2NY7H 3MJ9L 3PHOB 5ID0B 4NBYB 2DBLH 5HDLA 1QFWL 5TE6H 3F65A 3CSYB 2ADFL 3DIFB 4JFDA 3T0EC 1T4KA 1EHAA 4QRPA 1Q72L 1I75A 1IQDB 5DHVB 5DD6A 1TMCA 1RUML 3NABL 4ODXB 1EJOL 1JMZA 1AR2A 1AIFA 4O9HL 3JV6B 1I7UB 4HBQA 3DJ9A 4JGJA 3VFGL 5HHOD 1K8DB 3P4OB 4CU7A 2FB4L 1CDHA 1GOGA 3FB6A 2VZ1A 1KPRA 2UVEA 1KN2H 4ORGB 4PRAB 1M7IB 3NFSL 3VXQA 3RZCA 2GJ6B 3QPXL 4PYGA 1MPAH 3P30L 3BGMA 1F97A 3DVGB 4DUVA 1NKRA 1IBGH 3VD7A 5IESH 1JK8B 2DJSA 4JJ5A 3CSPA 4M5YH 5HVWA 4Y16C 4NC0B 3D69B 4CVZA 5DD5L 2DQHH 1NEZA 3EFFB 1CIDA 1KJ3L 3FO2A 1F4WL 4JR9L 3L3HB 5FYKU 3U83A 1MY7A 5CUSL 2O5YH 1CGXA 3X12A 3QHFL 3K2UL 5I73B 4QF1A 2WBKA 1A1OA 1JZ6A 1SJVA 2AXHA 3MXVL 4R4ND 5T3ZD 5E5MA 1IC5H 1V3LA 4LHUB 2GY7B 2VLME 1N4XL 3KXFD 2AEPH 2Q3AA 5FEBA 3D85A 3W2DL 3KPNA 4FQIL 2DQDL 3OKKB 4OCYL 5KSVB 4NDMA 3I3EA 3KPSD 5IFAL 3EDFA 5CBAA 3N9GH 4TOYH 4RX4A 2YPLA 3HUJB 4NN7B 4W6XB 4OV5A 4L4JA 5E8EB 1YN7B 2BVTA 2OBGA 5F1KC 4N8VG 5D7SL 2FGWH 3TV3L 5JIKA 1JNHB 4MYWB 1QSFD 4MVBD 5CP3H 5EO9A 1WISA 3VE0B 4PRDB 4JPVL 4X98B 1FG2B 2XWBB 4OSUH 4MB3A 1LDPL 3LMJH 4G6FB 2G9HB 2DQTL 5KN5B 2X1WL 1UQSA 1CZ8L 5DUPL 3CLEH 2QKIB 2X4OA 4Y8DC 2JLLA 1LK2A 2DDQL 2NTFA 3R0MA 3HNVH 4PRNB 4JO4L 5ESAA 3ZKND 3ARGC 5DJAA 2PUQT 1AD0B 2FSEB 1YN7A 3RU8L 2BRQA 4JKLA 2EECA 4E5XA 3MRJA 1NGYB 1JZ5A 4S0UC 3LKOA 4HUUA 1A7PH 3MLVL 5DD0H 3U48A 5CJOL 4W70A 1UB6A 4HUNB 1MH5A 5HI4D 5ILTH 2IMNA 1KTDB 4IOIA 2V7HB 5DDHB 3X14B 1V7ML 4NYLA 4PFEA 5FAAA 2YRPA 2EDQA 2Z8VC 5I71C 4X6CE 5DMGD 3T8XA 3W5MA 2FL5A 3HAEH 4BELD 1NUNB 1TVHA 3L3GA 4LCWD 1MWAA 2WQRA 1RU9L 2Y07H 1A9EB 5TQ2L 4JRWA 1R5WA 4YFLI 1LK3L 3LD8C 1L4IA 2IPUK 2DWDA 2XQBH 1RUQL 3FQUA 5CHNB 4MQ7A 3ETBF 5FIEA 2A73A 3AAZA 2XTJD 2GQHA 4LIQH 3G08A 3W2DH 2JB5H 3MUGA 3ISWA 4M48L 5T3XH 4UQ2B 1UKQA 1EVTC 1U8IB 4BFIB 4D8PB 1HZHH 5DRNA 1FNHA 4XWOC 1D3CA 2EXWC 4G6JL 2N1KA 2H41A 5JOEA 5C08A 5DHVA 1FN4B 5SX5H 4TQEL 1TZHA 1KN4L 4J8RA 4PJDA 5JW4Q 4I3RL 1ND0B 1U8LB 1HQRB 4OQ1A 2NX5D 3RIAF 3QB7C 2UUDK 1I9EA 1YEEH 2LTQC 4C55A 3TN0D 4WI5A 4JHWH 4Y19B 4PV8B 3GMNA 1Q94B 5IFHL 1WZKA 3MRBB 3NIFF 2JCCB 4QXGH 4XAKD 1I7RA 4Z0BL 3WLWC 4G43B 2DM2A 1QACA 2YRLA 3OF6D 1CGSL 3MJGX 3RZWA 3QDJA 3HB3D 2OSLB 3I2CL 4JFYA 4XB7A 2P1YA 1IAIH 4OFYA 1NEZG 2FJHA 2NXZC 1PYWB 3ARSA 1PG7X 2NMSA 1IM3A 3L6FA 5HBBA 4OM1L 2ITDA 3EFDL 3WJJA 2CXGA 4NO2A 2WIMA 3L9RB 5EPMA 1WWCA 5J12B 5DK0B 3MJ7B 3TVMA 2IH1A 5D6DC 5SWQB 4PRDA 3SE3A 4M1DL 4R90H 1T0NB 4L5FL 1MY5A 5D6CA 3UPRB 3BPCB 5HPOA 4WHYH 3B43A 1JPTL 3CVHH 2UZIH 5E8EA 3X17A 3DBXB 3QNXB 4GXVH 1QSFA 5CBAB 4JHBA 3S34H 3P11H 3VH8G 3BN9C 4X6CA 1UYWL 3C5ZD 4N5EA 5DMKB 4P0DA 5KSVA 2P5WB 1QNZH 3OGCA 2YC1B 4LIQE 3MGTB 3V4PH 4RX4D 1RZKH 1BOYA 1VPOL 4HMEA 4OGXH 3GSUA 5T5FL 2QQLL 5FYJL 1A6PA 1NAKH 4JVUA 4OZHE 4LLMB 1I8MB 4H1LB 4JKPL 3RKDD 4P2OD 3GSRB 1MRDL 1QLFB 4PJHF 4X6EB 5JTWA 5B39G 2C9AA 5GS0D 3UAJD 1JPFB 5CD5D 2BK8A 2JB5L 2VWEE 2E7BA 3VFRA 4PJFE 1WITA 1E4JA 1MFAL 4CMMA 3KYAA 5IW6A 3MRKA 4EDWL 1VFBA 1DBJH 5GGTA 5MEOA 3MRFA 3GMOA 4JKMA 1JP5A 3BGMB 5C9KA 1U8QA 4MD0B 3SJVA 3HC4H 4WY7L 1DQQA 1BWWA 5E2UL 5CP7A 3BH8B 5C0JA 3QT2A 3WD5H 1NLBH 5I15H 1KPRB 3SDDC 3M1BA 3RKPA 5E08H 4KV5F 3CH8A 3DX6B 5CCKH 1S7TB 4UTBH 3GJEB 4K3JH 4Z76B 3HS0A 5MENB 1ZT4A 4HGWA 5EFIB 1M7XA 3WLBB 5HHOA 5AD0A 1P4LB 1TNMA 1U8OB 3CSYA 3DIFA 1WFTA 1NMAL 4I18B 4LNVA 4JM2B 1K4CA 1GHFH 3G5ZB 3U46B 4F9PA 5CZKA 2BDNH 2OI9B 4PJGA 1X9QA 1JHKL 3RY5A 1C7SA 1MCSA 3ZKXC 3MNWB 2HFEB 1MVUA 3V5HA 4CNIB 5LGJB 2OS7A 2EXYD 1K6QL 3QNYB 3EFDH 4IRSC 4UU9A 4D2NA 5KSUA 4MS8D 1U3YA 2EDHA 2DI7A 3ZKXB 3TF7C 3MBXH 4CJ1A 3OB0H 1P4IH 3L3OB 3PWNA 4DAGL 3PQYB 4XC1H 2H1PL 1HIML 1KTLB 3FQNB 3BP6A 3CFKA 4HKXA 1ZHNB 4U1IA 1U0QA 3LS5L 4P99A 3KYMB 4QHLB 3GMLA 3O11B 1JPTH 4WUUE 1FCGA 1YEJH 4BQCA 4NJ9L 6CGTA 3G5ZA 3U46A 5KVEL 1AKJB 1CE1H 1VB9A 3WIHL 4POZC 4LF3A 1T20B 4MSWA 2VLKD 1EXUA 3P11L 2AABH 5TDOB 1WBXB 4OZGB 1MCWW 4PJCF 3ALXA 5IBTH 1U8KA 4PRPA 1Y18B 4LVEA 4JG1L 1I8KB 1H0DA 2EYSA 3BUYB 3V4PL 1ED3B 1RZKL 4Y5VA 5JQ6L 3ZKQD 4OGXL 4HAFA 3B9AA 3PWUB 1P6FA 3RVVD 3BH8A 2X4RA 4KXZH 3MODL 1NCAH 1DEEA 5GS3A 4MAYA 4OUOA 4OI9A 3DO7B 4YC2B 4GRLC 3MRFB 4WNQA 5DJYA 1ZA3A 1X4ZA 2EDFA 4L29A 3V5KB 1S7RA 3P73A 3KYKH 1OOAA 3QWQB 4NT6A 2XTJC 1RZ7H 5J06A 1ZHBA 3OKDB 5GS1C 1KIQA 5C09D 4JQXA 1F3RB 4KPHL 4Y16B 4LRNH 1QLFA 1KFAL 4YHOL 3U7YL 5EUKA 3F58L 3WFEH 4U1IB 3GSRA 1FPTL 3HPLA 2EKSB 3L5JA 4HBCL 1ACYH 3V7MA 4P2OB 2B5IC 3W39A 3L3KB 3NZHH 3QDMB 3KPRB 5DRWB 5CCKL 4ODBD 3RWIB 4OIIL 1AC6A 4U0QB 2XA3A 5JA9A 4G80B 2DYPB 4PGBA 2YC1A 3OF6A 3R1GH 4LCCB 4CNIA 2VTFA 5EU5B 5IQ9B 4HC1A 3GBML 5EUOF 4NRZA 4ZPTB 4M7LT 3BP7B 2XNAA 2VZOA 3U0PB 3WLWD 1U92A 1Z9MA 4YHKL 1OD7A 4Y0GA 5DK3A 4OZFA 3VG0L 4YHYB 3DYOA 2XA8L 1ZGLP 4FOMA 4RWYH 4GRWF 1M71A 5GRWA 2EICA 1L9NA 2DLIA 1RK1A 4XP5L 1IKFL 4EUPA 3JWOH 4OQTH 3MCKB 3DRQA 4ONGL 3L5WB 3F7QA 4PRBB 5T1DL 3HI1B 1U58B 1RPQA 1ZWIB 1AHWC 2XYCA 2QSCH 3LB6D 4G8EB 1AGBB 4WWID 4MD4A 1PZ5B 4MA7L 2QQQA 2ADIA 5LAXB 4IIQA 4LSPL 4P9MH 5KVEH 4QHMB 1JWSB 3DLQR 1OP5H 4M7JL 3FONA 3KPSE 4K07A 4UILH 1XF4A 3MA7A 2BCKB 3GHEH 1IGJB 5IMMA 1TJIL 5IBTL 4GLRH 4NHCH 1L8JA 3BQUA 1W72A 4URTB 5DJDA 3FRPG 4ZXBB 5JQ6H 4NPYB 3A67H 5L2KD 1FYTE 5DHYA 3BGFB 4XI5C 5D1ZC 2NZIA 1LEIB 4TTDD 4ELKA 3GSUB 3SGJC 3WHE1 1IM9A 1NCAL 1HILB 2R23A 3M45A 3ULSA 3FB7B 1T80A 4JG0H 5BVPH 5IR1A 4NGHL 5CLTA 2W91A 5FYLD 3O45A 5GGTH 3PP3H 4XNQA 2AJZA 3IU4L 4M3JA 4U6YA 5FF6B 3KYKL 2NYYC 2VZSA 1RZ7L 3QNXA 3O3AB 1ULVA 2FO1A 1FZOB 5SWZA 4WFGD 3BIKB 3KPRE 5F88A 3TBTA 2XTJB 5CJBA 1G9NC 1LGVA 2EEAA 3K4ZA 3HN3A 1ACYL 2OR9L 4TULH 4OGAC 3LQZA 4JB9H 1WT5C 3VD9A 2IGFL 3QIBB 2R4RH 1GSMA 1NDGB 1OAXL 1G7PA 1XIWA 3LV3B 4RZCB 5MERB 3R1GL 1PYWA 2FJHB 3EYVB 3VXUA 3SOBH 3QFJB 2XWTB 1RQ5A 1ETZA 1GGBL 4IRSA 2F8OA 1YEFL 4XWGL 3GBNH 3QDJB 2CRMA 2VLRD 1PEZA 4YHKH 1KTDA 4IOIB 4JM4L 4JRYD 1IGIH 2I26N 3O3BA 4F9PC 2ZUXA 5CEZD 1VHPA 4J3VA 5FOBA 4POYA 2QTEA 2FO4B 2R1WA 4YPJA 2H2PD 3S35L 2ARJB 1JGDA 4Q0XH 4IRSD 1DQLL 2UWEA 4F8QA 4IDLA 1KGCE 2DQGL 3QCUL 4NQDB 3PIQB 4RAHA 3RPIA 2DQEL 1WEJL 1S7VA 3DVFA 1Q0YH 1N8ZB 3MLZL 3NZ8B 5ACZB 1BBJB 4LK4A 2B1HL 3CDCA 1RD6A 3AMLA 5MI0C 1IVLA 5DRNB 1A9BB 5DJZB 1HKLL 3DECA 4MQSB 3KLHC 4HGMA 2GTWA 2ADGB 4XB8A 3THML 3NGBB 4UILL 3VMNA 4WO4C 1JZ2A 1DUYA 3KNBA 1T21B 1NDGA 2PETA 3OSKA 3TJHC 4M1CD 1KYOJ 3P9MB 4EIGB 2BMKA 1LO5A 4B7LA 3FQUB 1INEL 4NNYA 5CAYB 3GNML 4TUOA 1S78D 3BYTA 3OG6B 4NN6C 1FJ1B 1NCNA 3U36B 4JEGB 2BHUA 4NGHH 1F90H 1D6EA 3D39E 4Z7NE 3WNMA 3SGEI 1GJIA 1J7VR 1F58L 4PS4L 5KZCB 2EYRB 3OKKA 4FFVD 3B8YA 1PG7L 3ARDA 1JHLH 1L6XA 3PWPD 4MAUH 3SKMB 1HILA 3ILPB 4FNLL 4HJGB 4U1HB 5DHYB 1UM6H 4NHUB 5KOVC 2XN9D 4OCMC 5JZ7D 1GL4B 5EBMA 3ROOA 1I1AC 3A6OA 2PKDA 2Q3ZA 1G1CA 4EOWH 2AJ3B 4M5ZH 4X9HA 3PXJA 1T66D 1UM5H 4M9OA 4NM8H 4JB9L 4AY0A 1R3JA 3RWEB 3BQUB 1NCDL 3KVQA 3BX7C 3L3HA 1ADQH 4YH6A 3U36A 4YXHL 4WWKB 2DRUA 4RGND 1OB1B 5HJ3A 2AK4B 3GJFA 5FCSH 1I3GH 4QHMA 5DJAB 4JFFB 1UCBL 4NN7C 3T2OA 2J8UA 2CSPA 5GRZA 5DMYA 3T0XA 1DLFH 2A83B 1AGBA 2FLBT 1YMMD 4NO3B 3UBXA 3GBNL 3TO4C 2EDRA 3DXAE 5E99L 1QVOB 4JM4H 3T3ME 4UTAH 5T3ZL 3NOIA 1PD6A 4ODVH 3BGAA 4MDIB 3IRZA 4M6NL 4BZ1H 2X4SB 4GKZA 1N3NA 2HT4D 4X98A 5FUCC 1IFHH 1CT8B 1BAFH 1IGMH 4QXUH 4U3CA 4ODXA 4TNWF 1QBBA 5JLZA 1BBJA 1JHTB 4QWWC 4LLWB 5JO5A 1OM3H 4JFDB 1MVFA 1UZ8B 4JFOA 5EULV 5LGHH 4DQOL 4OTXH 4P4RA 4XCEA 2UWEB 4PJAB 5IVXF 3SJVE 2YPLB 4LPCA 4BSWB 3H9SB 4NRZB 2WAHA 1HKLH 3MMEA 3O4OB 1FO0L 4Y1AA 1JGLL 4Z7VB 1KF9B 2CKBL 4G80A 8FABB 2GSGA 2XXCB 4QHKJ 4PP2A 4JZJA 5SWZE 3TBVA 3W39B 5B38B 3FT2B 2R69H 4WI4A 2OM5A 2XZCH 3TIEB 2Z92B 3IDYB 5DC9B 1VGKA 3LD8B 4QXTA 4YHNB 3LV3A 4RZCA 1NQBA 4H0GA 3WIIL 1O5DT 4FZEH 3VW3L 4K2UH 4YX2L 4X6DA 2HFGH 2KPNA 4TTDC 4I2XE 5F9OL 4L8BB 4DW2L 2OL3B 1CGUA 4ONHB 1TNNA 5EIIA 5BJTB 1ZA3B 5F7HA 2VAAA 3FO0H 1E6JH 1IC7H 1IZKA 1PG7H 2DICA 3N1GC 1DEEB 3C6SA 1MIEL 1OWRM 4GKNB 2FH8A 2AK4E 3C60A 3BP4A 1YQVL 2EDKA 5F7DA 1NAMB 2ZUUA 2FD6H 5C0IB 1AIFB 5E9DD 4P5TC 4J4PC 1N59A 3AMKA 4CRPA 4CW1B 2GITB 4AEFA 3MGAA 3K4DA 4OLEA 2JJWA 2R23B 5HTSA 1H5BB 1T0MB 4PJFA 3GFUA 4KVNL 5CEZE 4JY6B 1AKJA 1RZFH 1SYSB 3AS2A 4KK5D 3S5LA 2YEZA 1A5FL 4ERSL 3ET9F 4P59L 5D5ME 5EA0L 3T3PE 5DJDB 4QNPF 3C09C 4PBXA 5T1LB 5FO8B 3EOTL 5GQBA 1KTLA 4GFTB 2NXYB 5INDA 5GZNC 4I9WE 1VKXB 4K3EH 2BC4A 3WFDL 1I9JL 5J9PA 3MRCB 2APVA 2GFBA 2JE8A 3DYPA 2QQNL 4FQJH 3S4SA 1BM3H 4LAQL 4PJXA 3QRFM 4R96A 1H8OA 3MNWA 3UMTA 5CINH 4XNUL 5EZIH 1RZIA 4QRSB 4TSAH 1MCHA 2Y7QB 1OL0A 2EDNA 2FYYB 1U8OA 4P46B 1DBKL 4XTRC 4J12A 3LEXA 2P5EE 4K7PY 2ED7A 4GAGL 3JUZA 3TH3T 2LU4A 4KI5D 4U4BA 5IK3A 1D9KC 1RZ8A 2HJFB 3CXDH 3QJFB 5E03A 2IPUG 3BXNA 3MLXH 4W4NA 1YJDH 1LO4L 3QUZB 2AXFA 2XNAB 4HDIB 1VADA 1ZHLA 3D2UA 4OFYD 3V6OA 3ZE0E 2CIIB 5JOPE 5TDNA 3GSWA 4WO4A 1DQQB 5C07E 5JDJA 2XZCL 5IVZB 1LD9A 4GH7B 5EZOL 5E8OA 3MZTA 3NABH 3S3JA 1S7QA 3OMZA 4N1CA 3BPOC 3SDCC 5L9DL 2I9TB 3UZVB 3HI6L 2W59A 1KN2L 2R2BB 3S4SG 4UI2A 2E9JA 5EOTB 5HVHB 5DGQA 2VL5A 5EUKB 5IMKB 2WSKA 1CL7H 4Y16A 3O6FD 4HS6B 3WKNA 1E4KC 2R9HD 3QG7H 4OGYL 3HG1D 3VG9B 3OR6B 3HLAB 4Q6IA 4Z7OE 3L95B 2DQHL 1MRCL 3RZCC 5K9QI 4L3EB 2FX8L 4S1QL 3D0VA 3MGTA 3QZWA 3VI4F 1JV5B 2P5WA 5I1AB 2Z8WC 4R4BA 2YMXH 5E2WH 2W0FB 1WJ3A 1G7HB 3BVNB 3BPNB 4Z7VF 1MLCB 2CIIA 1YMME 5D2NA 4UDTA 4AQ1B 5KVDH 1PLGL 3QUZA 2XPGB 5EH1A 4LNRA 1V7NH 2LABA 1KJVA 4ERSH 2ZPKL 4Y5VB 4I18C 3BIAX 4OF0A 3QJFA 4WU5B 5DHXB 4PUBL 1A1NB 2XRAL 4ZPVB 1HNFA 1MCPL 4OZGA 1K4DB 3LEXB 4I4WB 3MV8B 1T20A 4MSWB 4MQTB 3SKJL 2KZWA 2D31A 3QPQD 4J3TA 3K81A 4B41A 2J8HA 4OZIE 5GSVA 3QDJD 4V2BA 2EIDA 2FGWL 3TV3H 3CFDB 2Q8AH 1YEKH 5CINL 4I5BB 3GM0A 3P0VH 2ZSWA 1NH6A 2Y5EA 5JORA 4BUGA 5CD3B 1IGTA 4HFUL 1VKXA 2DQTH 1QFWI 1CZ8H 4GAGH 4PJIE 5DHVH 1T7YA 3RWHA 4AMKL 3AS0A 3TESA 5GISL 1XZ0B 2DDQH 3NFPB 4BA8A 4KK9C 5DTFA 2HFFA 4FFWC 4PR5A 2AGJH 5HYEA 5AUMA 3NIDE 5D1XC 5FDWB 2DM3A 1K4CB 4D0DB 2P7TB 4DVBB 5JXED 4EKXA 4YDIL 1Z9SA 3OAYH 5HYSG 3RU8H 2O93L 5HHOB 3QFJD 2GITA 2VNCA 5EZOH 3KLSA 3B5GA 3B6SA 1WFUA 3TNNA 3BKJL 2OX5A 5FYJE 2H32A 3AU1B 2R1YA 3MRMA 3RDTB 3DX6A 4QRTB 4MNQD 5CJOH 2P4AB 1UH2A 3GUTA 1X5KA 1TZIB 3QA3A 4ZNEE 5L88L 3G08B 4XMPL 4JQIH 1WWAX 5SV4A 4G9FB 4AK1A 2DWEA 4NC1C 1FVDA 4ZDHA 1KYOK 3N85H 3B9VA 1HHJA 1EH9A 1OW0A 3QG7L 4OGYH 3VFRB 1LEGA 4NZRL 3ZE1E 2OYPA 4Y2DA 4X4YA 3QDGD 3UTSA 1OTTC 3PWPB 5ALCH 5EIVA 3Q6FA 4ZQKB 1D5ZA 4KKBC 2ICWJ 5FHAL 5IGXH 1ZAGA 1MHPH 2IADB 2QBWA 4P5TD 4QRRB 5B21A 4AJ0A 2ITCB 5B38A 5DJ8B 1PLGH 2EZ0D 3T0ED 4PP1D 1BIIB 4NBXB 5C0AD 2GJZA 1KT2B 3ZDYE 1X5AA 3FO9B 5FM5O 1I9RH 1CDIA 3MNVA 3WS6A 4JE4B 4PUBH 4F2MB 1ZS8B 3OGCB 1VCAA 4LASH 4YK4C 1I3UA 3L1OL 3LCYA 3NH7H 4E5XB 1U9KA 5IMLA 4Z7WA 1NGQH 4PJ7B 3V95A 1FO0B 2XZQL 5I1HL 4WUUA 1XH3A 5CMAA 2MMXA 2AJXL 1CLYL 1E4XL 4G9DB 4JFEB 3VFWA 2LV4A 5EB9A 2PNDA 4GUPB 2AJSL 2I5YL 4PTUA 5IFHH 1RMFL 4QXGL 1IEBA 1RUPH 2JJUA 2X4OB 1CLCA 1MIML 4WTZG 1CIUA 2ITDB 5E9DE 5KN5A 3T65A 4WGWB 5GISH 2PCPA 1UJTA 5FCUH 2BOBA 4LHUG 1ZS8A 2AGJL 3B8SA 4KY1L 5CLWA 1DDHB 4LSQL 5IHZB 1JNHA 1MRFH 3HMWL 1XR8A 5HJ3B 3TO4A 1EEUA 4NQDE 3WN5A 1FNSL 3Q6GH 4P2YA 5L8LB 3ZLQC 3DV6A 2V9TA 3BO8A 3MRBA 3T2NL 1PEWA 2XV6B 3EJZC 3MREA 4APQA 3WO4C 3U2SA 3DUUA 3KXFA 4LKXB 3UJJL 5I1DA 3IDNB 3UTSB 2VRAA 4PLNC 4L9LB 4L5FH 5IV2B 3KPNB 4U1HA 3HR5A 4NC1E 3NIGF 1QQDB 3C08H 5EORH 4ZUTB 3LKNB 4L8CA 2YN3A 4YO0B 1A1OB 1OTUC 4R2GB 3VFOB 4FXLA 3WJLC 3DV4A 4FG6D 1Q9OB 3UDWC 3K8MA 4PG2A 2WUCL 3D25B 3I6KB 5ECJE 5DJ0B 5HDQL 3BDYL 5JPNB 4JJ5B 4ONOA 5KAQF 1JK8A 1MHPL 3GB7A 4K71C 4GBXB 3H7BA 4P2CG 5LXGL 3VG9C 3DVGA 4D94A 3V6OE 1Q9KB 4DVBA 3RZCB 4HZLB 3VXQB 1JGEA 3WIFA 2FHCA 3SDDA 4FQCH 4HUXB 1YDPA 4XP6H 2NY3D 3OKOB 3MRDB 5DEZA 5I30H 5IM7A 3NH7L 2ZG3A 3SY0A 3TJHA 4WHDA 5SWSA 2AV7A 2VDNL 2EC8A 2RAMA 1T4KB 4NYLB 3S3SA 3O4LD 1CCZA 4PY7A 1EAPA 4WY7H 5FKAA 1OGAB 1G9NL 4I0CC 3PHOA 5ID0A 5E00B 2OP4H 4YJZL 4QRQA 2E27L 1NBYA 1OSZA 1XGUB 3QDAA 1PX4A 4WTWA 2WWMC 1H5BC 3DUSB 4S1SL 4NO0D 3IKCB 4NNXA 5JR1H 5CEZH 3LN5A 1K9TA 3AREA 1RUAL 1IM9D 5DK2B 1CFQB 5ESAB 4YDVA 3QFJA 4KY1H 1QFHA 1JHKH 3PWLB 4NQDD 3RIAK 1BQHA 2VQUA 1VDGA 2VLKB 5D4QA 3UTSE 4H25A 4XVTL 4IRJD 2QKIA 4JFDE 1AD9B 2XPGA 4CAGA 4X99A 1N6UA 1NGXB 3QCTH 2EXWD 2A38A 2W0FA 4HWBH 4I9WD 1YEIL 4W4OC 2XG4A 2QL1A 1LE5A 3QXDA 4ZYKB 2E7MA 1AY1L 3QQ9C 3LS5H 4W81A 5FHBH 4HEME 1YNTA 1U93B 5F88B 4NJ9H 2P42B 1FZOA 5SWZB 3HC3L 4N5UA 3W9DA 4NBZB 2AABL 1SBSL 2X42A 1CR9H 4LCIH 2NTSP 4JG1H 5I18H 4KUZL 2AEIT 4AEEA 5F7LB 1WZ1H 4JVPA 1T89C 5ITFA 3OHXA 1YPZF 5L8KB 3L3DB 3QUMA 4H26B 1IILE 3GMQB 1F8TL 5ISZB 5BV7H 2EEDA 2GSIB 3FRUB 5I8EB 2NXYD 2OZ4L 1CQKA 3RTQC 1MHCA 2D03H 4RNRA 2F8VA 2QADD 1CLOH 5F8QC 4B0MM 4H5SB 4F15B 1HDMB 4ZFZB 4KKAD 1BX2B 3FT4B 3IJYA 1DBMH 2RHEA 2EKJA 4KTDL 4U1SB 5KG9B 3SDXF 5KS9E 5ERWA 3BDXA 1KC5L 2F53D 5E2TH 5F7WC 2XTLA 1U58A 3HG1A 3DX8A 5FDYA 3WFEL 4PRBA 4HBCH 3OXSB 3GSOA 3MV9D 3BP5A 5M94B 4OZ4A 3C5ZC 2OP4L 3UTQB 3I6LE 3H6JA 2VE6A 4D9RE 3ZMRA 5I1CH 3O6FB 3D3VA 4Y19E 4GW5B 4MJ6B 4BSVA 5BRZA 3MV9B 4R6UA 2VISA 4MWFB 3T0WA 3MOAL 3GI9H 2KBGA 1RHFA 2VLKE 3LKRB 1EDQA 4YHIB 4MAYD 3UZQA 2JB6B 5ID1A 3E6FB 1ZVSB 3VMOA 3TZVB 2IWGA 3U0PA 3PWJB 5B8CC 3E8UL 3DXAA 4JZOA 4KGLA 1KV3A 5KSBE 2VXTH 1OGAD 4X9FA 4GMSH 4PGBB 5E8PB 3TFKA 1YY9C 5TF0A 1S9VB 1WC7A 2CRIA 1E27A 1S7UA 3JWOL 3EGSB 3EYUH 4IDJH 3FCTA 4FQHB 2ESVA 3HPLB 5T1DH 3KLAB 4G8FB 2J4WH 3EJZD 1FAKT 3MR9B 3WXVL 2DQUL 3IFLL 4PLJD 4BFBD 3LKPA 3MOQA 2ZCLL 1L7IL 1LP9B 1MOEA 4LSPH 1BVLA 4HK0A 4XNZC 3QEUA 5J11C 4NWUH 5ICZB 1SBSH 2F74A 4L29B 3V5KA 1T1YB 4FQ1L 1KIRA 3FZUC 3UCRA 3DO7A 3V6ZA 4J23A 4L8BA 2X4RB 2OQJB 1NCBH 4CADB 2H6PB 2IPTL 2ZKHL 4ODUB 3CDGA 4Q9RL 3DVNB 3LKPB 1S9YB 4ELME 3VXMD 3MV8D 4E41E 3WUWA 2J88H 5BXFA 4XPTH 5BVPL 5KANG 3KLAA 4BYHA 5C0ND 1AKJD 3VGAB 5DK2A 1WC7B 3QULA 2EDEA 1R3HB 2ESVD 3C09B 4GMTH 4NNXB 5HDOA 3MFFA 2MJWA 4Z7VA 1KC5H 3B9KA 1NUFA 1P7QD 1I85C 3DURA 1T7VA 1MUJA 3BP6B 3CFKB 2OR9H 2Q7NA 2VN7A 3RY6A 4LMQE 1OGAA 2W9LA 4OFKA 3BEWA 5HYJD 2R4RL 4XBGA 3EDKA 1KCRL 1VGEH 4ZD3H 1VA9A 3IRPX 5MENE 4HUVA 2EH8H 3D3VB 1MVUB 5LGJA 2VABB 5GHWH 4P46C 3MRNB 2WWKT 2IAMD 4X6CF 4Q9BA 3MV8E 4XWGH 2HMID 5HI5C 1JRHL 3FN3A 3E8UH 5E70A 1MFCH 4PJ8B 2BSRB 2NY1B 1P9MA 2VXTL 2YSSA 3NVQA 4KKCD 2H2SD 3FQRB 3HCVB 2X89A 2VZ3A 2VR4A 5DYOB 4ZUSB 3VFMA 3GJEA 5KG9A 4GG6B 5F1NA 2DIAA 1NBVL 4CUCA 3G04B 1M7DA 2EDJA 3IJYB 3OAUH 4IRJC 1NAML 5FB8A 1DQLH 3MO1B 2FDBP 1HDMA 2DLGA 4IJ3B 3O2VL 3IJSA 1AGCB 3RWEA 2Y23A 5CP7B 2J4WL 2PO6A 2GSIA 3N50A 1EHLH 4P3DA 3QR2A 5BS0A 4HJGA 4H26A 3MRKB 4JCLA 3L3DA 43CAA 5K9KA 2JIXB 5GPRA 1JPFA 5L2KB 4YDJB 2Q20A 4Z6AT 4B53A 3DHJA 4FFYL 3ZYOA 1EERB 5DWUL 2Y9RT 1QRND 3MRRB 5FXCH 1YMHB 4JANA 4NN6B 4Y5YC 3FQWB 5MEQA 3HE6C 3EO1A 4JGMA 4KJYA 1UA6H 2MPAH 1LO0H 5GS1B 1S3KH 1TIUA 4G8GE 2E5EA 2LAGB 1C12A 1MCOH 3OB8A 3HZMA 2FECL 1YNTB 1YMMA 3S5LG 3J7HA 3LVEA 2J88L 3WE6B 2I24N 1JYVA 1IZJA 2RIKA 3HHRB 2BVPA 1FFOB 2R0LH 4U1MB 5HVGB 2UV3A 4KC3B 4BH7A 3QUZC 1WIPA 1GGIH 5D2NC 5H8DA 3BN3B 2CD0A 1FBIL 4KI1A 5J1AB 3RX8A 5ENWA 3BPCA 3QIBD 1UM6L 3C6LA 4JFEA 3VFTA 1MLBB 4QRRE 1ITCA 2V5YA 4NQVA 1IL1B 3DGGA 1P7KA 2CLZB 4NQDA 3QUYC 1NCDH 4NZUL 1F11A 4OD2B 4YE4H 5F3HB 5IMLB 4KFZC 4XAWL 1JGDB 3S36H 5D70L 1IM3B 3L6FB 2NW3A 4U2YA 1DQTA 3PWVB 5FOBB 5GHWL 2R0ZH 2VDMH 2P8MA 3GJFH 3SKNB 4P2OC 3O6ML 2Z35A 5E94B 1X3DA 5BQ7A 1QPPA 3QWOB 2YD2A 3MRQA 3MSPA 3SDCA 4ONFH 4PJ7E 2GJZB 1WCQA 5T3ZH 4NO0B 5CD5C 4LLUB 2ITCA 2PYFA 4Y1AE 3UXFA 2NYYD 3ZTNH 4PREA 4M6NH 4BZ1L 4PV8A 3WFBL 4PJ8C 4DOHE 1BAFL 4HUXA 1AQKH 3SDXB 3O2VH 1P7KB 4J2XA 1B0WA 1T5XB 3RX5A 4DQOH 3B83A 4MZ3A 5DI8A 1AFVH 1HYRC 3I02B 2YD3A 4JAMB 3SDDD 4K9EL 3TBTB 4BFIA 4D8PA 3SE9L 5JIIA 4YQXH 4PB9L 2C1OA 4G8GB 1JGLH 2D0FA 3DGCR 4Z8FH 1KTKE 4QY8B 1ZMYA 5DWUH 5DUBB 2HN7B 3W11C 1CG9A 1WZLA 1IRAY 1G9MC 4HF5L 1KIPA 3KYOA 5CEYA 3LKNA 1P2CB 5DI8B 3WE6A 1DBBL 4JDTH 4NSKA 4QRPE 3VFUA 3FB7A 3K2MC 4UT7L 4ELKB 4F7CA 5DEFA 5IV2A 3RI5K 4EZMA 3QXVA 4NPYA 1CFNB 1NC4D 3H8NA 4D3CH 5IIEA 3T8XB 1HOCA 2JJVA 5HGBB 5GRYA 2DQCH 1W72B 3KPLB 1DQDH 1F4YH 1GGIL 1MFNA 4MVBA 3MA7B 3NCJL 3LN4A 3FONB 5A1AA 4N0UE 1FBIH 1QRKA 1YPZB 3QWOA 4IIQB 1PSKL 5E94A 4WUKH 1FL6A 3TN0C 3FN0H 3ESUF 1HHHB 2OJEB 1KB5L 2HLFD 1G6RA 3VCLB 3IJSB 3ULVC 4PG9A 4Y4HA 3UTTB 2WW8A 3IETB 2CLZA 4XAWH 5CGMA 4EUPB 4Z7UF 5I16B 4PTUB 4KVNH 1C5DB 2VR9A 5I1LA 1I8LC 4Q58C 2C3VA 2R0ZL 4ZPVA 2RR3A 3O6MH 2H3NA 4WWKC 4W68A 5EG6C 1MAML 2NXZD 4P46D 2NY5H 1PZUB 5I66A 2I07B 3CMOH 3GIZH 5J3HC 3TT1H 1MLCA 3O41A 5I9QC 2CMRL 1I9JH 4U2ZA 1FFOA 1XCQB 1KJ2A 4UT9L 4WI3A 4HUVB 1KEGL 4D9LH 2DQIH 4YBQD 1ZLUH 2DIBA 1AQKL 4XBGB 3KPRA 3QI9C 5ACLA 4X80H 1NL0L 3GMPB 3F12B 3L7EA 5ETUB 3K1DA 5DJ8A 4OCLC 3O6KL 1ZANL 1OAYL 1FYTD 4WI6A 1HSBB 3BN9D 1ERNA 3MV7D 4YQXL 5EU6A 4M1GL 5JPMA 5IW1B 5DRXB 1LEGB 4MCYA 3QG6A 3QULB 1CD8A 2VKXA 3TH4T 3C6LD 5C7XL 4C58B 2F19L 2NQCA 5HD8C 2ZCKL 1YJDL 3JV0A 4JO3L 3QO1B 1FVDB 2FEDD 4LVOB 5I76B 2HT2D 4YZFE 2PO6B 5BXFB 1F4XL 1JGUH 1NLDH 4PJEF 3EYOB 1MJJB 4N8CH 4NKDB 3GSWB 4WO4B 1AGCA 3UROR 3GUTB 3W5NA 4BQ8A 3CFEB 4NN5B 2YXMA 3QIWD 3QSKB 1CD1B 3RKDC 1JYXA 3NACL 2DQCL 3VWKD 1H0DB 1KLGB 3ULUC 1CDJA 3FQTA 1F4YL 2APXA 2BSRA 4HZAA 1Q9LB 1CVSC 3NCJH 4Z7QF 4M6ML 3RUGB 4LF3B 3FN9A 1ZV5A 3HZVB 2CR3A 5L8JB 3MFGB 5A43C 1PSKH 4DZBA 1FQ9C 3U0WH 4WUKL 4NHUE 4FTVB 2A9NH 4GW1A 1KCKA 5EDXA 2VABA 3GMLB 3O11A 3TA3C 5HHMD 2G75B 2IQ9L 4FQHA 4MNGE 4DJMA 4UIKH 1TMCB 2YMXL 3BMWA 3NPSC 15C8H 1T5WA 1E27B 1S7UB 3MLRL 4M8VA 3QXWA 5CD3A 3QUXD 4PY8I 2AEQL 2X10A 2DBJA 3PGFL 5FK9B 5GGSA 2HFEA 4R9HA 1MAMH 3LS4H 3O4LE 3BKMH 1HINL 1IKNA 3EYSH 3DXAB 4PIRF 2Z93B 2LTQB 3CMOL 1U6AH 3QIUB 1H5BA 1T0MA 4LSTH 4PJFB 1VFOA 1K4DA 2HAZA 1BD2B 1R6VA 3HZYB 4HGWB 1ZT4B 1INQA 2DQIL 3DSFH 3CFCH 3EJYD 3VXOB 4U7MA 4WEMB 4MS8C 5F7DB 2FIKB 2G2RA 3C5JB 4Q97A 3GSOB 3WS3B 5GGVY 4HKJB 3QUKA 3O6KH 2W38A 4PJAE 3SJVB 1Z9LA 1OAYH 1BGXL 4RMRA 5I1AA 3FQTB 4CKVX 3LKQA 3NCBB 4G3YL 4OJFH 1U3ZA 1VFBB 4HIJA 4YXLH 5ICZA 1BJ1J 1HEZA 2L4OA 4DCQB 5C0RL 4TRPH 2NY6B 1M1SA 1F6FB 2YD8A 3R8QA 5JIPA 4LVHC 1QFWH 5TE6L 3SDYL 4YDIH 4PJ5E 4YHNA 2IBZX 4NKDA 4RNRB 2WINB 3NCCB 1JGUL 5E4IA 1A3LH 4GRLD 1WVZA 3UJIL 2DLFH 3RUGE 4XCNA 1JFQL 2PO6C 3OHXB 2FB4H 4XCNB 4J1UB 5DRXA 1BOGB 1LD9B 3T2QA 1MPAL 3P30H 4X4MA 1NBZA 4X6FB 3H9SA 1QSEE 4D9QD 2DTSA 4HDIA 4NM4H 3N85L 4PY8J 1TITA 1PFCA 2P45B 1NJ9A 1NFIA 3OQ3B 3TVMC 2CLRA 4DGIL 4ELMB 3LKRA 3BWAB 2BY0A 4OZGE 2HJFA 4JR9H 1C16B 1VFMA 4MWFA 4LCUB 2DM7A 2MCG1 4MJ6A 4YUEH 2DLEA 1PGRB 1N3NB 4GKZB 4MXWL 2SEBB 1YZZA 3OBAA 4JN2A 3R06B 4MJ2A 3GSNH 3ULVD 2Y36H 3L9RA 4OZ4B 4QRSA 5EPMB 4BUHA 3OXSA 2AEQH 3QEGL 4LCCC 2WNGA 3PGFH 2APFA 4HAGA 4MDJB 1JPGA 3LS4L 4LSUH 3ZDZF 2DQDH 1ZKAA 2YUWA 3EYSL 3RGVC 5ERWB 4JFFA 4OCYH 4LASL 1GGTA 1FH5L 4LSTL 3N9GL 5INDB 5C8JB 3D0LA 1JWUA 2P8PB 1I7RB 1A6AA 3OPZH 5ADOH 4N5ED 5C3TA 1TQCB 2CXKA 1E6OH 3LB6C 3DI3B 3ROOB 4XCFL 1OCWH 4UBDC 5E00A 4A6YA 2I5YH 4HXBH 1YPZA 5FYKE 3BKCL 5SX4I 5FKAB 4N8PA 1TZHB 3LN4B 4EN3D 1XGTB 4JO1H 3ZL4H 4Y4FA 2EYRA 3P40A 2J8UE 1HYSD 1T3FB 5FCUL 5HHXH 2YD4A 5J11B 4GW1B 3EDJA 3MRDA 4MJIB 3EUUA 1FORH 3U30C 1MFEL 3L5IA 1TCRB 5BVJB 5E5RB 1I1RA 1JGEB 1MRFL 3C6SB 3AAZB 1BQSA 1PDKA 1HSAB 3FB8B 3FKUS 1FNSH 4NSKB 4MLSA 4Y2DC 4I77L 5K9JH 1OPGL 3V8CA 5JW3L 1MI5A 3MA9L 1NCUA 1TVDA 1D6VL 2OL3A 4HT1L 4QGTA 3D25A 5DUBA 1OAUH 4HPOL 4ZXBD 4O2CB 1Q9OA 1BJMA 2UY7A 4Z7WE 1U8MA 1MWAB 5HHQB 4JM2D 4L4VD 1AO7B 1VGKB 5ILTL 3GDBA 2LU3A 3TN0A 2K3TA 1JL8A 3PWLA 4JFHD 1CXFA 3TFKC 2WUBH 4QHUB 3ULUD 4JAMA 4NM4L 2BSSA 3QAZC 1CFQA 3FHQA 1NANI 1QBLL 3KS0J 3FHAA 1QQDA 1UB6B 1CFTA 5LWYH 4GBXC 3WFZA 1YYLL 2PYED 5E7FA 5M7QA 1C5BH 5KAQG 4MXWH 2E9WA 2QV2A 2DF3A 2FATH 4MNQB 5IOPA 5DS8B 5JXEC 4PJAA 5TQ0L 2VXVL 2BNUB 1UZ6E 1UZ8A 1AD0A 3SGEH 1CBVL 3DROB 3QBTB 3SDAD 4LIQL 1F2XK 2CDEB 3HZKA 5IHZA 5CFHA 4FQCL 5BQ7B 3UTZB 4XP6L 3VD4A 5C2BH 3SKNA 1ZGLA 1A0QH 4PRNA 2IANA 3BE1H 2EDBA 5CJQL 1K8IB 3I6LD 4K3HA 5CWSA 1P5VA 4HUMB 2H2PC 1IGCH 4R8WH 4R0LB 1K3IA 3UPAA 5F3HA 3C60D 2R8SH 5ADOL 1ZTXL 3VXSD 1NCCH 1E6OL 4HIIB 5FM5M 5L2JB 2YK1H 4WV1A 2WP3O 1AGFB 2J8UB 1MLBA 4NJAL 3GB7B 4IJ3C 4OZGF 4A2LA 2VDQH 3BEVA 2E9IA 1EO7A 1MQ8A 2A0LC 4PJ7A 2F53E 5MI0B 1RIVL 4Y4HB 1MWAL 4D9QE 3ZHLA 4PJBA 1F6LL 1YEGH 3PDDA 4JRYE 4RGNE 1UADC 3MLWL 2Z0BA 1FL6B 4UOW1 1FORL 3QFJE 4NHUA 2HA1A 4C56B 3TJHD 5C0CA 1IM9B 4IMKC 4ZO8A 4DKEH 4OM1H 1CE6A 4QTIL 3HR5B 4BK5A 3NCMA 4M4RA 1BQLL 1CDCA 1EGJH 1EBPA 1CXKA 3NBNA 5JW3H 2F54B 1X7QA 3C87A 3HMXH 2NLJB 2QLVB 4HLZH 1D6EB 3DOSA 4Y1AD 1HH9B 1XF2B 3ARDD 3PWPA 1I1CA 2BX5A 5L6YH 4YDJA 1E4KA 3QUYA 3D69A 2PO6D 3B5HA 1AGEA 3CUPA 3UJTL 3ULUE 3HTLX 3VFUB 5LAXA 3WNKA 1J12A 3MV01 4N0YL 2QHRH 3SKOA 5IB4B 3HC3H 4ZOBA 4V1DE 2FGZA 1ZWIA 2JK5A 1SM3L 3T65B 4LCIL 3KAAA 4PJBB 5F7EL 2VXUH 2EH7H 3H3BC 3L5WA 4M6OL 2IC2A 2IMMA 3DRQB 4JM2F 3P4OA 4ZUUB 3MRMB 3RDTA 4PJGF 4HGKC 5DJZA 1JUFB 5GRUL 2FATL 1U95A 4G9DA 3P77A 1KPVB 1A7RH 1YEHL 2D03L 1BJ8A 4OBSA 3TNMA 1UGNA 3NA9H 3VRLF 1YYML 2UWEF 4K71B 5FDWA 2C4FU 5ISZD 4ZPTA 5I6XB 4PRHD 5AZEH 1DBML 3IFNL 1A0QL 5CWSB 3BZ4A 3SE4A 1MFAH 4Z7WF 1XZ0A 2YA2A 4OFDA 5CJQH 3C5SB 3TO4D 5E8DL 3RNKB 4D0CA 1IGCL 4R8WL 4ZOCA 1EHNA 1CDGA 3FO9A 2YA1A 3Q2CA 2R8SL 1WIOA 4P9HH 3O6FC 1CVRA 3L3KA 5A3ID 1QUNA 3BW9A 1LE9A 1BIIA 3OB0K 2P43B 3RWGA 4NQCE 4N68A 5IBLD 3ZZ1A 4H88L 4N5EC 5IOPB 2IADA 4LFHG 2UZYB 4JRYA 2VDQL 2NW3B 4OF6A 4UTBL 2Z91B 2IF7A 5AG9A 2Y06H 3MOAH 1A6WL 1ZLUK 1KIQB 1CFTB 1RIVH 2OMNA 3ARBB 1P69B 4LVNC 1UEMA 3ERYA 3MV8A 5E9DB 1FHGA 2OL3H 3QYCA 4KMTH 3BWUC 1QSZA 4OFVA 1KB9K 4RMTA 5K33A 1UEYA 4P5KA 3O6LL 3MLWH 4L9LC 4LPUA 3UDWA 4CVUA 5DJYB 4UDUB 5D6DA 4S0TD 1P7HL 3VI4E 1HYSC 2V2XB 4XVJH 4Y4KB 1A4JA 2VLLB 3BIKA 5HHQA 5F3BA 4P2RD 3WJJC 4HQQH 3VI3F 1OP9A 1ZLVH 4O2CA 1OP3H 3DX9A 4ODWA 2G60H 3V5DA 1P4BL 3CH1A 1ED3A 4R4BB 4XC1L 4PJXE 4X4ME 3U30B 3QEQE 3QEQA 3QZWB 5C0AA 1ZEAL 5C0BD 2QSTA 1CXHA 3VWJA 2DQUH 1MCKA 5F6IB 4OLZL 3LRHA 1NDMB 4AEHL 1L7IH 5FO9B 1EPFA 1PW3A 1LP9A 4Q74A 4S2SB 1N6QH 4N8VA 4Z0XB 4NWTL 5D1QD 4NWUL 1SVCP 3CDYA 2FWOB 4G8FA 3RPKA 5EUOA 3ZKMC 3MBEB 4ZFOB 4I13B 4WGVB 5L2KA 3WDJA 2O5ZH 4KK9D 2Q87A 4U7KA 4RBPK 2ADIB 4KRMB 3G6JB 4P3DB 1S7QB 4J4PD 5EUOE 3RHWF 5EZJB 4YGAB 2QQKH 2CUHA 2EE3A 3NA9L 2KL6A 4JZOB 2MFNA 5D2LB 3Q3GA 4HCRA 3NIDF 2NR6C 1XIWD 5FOJA 4H8WH 1FGVH 1FFPA 5E8NA 5C8JA 4GG6A 5ADPH 2VUYA 4Y5XB 5JXEA 4JO2H 4YLQT 4P2QE 4BSVB 5KVGH 3MROA 3U7YH 1IC4L 5C86A 4YXKH 4GAYB 4IMLA 3TPKA 1JCKA 4J7RA 4GJTB 2XKSA 3LAFA 4XNXH 3BP7A 2CK2A 4ESKA 4JFHE 4TNWK 4UB0H 3V0WL 5CEXA 2NXZB 3NZHL 4JN2B 4K7PL 3SGKA 1DCLA 4LCCA 1KCRH 1VGEL 2BVEA 5IQ9A 1HI6B 4MA8L 4HMCA 5JW4N 1OTTD 4PJGE 5GGVH 5DMIH 1IARB 1X4XA 3RWCB 3V0AC 4PTTB 5FECA 2EE9A 4I3SL 4KMTL 4PP1C 5AZ2L 3O6LH 1JI1A 3PGDA 4F58H 3ARYA 1LQSR 3DURB 1D9KD 4X7FC 1RK0B 5E7BA 3CVHB 3LZFL 1UJ3C 3IDXL 5EO1B 3KDMA 3GMQA 4MXQD 5L0QC 1A7BA 4FXGA 4G6KH 4HQQL 4YWGL 3VGHA 3O2WL 4NT6B 2G60L 2XY1A 2HLAB 4OQTL 3PHSA 5SX5K 5GGRA 4OQTA 1XCTB 1ZEAH 1MEXL 3K3QA 1WAAA 5C0IA 1TTUA 3S88L 3ARFC 1EHLL 3TBWB 4MMZC 2P5WD 1EO5A 2H6PA 3PWUA 2HFTA 4P9ML 1NGZA 4OF5A 3N1QC 2DOCA 3G6JE 3ZKNC 4HG4J 5CZVH 1M6OB 5IK3B 3ROLB 2GJJA 2DLHA 3MJ7A 1GGCH 2BNRD 1EXUB 3ARWA 3JWOC 5D7JB 3A67L 1N6VA 1S3KL 4OD1L 1NGXA 5AG8A 2VXQL 1MCOL 5DJ2A 2DD8L 3QJHA 1E4XI 3VXOA 4WW2C 4JG0L 4RISL 4JREB 3UBXI 4PJXF 2HH0L 4X6DF 3LN5B 1T89A 3QIUA 4KKLC 5BV7B 4C83B 1GPOL 3ARVA 5ADPL 1Q9WB 3VRIB 3NPSB 3GMNB 2ENSA 1IC4H 5GGSB 4YXKL 4PJGB 3E3QA 1RIHH 2EIEA 2PW1B 4M93C 3EW3B 5C2UB 4P4RB 3EYQD 5D7LA 3TZVA 4ZSOA 1QLEL 4HWEL 3E6FA 4I18A 5I1GH 1N5YL 3Q48A 3V0WH 3DETC 3RBSA 1T5WB 1J0YA 5DZLA 2J8OA 3S36L 1OAXH 1S7TA 2FH6A 2V2WA 5HYIA 2VE6B 4FTVA 1CFVH 4Z9KB 2DQFB 1GGBH 4Q9QH 1BEYH 5AZ2H 4DUWA 1QVOA 4ZO9A 3FQXB 5KVFL 1IMHC 3MLUH 2A73B 1X5JA 1DJSA 2VAAB 3KLDA 5T5NG 3ZTNL 1IQWH 3IFOB 5JA8B 4P5MB 1EA9C 3N06B 1HHGB 4IOFC 3ALPA 2JJSA 3RWFB 1BX2A 3JV4A 2AKRB 4HS8L 3BHBA 3BYYA 4PV9B 2DQGH 4HX1B 3QCUH 4MJ4A 3R8BB 4NIKB 3X13A 3DX7A 2X1XR 4YPGB 5LGKA 5ISZA 2IPKB 5IVOA 3CK0H 2J12B 4LLMA 3IXTB 3VWJD 5DVOA 1I8MA 1WFNA 4UMGA 1E4WH 2F54D 4PB9H 3L5XH 1URLA 2E3VA 3KPMB 3THMH 4PGCA 2GSGB 5CZVL 2YD7A 2VQTA 5EU6B 4MS8A 4HUUB 2A6JA 4P2RA 3SCMB 3TO2A 3DUUB 2DN7A 3IS0X 1GGCL 3L3JA 3TWCH 3DBXA 4LGRB 1INDH 1JNJA 1DBBH 1X5ZA 2EZ0C 4YFEA 4UT7H 1XR8B 2X4UB 4YZFF 4HUKB 3EIFA 4RISH 4ZAKC 1CT8A 1LO3H 1CU4L 1MCQA 4D3CL 1QFUL 5DK0A 4MDIA 5FUOL 2HVKB 5EIQA 3FOMA 2ZZUT 2NR6D 1JHLL 1OLZA 2P5ED 2GTWB 5IF0A 5EZLA 4XXDA 4H25B 4CDGC 1FV1B 5IKCA 2NY5C 5KZCD 5D5MB 3L7FA 3O3EB 5ESQB 4JFYB 3UEZA 2APBA 2BJML 2A77H 3VFVB 3RFZC 5FV2A 4OZHF 5HI3C 1OB1A 3O8XA 4HWEH 1UM5L 3G6AA 1P5UA 4NM8L 5E6YA 3RWDA 4WWKA 3RPIB 4YHPB 4QHKI 1KXQE 3VA2C 4NC2B 3A6BL 1OVZA 4WHYG 5L0QB 4YXHH 1G6RB 3VCLA 1Q94A 3GO1L 2FO4A 2F5BL 3VD5A 2PXYB 3UAJC 4S0SD 3VXUE 4FQQA 2ZCHH 3DI2B 4QT5B 1HQRA 1X4YA 1ND0A 4J8RB 4PJDB 4P5TA 3ILPA 5DGRA 2NY5L 5KVFH 5IB2A 2ZUSA 3ARDB 5I0ZA 5C08B 1FAIL 4HPYH 2DYPD 4ZQKA 4MVBC 5F1OB 4I48A 1BZ7A 1BWMA 1IGML 4Y2DB 3SDDB 4HS8H 4JZNA 1YECL 3BT2H 4AQOA 5D2LF 1KJMA 1JZ4A 4JQXC 4PJ9D 5CZXD 1A14H 1QR4A 4JN1L 1T83A 4NZTH 3JWDL 4IM8A 4PBWD 5KSBA 1B4RA 2R29H 1DSFL 4KJPC 5DJ0A 3F7VB 3L5XL 4NNPH 4WW2F 4PJAF 3IFPB 3CFBB 2CKBH 4XPAL 3S8WA 3B3IB 4DFIA 2F58H 4ZOAA 2ADGA 4PGJA 5AAWA 3VGAC 4G7YH 3MXWL 4XHJC 4U6YB 5FF6A 1D5BB 1N2RB 2D0GA 1T22B 2BY2A 2ZCKH 5HGDA 4XNQB 3UP1A 1N7MH 5TE4H 2NY2C 5ACZA 1EUTA 1B2WH 1ZSDA 2GK0B 4OF8A 3OX8A 3SCMC 1QO3B 2QR0A 2VH5H 4N8CL 3KPSB 4K7FA 3PIQA 1WV7T 1JYNA 2V5TA 3U0TA 4F9LA 2B1AH 4BFGA 4YX2H 3V7AG 5J89A 2W0LA 2R1WB 3MLSH 5GSRA 3U2SB 3QCVL 3T0BA 3MRJB 2A9ML 4H20L 4XZUA 5IT2H 3G6DL 1S9KC 3TJEL 1E6JL 1IC7L 4XNZB 2VDOL 4AEIL 1YUHB 2FSEA 5F71A 5CIPA 3RY4A 1ZT7A 1KIUA 1T2JA 3VXSA 5BZDB 4I5BA 2Y6SC 1EFQA 1J05A 1F3JB 3RVXD 1S7XA 1R0AL 3VXUB 3FFDB 3PWVA 1UXWB 4ZUVB 2OTUB 5LQBL 4OLUH 1IGYA 1QFPA 2D2OA 5GSVB 1AR1C 4HK3J 5BW7C 1F11B 4OD2A 3A6BH 3TBYB 5IEHB 15C8L 5JQHC 4QYOA 1I7TA 1TFHA 4GUPA 2XTJE 3TPUA 4RAUA 2ZCHL 3MYJA 4U1NB 4E0RA 5ENWB 4OZFB 5F6HI 4AM0B 4LOUC 1OT2A 3OAZK 1AGDA 3HUJA 5E6ZA 4FS0A 2J1KA 3CXHK 1BVZA 4KHXH 1G0YR 3B5TA 4K3EL 1MF2L 5EBLA 5FYKD 4OUUA 4NDMB 3OKLB 1T03L 2DYPA 1FZJA 2H8PA 3V6FB 3BZEB 4LAQH 3GIVB 1LDSA 3DSFL 4H0HB 4NCC1 4FP8L 1R3IL 1QBMH 1IT9H 4IOFD 3LN9A 5F7KC 4ISVB 3H9ZA 1ORSA 2BVQA 1JGVL 1FRGH 1C12B 4POUB 4KJYB 3D85D 2YZ8A 3PV6B 1VFAA 2K7QA 3FQWA 3G5VA 3HB3C 4GQPH 1DLHA 3PGCA 1DSFH 3Q6FB 1YNLH 2G5RA 1BMGA 3DARA 4X4YB 3CXDL 2F58L 2BCKA 1NEZB 2Q76A 2EYTB 3FO2B 3I6GA 4TRPL 2DL2A 1S7RB 4DN3L 3MLXL 4KDWA 4PDCE 4UV4H 4XP4L 4MD4B 2OK0L 4U31A 4Y7MA 5E8OB 3BD5A 3I50L 3TEUA 3RIFK 5IW3A 5DFWH 5HGHB 2GJ6A 2VH5L 5DO2C 2HJLA 1I4FB 4M61B 5IJKA 1VADB 1ZHLB 3D2UB 3T08A 5KBNC 3BXNB 1MCNA 3NA4A 3ZE2F 4MLIA 5L9DH 1GAFL 4LP4A 4PD4J 5SWSE 1I7UA 3JV6A 3QCVH 4J3XA 3B6SB 4NKMA 4ZFFA 3FQRA 3HCVA 5A16B 2P24B 1CL7L 1JZ8A 2KKQA 1NMBL 3GI8L 1RZIB 4B7IA 5C0GA 5T1LD 4WU7A 5KANI 2WANA 4MNHA 3NFPA 1BVKB 1ZHNA 3S4SB 5IB1B 1DE4B 2F9BT 4WEUD 4YUEL 2P8LB 4U1LB 1RUKH 2GT9A 4DKAA 2BC4B 4HEPG 3KJ4C 3U6RA 2FEDC 3L3OA 4WW2B 5TGBA 4X4XB 3QH3A 2Y36L 1DBAL 1U8PB 3VD3A 1HHKB 1RI8A 5B4MD 1V7NL 1NC2B 2VLJE 4P2QA 2X4NA 2QSVA 3ARGD 1JN6A 4X7SL 2V5MA 3IJHB 3EYFA 2QADB 3HUJE 5DJ6B 5JW5B 2D31B 1U8JB 2Y25A 1C8PA 1U8NA 1D9KA 2VL4A 3VFNB 3ARUA 5KS9B 4WW1B 2O61A 1Z3GL 1DQJA 4EI5D 3ARBD 2YA0A 4MAYB 4Y5YA 2MHAB 3GKWL 5IQ7H 3LDBB 2M1KA 1S7WA 4LNRB 3N0PB 3P0VL 2XI9A 4GG8A 4LVOC 4R97B 4QRUB 1CS6A 5I74B 3BKCH 1MFBL 4HFUH 3KWWB 2FX7L 4OAWB 4RA0C 5DMGC 2X1QA 4Q6YA 5I8CB 5JXAL 3EOYG 1KIRB 2BNQE 3OAYK 4X5XA 3MGOA 5CKAA 1UB5A 4NQSA 3ES6A 4DN3H 1Q0XL 4GLRI 3PDOA 2EIBA 1B90A 3ZYJA 2H9GA 5TH2A 3TZVD 4QXTB 4KQ3L 2ADFH 1OF2B 4K23L 2NNAA 2X4QB 1Q72H 2Z4QB 3FT2A 3GHBH 2ESVB 1SEBB 3BKJH 1D6VH 2IBBA 3SCMD 3PWNB 3S37H 4PP2B 5I2IB 1C08B 4P3CL 3QNYA 4X6CB 3MOBH 4K94C 4E41A 1XF5B 3DSNA 5TDNB 1A47A 3W9EB 1UVQA 1IBGL 2IBZY 1ZVSA 1JPSL 2X4PB 1EEZA 2MTPA 4G9FD 4QTHA 1P4LA 4YHIA 5JO5B 5LWYL 3RVVC 1F4WH 5JLZB 5DD3L 2JTDA 4GW5A 1M05B 3RVXC 2GY5A 1C5BL 2HYMA 1YQ2A 1P84K 5KSAD 1KPUB 1A6ZA 2E7LA 2NY1D 3MXVH 3L3IA 4FXKA 2Y7QA 4ZG1A 1AR1D 5EU6D 2PYEB 5C0BA 5HI5D 5TQ0H 4DEPC 1JTOA 3R0NA 5C0JB 4WI9A 4BKLB 1L7TL 5C6PB 1I9RL 1N26A 2H2SC 3FT3A 5C2BL 3RJDA 3VRLE 4OZIA 2HJKA 2BVOB 4JZJC 1KULA 4XP1L 3BE1L 5IFAH 1CGTA 1EX0A 3JTTB 2BERA 4MA1C 3RGVB 3ULUH 5T1LA 5FO8A 1NGQL 1EJ6A 2XZQH 4P4KC 5EN2A 4MXQA 1F3DH 3VXRB 2AXJA 4NJAH 2BNQB 2CIKA 2JCCE 4H1LA 1U8LA 4JY6A 3VH8A 1MFBH 3LMJL 1A7OH 3JTCA 3D39D 1I7ZB 3LEVL 2BNQD 3HE7A 1MIMH 1MWAH 3T77A 2WBWB 3HAEA 4K8RC 5DMKA 2FRGP 3HNVL 4FFEX 1GRWA 4GW4B 4Q7DA 4Y4HD 1A4KA 1TPXC 5JHDE 3AS1A 4LSQH 5HVHC 1J86A 3HMWH 4JGUA 5FYJD 3CZFB 4R7DA 4DKEL 3ARFB 3QQ3A 3VDBA 4K23H 2HT3D 4JPIA 4LRIC 3SEPA 4QWWD 4OLVL 2CGRL 1R3LA 1MQKH 5CJ8A 2EDTA 1T04B 3HMXL 1CGYA 3P9MA 3RQ3A 5C9JA 3UJJH 4EXPX 4ZTPH 5B8CA 4X7CC 1A9EA 1WF5A 3K0WA 5DD0L 4ZUWA 4X6DB 3KPOB 4P3CH 1AXSB 1AD9A 3RL1B 3RRQA 1TVHB 2BNRB 5C07B 2QSQA 4U7SA 3C08L 2Z92A 1X5HA 1I1AA 1UKSA 1Y6MR 3TIEA 3WCYA 5FYLE 2MNUA 3AXLA 2QHRL 2OSLA 5E4EC 2AV1B 3DWTA 5T1MA 4PRHB 1N0LA 1SM3H 1JPSH 1T2XA 3C5ZA 1S8DB 2MQ0A 5D2NE 5F7EH 2Q8BH 1G0XA 5L2KE 4OZHB 4JJHA 8FABA 4RMSA 4WHTA 2JCCA 4OCWL 1FFQA 2ZNWA 1T7WA 3MMEB 3U7WH 2E7HA 3ARPA 3ARXA 5D1QA 4Y5XC 1RUQH 3QUYD 4GQ9L 3ZDXE 2P47B 4JFOB 5DRZB 1FN4A 1L7TH 2IALB 1ETZB 1CFBA 2IH3B 5AZEL 3SY0B 5I30L 2E7CA 5DD1H 2YRZA 1FZMB 5E8DH 5C0CD 3ZHDA 3T0VA 4PJFF 1T1XB 4JHZA 2W65B 3LIZH 3ULUL 1RZJH 1J9CT 1G9NH 1KN4H 2XWBA 3H9YA 1CXLA 2LAAA 1W0WA 1RVFH 4N90D 3PJSA 5HPMB 2MCPL 5EC2A 2E27H 1T0PB 1VEOA 3QXAB 1H3TA 3KR3H 4P4KB 5CSZB 3G5XB 1R5WB 3MRPB 1A7NH 4KRPD 4OV5B 2Y06L 3LEVH 1BZ9A 1Q38A 5CEZL 4CN4A 2WQ8A 1CGSH 1RUAH 4WI7A 3QUXC 4HKBB 3TBSA 4XT1C 5FUZL 4RGOH 4XVJL 1IAIL 1LP9E 3D85B 3HNTH 2VB5A 2ZUYA 3T4AB 3VXTB 4PJIB 3C8DA 2A6DA 3QCTL 4DTGL 2CGRH 3IDNA 1KG0B 5IWLC 2IANE 4J6RH 1TTGA 1IJ9A 4YNYB 2YPKA 3UYRH 4ZTPL 3QEHA 3BD3A 4BSJA 2YWYA 4MJ5B 4R90L 1KLUB 3OKYA 3SDXE 1XF4B 4RFEA 5F1IB 1DL7H 3CNKA 2UZIL 1AO7E 5IEKA 2XQYG 3KPQB 5IG7B 4DK6A 2YUZA 4ZNCD 2BXZA 5JOFA 1PZ5A 1LO5B 2DAVA 1FNFA 1G9EA 5C0EA 2BOBB 4AH2A 1UYWH 2HLFC 4OBRA 1FL3A 1U36A 3HI1A 1FZKA 5F9JB 2Q7YB 4PRAA 5EWIL 3KNBB 5D7LE 1I1YA 4RMUA 1VPOH 2G9HA 4XNYL 5I1KL 1XFPA 4U0RC 1VACB 4KHTH 1NAKL 1AE6H 5EO9B 4WENB 1F6AA 3BDBA 3U4EA 4GQ9H 4QRPB 1N8ZA 2QQKL 3NZ8A 3QFDA 2HRLA 1MHEB 3S98A 4RMQA 5F93C 1MAKA 2XKNA 5ABDE 2ARJA 1WLHA 5FGCB 3T2PA 1IAKB 2GUOA 3PF2A 4WWKD 3VRJB 2COQA 1QFWM 4JO2L 1RJZA 2BP3A 2PR4H 5E2JA 3O2DH 5LJYH 3OWEA 1J0ZA 4PG2C 3QDME 3FJTA 5DRWA 3RJQB 2B7DT 4PPTA 1GC1C 1W8OA 3UO1H 1NLBL 5KVMC 4UB0L 1AHWA 1D5ZB 3KR3L 4UIMB 5DZNA 5MERA 4L8SA 3AVEA 4R26H 2NY3B 3AY4C 1ZHBB 3OKDA 3OZ9L 5T1MB 1E28B 5K93A 2WWKO 4XVUD 1YN6B 5ESVA 4B50A 5HD8D 2ZUQC 1GHFL 1D7FA 3T4YB 4NP4H 1HHJB 4HKZB 4JFEE 1NEUA 4M62H 1JF1B 4X8XA 3CX5K 3ABZA 1FNGB 1JNLL 3LPWA 5ICXA 3NFNA 1K6QH 1M7IA 2DL9A 3IDXH 1FVCA 3QA3B 1TXKA 4R7NA 1ES0B 3ZYZA 4YWGH 1WCBA 3QAZB 3X3GH 4DTGH 2CKNA 3MBXL 5HDBF 4QCIB 4M3KB 3EYUL 3TNNB 2EYSB 3V9FA 4IDJL 2C7UA 1SJEA 1MJ7H 3DNKA 4M02A 4HLJA 1WBXA 5BS0D 2I27N 1F4AA 3IFLH 2YD5A 3QIWC 5E6IC 2P7TA 3WBDA 2ZCLH 3HE7C 1YEJL 2HTKC 1HNGA 3ESVF 4LQFL 3UC0H 2W9EH 3WIHH 3FL7A 4PR5B 5D7JC 3LKSA 1RJLB 1U3HB 2A6KB 4ETQA 3IB4A 3HE7B 4U05A 5TE7H 4HKXB 2CR6A 3RWHB 3MNZA 1CK0H 2D9CA 5EWIH 4KMQA 2XACC 2GHWB 4K7PX 1JWSA 5I1KH 1G7IB 1NCBL 2ZKHH 3BJ91 3BISA 4Q9RH 5ITBL 4KHTL 4R0LC 3STLA 5TF1H 3KJ4B 4JFZL 5C71A 1TVBA 2A1WL 3C2AL 4NKOA 4U3XA 3RAJH 4FTVD 3GBLA 3FFCD 2ZOLB 3MCKA 4JM2A 1JVKA 3BZFB 1RZKC 4AENB 1M71B 1U8HA 3WLBA 3VGEA 3QDGE 1T1ZB 1A1NA 4YDKH 1J8HD 1YY8A 3FMGL 1UENA 5BOZG 4YAQA 3O2DL 5HYQA 3QUXB 4WJ5B 5C0BB 2F5AL 2Q86A 1OSPL 3M1BB 1U92B 1H15B 5BMFL 4KVCH 3B9KD 3MTRA 4AG4L 5I1GL 2VLJB 4HS3A 1UH4A 3UYOD 4JHAH 3QIUD 1A22B 3EJYC 3GEWB 2V9RA 3LY6A 3QQ4A 3JV5A 4KK5C 5IBUB 4MNGB 5LCVL 3WIHA 2R2HB 5FA4A 5I74C 3RWIA 2VLJD 3HLAA 4Q6IB 1OGAE 2GAZB 4N90E 5B3JE 5HHNA 3DHMA 4RRPA 4P2OA 4NP4L 4WI2A 4UNUA 3K46A 4X6EA 1NMCB 2VDKL 5IMKA 3OKMB 1JNLH 3CPLA 2ICEA 2GTZA 4NQCD 5AYUH 2V6HA 2R2BA 3AC0A 1WSST 1LEKB 1BLNA 4ZS6C 4HCRH 2R2EB 4XP5H 3OAUL 4KTEH 5D1XA 5HVFB 1ZK9A 4MXVF 5FGBC 3ARRA 2OI9C 3MV7E 4WNQB 4TVPD 4HULB 5HYFA 1FNEB 1DZBA 2QSCL 5E24E 3D5OF 5CJ5A 4YR6B 4Z7UB 2P44B 3NCYP 5IJKC 5A2FA 4PJEA 4BQ6A 3MGOB 3VXRD 4H1LH 3TVMD 2W9EL 4IBLT 5HHVH 1TLKA 2GI7A 4X6BA 1A6TB 4MNGA 6FABH 3MYZA 1Z5LA 3QQ4B 3BUYA 4FFYH 2OTWA 4UOJA 4FQ2L 2IH1B 4JY5L 1MREH 3E6HA 2BHYA 4AIZA 2MPAL 1INDL 1I3RB 4N0UB 2CKBB 4EVNA 2XFXB 3CFIC 4PGEA 3HE6A 5ALBL 3VFPA 4R96B 5DLML 5KS9A 1LO3L 5GGTL 1U3JA 4M4PA 1ACZA 1J5OL 2FJFB 3MRCA 1JWMB 1ZE3C 3H9HB 3I3BA 3IU4H 1KCLA 5JW5A 4BM7A 1WQVT 1U3HD 4G43A 4L3ED 3IJHA 1PJ9A 2H32H 1JZ3A 3CFJA 1MJUL 1RHHA 1UM4L 4P23D 2W07A 3QRGH 4DZ8A 4P2QB 1NC2A 2BVUA 1RHHB 3TCLB 2BY1A 2F5AH 2OI9A 3BPOB 1G7QA 4IRJA 1NC2D 5AAMA 5BMFH 4TULL 4G8IA 1CGVA 2PYEE 4N0CA 2PTUA 4DVRL 1OAQH 2PXYC 4JCMA 3RVUD 4XH2B 5LG1A 2ZSVA 2J5LB 1U3HA 2A6KA 4ETQB 1N59B 1B0GA 1EFXB 4KTYA 4YHLH 2ATPA 3HS0B 5D70H 5F89B 5MENA 5IVXB 4UQ2A 2MSPA 3SOBL 5JHDD 1BZQK 1I3RA 4N0UA 2E9BA 4S1DC 2M8XA 3FAWA 3E6HB 5DUML 3AS3A 1QHPA 4IMKA 1J10A 2WY3A 1KSRA 4OLXH 2YPVH 2N4IA 4FZ8H 3GMOB 3IXAA 2DWDB 2IG2H 4HPYL 4LCWE 5BJTA 3BUTA 4ONHA 3T09A 2ICWA 3QI9B 3PXHA 4CMMB 3WFBH 5IW6B 2C5DC 4NQED 1U91B 4R7NB 4X83A 3U9UB 1I4FA 4M61A 2UWEE 4N0FB 2VXSH 1GZPB 3WFHB 5HGAB 2FL5B 3UYPA 1JYWA 3NN8A 2EC9U 1A14L 4LEXH 4I0PD 4OT1L 5TDPB 1B88A 5FYKL 4LVHB 3GSXA 4KJWC 4Z8FL 4XAKE 3EHBC 1MNUH 3GSQB 3LRSB 2HTLD 3QHZH 5HYSB 3S96B 2FR4A 1NGYA 4HF5H 1XF3A 2DQJH 2P46B 4BJLA 1INEH 3NIFE 4ISVA 3EDDA 1EEYA 1CXIA 5ALBH 5IFJB 2BFVL 1JHTA 1EMTL 3BESR 2B0SL 5EBLB 4OCRH 2VLJA 2W92A 1F90L 3TVMB 2FCBA 3SBWC 1WK0A 3JZ7A 1XGPB 2A9MH 4H20H 5D7IB 1H15A 5GZND 4PS4H 1DQDL 3AFLA 4NO2B 1ORQA 1GGYA 2C4FT 4JKKA 2YBRA 4MAUL 1SY6L 3QIWA 3VI3E 1MJUH 1QRNB 5KSAB 4ZODA 3QRGL 1DQMH 5EU3A 1F6AB 1DVFA 1SY6A 1WICA 4Y89A 3D18A 1I7TB 3OJDA 5HHPB 1T1WB 4NQTA 2R56L 5LQBH 4OLUL 3CDFA 2A0LD 3HKFA 1QA9A 2Q7YA 1XGYL 3M8OH 2V17L 1ADQL 4NKOB 1DR9A 1TVBB 1R3JB 1F2QA 3LSOA 4YIQB 5C0EB 2EDYA 4LARH 2OR8A 1P7QB 3MV7A 4ODTH 5EBMB 1HXMA 2CDGB 2CLVA 1XGRB 4LLQA 4P23B 3O8XC 3PP3K 4FFZH 5D71H 4HJJL 1CF8H 1WWWX 3GSNB 4OCXH 3RDTD 4C59B 3BMVA 1LO2H 3CVIL 1VESA 3RNQA 4O5LL 1AXTL 1IC1A 1MF2H 3OTTA 3X12B 4AT6B 3ARDC 1T03H 5INCA 1WZMA 1Z0NA 1XR9B 2IAMB 4D9LL 2Z31D 2J6EH 1R3IH 1H3PH 3EFFA 5IB5A 4O58H 4CVZB 3I9GH 4X80L 2P5EB 4OTXL 4MQ7B 1T22A 5HGDB 1TPXB 3O3DA 4LBEA 4OKDA 1D5BA 1N2RA 3P9LA 4YK4B 2BMKB 2JELH 1WCBB 4P3WA 1FO0H 1NGWA 5IB3A 1JF5A 4HIHB 4F7EA 3F7VA 1DUYB 3L3GB 1WBYB 3LH2L 2EDOA 3P4LA 1OARH 4U1JA 5I1IL 2L0DA 3RTQA 3B2VH 3QDGA 1AQDA 3CCHA 3MJ9H 4XP4H 2DQJL 1QSEB 1KJMB 5DQ9B 4F3FB 2NY4B 4ZO6A 4LPVA 32C2B 3IS1X 1MH5B 1RUMH 3MJ8B 4Q2ZA 1KBGH 4LGSB 2I60H 4WTZA 4LLDA 5DEGB 4C4KT 1EMTH 1QSED 4F33B 3GMRB 2B0SH 4OCRL 3KS0H 2F54E 4IOSD 3H0TB 5F9OH 4RIRA 4X9GA 3SE8H 2YOCA 2EE6A 1S9WA 5DSCB 2DI9A 3BPLC 4YEEA 1CICC 4PJ9C 5CZXC 1F45A 2C4XA 4M6MH 4F57H 4F7TB 2KQNA 43C9A 5A3IC 3DMMD 3FZUD 1MIEH 4TNVF 4LGPB 4WUUD 5CJXC 4NUGH 4FG6C 4N0CC 1DFBH 5DD5H 5MEPA 3EYVA 4V1DB 3GMRA 4MGXA 2R56H 2FD6L 3MRIB 5FKPA 4ELMF 4PJBE 2IQ9H 3VFSB 5CUSH 3RWDB 1UQSB 1NUDA 2V17H 4GRWH 2FX9H 3ZSTA 1NC4B 1T1WA 4NQXA 5C0NC 1MAJA 4RGMB 2AV1A 2R1XB 3PABA 1CN4A 5BS0E 4LARL 4AYFA 2UZXB 5HHMB 1RZFL 1AQDB 3CCHB 5HGGS 4PJCE 4QO1A 2NY3C 3WEXB 5IKCB 5AEAA 3T0EA 2AEPL 3VXME 4U1GB 3C8KB 4PGDB 2CJUL 5D71L 4FQIH 2ZUQB 1CF8L 4R3SB 5B8CB 2J5LC 3EOTH 4G42A 2PTTB 4AH2B 1U6AL 2ICWI 3O4OC 1AXTH 1JJUA 3VJ6A 3UTTD 1Z3GH 1S7SB 1FLTX 4HUWA 2HVJA 5D7SH 3Q5TA 4KK6D 2ERJB 3CFCL 3WHXB 3WSQL 5IQ7L 1H3PL 1XR9A 2IAMA 3KHQA 1A3QA 3QEHB 2AVGA 4JPVH 4QOKD 5H2BB 4L4VA 1Y6NR 5E5MB 1NANH 3LRSA 2A6JB 4P2RB 3DETD 2JELL 4ZXBA 5DVMA 1BGXH 1V3KA 3IKKA 5F1SA 5F96L 4XRCA 1QPXA 4N9OB 4G3YH 4NUJA 4OJFL 2MOVA 1MHHA 2I9LB 2G5BB 4U6VL 1K2DA 2R0WH 3QQNA 4MX7B 1FDLL 5D1QC 3EHBD 1D5XA 5T5NF 5TPWH 3V79C 1QOKA 3RVWD 4N1HB 4N0FA 4X9BA 5I19L 2EO9A 1JZ7A 3U9UA 1DTUA 1KBGL 3JWNC 3UJIH 3WJLA 2NY0C 3FB6B 5CSZA 5IUSA 2X9WA 3B2UC 3GSVA 3MLVH 4GRLB 1XGQB 5KW9H 5DD6B 2AAVA 3O81A 3MOBL 5FO7B 3VGGA 4BKLA 1G1YA 4WDIA 4Z77A 2PYEA 2Y4SA 2X70B 1KPUA 4NUGL 3RA7L 4OB5L 4PJCB 3D2UD 4A2MA 2AQ1A 4K3DL 4S1QH 2NXYC 1EEYB 3QDMA 5FYJU 1XF3B 5ACMA 1QD0A 3D1MC 2BSED 5KVDL 1KJ2L 2DKMA 1A6UL 4MZ2A 3QEGH 4JRXA 4S1RL 3WKMH 4EQ2A 3VRIA 1EGJA 4CN1A 1MI5D 3X11A 2VZUA 4MA1B 2CJUH 4LL9A 4YHMH 5T3XL 2XRAH 4UZGA 3DTXB 1KCSL 4LDEB 3SGJA 3IDIB 4G6JH 3P73B 1EAJA 4OD3L 4RGNB 4NQEE 3GJFK 2NNAB 4OLYH 4DUXA 1PKQB 2ZUVA 3VWKB 4MXQC 2H9GB 3NAAH 4S11A 5EU4B 1X5IA 2ORBL 3BQUC 1G7LA 1AC0A 2CKBA 5EOQH 4EVNB 4Z95L 2ICCA 4JHWL 2ICWB 3QI9A 5BO1L 1A7OL 2Y5TA 2AXGA 5C6TL 1M4KA 4FQXA 1I8KA 3GGWA 5F96H 2D7QA 4CU8A 3ARFA 3QQ3B 4JDVB 1Y0LB 1NGZB 3CZJA 4RAVB 5CGYC 3WYRA 2LE9A 1MFEH 5HYJA 4CMHB 4YR6A 1B4JL 2NCMA 2HG5B 2GEEA 3OKEA 4QKXB 5TPWL 1K5NB 1GH7A 1LP9F 4OLVH 1FYTB 5EC1B 1UZ6F 2HLAA 3MA9H 3TT3H 3VMPA 2OMBA 1HXYA 3REWA 1OAUL 4HPOH 3CVHA 2YPLE 5JW4R 3CPLB 1RK0A 5DQJB 3X11B 3CVHL 4UUJB 3U4AA 3IDUA 3TF7A 4IRZL 3CC5A 5C09E 5E1AA 4WEBL 2WUBL 5B39A 4GXVL 5TGBB 3W11D 4PTTA 3S34L 4ZFGL