4HUVA

Crystal structure of h2db-npm6w
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Preemptive priming readily overcomes structure-based mechanisms of virus escape.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 275
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4huvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4huvA01
5DQDH 5ISZA 4PTTA 2ESVE 2IH3A 3JZ7A 2D2OA 2DJSA 3EOTH 1BVKB 1KC5L 2VZ3A 3L3JB 1A6TA 3I85A 1IKFH 3D85B 3KYMB 3S4SG 2CJUL 4YWGL 1DUYA 5IEKA 4LASL 5J06A 1QACA 3PGDB 4TVPE 5IB4A 3LKNA 4PJ7F 1SY6A 3U6RB 2X4NB 1VESA 2R0ZH 4JFXB 5DMGD 5C0AB 1EHLH 4OFYA 2W65A 5DD3L 3BIKA 3IDNA 3DGGA 5J89A 3EJZD 4U1GB 4OZGA 3JWOH 1YNKL 3QDME 1CLZL 3OGCA 4GAYA 2C4FU 1URLA 3MA9L 4XPAL 1G1CA 3C5ZA 4GAGH 3GMPB 1NH6A 1FPTH 2H8PA 3PQYB 5HDQL 1G7MA 3MLYH 2WP3T 5GGRY 2YN3A 3TBWA 4MHHG 2W9LA 2YC1B 3LQAH 3HMXL 1G7PA 3K2MC 5DJCB 4JFEB 3PGFL 4LQFL 4LOUD 4TQEL 3X17A 1K4CB 1B2WH 2AK1L 1QNZL 3E8UH 3MV9D 5CSGA 1NMBH 5JQ6H 3DSNA 4NDMB 1BFOB 5H2BB 2RR3A 1LO2L 4L3EB 1SHMA 5TPWL 4OQTH 5JHDE 3WE6B 4MS8A 3TV3L 1BGXH 4NOBA 3PABB 5SWSB 4JGJA 3UBXI 1K3ZA 2CGRH 3MRLB 3HE6C 5IVZA 2WUBH 1JNNL 5C0BA 2YBRB 3VFNA 2HJFB 5FKPB 3VGGA 5HHVH 2VC2L 3BEVB 4NO0A 2NY5L 5E6ZA 3OR7A 1A6AA 2F9BT 3G5VA 4WFGE 4AY0A 3ULUH 3TPUE 2BC4A 5HHQA 1CLOL 1KJ3L 1DZBA 1T0MA 1OY3B 3M17A 2MPAH 5HHME 3ARGD 2P43B 3W39B 4Q9QL 3MRNB 2FWOA 2KDGA 5IT2L 2R2EA 5GSVA 2GJJA 2EIZB 4CJ0A 4G9FD 4S1RH 1IGML 4LPCA 5EU3B 4LSQH 3P77B 3O2WL 3QDJD 4P0DA 4U49A 3N1GC 1AGDA 5I1GH 4H1LH 1P7KB 5GGVL 2X40A 4J4PD 4RQQB 1AXSB 1PX3A 1S8DB 1OSPH 1PGRB 2X4SB 1DQLL 4XP5L 4HUUA 4YBQC 5IFHL 2RJMA 1BREA 3B3IB 3GNML 3QIUB 5EU5A 3MYJA 1A6UH 4P2OA 3VFPA 3MV8E 1XGRA 1I7UB 3IXAB 2JJWA 4XVJL 3OBAA 4Y5VA 1OTTC 1JGLH 2IPKA 2DD8L 3SKMB 1V3LA 2YA2A 2VE6B 3G08A 4JKWA 1QLRB 3JTSB 1BFTA 3S4SA 5D7IA 3RPIB 3HI5H 1MCWM 1YDPB 2E7LA 1FZMA 5BRZA 4R4BB 4Y5YC 4DKFL 3MC0A 5EOTB 4CU6A 1T6VN 5C09D 4ODTH 5D9SB 1MFDH 1ZLWK 5ITBH 1W72L 4HKXB 4KPHH 3T3ME 3CK0H 1MRFH 3QWQB 4RFEB 5DEGB 4OD1L 3RNKA 4YDIH 5GJSH 1I1CA 4GKZA 2DIAA 5ACMA 4M8QA 1ZTXH 3RGVA 4EBQL 2EZ0D 1R5VB 4OLYH 4P9MH 3PL6D 2P8PA 1FFPA 3DUUB 4LDLB 1RFDH 3QG7L 4JM2B 1KPUA 5DD0H 4EN3A 5K59F 5LXGL 2DDQH 1PJ9A 1X5FA 1WIUA 1UB5B 5FYJE 1MPAL 5BVJB 1D5BA 1ZEAH 1R3KB 5JO5B 1AD9A 3DX8B 3E2HA 4PBVC 1JNJA 1F3JB 4CUCA 3NZ8A 4QHMA 3TVMC 1JUFA 4LLUB 3LS5H 4F7EA 4X4YB 5IIEB 1IEAA 1W8NA 1LE5A 1FBIH 4MAYD 1T22B 4QHKJ 4NO2B 4EI6B 3LVEA 1DL7L 2JCCE 1QR4A 3X11A 2EYSB 1EEUA 5GGUA 3SDCD 3GBML 5IWLA 5KN5B 1CVSC 5MENE 3I84A 1NMAH 5I1KL 3Q2CA 1I9JH 5EA0L 5JXEA 1S9WB 4GMTH 3PGCA 4NSKB 4YUEL 1CD0A 1MLBB 1DTUA 3B6SB 5IM7A 3JV6B 2P1YA 3ECBB 4IRJA 1QSFA 3L95A 1ORSB 5J12C 4POZC 4JHAH 5CLWA 4X5WB 4N0UE 2BRQA 3VXTB 1AGFB 5E8EB 3NCYS 2XXCB 2F19L 3MODL 3MYZA 3NIGF 5DA4A 5DRWB 4DEPB 4MJ5B 1LK3H 2AXHA 4WI9A 3UJJH 2W38A 2XTJE 1II4E 4P4RB 4X9GA 2V2XA 3K4AA 1SY6L 2PXYC 4WGWB 5TF0A 4P4KB 4NJ9H 1AQDA 5HI4D 2VNCA 5IVXA 4M43H 3RWIB 3FFDB 4HWBA 1N59A 4JFFA 1INEH 3MJ7B 4CNIA 4NQCA 4AMKH 4LAJH 1KN4H 2ERJB 3B8YA 5ITFA 1LK2A 3AM8A 2B5IC 3WFDL 3S97C 1L9NA 2WV3A 4XMKL 1MJ7H 5AYUH 2OR7A 2F54A 4OKVB 1TJGH 3SOBH 1YEDA 3UTZA 5TQ0H 4O4YL 2XV6B 5H35A 3TNNA 4RWHA 3C60B 3U36A 2J1KA 2IANA 4BQ6A 1EFXD 3SY0B 3MROB 3CFEA 1HNGA 4LEXL 4NQVB 1JYXA 3QI9B 2P8LB 3S35H 2X4OB 2NLJA 5LG1A 4WWKC 4F15C 4ZTOL 3RKDC 4NWUH 4MNGB 3C2SA 3S36H 3HS0B 1JWUA 1WISA 4W70A 3VMNA 4JM4L 1N6QL 1EV2E 2EE6A 3KLHD 1VFAA 1OPGL 4KRPC 4P9HL 3I2CL 3ALXA 1KGCE 5AWNH 4ERSH 2JB5L 2R4RH 4JM2F 4L29B 2AK4A 5A2JH 1U8MB 3C8DA 5M94B 3L3DA 2CRYA 2D7QA 3SQOL 4MXVF 5F93C 5DJ6B 5FA4A 1CTOA 3QIWC 4ODBD 3OKLA 1AP2A 3V52L 1A1OA 1G7JA 1H3GA 2Q86A 3P9LB 3RVWD 4R26L 4I3RH 4P23C 4KU1A 2APVA 4QRQB 2YEZB 4EDXB 5ALCH 1V7NH 3VI4E 5C92A 8FABB 5ISZE 2IBZX 1SYVA 1DQJA 3V8OA 4KK6D 5IB1B 1AJ7H 3IJHA 3WFHA 1KB5B 5KANG 3ZDZF 3GRWH 3LQMA 4PB9H 3UJIL 5I1JH 4XNQB 1XAUA 2P24B 3NAAL 3IF1A 4NT6B 4TSCH 5E8PA 4Q6IA 3IDJB 4GSDL 4WW1A 4KZEH 5HDBF 3V4VH 4BK5A 4PTUB 3T4AB 1QFHA 1EAPA 1BJ8A 5F9OL 4KI5F 2XOTA 1FAKT 1SJVA 4P3WA 4YFEA 4L4TB 1WEJL 3NTCL 3LEYL 1I3RB 3MXVH 2VDPH 4HDIB 4LKXA 3IKCA 5EIIA 4FXGA 2H45A 1NC4B 5CEYB 1I7RB 1N0XL 1CXLA 3HTLX 4N8VG 4NYLA 2VITA 3N50A 1KN2L 5BS0A 4FQ1L 3K8LA 3WHE0 5I76B 1FJ1A 3R8QA 4I4WA 2FJFA 3QUYA 4P57A 5I0ZA 4HMCA 4LDOB 1Y6MR 5FYJU 3ARBA 4XP9H 2XPGB 1ZA6B 4AT6B 3SGDI 3HCVA 1IGYA 5C0BE 5CSZB 3L5IA 1E4XL 3FRUA 2W92A 4FFZH 4QRRB 3VH8G 4OBRA 4F7TA 4G8EA 1T21B 1P9MC 5I66A 5DI8B 1NFDB 1NGPL 1W2KT 3KYKH 4X9IA 5F7NC 1WBXB 2WBJD 4JFYA 2N7BA 4L8CA 4U31A 1Y0LB 3QZWB 3FOMA 3V4UL 5I2IA 1WJ3A 4GH7B 3KXFE 5HDOA 4EOWH 5DURD 3L3HA 4OZHB 5A2KH 5CD3A 2GITB 3PHOB 3PWUA 3SCMC 3ARWA 5BMFL 1DBAL 1C5DB 1P6FA 2Z93B 3MRBB 4PJHE 2PR4H 5KSBB 1RK0B 1U58A 3G5ZA 3P4NB 3LSOB 4K7PL 4QHUA 1QO3A 4M00A 4WW2A 1T0NA 3UJTH 3QXVA 2P47B 1KELL 5E1AB 4CJ1A 5LVEA 5DLMH 2J88H 3QULB 2WBKA 3U83A 5DHYB 3WJLC 4PJCA 3O6FB 4C56A 4WI8A 3OGOE 5JW3L 1NKRA 1LMKA 3HE7C 2OI9B 4RGND 1UA6L 4Y4HC 1YEFH 5GRZA 1FE8L 3ULVF 3BESR 3WIHA 4I0CC 1IM9A 4KTEL 4JKLA 5EOCJ 3S34L 1Z9MA 3HRZA 4OZFG 4JZJC 3FQWA 4POYA 4U1SA 3RDTA 4HKBB 4QCIA 4JQIL 4Y16C 5E5MB 5SWZB 2W0FB 4IRSA 1KCKA 2Y72A 1RJLB 2HTLD 2BSED 2Q76B 3F7RA 2AJZA 4XB7A 3F7QA 5HYJE 1HN1A 4IS6A 5D7IE 4Q2ZB 2G2RA 2YD2A 4NHCL 2E7LE 3LN4A 5BRZE 3EJYD 1VEMA 3HG1A 2IPUG 2DQEL 4LSUL 2WK2A 3QUZB 4RX4A 1ULVA 4PLOB 1EO8L 2I07B 1AO7D 5F7HA 1JPGA 4UUJB 1W0YT 5CJXA 3W9EB 3EYVB 3UAJC 2P49B 3L3KB 1EX0A 3HKFA 4MNQD 1PW3A 5IVOA 3AS0A 3I6GB 4ETQB 2DQFA 4X98A 5DMIL 1EHNA 4YNYA 2JELL 1L4IA 5I1AA 1S7QA 5EZOL 2FB4L 1U3HA 3KPQB 4KKBC 1EIBA 1CZ8L 3FT3B 2OZ4L 1OARH 3AC0A 1AY1H 1N4XL 2EC8A 2NTFA 2ZNXA 4WHYG 3GSNA 2VLRA 3IU3A 3OV6A 4S2SB 5IHBA 4FQCL 1NFDF 4P2QD 1SBBA 2DQIL 1L9MA 4QKXB 5L88H 4E41A 3A0OA 2FHBA 5IV2A 4M62L 4U1GC 5IB5B 35C8L 3WXVL 1WF5A 1QFWL 3D3VA 3IT8D 4IMLA 1BZ7A 2VXSH 2HJLB 3TP4A 1BAFH 1P4IL 4D9QE 3LZFH 1DBJH 5H94A 1BF2A 2ZOKB 3MNVA 2H3NA 1RU9L 3PWLA 1CDCA 1D5IH 2NY3B 3LKRA 4Y19B 4D0BA 1FCCA 3JTCA 4IOFD 3BKCH 3GMNB 3WSQL 1YECL 1I1AD 2QEJA 3OMZA 2RB8A 4GBXD 2HLFD 2PW1A 4I0PD 4IJ3C 2ENYA 4PFEA 2AJYH 4NWTH 4Y1AE 4YXKH 4CMMA 1Z9SA 4U0QB 4P5TB 1QSFE 1JHTB 1G9MC 4OCXL 4CU8A 3OKDA 1FNGA 4RBPH 1FLRH 5C0AD 2V2TB 3KHQA 4G80B 4L9LC 5IQ7H 2YRPA 1G0YR 4B50A 4QXTB 3EFFA 1G7HA 1U9KA 4NNYB 1CD1B 4ORZC 1LO4L 2J4WL 5IVXE 3PQYD 1N26A 4HXAH 2LE9A 1N2RB 4KC3B 1S7TB 4NQCE 5GHWH 5MERB 4OSUL 4TSBH 2AXJA 4Z7OE 5E03A 3U0WH 3MRPB 3FB5B 3MUJA 2GHWB 3LB6C 3NPSB 5DD1H 2F5BH 3MJ6A 3VXPA 4XC3L 1ZLVK 2SEBA 1RZ7H 2F54E 1WWAX 4OD2B 1GGTA 3BYTA 5ID0A 1IGTA 7CGTA 2JK5B 3EGSB 2GJ6B 4FG6C 2UY7A 4KTDH 5KW9H 2IANE 5D1XB 1DN2A 2A1WH 3MO1A 4L3ED 2YSSA 2GJZA 4ORGA 1WSST 2P5EA 3KPMB 2AW2A 4URTB 5SWSD 3CMOH 4E0RA 5CINL 2WQ8A 4HFWA 4OZFA 3ZDXE 3VXQB 4L8BA 4XCFH 2ADIB 1TIUA 3ARXA 3K7UA 1RZJL 4MA8H 4XNYL 4JHWL 1DVFC 2HRLA 2MQ3A 1UXSB 4LHQB 3QXTA 5DQ9B 3N1MC 3BDYL 4MYWB 5D96B 5DC9B 5DUMH 1JGVH 1BIIA 5GRJL 3IFLH 4ODUA 5T5FH 5BXFA 4UB0L 3TT1H 1DBKL 4LSTH 4PPTA 3QIUC 3LV3B 2VMFA 2A9MH 4DN3H 2VN7A 2HT3C 1F4XL 4FQXC 3UO1L 1YEKH 2FJGA 1REIA 2Y7QA 2AQ1A 1I7ZB 3RA7L 3B9VA 2IAMB 3IAGC 1T89C 5D2NB 4GUPB 3KPOA 4XMLL 1OM3H 4UIMB 1A6WH 5F1IB 4BFEA 2X4TA 1IT9H 1VACA 4V1DE 5INCA 2F15A 4MDJA 1UT9A 1DANU 1P7HL 4Y4FD 3ALPA 4Z8FH 1BZQK 4PRHB 3MRHB 3V0VA 4UTAH 4YHLH 1K5NA 1FRGH 5C0NC 4JRYB 3BQUB 3X13B 1Z9OA 1I9RH 2A6IA 3OAUL 3TO4C 5FHBL 3S88L 1I1RA 2DIJA 5IP4A 3OAZK 5AZEL 4L1HA 1OAYH 2V9TA 3LIZH 5D2LB 2FL5A 1GPOH 2AAVA 2CLVA 2V6HA 4OGXL 2R1WB 1VFBA 3CFCH 4PJIA 3JV4A 1ZVYA 4XX1G 1AR1C 1FO0B 3S3PA 2H32A 5M95B 5E8NB 3MLZL 3WIHL 4R3SA 4JJ5B 5HYIA 1JRHI 4HUMB 1XF4B 4N0YL 5DK2A 2D0FA 2WMPA 2YK1H 2ZJSH 4YC2C 4M6OH 2BNUA 5T1LA 1FZOB 3MRDB 4ALAH 1OAZH 3VFSB 2HTKC 4Z0BL 5EC1B 3QEUA 1G9MH 3MCKB 5BS0E 1F11B 2WP3O 3H9SA 3MACL 4GW1A 2Y4SA 4QRUA 3SDYL 3BP4A 4P2CG 4R4NC 3SGEH 4EJ1C 2NY6B 2GTWB 3BAEL 3CLEH 2XA3A 5HI5C 5I73B 3SE8H 1EMTL 4JM2D 3OKOA 1QSZA 4I9WD 2XNAB 5CHNB 1CCZA 4YHOL 3WKNA 1QRND 3T3PE 1U95B 2F74A 3DJ9A 1PY9A 4NGHL 1J1XH 1F6LL 5D72L 2DM7A 4CADA 1OQOA 4G9DB 3BX7C 4MXWL 5E2TH 1MWAB 4P4KC 3W2DH 4G3YH 4F7PB 4X6FA 2QQLL 4UV7H 4WJ5B 3BH8A 4PJBF 4DKEL 5DK3A 1D6VH 1X6NA 4NCC1 4YO0A 1JK8B 3D1MC 4BQCA 2ERJC 4QTHB 1ZHKA 4P46B 1YNLH 4JZOB 3RNQA 2ILLA 5HYSA 3F5WB 3LKPB 5IR1B 1EJ6A 5FGRA 4OQ1A 3HC4L 4F37K 2HFFB 4UQ3B 3C60C 1RIVH 2JB6A 3TIEA 5DD5H 3VFGH 3QI9C 4UDUA 4LMQI 1IAOB 3VRIB 1EXUA 1MF2L 4ENED 5IW6A 2AXFB 4PJCE 1CU4L 4C56E 3GUTA 4JFDB 3MUZ1 1RZIA 3PWPA 1MHCA 2EH7L 3JV5A 5DJDB 4X99A 1NC2B 2AEQH 3IETA 2V7NA 4KI5D 3RWDB 4WFHD 4G7VL 4JO1L 4AM0B 1QBML 2W9DH 1MH5B 3MR9A 4NHUA 1WCBA 4Z7VA 5IROA 3MLRL 3PWVB 1KIPA 1YEGH 2F53A 2O5XL 4AENB 1DJSA 1INDL 2DM4A 5KAQG 3T0EA 3GSOB 4IIQA 4RAHA 1B0RB 3HG1E 3VFVA 4XBPA 4ODSH 1JWSB 1D9KB 4P59H 5DRZB 3QPXL 1HSAA 1F4WL 1DLFL 3GZKA 4NQXB 5FO8B 3HFMH 1T5XB 4PGBA 3U0TB 3O81A 2VXTL 1BD2D 3P9WB 4GW4B 1MCIA 1NLBH 3B43A 3QCUH 3IDMA 2FECL 3R06B 4FQ2L 4ZFFB 2AJSH 2C1PB 2PYEB 3SQBA 1VADA 4ZSOA 4ONFH 2IALB 3VXNB 5I16A 2DQUL 5ESQA 5D1ZB 3CMGA 2K7QA 3ZHDA 4HIHA 1WZKA 4AEHH 4E41E 1ZHNA 3MJ8B 3Q5TA 32C2A 3OKYA 4FA8A 5FUCE 3CH1A 5C2UB 2CLRA 3RTQD 5DJZB 3ZKXB 3RAJL 3HLAB 4MB5A 4Q6YA 4G6MH 3K8KA 5CWSB 1MSPA 1P4LB 1ZHLA 2OSLB 3KNBA 5I1HL 5IJVA 4UI2A 2VXUL 2DICA 4M03A 1IARB 3DVGA 1QVOB 4MXQD 3B5GA 4Q74A 2VQ1A 1S9VB 1UJ3C 2ZSWA 5CZVH 1OP3K 1SYSA 4JCMA 5D7JA 3KDMB 3VWJB 1E4KA 3ARSA 4P5MA 2QKIB 1XR9A 3S37X 3EAKA 1DUZB 4UOW0 5J1AA 1SEBB 5FGCB 1MJUH 5HVHB 3ULVD 2FX9L 3IS1X 4KDTA 3KJ4B 5CEZD 3WXWL 1EFQA 4OLZH 1INQB 1J5OH 1A6VL 1KNOB 5FV2A 3UBXB 1Q94B 1AGBA 4WVRA 5I19H 3N1QC 2J6EL 3F58H 1FYTB 4LCIH 1W0VB 5KTEH 4U3XA 4FN0A 2CIKA 2ADFH 2EDNA 3BGAA 1UCBL 4WWID 3TYGL 1ZGLP 3GDBA 4JN2B 3QB7C 2JJSA 4K3DL 2AI0H 3LH2L 3DTXB 3NOIA 5FIEA 1RJZA 5L0QB 4NFCA 1YEHL 2AJXH 5F7MC 4XPBH 1U8NB 1ZA3A 1IAIM 2BHUA 3Q1SL 4Z5RB 1RVFL 3BH9B 4YXLH 3WJJC 3GI8L 1FDLL 4PJGA 3L7FB 1HHGB 2IPTH 2BVQA 2BP3A 1EA9C 4RMTA 5CUSL 2P5EE 1QBBA 4ZNCD 2YKLL 5A2IH 4FFWC 5ACZA 1OGAB 3IVKB 2AGJH 3GJFB 4PJXF 2J8UB 4OGAC 1FLTX 3C08L 1A7QH 3FQNB 3SBWC 1CI5A 3GM8A 3DRQA 5GIRA 3DBXB 4NKIL 3O6FC 4WO4A 2OI9C 2OJEA 1S78D 2EDWA 5LKNA 3GO1L 3W0WB 3Q3GA 5KS9B 1MCRA 2N1KA 2F58L 2VAJA 1OAXH 1BM3L 3FT2A 4HUWB 3ZMRA 2Q3ZA 1NJ9A 1LDPL 2HN7B 4MA1B 4YPJA 2C1OB 4K3JH 4XHQA 4YEFA 1TQBB 3IDGA 1ZT1A 3CLFL 3NCEB 3JWDC 4WEUD 2FGWH 1D5XA 1VFUA 5JIHA 1YY9C 5D70L 1P7QA 4DVRL 4ZOCA 1IEHA 1FVDA 1KB5H 1KENL 1QYGH 4ZUWA 4LU5H 3L5HA 4G42B 4U1JA 3RZCD 3JTTA 2IFFH 2UYLA 4I48A 4ZS6D 2X89D 2PYFA 3KPRA 1CD9B 5A16B 1RHFA 4MQXD 2VDRL 4RMWA 4CU7A 4OCWH 3TN0A 3WV0A 2IADA 3ULVH 2DBJA 2RFXA 4JANA 1A5FL 3L5JA 3MBXL 2NZ9D 5CEZH 4ZUUA 5E70A 2X70B 4XNZC 3V6OC 2NY1D 4M9PA 6FABH 5B39B 4PRIA 3LMJL 4PG9A 4PJIE 5SWZD 3RL2A 3KPNB 5J6HB 3CDCA 1MHPL 3GSXB 3TZVC 2DQHL 1XGPA 1BEYL 1AC6A 1JCKA 3U4AA 4PJFB 4LHUD 3FL7A 4JLRA 5HYQA 2FBJL 2GT9B 3G04B 3T8XB 2DTMH 3ZE2F 3HI6L 3QUZD 4FTVB 3UXFA 5FAAA 3CXDL 2XACC 3FJTA 4P2RD 1PDKA 5ALBH 4G5ZH 1TCRB 3BEWA 4HIEA 3QQ3A 2NY3C 3LEVH 3MLPA 3EZ8A 4S1DC 3QG6B 3O3DB 4UV4H 4GG8A 3BISA 1A9EA 3R1GL 1WLHA 4OQTA 4XGZA 4UQ2A 1S7RB 2DQCL 1H3PH 3LEXA 3BZFB 3T04D 5DJAB 1NDGA 1AIFA 4ZUVA 1HSBB 3WFCL 1CE1L 3QQ4B 5EFIA 3DURB 2HFGL 1JFQH 1JHKL 1O0VA 5DJXA 1KYOJ 2VLJB 3RX8A 1SEQL 4X6DA 5DYOB 1NSNH 2FEEI 1U8LA 2EDXA 3EYUL 2V9QA 3DMMB 4DZBA 1B6DA 3UYRL 4MQ7B 3CUPA 2ZUYA 1LHZA 3SKUD 3ARFA 3QEGH 2BSTB 2DQGL 4NZUH 5FYKD 1J12A 4J12A 2VZVA 1WC7A 5ESVA 3FMGL 3CFJB 1LEKB 1G7QB 5L9DL 4MD0B 1IM3B 1CL7H 3NMEA 4KUZH 4U1MA 4P5TD 5D1XC 1TZIB 1HQRB 4H1LA 5IBTL 1K6QL 2HMID 1JYNA 4TPRL 2J12B 1YPZB 1TZHA 4WUUB 3JSSA 1HILA 1KEMH 3QO1B 4FZ8L 1G6RL 3PWPE 2PO6B 4A2MA 2ENSA 4PUBL 3HPLB 3H0TA 3I6KB 5IMMB 4EI5B 3D87B 3SDAB 4ZS7L 1H3UA 4ZTPL 2Y07L 3MMEB 4UINH 5HTSA 5MEQA 4NHUE 3TJHC 1H3VA 4Z7VE 5EUKA 3D39B 2UWEB 2QHRH 4NNXA 2F53E 4X5XA 3QUXC 2Z91B 4M7KL 2H6PB 5C07B 3D0LB 4NQUA 2ZUQB 5EBMB 3T0EE 3WL9A 4S0TD 4CBPA 1PYWB 1A7NL 1U8HA 2X2YA 3GHBL 5D1XD 3HMWL 4ONHA 1BBDL 3Q6FA 4Y5XB 1OAUH 4TTGA 4JCLA 2V17H 2CKBA 2Y25A 3B9DA 4GMSH 3U1SL 3CC5B 4BSVA 5I8EA 4JFPB 2BFVL 2CK2A 4J8RA 3WEXA 4LK4A 1VGEH 1G9NC 5ENWB 5HI3D 3WYRA 1H0DA 3RWFA 1UGNA 4LSVL 5DDHB 2R56H 2QQKH 4H0IA 1VKXA 1OWWA 2YPLA 1MI5A 3BQUC 4ZSOE 3I6LD 4DTGL 4PY7B 4N0FB 4JFHE 4PB0L 3PP4L 4Q7DA 5HHPA 3C5JB 1KIQA 4HHAB 1UJTA 2I5YL 4GAFB 3STLA 4OT1L 4W6YB 3TBSA 4TYUA 3B9KB 2C7UA 1BQHG 1UXWB 1XGTA 5EORH 1I7TB 1FL3B 4ELKA 2EE3A 1F5WA 2IAMD 5FYKH 5KZCB 3VD4A 1NCBH 2NY7L 3CVIH 1FIGH 3NIFF 3ETBF 3X14A 3W5MA 4KZDH 4PRHD 2HKFL 2MQ0A 2EXWC 4JRXB 5I8OL 4QRTA 5SX4H 2GK0A 3RL1A 4JRYD 5F88A 3IJYB 4PV8B 3CFDA 3HE6A 5DK0A 5B3NA 2VISB 4R4FH 2BVEA 1HHKB 5FO9A 5DQDL 1A4KA 5AUMB 2HJKA 3QEQB 1D3CA 1FV1A 2NY6C 3EOTL 5I73C 1IKFL 4BH7B 1DSFH 1MCPH 1T3FB 2FO4B 2OX5A 4RMQA 3G6JF 2A83B 3MJ9H 4M61B 4LP4A 5A1AA 1QSEB 4BUHA 3SDXA 2CMRL 3L3GB 4RAVA 3P9MA 1DE4B 4G6KH 1ETZB 2R0ZL 3BN3B 1S7XB 3K8MA 4P2YA 1NMCC 4PREB 1EHLL 3ZO0A 4PJBA 4NO3A 1FVEA 3BFOA 4L4JA 5D5MA 1MCKA 2D31A 3LD8B 4RMRA 2DWDA 3JWOL 2NR6D 1LEIB 4MVBC 1VGKA 1U3ZA 3OF6D 2E6PA 1FIEA 2AJUH 1F8TL 4D0CA 1FPTL 1R24A 3MLYL 3BIBX 4OZIF 4PR5B 3P0YH 1IVLA 2PW2A 5I8CA 1KB9J 4P46C 5C8JB 1CGYA 2ZCLH 1OGTA 1EEYB 1KLFA 4N68A 3LQAL 1OP5H 2G9HA 3UZQA 2GSGB 4GFTB 3GEWB 4LLDA 2NQCA 1JJUA 4DOHB 2BCKB 1B2WL 2ZCKH 1BVLB 4XI5D 1NMBL 2E7BA 1YNTA 4OQTL 5CBEB 1BGXL 1GC1H 2LTQC 3T2NH 1G7IA 2CGRL 4IDJH 3GSWB 9CGTA 5CP7A 5DT1H 2WUBL 1XIWB 3VXUD 3IXTA 5HHVL 2P7TA 1JNHA 4Y5YA 3MGAA 4JHBA 4P3DB 2IWGA 2MCG1 4ZUSA 2ZP0T 4GG6F 3DPBA 4NRXB 4PP1C 1MAJA 4JAMB 3BGMB 3ULUL 4XBEH 2XTLA 3GIVA 3NFNA 4ZXBB 1QR1A 5HY9A 3VXOB 3DX6B 5AEAA 3QFDB 3C5SA 3ARPA 2CDFB 1I4FA 4LGSB 2MPAL 2E7HA 2FLBT 1CG9A 3QDGB 2GCYB 1U8PB 4TNVF 3GRWA 1MCNA 3VW3H 1NCUA 4LSQL 5FK9A 4Y2DD 2NMSA 4HIXH 2FD6H 5I1GL 3GHEH 3TVMA 4G8FB 4HUVA 1CLCA 4HIJA 1GJIA 4PRIE 3WS3B 1UM4H 4LLQA 1FO0H 1OSPL 2R23B 4ZFOA 3ARDB 8CGTA 3BWAA 4QRSB 1YMMB 4L4VD 2AXGA 4YHIB 4HK3N 3TPKA 3OR6A 3VFRB 5SX5H 3ZKXC 1CFSA 1A6UL 4YIQB 5IMKA 1D9KD 1QA9B 4PJEA 5IK3B 4X6BA 1VFOA 1S5IH 1S7SA 3OL2A 4HG4J 5GS1B 3NH7H 1JGLL 4WGVB 3F7YB 1IEBA 2FJHA 3FB6A 4R0LB 5D1QB 3GMQA 3HI5L 5FF6B 1EEZA 4YE4H 3VWJC 5I1LA 5J57B 3UTPD 2BVPB 1SMAA 4MQSB 2CRZA 1RZKH 4ODTL 5ITBL 2NXZC 3BT2H 2Y9RT 2PXYA 4KPHL 4LCYA 5D1ZD 1VSCA 3C9NB 3CK0L 1MRFL 3KJ4C 3LKOA 2LVEA 1FG9C 5IHZB 4X6DE 5GJSL 1S3KH 4CDHA 1LD9B 5TDOA 1MWAH 4QNPE 3ULUE 4NQSA 1ZTXL 3AAZA 4OLYL 3CIQA 4DK6A 4YHZH 2FEDC 1RFDL 3UCRA 5DD0L 5FB8B 2DDQL 1BZ9A 12E8H 2X9YA 4XXCC 1I8IA 4PGDA 1ZEAL 4MD5B 2ZUXA 1U41A 4RA0C 2UUDH 4PRAB 3LS5L 2X4UA 4WWKA 1FBIL 3ZE0F 2YXMA 4R96A 2Z35B 2CIIA 1TVBA 3O41A 4FMKA 3G5XB 5BZDB 3ELAT 1A1NA 3HC0B 1IZKA 5ADPH 3B4NA 1FN4A 1DEEB 2A6DB 5A2FA 4GRMB 1NMAL 2N4IA 3LKSA 3PWNB 3VGBA 5T3XD 3UTSB 3VGAC 4G43A 1I9JL 1IJ9A 1HI6A 4G6AD 4GMTL 4O2FB 2CRMA 5F7DA 4XAWH 1IGIH 3HZKB 1OB1B 1UACH 1YN6B 5C2BH 4ZD3H 2NX5D 2WIIB 4JHAL 4NM4H 5FCUH 4O2CA 5IMLB 3WBDA 4P23A 1BQSA 4ZOAA 4G8IA 1LK3L 3CJJA 4S0SD 3UJJL 5HJ3B 3O6MH 1Z2KA 4MA1C 5TQ2L 1ZXQA 5DRXA 4AEIH 3FT4B 4NZRH 4NJ9L 4MZ3A 4C83A 3IDXL 1NCCH 4XPTH 3FONA 5E0QA 4AMKL 2H2SC 5FA3A 1QPXA 3WNMA 1KN4L 1GVIA 5HHOB 3KLAA 2XWJA 3DV4A 2BOCA 5AYUL 4JPIA 1MJ7L 2C3VA 1RZ8A 1TJGL 1ZT4A 5C0IB 3SOBL 2BNRB 5TQ0L 4OGZA 3QBTB 3IGAA 3N9GH 4BFIB 2YPLE 1MI5E 3NFPA 3DVIA 1F2XK 3S35L 3W0WD 1J0KA 4NWUL 4QOKB 4TOYH 5F6IC 1NDMB 3AREB 3GBNH 4JZNB 3RWHA 2WBJA 4Y88A 1KUMA 2R2HA 2ADGB 1RZGB 3GB7A 3VD7A 2A9NH 4F7CB 4BK4A 2L7JA 4O02L 4WRLA 4JFOA 1GZPB 5AWNL 4M7LT 4LARH 2XWBB 4ERSL 2CSPA 1T1YA 4I18B 1L6XA 4R6UA 1MRCH 1F42A 1T7XA 5JLZB 5GGSA 5FUOH 5A3ID 1MY5A 3DX9A 5JHLH 4I2XB 2GQHA 1F4HA 2WWMC 1BBJB 5KOVC 4N90D 3PP3K 3F12B 5CP3H 4I3RL 3OKEA 4Z9KB 5IHLB 1F58H 1L0QA 3VXSE 1ZGLM 5ALCL 1V7NL 3QNZB 5EZLA 4NNPL 5EU6D 1AJ7L 4M1CC 2W0KA 3MREA 1N3NA 5ICYA 2H9GB 2V2WA 5KSUA 5FCSH 1TNNA 1KLGA 2YRZA 5MHSE 2Z4QB 4GRWF 3O8XC 1QQDA 3GRWL 4PB9L 2YZ8A 2VAAA 5I1JL 3PWJB 4MCYA 5CJOH 4PJ5A 1BECA 1LP9A 4XVSH 1AHWB 3SDXE 4TSCL 3D2UA 3QHZH 3GMRB 3OTTA 3SJVA 5IJKA 1N64H 1I8LC 3DMMC 5GJTH 1TLKA 4PJBE 3QCTL 3MRJA 4ZAKB 3V4VL 5D5ME 3GMOA 1A3LH 1LO5B 3MA7B 3ZZ1A 4UILH 5IB3B 5EU4A 1IGCH 4ZFOL 3BMWA 1MHEA 1K2DB 3D25A 1AO7A 1I1YB 5GISH 1CIUA 2VN4A 3V0AC 3LN9A 3FB7B 2LVCA 3UTTA 3KAAA 4HWZA 4M1CD 1PG7H 3WJLA 1FZKA 3EOBB 1I85C 4IDLA 1F6AB 1JGUH 3WHXB 3MV01 4P49A 3PXJA 4MNQA 2BERA 5F3HA 1JVKA 1FL5A 1DN0B 3GJFH 3HE7A 3MXVL 2VDPL 4Y4HA 4F33B 5T3ZE 3PIQA 4O58H 1XGYL 4Z7QE 5F7KC 1R3JB 3L6FA 3UPCA 4Z7WF 5DTFA 4JZJA 3KPPB 3VXRB 5DRNA 2VLJD 4Y16A 4PLKD 2PO6C 4P2QA 4XP9L 3WCYA 4OI9A 3BJLA 4H0HB 2BY3A 1S5HB 2BNQB 4NQDA 5DS8B 3SDAC 5DMKB 5KOMC 2Q7YA 2DIBA 2QLVB 4FFZL 1C12B 3ZT6A 2AKRA 3KYKL 3BPCB 1CF8H 2EEBA 2D9CA 2DLGA 2ZUQC 3GKWH 1EGJH 5F3BB 4U6XB 4NRYA 5C08B 2M1KA 1BVKA 3DARA 3L3JA 2IEPA 3HPJB 2W0PA 3D85A 1U8KB 5HGAB 4UOJA 4PJAF 3PGDA 2FX7H 3BN9C 3S9DB 4KJQD 2EDDA 3SKNB 5KSAB 5TH2B 3MXWH 2PR4L 4JFXA 4NQEB 3ESVF 3T08A 5EO1B 5JW5B 2MKWA 4MD4B 4C59B 4HKZB 4HCRH 4BZ2H 1SVCP 1FZJB 4WI6A 1FC2D 2B0SH 3UJTL 2VL5B 4EI5D 2EDFA 3ROOB 1TZGH 1WAAF 5DLML 1OTSD 5KVMC 2J88L 5DHVB 3RGVC 3D39D 2A73A 1JZ6A 3PQYA 4QTIH 2R29H 4G8GE 4M4RA 3SPVB 3MBEB 5KANI 3ZKNC 5C07D 4ZPTB 1YEFL 4FXKB 1QFWM 2YC1A 4WEBH 4M6AA 4BQ9A 5HGGS 4XP4H 3K4DA 2Y5TB 5DJCA 4JFEA 4KJWC 4PS4H 4PJEE 3W5NA 3KYNB 3RU8L 4I77H 4OF8A 2WWKT 1BFOA 5H2BA 1IAMA 3O9WB 3WE6A 15C8H 2ZSVA 3PABA 4BFBD 4A2LA 1KXVC 4L9LA 2Q8BH 4BM7A 1PAMA 3MRIB 2YBRA 2VLKD 2HJFA 4LEOB 5FKPA 3ZKSD 1MCWW 1UADC 5BQ7B 4ZNEA 3CPLB 1JZ3A 3BEVA 4JJHA 5CJBA 2VABB 1A14H 3B9KD 1UKSA 2IJ0C 3QDMB 4PGEB 1QFUH 3F6LA 3W39A 1OARL 1AY1L 3RIFF 4YHKH 1CICB 2YD4A 2NY0B 2OLDA 1JPST 1S9YB 2EIZA 5L88L 3LD8C 1KFAH 2FCBA 4U33A 5FO7B 3HNTH 2VXSL 4OCNC 1BAFL 3HR5B 3ZT5A 4LQ1A 3LZFL 4HS6A 3GMMB 1U91B 1AXSA 4X0KB 5JMRA 4XZUB 1S8DA 1D5IL 2CXKA 4HS3B 2X4SA 3QEQD 1YJDH 3X3GL 5KVGH 3BKCL 2I24N 3B3IA 2J8OA 3VGHA 2AJYL 4NWTL 4YXKL 4YQXH 3QIUA 1KPVB 3O4OB 3FO1B 4PGCA 1NQBA 4FQXA 5TGBB 1KBGH 1WBZB 3IXAA 1AGEB 1P4BH 2IQAB 1FLRL 2PTVA 3RWEB 4LVHC 4GRLB 1PFCA 1H5BC 3UMTA 5I18H 1T89A 3CH8A 4N5ED 4U1LB 3C6LD 3SKMA 5IQ7L 3QNYB 1QLRA 2XN9B 2ZCHH 4B7IA 5HHMB 2AERT 3RPIA 5JDSB 1XIWC 1ZKAA 4ZO9A 1ITBB 4R4BA 5IW1B 2DQDH 1X6LA 3WN5B 3H3BC 2BDNH 5GHWL 3TFKC 3EIFA 4TSBL 1DDHB 3U0WL 4HKXA 5AZ2L 4JY4A 1LO3H 5DEFB 3WO3B 2X42A 5DD1L 2F5BL 4RFEA 1SMOA 5DEGA 2OBGA 3QQ9D 3TO4A 4LRNH 3QYCA 1RZ7L 4TULH 4RFNC 3IJSB 2KH2B 2XZQH 3V5KB 2OQJB 1YUHB 1R5VA 4KTDL 5KW9L 5TDPB 2A1WL 2FHCA 1MFAH 1ZVSB 5FM5O 2EYTB 2I60L 3KYOB 1U0QA 3LRSB 4R90H 1UB5A 2PKDA 3T09A 3FAXA 5BVJA 4HUKB 1R3KA 5JO5A 3DX8A 3CMOL 1F3JA 4XCFL 4LLUA 4DGYH 3ZYOA 4X4YA 1JPFB 2VZUA 2NX5E 1YY8B 4MA8L 4OAWB 4NO2A 4EI6A 5FECA 4F8QA 4WFFD 1P53A 4ODVH 5DUML 3ARDC 4GQ9H 3AFLA 1JGVL 2EYSA 2W0LA 3IFLL 1QBLH 2QR0B 3TT1L 3AUVA 2VLMD 4ZXBD 5KN5A 2VXVH 4LSTL 3FN3A 3GSVB 3QIBB 2A9ML 4DN3L 1JL8A 2Q7NA 2YUXA 1AKJB 1YEKL 3QDGD 3TM6A 4NSKA 1MLBA 3B6SA 4UAOC 5KSVB 3ECBA 4TN9A 1OM3L 1ORSA 1A6WL 2V5RA 3BXNB 4X5WA 5D1QC 1JZ8A 3VXTA 5SWQB 1AGFA 2ZZUT 3Q6GH 5E8EA 1J8KA 5DRWA 4Z8FL 3C87A 5GXBB 4ZYKB 3HZVB 1LNUA 3SGDH 2Y36H 1HXMA 4G6JH 2YS4A 2P8MA 1QLFB 1FRGL 1T20B 2X9XA 4KKAC 5ICZB 1KLUB 4PJ5E 5GRVK 3HAEB 4P4KA 1LP9E 1IZJA 4HBCH 4KTYA 3RWIA 1I9RL 3FFDA 6CGTA 3B2UC 3SJVE 4OCSH 4NKDB 1YMMD 4X9HA 5K9KB 4HX1A 3QFJD 1OAYL 4I3GA 4TSAH 3LIZL 2BVUA 5FYLH 1GPOL 3QZWG 2YUZA 2OTUB 5IESH 3RP1A 3C60A 4ZODA 3SY0A 3OXSA 5MENB 1UFUA 4NQVA 1JF1B 3QI9A 5DJ2B 3UTTE 5HD8D 5D1QD 2P8LA 2X4OA 2YK1L 2ZJSL 4M6OL 2P46B 4MNGA 4ZO6A 3RWJA 3HS0A 2JF1A 1LEGA 2OL3B 1IBGH 4ALAL 5C0JB 5JW4R 4JY6B 5F9WB 1G9ML 5EU6E 4ELMF 2Z92B 4NRZB 2JJVA 4O2EB 3H7LA 4Z7UA 5IW3A 1U8MA 1NAMH 4XTRD 2XTJB 4CAGA 5F1NA 1BJMA 4Q9RH 4L3AA 5KVEH 4NQDE 4OLXH 4R8WH 4FFEX 1B6UA 4NCC2 1RUML 2GTZB 5D7LA 4CDGC 1AFVH 4QRQA 2YEZA 3VXMD 4LFHD 1ZMYA 1X5IA 4Q0XH 1J1XL 1T03H 3IFOA 3T1FB 4RDQF 5E2TL 4LRIC 3W2DL 4G3YL 1KB5A 4UV7L 3VJ6B 1J05B 1LDSA 3ALWA 4ODHH 4W68A 3S96B 1D6VL 1HK6A 4XNQA 2FZ3B 4QGYA 3GMLB 4MX7B 5FDYA 3T3MF 4NT6A 1UVQB 2V5MA 5I74B 2OMNA 3UTSD 4WI5A 3PDDA 3VGFA 1V8HA 1R6VA 1TQCB 4S10A 4PTUA 3T4AA 4U1HB 3D48R 3MJGX 4YZFE 2HG5B 3E6FA 3FQXA 5DD5L 3VFGL 1M6OA 3HI1B 2E27H 4GXVH 2EDLA 3SDDB 3AREC 2ZG2A 1KIUA 4L4TA 2JJUA 4KK8D 5B4MC 3HC3H 2XZAH 3RVUD 4FQJH 2WINB 2BZDA 1I3RA 2AEQL 4APQB 5IBUB 1UJ3A 4HDIA 4JFEE 2W9DL 2JCCF 1NC4A 5CEYA 1I7RA 1BOYA 4I18C 5I30H 1YEGL 4LCWB 1UC6A 4N8CH 5HHOD 1F90L 3H9ZA 4ZO8A 1A6TB 3RFZC 2BNRD 2XPGA 3KJ6H 2QQQA 1ZA6A 1HHJA 4AT6A 2EDHA 1ZE3C 4ODSL 3LKNB 1ZOXA 3RVVC 3BDBA 2PTTA 4POUB 5CSZA 4P59L 4FXLA 1Q9KB 3TWCH 4QRRA 4KJPC 4ZNEE 1MCOH 3HFML 5EBGA 3OXRB 4RMSA 4QOKD 1MCFA 4Q9CA 4TNWF 2PTUA 5GZOD 1WBXA 4U6HA 3BIKB 3IDNB 3AGVA 1NLBL 3QCUL 1HHIB 5LGJA 1Y0LA 3TH3T 2AJSL 2Y1VA 4GAYB 4YGVB 1NCAH 4BH8A 1AHWC 1NFIB 1ZHBB 4ONFL 1ZAGA 2A77H 4OZHA 2N56A 5D7KD 2GITA 3PHOA 1YYLH 3ILQD 4ZAKC 4AEHL 4ONGH 3WJJA 3MRBA 1G7PB 2B1AH 2R9HC 1M4KA 2XG5A 5JNYA 5KSBA 3OG4B 1RK0A 1JBJA 3P4NA 2HFTA 3THMH 4K8RD 4G6ML 3SBWA 3QSKB 5DVMA 5E1AA 3DXAA 3RIAK 5DHYA 3O6FA 2X41A 4Y7MA 5J4MA 2OI9A 1F97A 2O5YH 5CZVL 4XRCB 5IVZB 1K8DA 5E5UB 5E9DA 1EHAA 1TETL 3UC0L 3INUH 3BP5B 1HYSD 4HKBA 4NO0B 2NCMA 3P2TA 1ED3A 1MJUL 1N5AA 2EXYD 2W0FA 5DO2D 1WWBX 3G5VB 4OLZL 5HHQB 1RJLA 2Q76A 1J5OL 4XAKE 4PRPE 4I3SH 1WTLA 1T0MB 2IBZY 3KXFB 5I19L 3W11D 3M17B 4Q2ZA 3F58L 3IU4H 3T2PA 4FFVC 4LCIL 2V5SA 5KTEL 4MLIA 4DW2H 1NANI 2ADFL 2I07A 2EC9U 1IMHC 1E28B 4UUJA 1I9EA 4PJHB 4TNVK 3EYVA 3W9EA 5FM5M 2AI0L 5AAMA 1JTPA 3L3KA 4AQ1B 1AGDB 1N6UA 4ETQA 3ZKQD 5JDJA 2AJXL 1UG9A 1UM5H 3MV9B 3Q5YA 4XPBL 1FNFA 5CJQH 3V6OA 3KPQA 2X1QA 3DWTA 3VXRD 4YXLL 5T33H 5KSAC 1UENA 4FHBD 2NYYC 2OTPA 3MZGB 3T0WA 1ZV5A 4S2SA 5CLTA 3O6KL 4KMTH 4NN5C 3FB8B 2BNQD 5EU5B 4Y4KD 2AGJL 4O51B 4OZGF 2XQBH 5IB5A 4P2OB 1XGRB 2HJLA 1S7WB 5TFSH 2AP2A 2X09A 4PRBA 2XKNA 4OUUB 5CD5C 2DJUA 1JRHH 5BOPA 1KXQE 5HYJB 5CIPB 4Y19A 2KZWA 5D7IB 3MRGB 5D93B 1X5YA 1JFMA 5C08D 3GMNA 3JVGC 4LSPH 3U30B 3GI9H 4K3JL 1CYGA 1J8HD 1EUTA 4G9FB 4K8RH 4U6TA 3B2VH 2FGWL 4P5TA 2G5RA 4TUKH 1JHTA 4QWWD 3ES6A 1VPOH 2R1YB 3V7AG 3O9WC 3NCBB 4HFUH 4OM0H 5CFHA 1KB5L 1Q0YH 3TNMB 4LF3B 1QYGL 2VLLB 3SEPA 4LU5L 4JR9H 1RULH 5IG7B 4PLJD 2IFFL 5C0CD 1C1EH 4XNXH 5H37H 1GH7A 4OCWL 4X7CC 4QXTA 1KPUB 4EN3B 3RVXD 2BSSB 1CD1A 3MJ9A 4WFED 2BXYA 1N2RA 1U8OB 2QQNH 1RUPH 3E2HB 3MBED 5CEZL 5C0EA 2ADJB 3OG6B 4J3XA 4GS7C 4XCEA 4F80A 3SO3B 3ZDYE 3CZFB 3TF7C 1Q0XH 3PHSA 6FABL 2NW3B 5GGQH 2ED7A 1R5IB 2KKQA 4NKMB 3WHE1 2OXHA 3CZJA 2GJ6A 2JTDA 5GGUB 3MV7A 2ESVD 1NGWB 3EDDA 2DLFH 3MOBH 4UMGA 3QXWA 5D1XA 1UQSB 3B9AA 2NY0C 3ZE0E 3BRGC 1IAKB 1K85A 1JV5A 3O9WD 1T7ZA 3KWWA 4HZAA 5C0DB 3V8CA 2WLYA 1KIRB 4PJ8B 2YXFA 1EAJA 1CDUA 2DTML 4Y1AB 4IRJB 5KVDH 1T66D 3VXQA 4TVPD 5FGBC 5ALBL 4G5ZL 4V2CB 1OLLA 3BZDA 4HMDA 3LEVL 3QXDA 4OCMC 1UXSA 4HPOH 2BSRB 4Z7UE 5DQ9A 4UV4L 4ESKA 5IUSA 4U2YA 4YHMH 3TJHA 1M7XA 1A6ZA 3OZ9H 3MLTB 2WZPD 4ZPVA 3QUXA 2V2XB 1BOGB 3LRGA 3LV3A 3VG9B 3U9PH 5IVXB 1JWMA 4PIRF 3QNXB 4UT9H 5E6ID 4CNIB 4NQCB 5I71C 5DR5H 2IH1A 1G0XA 3K46A 3VG0H 1P6AB 2DKSA 3QFJE 1CICD 5D7LE 5D2NA 5I75B 4N0CD 1JFQL 3D5OF 4GUPA 3FO9B 4FQPA 4MAYB 5F1IA 5IQ9B 4S1QH 3CSBA 3BHBA 3WDIA 3MUGB 1D7FA 1NSNL 1CK0H 2F54B 3D18B 1Q9LA 5D7IF 3L5WB 1XCQB 4PRHA 3MRHA 3KHOA 3SDCB 4NPYB 5H35B 4KY1H 3WN5C 3ZT7A 2VZTA 4JRYA 1CS6A 5JHDD 2GAZB 2NLJB 3AMKA 4HJ0D 3U4EB 3BQUA 3LPFA 1CGWA 1MIMH 2HKHH 3X13A 3SE4C 1F00I 2VO5A 2M2DA 4J3WA 5I15H 4UNUA 1Y18B 4JFQB 2NY4D 1CL7L 2H2PC 4JO2H 4KUZL 1BQHB 4X80H 5D2LA 5DHVH 3RUGA 5K33A 4HLZH 2ED9A 2R1WA 1SJHB 3ZKMD 1UH2A 3EFDH 4GRLD 3MCLH 1FO0A 4WFGD 1AGCB 1KEML 3OJDB 1WZ1H 5I6XC 4L4TE 3J7HA 4KFZC 4H0GA 5FKAA 1XF4A 4OLVH 5JA9A 5HHMD 1TVHB 1AP2B 2VDKH 1G7JB 1CE6B 2GYSA 3CVHB 5CKGA 3S6CA 2Z9TA 4NIKB 5EC2B 3EYQD 2O5ZH 3MRDA 4YDJB 5IGXH 4LSRH 4UINL 1VDGA 4LDEB 1T1XA 3OKNB 3VFSA 4V1DB 2GY7B 2QHRL 4UBDD 3MCKA 1F11A 4MA7H 3WFHB 4YEEA 5JIPA 1EUUA 5C0GA 4MMXC 1EFXB 1QZ1A 2Y23A 4TVPH 5I1DA 2GTWA 1I9IH 4KKLC 1ADQH 1OAUL 1AE6L 2XQYG 5D7JC 1GGUA 2C5DC 2V17L 5E8PB 4QRRE 4Q6IB 7FABH 4GRWE 3ZYJA 5CHNA 4KMLB 5B3JF 5TE7H 1CDJA 4GMSL 4R2GB 4WW1B 2DWEB 3W81A 5CZXC 3K0WA 3HNSH 3UTQB 3DVNB 4MA3A 4Z6AT 4K07A 1VGEL 4KDTC 4G9DA 2LU7A 1EAPB 3MV8D 3WIFB 5IFJA 2R56L 1SBSH 1MWAA 4F7PA 3UBXG 4WJ5A 4F2MB 5IVXF 3BPNB 3TO2B 4MVBA 1HCVA 4YJZL 3EO0B 3DV6A 1KCRH 1CQYA 4Z7OF 1ZLSH 2A6KB 4QTHA 1T2JA 2EDKA 5FM8A 2W60B 2GFBB 4P46A 1MCEA 3QIBD 4JZOA 3IKCB 3F5WA 5EORL 5KSBE 1A7OL 4XWOC 5IR1A 2DBLH 5BO1H 4KGJA 4QGTA 2HFFA 5E8OA 5D71H 4UQ3A 2QADB 3U4BL 1NCBL 4I4WB 1IAOA 3QUYB 2JKXA 3DXAE 4OUOA 3VRIA 3CVIL 2AXFA 2X4PB 4W81A 1FIGL 3ARBB 3V4PH 4JFDA 5FUZH 1HH6A 4KZDL 3Q0HA 2QBWA 4ELMA 5IMOB 4XHJD 3HCVB 3ZDXF 1U42A 3QT2A 1KPRB 4M93B 1NC2A 5F9WC 1HOCB 2FATH 4D9LH 5E9DE 4G8EB 3RWDA 1E4WH 2G5BA 4R4FL 5FYJD 3U0PA 1AI1H 1VFMA 4XXDA 1MH5A 3E1F1 5CILH 4RGMB 4L8CB 3ZE1F 4LLYB 5I2IB 4AENA 1SJEA 4GW5B 3VWKD 1DSFL 1MCPL 4HG4K 5CJ5A 4V2BA 5F7WC 3L3HB 4YWGH 3GSOA 2HT4C 3MJ9L 1B0RA 3PWUB 3TA3B 1JWSA 4G6KL 3NN8A 5DRZA 5MEND 2QSTA 4Z76A 5FO8A 1T5XA 3U0TA 4KKCD 1U58B 3FQTB 4QHUB 3N0PB 2EDJA 4WW2B 3C09B 5TF1H 4HPYH 3R06A 1A1MB 3V6OE 4ZFFA 2AJUL 2C1PA 2PYEA 3QWRD 4YPGB 5I74C 3VXNA 5HGHA 3TN0C 2ZCLL 3IDYB 4KJYA 4QYOB 2XTJD 5E4IA 1IM9B 1J18A 1TJIH 1TQCC 3QWOB 5F1OB 3MJ8A 4XVUD 1NBZB 1PD6A 3HRZB 4P48A 3PGFH 1P2CA 1ZS8A 3RDTB 2NXYB 5BCAA 4ONOA 3KG5A 4GJTB 1HEZB 3MLSH 3SDDC 3R8BB 3UPAA 1XFPA 1QFPA 3JWOC 2OSLA 1P4LA 4XCYB 5CWSA 1GXEA 4AJ0A 1GC1L 4IS6B 4Y19E 5DURB 1Z3GH 3K4ZA 1QVOA 3T2NL 3LN4B 2Z8VC 1CQKA 4IDJL 1S9VA 3HG1B 3I75B 5DT1L 3X12B 4U6YB 4NO5B 3VWJA 2AEPH 2QKIA 4GKOA 5CP3A 1JZ5A 4XP1H 1DUZA 43CAB 1SEBA 2BVOA 3HB3D 1WT5C 5L2JA 4HS8H 4XBEL 1EK3A 3OJVC 4PJ7B 3O3BB 2XIDA 1PSKH 4KQ4H 1G9NL 1KNOA 2ARWA 3UBXA 1KJVB 1Q94A 5GZND 3HAEH 2C3GA 1GGYA 1BX2B 1FYTA 3NPZB 2Y06H 5FYJH 1MFNA 3VW3L 2Q6WB 2NTFB 3ORJA 4YLQT 3GSNB 2P5WD 3T3PF 2B4CH 3ZTNH 4E41B 5IKCB 4JN2A 4HIXL 4XXCA 3RIFK 3QEHB 2JJTC 1H3TA 2YHGA 2FD6L 4C58B 1UWEH 4APQD 3RVTC 3GHEL 1MJJA 1L0YA 5IB2B 3TYFB 5HHNB 1UM4L 1JP5A 3MNVB 2OTWB 1WBYB 1FO0L 2GJ6E 5ISZD 3MV7E 4RWYL 1ORQB 2AABH 3OX8B 2DTSA 3H3PH 3LKRB 4YH6A 3BH9A 1HHGA 3HRPA 4IM8A 4N9OB 1QKZH 2OL3H 3VCLA 2PW1B 1OGAA 3IVKA 5CBAB 4IBLT 3GJFA 4WW2F 2J8UA 4LVOB 3OKDB 5HGDB 1NCWH 3NH7L 3DO7A 4PJCF 1GRWA 2FHFA 4OFYD 4YBLC 2DD8H 4QEGA 4DK3A 5KS9A 3QHFH 2P44B 4YE4L 5F96H 4E5XA 3EFFB 1JPTH 4XMPH 5DMGC 1HQ4A 1G7HB 4DKFH 2VSDA 3C5ZD 1RZKL 2ORBL 3BT2L 3U7WH 2X4QB 5F7EH 2CUMA 3EJZC 4OI8A 4NUJA 4Z18A 2VRAA 4H20H 4HWEH 2E3VA 1XF3B 4M6NH 3VFOB 3VXPB 1S3KL 2SEBB 2KPNA 4N0RA 1MWAL 1EJOH 5INDA 1EGJA 3U79A 3SO5A 3JWNC 4G42A 2XY1A 3RWCB 4EBQH 4KV5E 4YHZL 1J1PL 3WNKA 1CGXA 12E8L 1K8IB 1KTRL 2WY3A 4MS8D 1I1AB 2P5EB 4LOUC 4ZDHB 4GBXB 4I0PB 4YXHL 4HFWB 1KT2A 1YQVH 4TTDD 1J1OH 5C0BD 1IILE 3FZUD 2X70A 1RUAH 2GK2A 4Z78B 1A7PH 1YA5A 4FQLH 4HCRA 5CEXA 5D2LE 5B39A 3V2AR 3RUGE 5ADPL 1ACYH 2RHEA 4NO0D 1BIIB 4HKJB 3MGTA 3KPNA 4ODUB 5J6HA 3GSXA 1M05A 1JI1A 1UWXK 3ARYA 4YHYB 3KXFD 5J13B 4PJFA 1XF2B 1MQKH 2DS4A 1IGFH 3MNWB 4XAWL 4YUEH 2GT9A 3BDXA 1IGIL 3G04A 1Q1JH 4TRPH 4FTVA 3BSZH 3WKMH 4YAQA 2FIKA 4LCUB 5C2BL 4ZD3L 3B8SA 2O93L 4PYGA 2VR5A 4NM4L 5FCUL 3FOLA 3L5XL 3U9UB 4LBEB 4MDJB 3ARGC 3QG6A 2EKSB 3O6ML 4CVXB 3U30C 3V0VB 3RJQB 1N7MH 1K5NB 5K9QG 4AEIL 1S7RA 4NZRL 1SY6H 1NCCL 4XPTL 2IC2A 3O8XA 3BZFA 5DJAA 1HSBA 2WBWB 5T1KB 3DURA 4J4PC 4J3OC 1I8LA 1T5WB 2CDEB 4TVSa 4D8PB 3PV6A 4P2OD 3DMMA 2CLVB 3N9GL 2CDGB 4MQ7A 2KUTA 3V5HB 1PBYA 4J23A 5A43C 4F58H 3FN9A 3VD9A 2APWA 1E0OB 1CDIA 2BSTA 4R3SB 5HYJD 1FGVH 3MUHL 3SO3C 4TOYL 2AV7A 3DSFH 4YX2L 1FC1A 1QPPA 5BRZD 3TJEH 4MJIE 5T1LB 2X1OA 3CFJA 3CFBA 1LEKA 1I85A 2CUIA 2ITCA 2A9NL 1G7QA 3GM0A 1BP3B 2OR9H 4MD0A 1IM3A 3TEUA 4UOW1 4P9HH 3EHBD 4LARL 4I5BA 4Y4FB 1TZIA 1NGXB 1HQRA 3DROB 1GYAA 3LHPH 2ICEB 2UZIH 1MRCL 1SQ2N 1YPZA 3MRKB 4WUUA 3A6OA 4JFDE 5FUOL 5JHLL 4ELME 4UU9B 4YFLI 1Z9LA 2DI7A 2YD9A 4YBHA 2PO6A 3VFUB 1CFNA 4EN3D 3HPLA 4M7LH 1F58L 3I6KA 5IMMA 4R26H 4WV1B 3WUWB 4EI5A 3SDAA 3OKMB 4NJAH 2F74B 3QJHA 1KTLB 2APTA 2EZ0C 4PRDB 3DI3B 1WICA 3BZ4B 1XEDA 3PL6C 1XT5A 2EDEA 4OLUL 3KLDA 2Z91A 1P69B 5KJRH 1G0DA 2H6PA 3DLQR 3VG9C 3D0LA 4WU5B 3GKZA 1WQVT 4D9QD 2HYMA 1A7RH 1U8JB 3BH8B 4FRWA 5CJOL 1PYWA 4NCDA 1NL0H 4OCYH 1ZGLA 5I75C 3DYMA 1TJHH 1KG0A 3QHZL 4RZCA 4MAYC 3GJEB 1N64L 4I1NB 5HYSB 5JXED 3HA0A 5GGRB 5CCKH 3BGFB 4HC1H 4PJ8D 4JFPA 3SDCC 4Y1AD 1A3LL 4IRJD 3SE9H 1QSFD 4UILL 2FO1A 2YPVH 1IGCL 3TIEB 4DN4L 5DDHA 2PYEE 1R3IH 4OF0A 5C7XH 3GUTB 4PY7A 3C8HA 5EUOA 1PG7L 4Y89A 1WEJH 3O3AA 1JGUL 4F7MA 3LEYH 1T4KA 3AVEA 4HHAA 2MQCA 2IQ9H 4P5KA 3PHQB 4O58L 1QRNB 4HT1H 2J5LC 5TE4H 1I7TA 4NQCD 3P40A 3K74B 4PJIF 4QXGH 2F53B 4FQ1H 4OIAA 2MHAA 1UYWH 5CIPH 5C6PB 1KJ2B 3QP3A 4DAGL 5HI4C 2F54D 5EDXA 3NCJH 4J1UB 3QUMA 2W9EH 4XBPB 4JRXA 2IAND 5I1CH 3IJYA 4Y2OA 3N06B 4NC0B 2NPLX 4ISVB 5T1MA 1CF8L 2DL2A 1HHKA 4IOSD 2ZG1A 4MJ6A 1IC7H 3GKWL 3KR3H 1EGJL 1RK1B 3Q5OA 4XT1C 3IDMB 1KSRA 1DEDA 4IMKC 4TNWK 1CWVA 1YZZA 1VADB 1T3FA 2CUHA 2FO4A 1H8OA 1FYTE 2AK4D 2A83A 2FX7L 3R4DA 4M61A 3SGJC 3VU2A 1QSEA 4AG4H 4Y8DC 3L3GA 4OIIH 4HIHB 4MNHA 3OKKB 1ETZA 3MXWL 4XWGH 1S7XA 3KLHC 1XH3B 4PREA 32C2B 3FHAA 4HCRL 4BZ2L 4L3CA 3CH1B 1KJMB 1R3LA 2B0SL 4X4ZA 4RRPG 1LEIA 1TZGL 5EO0B 1MCQA 1ZHLB 5IJVB 4V1DD 3F7PC 4QTIL 2R29L 3EOAB 5MEPB 4PR5A 5L8LB 5MI0C 1QBAA 3OHXB 3C8KB 1C5BH 3RVWC 4OGYH 2FLRT 4M4PA 4QLRA 5C8JA 5B38B 1A22B 4O9HH 3DETD 4WEBL 4YK4B 5HHXH 3DIFB 4LFHG 1Z0NA 4XP4L 4P5MB 1OGAE 3QUKB 4KK6C 1T2QH 1R5WB 4GO6B 4QRPE 2J8UE 2OZ4A 4PS4L 5KVFH 1BD2B 5J1AB 1BVLA 4I77L 1JYWA 4JQIH 4RMUA 4R2GD 3QJFB 2W07A 5L2KA 2UZYB 5CBEA 3PE9A 15C8L 1IGJB 3TBTB 1AGBB 4OJFH 1H5BA 5CZKA 5KS9E 3E0GA 2Q8BL 1JGDB 3GSWA 4HWBH 3WNLA 2CIKB 3GSUA 4OFIA 2K3TA 4EVNB 1T04A 2P5WE 1IC5H 1XIWA 4XP6H 4EDWL 4Z7VF 1PEZA 4RGMC 4HIIB 4K7PX 2VDLH 3TFKA 4KROB 3RTQB 5F9JB 3BGMA 1ZLVH 5TE6H 4ZXBA 3VXOA 1PZ5B 1ZA3B 3DX6A 4N1EA 4M7ZB 2QADD 1QFUL 5BS0D 2GCYA 3F7VA 4K9EC 4EEEA 1U8PA 4NZJA 3QUYD 4YHKL 1N4XH 3P73B 3V9FA 2IBBA 1X3DA 4OZ4B 5DFVD 3ARBD 4WHTA 3O4LA 2E6JA 4OCRL 5CJ8A 3REWB 1KFAL 2XI9A 3L3IB 2BOBB 3C09C 5AAWA 1O7SA 3HNTL 4JREB 2BRRH 4KAQH 4MDIB 4G8FA 5IBLD 3TCXA 4WO4B 1R3HA 2XZZA 1RU9H 1JPSH 4OZGE 1J88A 5TDNB 1YJDL 3ARDA 3FT2B 3QPQD 4DVBA 5KVGL 3H42H 3CVHH 2JLLA 1JF6A 1YECH 4YHIA 4HEPG 4PJFE 5ID1A 4K23H 4M5YH 3VFRA 5E2JA 3IDGB 1ZT1B 2WBJC 4YQXL 1NAKH 3ZL4H 4FTVE 2YWYA 3E6HA 4YIQA 3TA3D 3PV7A 4JB9L 1KBGL 1QA9A 4HQQH 5IK3A 1P4BL 5A40E 1P7QB 5I18L 2EDRA 4R0LA 5J1SC 4ZUWB 4U1JB 5D1QA 2ZCHL 5DMJB 1RUQH 1U8QB 5FF6A 1OSZB 4JQVC 2CQVA 3OWEA 3GGWB 4PYHA 4X7TA 3HNVH 3VFTA 2BDNL 4C56D 5C0FB 2DYPA 1LO3L 1CXKA 3G5YA 4ZUUB 3C9NA 1IM9D 3FAWA 1RSFA 4LRNL 3QDAA 5LGHH 3OAZH 4TULL 1IKNC 4D0DB 1LD9A 1T1WA 1EPFA 2XZQL 4PRIB 4RGNC 3RDTD 2NXYD 4PG9B 4M1DH 3UEZA 4IRSD 5FB8A 4R90L 5H37G 1XGPB 5EPMB 5IJKC 5CGYD 3HG1D 4RX4D 4DGYL 3BVNB 2HTLC 2H26B 2Z35A 5K9OA 3BEWB 4JHWH 3G5XA 5BZDA 4IEFB 4ODVL 4M3KB 4GQ9L 3HC0A 4QF1A 3EJYC 3RZCB 4PJGF 1QBLL 3QUML 1DEEA 1MRDH 2A6DA 4HSQA 1YPZE 1T7VA 3MSPA 4GRMA 1OCWH 4NKOA 4WUUE 5J0BA 3LN5B 3PWNA 5EWIH 4UQ2B 4KH2A 3T1WA 3T0AA 4ETYA 3LEXB 4F3FB 1HCFX 1U3HD 4ZUVB 4LVOC 4LLMB 2FX8H 1V3JA 2VLRD 3HZKA 1OB1A 1YN6A 4WTXA 2NY1B 4E41D 5EBWB 3Q6GL 1KTKE 5IMLA 4PJ9B 1GZQB 5KAQF 1X5XA 4G6JL 5HJ3A 1BQLH 5DZNA 5JUEH 3FT4A 2DN7A 4LRIA 4K9EH 4HBCL 5JOEA 1L7IH 1NGYA 4LHUB 2O61A 4OCSL 1F3DH 1YMHA 4R7DA 2B1HH 1LILA 1DLHB 4P2RB 1V3KA 1LVEA 4G6FD 1CXFA 4PJDA 4TSAL 2EDOA 1ZT7B 3KPSA 3MRCB 4XBGB 5FYLL 5C0IA 1NBQA 5E4EB 4YFDB 3BKYH 4IOFC 2D03H 5IESL 4BFIA 2HT2D 5LCVH 1I1AC 3ULSB 4LP5A 4LKCA 1OL0A 1HILB 4GBXC 2HLFC 1J10A 4I0PC 2H1PH 5EUOE 4KVNH 3WNPA 4HXBH 1NDMA 3AREA 4JZNA 2YZ1A 1PKQB 1MCSA 1IBGL 2ADGA 1HINH 1RZGA 4F7CA 1MELA 5KG9B 5E2UH 4EIZC 4FABH 2AJ3A 5EUKB 4LGPB 3WLWD 1GZPA 4JKKA 1CVRA 2XWBA 5K93A 4N8VA 1QEWA 4YHYC 4I18A 5J13C 2E8YA 4HLZG 5JLZA 1LE9A 4Q9RL 5KVEL 4OLXL 3REVA 3BAEH 4I2XA 4R8WL 1U93B 4KI1A 1AD0B 3BD3A 4JRXE 4NN7B 3L9RA 3U2SB 3MOAH 3O0RH 1AFVL 2CKBB 2P5ED 1JN6B 1OT1A 4X8JA 3X3FH 4BSVB 5HVFB 2Z31B 2MCPH 4Q0XL 5FOJA 3VH8A 2XKSA 1T03L 4J8RB 2BXZA 3WEXB 2YD1A 1RZFH 1YN7B 2FGZA 5EO9B 2DAVA 4PGJA 3ILPB 3RWFB 1DQMH 1HKLH 5B3JE 1VKXB 2Q3AA 3IAPA 5F97E 5EOQH 1T83A 3TBYB 3GSNH 2Y6SD 5IEHB 1QSEE 2A0LD 1AHWA 4L5FL 2QHLA 1RPQA 3STLB 2C7UB 4X6DF 2OXGA 4JFFE 4ZAKA 4QNPF 3K80A 3ULUF 2NNAB 2YD8A 1BVZA 3EYSH 3MA7A 5IB3A 1F6FB 1P1ZB 1TMCB 5FYLE 2EDQA 5ECJE 2E27L 1UWGH 2EECA 4GXVL 3RI5F 1AR2A 1I1YA 3X14B 3V0WH 5FXCH 3FB7A 4ZOBA 4UDTB 2FNBA 3HC3L 3EOBA 2XZAL 4FQJL 1F6AA 1GIGL 1OP3H 2HVKB 4QRTB 1DN0A 4WNQB 4F33A 1FVCB 5DK0B 3HE6B 3VXSB 4Y4FC 4DOHE 4N5UA 5FO9B 1GGCH 1B0WA 1OD7A 1U92B 1J9CT 5I30L 5T1KD 1A4KB 5LQBH 1MCDA 3OAYK 2R2BB 3KPPA 1FV1B 5L2KE 3KJ6L 2AK4E 1S5HA 3MLUH 5DS8A 4U1KB 4PP8C 3I3EA 3G6DH 2MWCA 3ZE1E 5DMKA 4RAVB 3TWCL 3QPXH 1FG2B 3VRLE 5J1TC 5BZWB 4X9BA 1OTUD 4PJBB 3BPCA 1MLCB 4NO3B 3F6IA 5T1LD 2D31B 3HZMB 4XCNB 5F3BA 4U6XA 2BVYA 1MCHA 1HIMH 4FQ2H 1NCAL 3BO8B 4D0CB 1WGOA 1BHGA 3HPJA 4H8WH 5HSFA 4AH2A 3H7BB 4X6CA 1U8KA 4QY8B 1N5YH 5I8CB 3E3QC 1D6EB 1OAQH 2DQUH 1PLGH 1YYLL 2WQRA 5F7LB 3BOVA 1E6JH 1YYMH 4ONGL 3O4LE 3SKNA 5HYEA 5KSAA 4P99A 2G9HB 4NQEA 5EO1A 5JW5A 2J6EA 1U8IB 4MD4A 1O5DT 5BJTB 1C08B 1FZJA 3QQNA 3F8UB 3THML 2HFEB 1NEUA 4OBSA 5DHVA 1OVZA 5F89B 3NFSH 3SPVA 3MBEA 1FQ9C 2GY5A 4JM2C 4NZDA 2LU3A 2O5YL 4OB5H 4FXKA 2BHZA 1ROWA 5CP7B 1B90A 3KPTA 2EICA 2P7TB 4Y5YB 3LQZB 3JVGA 2Y5TA 3INUL 4HV8A 4K3GA 4DKAA 2EO9A 2MMXA 3KYNA 4B41A 3A6BH 1DR9A 2VDQH 3N85H 3EO1B 4MZ2A 2XZCH 4PY8I 1N6VA 4RAUB 3V6FB 3I3DA 3C5SB 4I3SL 5DZOA 3O9WA 3P11H 4CVZB 1CIDA 3IU4L 4JDTH 3UTOA 1M71B 3MRQB 4DW2L 1JGEB 4DCQB 1FH5L 3RY6C 1FL6A 3MRIA 4F9LC 4QHLA 3K1KC 3TCLB 5BQ7A 4B53A 3AXLA 3PWPD 4U1NA 3RHWK 1IAII 2EYRB 2ARJQ 1UM5L 2VABA 1XGQA 4ENEC 2LQRA 4KK5D 1S7UB 5CJQL 4DEPC 3QDMA 3TF7A 3H8NA 5GGTH 3SDXF 1X4XA 2F53D 4G8GB 5T33L 4NP4H 2C26A 2DMBA 4KI5C 2AXGB 3HAEG 1VENA 4LPYA 3T0ED 3FCTB 3OR6B 1S9YA 4KMTL 2A74B 1GHFH 1WK0A 5EG6C 3VXUB 2ARJA 5D5MF 2XQBL 1CFSB 5GS0D 5IMKB 1J0JA 5FO7A 4PP2A 5TFSL 3WFBH 3HR5A 4X6BB 3TBVB 3PNWB 1JYVA 4BKLA 5SX4I 5FGBA 1G1YA 1Q9OA 4XVTH 2RQ8A 1JRHL 1IEBB 1U91A 4X0KA 4XZUA 5JOFB 4FQIL 4MWFA 3OB0K 4K3EL 4HS3A 3W82A 4YK4C 4HLJA 3IFNH 4GKNB 4LSPL 5I1LB 4R7NB 3GI9L 4K55A 5CMAB 4K8RL 3QXAA 4Z7QF 5F7UA 1KCVH 3B2VL 4Y2DB 4JFHD 1KPVA 5FDWB 4TUKL 1PQZB 3FO1A 1BWWA 1VPOL 5TGBA 1AGEA 2WANA 1NUGA 1RJYB 1ZLUK 3RWEA 4HFUL 4OM0L 3IDIA 4WTZG 1Q0YL 5TDOB 4U1LA 3W9DA 1SM3H 5GGSY 4JR9L 1RULL 1RD6A 3QNYA 2B5IB 1C1EL 4XNXL 4V3EB 2XN9A 3M1BB 5HHMA 4FZEH 3PUCA 5JDSA 3O6LH 4QT5B 2XWTB 1BZ9B 5IW1A 4L4VB 1OQXA 4ZFZA 2X5PA 5E2WH 3WN5A 4D9RE 2QQNL 1RUPL 3R0NA 1VEPA 3RTQC 2VDOH 1EH9A 1K3IA 5ANMA 2COQA 3LS4H 4WWKB 4EUPB 3SE4A 4YHNB 4R96B 1Q0XL 1FNSH 4PJDE 3KPSE 3O41B 1HHHA 4CN1A 5GGQL 5CAYB 4MXQC 2CRIA 1AQKH 1FN4B 2OQJA 4U4BA 3S37H 2DLFL 3MOBL 4CKVX 5JZ7D 4PJXB 4PV9A 4MSWB 3LKSB 2DQHH 2WUCL 1KXTB 4JPWH 1ZVSA 5BV7B 2EYTA 3KYOA 3LRSA 3QA3A 1ZSDB 2FR4B 4JREC 1H9VA 1QHOA 1UM6H 5KVDL 3ULVC 3QIWB 3QHTC 2VLRE 1JPFA 1YY8A 2VOTA 5DQJB 4HMEA 4OAWA 1UZ8B 2IBGA 2DQTH 4HPOL 1S7VB 3MRRB 3D3VE 4YHML 1KJ2H 4KROD 2BY1A 3OZ9L 1IC4H 2QR0A 1X5ZA 1XMWA 5DRXB 5GS0H 3GSVA 3QIBA 1W0WB 4I2XE 3U9PL 1I1FB 1OD9A 4M9OA 3M8OH 3HZYB 5EH1A 1AKJA 2EH8H 4UT9L 1MVFA 5DR5L 4PJEF 2CLZB 3VG0L 3UYPA 5DJ8B 4NFBA 3CDGB 5IBUG 3NZHL 3UPRA 2QJDA 1IQDB 2R4SH 3BXNA 1G6RA 3I02B 3KLAB 4S1QL 2YMXL 5EB9A 1CK0L 4JPIB 4X6EB 5SWQA 2BX5A 2XICA 1MEXH 1ZT4B 4ZYKA 2PN5A 2OYPA 3D9AH 3IGAB 3IFPB 4J6RL 4KY1L 3UYRH 1NUDA 1IFHH 1QLFA 1T20A 2NTSP 4WO4D 4GKSA 3AROA 1KLUA 1A9BB 3HAEA 3WDHA 1MIML 4RIRA 1WFUA 3RWHB 4F8TA 4NKDA 5I15L 2PNDA 5K9KA 2R2HB 1WFOA 1ES0B 4WI2A 2NX5B 3DECA 1E4JA 4JO2L 1S78C 3FTGB 1FP5A 4X80L 1YEJH 4WI4A 2OTUA 3EFDL 1P7QD 5J3HD 1DFBH 1FFNB 1WZ1L 3NA9H 1JF1A 5DJ2A 4OLVL 2HLAB 4OM1H 2VDKL 2GSIB 3KPRD 2VR9A 1G9EA 2OL3A 3CFIC 2O5ZL 5IGXL 4LSRL 5C0JA 3RZCC 1A21A 2C4FT 2Z92A 4ZS6C 4WTZA 3FO2B 4NRZA 4O2EA 5LAXB 1I8KA 4MA7L 4MQXC 3ISWA 2GUOB 2D4DA 1M1SA 4PRID 2VAAB 1I9IL 2NZ9C 4FS0A 2JIXB 1ND0B 2IPUK 1ADQL 1LP9B 3D2UB 2NY1C 7FABL 2GTZA 4UT7H 1TITA 4BZYA 3SCMB 1M7IA 4BFGA 2YUVA 2NY2D 3LY6A 4QHNB 4X4XB 3HNSL 1OT2A 3T1FA 2D0GA 2EE2A 5EU4B 1TDQA 5DXWA 3CSYA 1HXYB 1SBSL 3TT3H 4RMVA 4NKQB 5DZLA 4X6CE 1MNUH 2FZ3A 3GMLA 1X7QB 4MX7A 1KCRL 2DMCA 2K9UA 3U48A 3QUZC 3UTTB 1ZLSL 5DA0B 1UVQA 2HVJB 2HH0H 3P4OB 1JTTA 1GL4B 2I5YH 1EZVX 4NQEE 1HDMB 3MRMA 4HGKC 5BO1L 1CGUA 4KKNA 5D71L 4CMHB 4U1HA 5EU6B 1NEZB 1JMZA 3QCVH 4BQ8A 2HG5A 5ILTH 1OAKH 1MFCH 3HI1A 4Y16B 4PJ9D 3SDDA 3V4PL 5FUZL 1KEGH 3ULUD 1U2HA 4NQDB 1MOEA 2HKFH 1ZK9A 4XC1H 5FM4A 2WINA 3ARFD 2VJXA 2FATL 4JFZH 2AKRB 1WZLA 4D9LL 4DQOH 1E4WL 4HK0B 1C7SA 1AI1L 3T65A 3TESA 5BVPH 5J11B 1F2QA 3BIAX 5CILL 3N1PC 4FQQB 3UP1A 4FP8H 2D7MA 4PD4K 4EIGB 2I9LB 5BOZG 4LCWA 3ERYA 4NRYB 4K3HA 3VDCA 2R0KH 1WT5A 2X4RA 5F6HI 4NN7C 2BJMH 3H9SE 4HW6A 1DBBH 4L8DB 3FFCA 5C3LD 1MJ8H 4AIZA 1NCNA 3D6GA 5E94B 2CMRH 4I0KA 2Z31C 2FYYA 1Q9KA 2R8SH 4H25B 4P5TC 5DVOA 5FHAH 3OXRA 2HMIC 1I75A 5TF1L 1FNAA 4HPYL 4KHXH 1HHIA 4Z0XB 4YFLF 2VTFA 2JJTA 3EYOA 2FSEA 4YGVA 5C9JB 1F8TH 2A73B 1MFEH 1NFIA 1ZHBA 1LP9F 1KACB 4TUJB 3EO9H 1M7DB 1XZ0A 2LU4A 3BYYA 2VIRB 4LL9A 1TJIL 4ZQKB 4G59A 4MMZC 2HWZH 3NPSC 3P4MA 1GOGA 2X6MA 4RISH 4IJ3B 1A3RH 3I50H 2R1XB 3MLSL 5JPNB 2X9WA 4DZ8A 2ZG3A 3I9GH 1MREH 2Z31D 3TGXA 2QL1A 1RHHB 1CFTB 3EBAA 3B5HA 1OOAA 1Z3GL 2ZSVB 5JPMB 4L9LB 2YPLD 1MI5D 3O3EB 4XRCA 5HXMA 3VD3A 2ZUSA 2D9QB 4DKDC 2AEPL 4M6MH 1YQ2A 2C9AA 1XF5B 4XP1L 5HI3C 3BP5A 1U6AH 2WM0A 4HS8L 5J7CC 3G6JB 3WIIH 4GOSA 3AU1A 5D96C 1PSKL 2ICWA 4KQ4L 3P0VH 4NQTA 2XN9E 3D69B 3KXFA 1KTDB 4OV5B 2Y06L 5FYJL 1GC1C 3EJJX 2DOCA 4LVNB 4PG2C 2B4CL 3ZTNL 1E28A 4WTWA 2FEEL 3NA4A 4KHTL 4G7YH 4PJHA 5ANME 2IAMC 5F70A 3S5LB 5D2NC 2LAGB 4CW1B 4OZIB 3T77A 2OK0L 1UWEL 4HC1A 4HS6B 3MV9A 3HE6D 3VXSD 4HUXB 2AABL 1DVFB 3H3PL 3AY4C 3FO0H 1AXIB 1CFQA 5FOBA 4TUOB 4XX1E 5MHSD 4Z77A 4E9LA 1UZ6E 2VLKB 1QKZL 2OL3L 4X5LA 2W91A 3QH3B 3M07A 3FB8A 3JXAA 4OF7A 2NW2B 4O51A 4PGCB 3FHQA 3OJ2C 1P5UA 4FQXB 4YZFF 1S7WA 1NCWL 2IFGA 1BLNB 4OUUA 3WLBB 3QRGH 1GAFH 3TH2T 5D4QA 4PRPB 5D6DC 5IF0A 2E7CA 5HYJA 1FNLA 3QHFL 5CIPA 3ARGA 4MB3A 3MRGA 5F96L 4GG6B 4XMPL 1JPTL 4M3JA 5B8CB 3U7WL 1DQDH 4XNMB 5F7EL 4G9FA 1RQ5A 2CKBH 4JY4B 3QDJA 4H5SA 4H20L 4HWEL 2NR6C 4XPGH 5F44A 4M6NL 3OPZH 2R1YA 3TO4B 4YBQD 2EE9A 3SE3C 1EJOL 4Q97A 3TNMA 1E27A 5T3ZD 4J4PA 3FQUB 4LF3A 2VLLA 4YHPA 5IG7A 4YGAB 3G6AB 5EZJB 3NABH 3EYFB 1EO5A 4AL8H 2BSSA 3QR2A 2ZWLT 1OTTD 3VI3E 3RWGA 3MFFB 1U8OA 1KULA 4W6WB 4HZLA 1RZKC 4XI5C 2ADJA 1YQVL 5E99H 1J1OL 2Z0BA 3CZFA 1RUAL 5HGBB 1A7PL 4L9DA 4HUNB 4YC2B 2LV4A 4FQLL 5I1EH 5FECB 1VA9A 2NW3A 3V79C 4LPVA 3JV0A 1T7WA 1ACYL 1FGNH 1R5IA 1Z5LB 3C6LB 1FFQA 4NKMA 5GRUH 1FFOB 1NGWA 4WHDA 1UQSA 1IAKA 1YEIH 4GAGL 5I0DA 2GI7A 1MQKL 5C0DA 5C09A 1IGFL 1KIRA 4PJ8A 4C55A 1Q1JL 4PJGE 4Y1AA 2XRAH 3PP3H 3BSZL 4TRPL 3WKML 2J8HA 4ODXB 3C6SB 5ETUA 4XH2A 2BSRA 5EOCH 1A6PA 1B0GA 1A64A 3FQRB 3VE0A 1OP9A 1LNUB 1HXMB 3E8UL 3RIAF 3TVMD 3VFMA 1NCDH 3MLTA 3PL6A 5JQ6L 1I3UA 2P8MB 1N7ML 5TQ2H 2ICCA 4J2XA 4Y2DC 1BOGA 3CSPA 4BQBA 3IDXH 3EKCA 1NAMB 4G8GD 3QNXA 3VMOA 1KCUH 2DF3A 4HX1B 3TIDA 1A4JB 1AXTH 3FO9A 4MAYA 2KZ1B 3BP7B 5IQ9A 1CT8B 4FQHB 3MRFA 3MUGA 3D18A 4BSWB 4NUGH 3L5WA 1XCQA 3SDCA 4NPYA 3U46A 2P4AB 2PCPA 4GQPH 4F58L 1CBVH 3OXSB 3ZYIA 4POZD 1P84K 1FGVL 2GAZA 3U4EA 4BSJA 4WDIA 3KPRE 5E8DH 3DSFL 1KOAA 1D9KC 3RWJB 3TJEL 1HH9A 4FMFA 5T3ZH 1LEGB 4XCCH 3CCHA 1Y18A 2D0HA 5JORB 1G84A 4JFQA 2XXMB 2OR9L 4S1RL 5E7BA 1BPVA 2PXYD 1BQHA 4O02H 4JN1H 4Z7UB 3LHPL 2GIYA 5BV7C 1FHGA 2UZIL 1SJHA 2DI8A 5F1NB 1AGCA 3OJDA 4L8SB 3IRPX 5D1ZC 2RGSA 2QV2A 4JVUA 2R39A 1TVHA 1T7YA 4JRWA 1CE6A 3ET9F 3CVHA 4M7LL 3DGCR 4WIQA 2VDNH 1LQSR 3MGOB 5EC2A 1ONQB 3QFJB 5D7LB 1GGIH 4YDJA 2VUYA 4NJAL 3PDOA 1MUJA 3OKNA 4V1DA 3IFOB 4NNPH 1S9KC 4BA8A 4A6YB 4WWKD 4LCWE 3RKDD 5KJRL 2V7HB 1E4XI 5JOPE 1A7RL 3CGTA 4IMKA 1EFXA 5ERWB 3S35X 3V6BR 2AJVH 1X5JA 4OCYL 1NL0L 2DB8A 3L3OB 4JO4H 4KRPD 3S36X 3BKJH 3FFCE 4U7SA 1TJHL 4OV6F 1BFSA 1WWWX 3HUJA 2WW8A 2KL6A 2G75B 4PY8J 3T2OA 3U7AA 4M7JH 1MQ8A 4LNVA 4I8DA 3SGJA 1C5CH 3VD5A 5CCKL 4HC1L 2DWEA 2L4OA 1MFDL 4MHHI 3QCTH 4AYFA 2N7AA 3UTQA 3DVNA 1U3YA 5HVHC 3SE9L 4PBWD 3QIWD 4LAQH 2YPVL 3E6FB 3FQXB 3M45A 3WIFA 3MFGB 1M6OB 1R3IL 5I17B 4G6AC 4YDIL 5C7XL 4P23D 1MHHB 4F2MA 3TO2A 2MNUA 5DSCB 1QD0A 2ZPKH 3EO0A 4WI7A 4JY5H 4P9ML 3RI5K 5I8KH 5K9QI 5DUBB 1ZWIA 2A6KA 3ZDYF 3MNZB 2W60A 2IQ9L 2GFBA 1V7MH 1FNHA 1UJ3B 1TTGA 4HT1L 5C0RH 5TE4L 3VXMB 5JQHC 1XGYH 1NBVH 4LHJB 2ATKB 3ARRA 5L0QC 4QXGL 5BW7A 4LLVA 5DJYB 3WFEH 5T5NF 1UYWL 1JHLH 4CN4A 4B0MM 2R2CA 2X4PA 3DRTB 4U1IA 3NCJL 5CSBA 5D7SH 5JIKA 1KCSH 2W9EL 5IMOA 1HHJB 4RNRA 1VB9A 3L7EB 4D94A 1KPRA 2PTTB 4K71B 5I1CL 2XA8H