1W0WA

Crystal structure of hla-b*2709 complexed with the self-peptide tis from egf-response factor 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
publication title Thermodynamic and Structural Equivalence of Two Hla-B27 Subtypes Complexed with a Self-Peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0wA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1w0wA01
2BFVL 3L7EA 1U6AL 4Y16A 5EZIL 3S35H 4R2GC 3TO2B 3QNYA 1RIVL 1JK8B 5F9WC 3QEHB 5I1IH 4MGXA 3V6FB 5L2KD 4DEPB 5B8CA 4JO1L 1R3LB 1FVDA 5DD1L 1DLHA 3DLQR 4XPFL 4APQB 1KN4H 4L9DA 1GC1L 1INQB 4PTUB 3FT2A 1HH9A 3SCMB 3UZVB 5DSCA 3WHE1 2ARWA 4JANB 5I1KL 1ULVA 2AKRB 5IK3A 3S36X 3MODH 2HMIC 2ESVE 1NGPL 4WFFE 4KKLD 1ADQL 4I5BB 4XPTL 1T5XA 5KSAA 1DSFH 3RU8L 3TIDB 1CFSA 5JOPE 5D5MA 2DTMH 3OTTA 3HA0A 3SKOB 2ADJA 3WE6B 4MMZC 3WBDA 4CVXB 4ZFGL 4OTXL 4AEIL 3S34L 5FM5O 1U8IB 1CYGA 2R69H 2ZSWB 3D1MC 1B4RA 3PWLB 1KJVA 3HFMH 4HEPG 1AXSA 5DJYA 2C3GA 1AI1H 1YEIH 2UWEB 2P8PB 4R7DB 1M05A 5D1XA 2OQJA 3VRLE 3K4AA 4X9FA 1H5BA 2PETA 4JPKH 4JFEE 2LQRA 4S1DD 3QJHB 3BSZL 5CEZD 1SVCP 1T66D 2B4CH 2P24A 3VDAA 4GOSA 3U1SH 3OAYK 3HC3L 1WICA 3O8XB 4P3DB 5ADPH 3QUZB 1RJCA 4WW2C 5ISZA 4MMXC 4KI1A 5E5MB 3VXRE 1ZGLB 4UT6H 1OSPL 4JO2L 4UILH 3VI3F 5TPWL 3MRFB 1X5ZA 4OCWH 1RIHL 3NABL 4YFEA 5GPRA 3CFBA 2VDQL 4JRYE 4JY4A 3KPRD 5DYOB 5HDBF 4X5WA 3S35X 3RGVB 1RJZB 3VG9C 1P84J 3CNKA 1XF5B 3UAJC 5K9QI 1G9MC 3LRSA 2OX5A 5F6HI 3RWHB 5E8EB 2R9HC 1KT2A 3UTPE 4MQXC 1WIPA 4G6JL 3T2PA 3BHBA 3NCFB 2O93L 1WBZB 5DEZA 2V5SA 4ZYKA 3DIFA 5GGVL 3OPZH 4HT1L 2FHFA 4F7CB 3Q48A 1LK3H 4MWFA 5FV2A 3FQRA 3QXWA 1JZ3A 3F12A 3PNWA 1AGEA 3TVMA 5E5RB 3KAAA 5GGQH 2CIIB 1U8JA 2FX8L 4P57B 4ETQB 1T1XA 2OJZL 3LY6A 1JPFB 2VXTL 5JR1H 4IRJA 1CT8B 5SX5H 5DFVC 5GS1C 1MPAH 3EYVB 4M5ZL 4DKFH 2DLTA 2X9WA 5F21B 3RUGB 5JW4Q 3T0EA 2P49B 4XPGL 1RSFA 3HE7B 4JFYA 3HLAA 4KQ3H 3M17B 5I1HH 4NYLB 5GGRB 4KUCF 1BBJA 5FCUL 3A6OA 5JPMB 2VDLL 3NZ8A 4QRUA 3T77A 3VFOA 4CJ1A 5DMYA 4OFYA 3E0GA 3MX0A 3QHFH 5D6DA 1KOAA 2E7LC 3JV6A 1EMTL 5IG7A 1EO5A 3PG2A 2Z91B 3G08A 5IHBA 2R0ZL 1GC1C 1NLBL 4MDIB 1FZJA 1KV3A 5DJDA 5E4EB 1MJJA 4PRDB 1AR1D 5CAYB 4OD1L 3DV6A 3AS2A 4HV8B 1MSPA 2RAMA 2VSDA 2BSSB 1AKJB 3ARSA 3KLAB 4JFHE 4YHIB 5EWIL 5F9JA 2EDQA 3KHOA 3L5JA 3QUZD 3VGAC 4X6BB 3HC0B 3GSRA 2G5BA 4A6YB 1PD6A 1IQDA 1OAZH 1K2DB 2AABH 3S88L 5LQBH 3UPRB 1WAAA 1TJHL 2FCBA 2AJZB 3RPIA 3I9GL 3UTZB 3GKWL 1JZ2A 2MSPA 5ETUA 4ZS6D 3V0WL 5T5FL 5T5NF 4TSBL 3O11B 1FFPB 2B39A 4J3XA 4D8PB 4EDXB 3AU1A 4X5XA 1FH5H 2V2WA 5C07E 4KI5E 5HBBA 3NN8A 4JGUA 1MJ8L 3TBYB 5FYKL 4P4KA 4LSQH 5FAAA 5L0QC 5ACZB 3OAUH 4FQCH 5JDSA 3FT4A 3QUXD 3TN0B 1FE8L 5E2WH 3VWKB 3W2DH 2FGWL 4GS7B 1YY8A 4KVCH 3MRIA 5AYQA 1ZOXA 4YR6B 3LD8B 4RFEB 1CLYL 4QNPF 5IIEB 2PYFB 3O2WH 4J3WA 2UV3A 1X6NA 4X0KA 3T1FA 2ITCA 3MNZA 3BPOB 4UB0H 4I2XE 4MQSB 4ENED 1W0VB 4UIMA 1IGFH 2AV7B 4U0QB 4Y0GA 3I6GB 4QRQB 3DBXA 1DEDA 2WINB 3MROB 3IDGB 4GBXB 2IBGA 1VKXB 4WO4C 4FQHA 5EU7E 3BQUB 5C6WH 2HT3C 3LPGA 5FHAH 5FGSA 1T0MB 1OW0A 1KTLA 4KZEL 4Q9QH 3LKNB 4XMPL 4HXBL 4PLJD 3CLEL 3SDYL 1U8PA 5CFHA 3MOAL 4XH2B 1LP9F 5B39A 5IB5A 2ZCHL 3OKEA 4JRXB 3LKRB 1JWMA 4TNWF 1BM3H 2FATL 4GKOA 3P9MB 5GHWL 4HK3N 4I18B 2Q7YB 3H3PL 3L3JA 7CGTA 3L3HB 3MBEA 2W1NA 2W07A 4MD0A 4ZPVB 4WWKA 4PPTA 3S3PA 3VXUB 3B4NA 4YEEA 4Q0XH 1D5IH 4N8CL 3U7YL 4GG6B 5EBMA 1Q9LA 2VKXA 3TBTB 3QEGL 4F7EB 5B38A 5L2KA 5D7LB 2DQEL 5L88H 4ZUUB 4XPBH 3HC4H 5JIHA 1N5AB 3DECA 4FQLH 4EQ3A 5GS2D 4UNTA 1Q94B 4MX7B 2OR8A 5C0NC 3TN0D 4WJ5B 4L4TB 5B39G 3VWKD 2A9NH 1PX3A 3CFKA 2YSSB 3GMPB 1KG0B 2DQDH 1S5HA 4OCMC 3T4AA 4BZ1L 4PYGA 1BAFH 3CPLB 4NCC1 1KN2L 4YNYB 3BZFA 4G6KL 4NC0B 1RZ7H 1J5OH 1HXYB 3IDYC 1D6VL 3STZA 1JYVA 2I07A 3HB3C 4IIQB 4RFOH 1FJ1A 1KYOK 3V6BR 2B0SL 5B38G 2AJVL 4JDVA 4BK5A 3G04B 2WIIA 2KL6A 1ZHBB 1T5WA 1CF8H 5CP3H 4GBXD 1YZZA 4HMCA 5CGTA 5MEOA 1T22B 1YEJH 3VFSB 4DVRH 1VENA 1G6RL 1CE6B 4TRPH 5IHUH 2EDDA 5GRWA 2APWA 2NXYB 4XBPA 1J1PH 1I3RB 3SKJH 5INCA 3VW3H 3G5YB 5HDQL 2DQFA 3QB7C 1W72A 2GTWA 1DBAL 1N4XH 3RWGB 5AZEH 3KYAA 1A2YB 1U8KA 1GXEA 3P3YA 3ZDYE 4JRXD 3FB5B 2UZIH 3M8OH 1HI6B 2CGRH 2DJUA 3HZYA 1C5BL 3OB8A 1LILA 3O6ML 4U49A 1HOCB 5IQ7L 3KPRA 1UKTA 3QXDB 5D9SA 5BQ7A 1FPTL 2Z0BA 3DROB 4FXKB 5ID0B 3VXUD 1JPSL 3C60C 1L7TL 2HKFH 2I60H 3AROA 4UQ2A 3KPSB 3TP4A 5F1IA 5DHXB 3QIWB 3H9ZA 4LLAA 4MJ6A 5D7LD 3HR6A 1WLHA 5KVFH 5BZDA 2VXSL 1J8HE 2H1PL 3V0AC 4Z76B 1Z3GH 1U3HC 3PHQA 4O2EA 3ZO0A 4LDEB 5FO9B 1CZ8H 2V17L 5SWSA 1XGTA 1T2QL 4Y4FB 2WWMC 5CZXD 2X89A 2XRAL 3WO4B 4L4TD 2NLJB 1NEZA 4WI2A 4YHYB 1MQKH 5DLML 3ZSSA 3KLDA 3IXTB 2J6EA 3JWDC 5I0ZA 3LEYH 1TVHA 2F8OA 1CR9H 1OGAB 1DQJB 2HT2C 3ERYA 1ZTXH 5EUKB 1FYHB 1UZ8A 5ITBH 2LTQB 1RK1A 2VB5A 4AENA 1MFEH 1LO4L 5C0EA 4YO0B 1K85A 1J12A 4M1CD 3UJIH 3G6JE 1QYGH 3DX7B 4L5FL 4JFOA 4P2OD 4Z77A 3TYGL 2NY2C 4EN3D 3MGOA 4U1MA 3HNTL 5IBLD 5C0CB 5I74C 2MCPH 1KNOB 2NXYD 4Y88A 3VFPB 1UXSA 4HJ0D 5E8DH 1DFBH 1KB9J 1QACA 2DQGH 4K7PL 1TCRA 2ZOKA 2EO1A 1NC2A 2ERJB 2IEPA 2CO7B 2EC9T 4JR9L 4Q9BA 3BGFC 2P43B 1R0AL 1DJSA 3WN5B 1GGCL 1MF2L 4LCCA 3U0TB 2W9DL 1EJOL 3DUUA 1KCRH 2APXA 2VNCA 3VFRA 3GSVA 3RAJL 1GOHA 1FL6B 2LAGB 3OAZK 3QFDA 5E2TL 5L9DL 3L3KA 3L1OL 4WENB 1FC2D 3BWAB 4NQXB 2PKDA 3KPSD 2HTLD 3QIWD 5C92A 2ZOLA 2A6DA 2CUHA 3RX5A 4N9GA 3SOBH 2BJML 3BGMB 4XP1L 3FRUB 3R06B 4U7MA 4NWTL 4RNRB 1BFVL 5HI3C 1KB5H 2VLLA 4Y4FD 3O3DA 3MO1B 4HKBA 5DJ2B 4M48H 4OI8A 4HUXB 3CH1A 3ARFB 3O2DL 1S7TA 2P5EA 3NFPB 3CLFH 5EFIA 1NKRA 5ID1A 4JY6A 4HJJH 5D4QA 3X11A 3ZSTA 1RHHA 2XQYK 1MJ7H 5C2UB 1ITCA 3PWNA 3UTSA 1NCBH 4MSWB 4JN1H 3REWB 5JNYB 5BMFL 2IWGA 1AJ7L 1S9WA 4E41A 4D0CB 1P84K 5E1AA 2XKNA 4Y5VB 4FQXA 3B2UC 1Z0NA 3P4LA 1JTTA 2GAZB 3QQ4B 3WLBA 3MLXL 3I84A 1LE9B 3FQUB 3QH3B 1M1SA 3VG0H 5GIRB 5I9QC 4F3FB 1IEBB 5EH1A 2CKBH 5CZVL 5C0CD 3KS0J 4LPYA 3IFNH 5CJXC 4OZ4B 3LIZL 1KEMH 4Z7WA 4XHQA 1PLGL 2BOCA 3U46A 3C09B 3MLUL 2R2BA 1D5MA 5DGQA 4KJWC 5I76A 1AXTH 4J12A 2JB6B 4FHBD 3CK0L 4N5EC 1HDMB 2O5ZL 1LO0L 2XTJC 4YX2H 2GSIB 5BJTB 1RFDH 2FZ3A 4NQCB 4U1IB 4Q9RL 2DQJL 1WZMA 5FM5M 2CLRA 1CFTA 3SDXA 1WT5C 3E8UL 2FBJH 4DW2H 2P5WE 5FDWA 4F80A 3ULVH 35C8H 1QLEH 3CMOH 4ODBD 4M61B 4OBSA 4MA3B 3QYCA 5DJXA 1FZKB 1G7QB 1PQZB 4FP8H 2HFGL 3D9AH 1ZHKB 4LSPH 3RVVC 5IMKB 1CBVL 2AP2A 2IBZX 3IVKA 3PJSA 2Z8WC 3RTQC 1HXMB 2C3VA 4DQOH 5ERWA 3TJHC 1FCCA 2CDEA 4Y4HA 2H3NB 1KELH 2B5IB 2Q8BH 1INDL 3KYMB 4JQVC 4NQUA 3OKNA 3QG6A 4O2CA 4TVPL 4MS8A 3ARFD 3F7QA 3LKSA 2DAVA 1VEMA 2RIKA 3ALWA 3S5LB 1A6TA 1PZUB 1AH1A 2YD4A 1F90L 3ZE1E 2Z31A 4JDZB 1HZHL 2EDFA 3KYKH 1OTUC 3QNXB 1E4WH 1Q0XL 2DQHL 5IFHH 4PJDA 3WNPA 2GFBA 1DUZA 4JQXA 5HVHC 1II4E 4HQQH 4L8SA 2Z8RA 2YN3A 3H7BB 3WUZA 5KS9F 1R6VA 1UB5A 4GAGL 3RL2A 2D3VA 5LXGH 4O5LL 5F1KC 5I71B 4YHMH 1P9MC 1ZVSB 1MFBL 3HG1E 3VMNA 4RBPH 1R3IL 5D2LB 3V6ZA 3BZEB 3W5MA 2AJSH 4W4OC 4Z7UA 1IAII 1G7MB 2X70B 4KAQL 2BVUA 4KZDH 3JWOL 5C0IB 2DL9A 5CCKH 3MREB 3I6KA 1AR2A 4OLXL 4NKMA 1CGTA 3LN4B 4NQCD 2FB4H 1B9ZA 4ZO9A 3F8UB 3U7WL 1Q9WB 4WTWA 3RNKB 3W9DB 1GOGA 1J88A 3DSFL 4JKLA 4HUUA 2VLRA 2MQ3A 5K9KB 1I8MB 2DRUA 3S37L 2ICWI 4OJFL 4BELD 1G7IB 5CJQH 5MEQB 2DQCL 3FT2B 5F7DB 4IS6A 2QLVB 4GRMA 1WEJL 4WUUB 4ORGA 3K2MC 1QSZA 1FP5A 2PO6A 1NUDA 1DEEB 4UZGA 2LU7A 3SKNA 5D5ME 3QUYB 4HWZA 3MLWH 1NC4B 1PVHA 5KSAB 1UJTA 1FORH 3T8XB 2J8HA 3WJLA 2O5YL 2R29H 5L6YH 3BI9X 2XV6B 3WIHA 3FB7B 3BT2H 3O6FC 2W0FB 3WYRA 2F74A 2CUIA 4NN7B 3LKOA 3KPNB 2EXYC 3KYNA 3ULSA 1V3LA 4AZ8A 3GHBL 1XGQA 1IAIL 4P2OA 5CBEA 3P0YL 1MLCB 1S7XB 5FO7B 2X4QB 4EN3A 4LVNC 4TTDD 3IF1A 1T3FA 4M6MH 1MAJA 2DL2A 3DMMB 4G6ML 3U36A 2BFVH 1HQ4B 1U6AH 5EZIH 5ISZE 3PHOB 4Q6IB 1EXUB 2DI8A 3KPOA 2NZ9D 3V4VL 4RDQG 4JO1H 3QUML 5DC9B 2IH3B 5DD1H 4XPFH 4I48B 4B5EA 4RIRA 3GSQB 3T3PF 3TCLA 4PGDB 4ZSOA 2PUQT 3PDDA 5JLZB 4K9EL 5IW1A 4OM1H 1G1CA 2ICEB 2FJGA 5D96C 5SV3A 3FJTA 2AJ3A 2RB8A 1ADQH 5FYLD 4XPTH 4GLRH 3QIBB 3RU8H 4Y5XC 5CD5D 5DRXB 3C5ZC 4RAUB 4WFHE 3AMKA 4OZGB 5CMAA 4G8EA 4N90E 4MAYB 1QUNA 4ZFGH 4OTXH 4HGKC 4AEIH 3S34H 4WI4A 3JTTA 12E8H 4RAVA 5C7XL 1W8NA 2BOBB 4ZOBA 2EDBA 2XN9A 4DZBA 1RIUL 3F5WB 4WUUD 2YEZB 2B1AL 2XACC 4KV5E 3T0EE 4X6DB 4HHAB 1UB6A 1KJ2L 1TVDA 3QUYD 4ZFZA 1R5WB 1NC4D 2QHRL 1AGCB 2CDGA 3U0PB 4AY0A 3BSZH 1AFVL 3JWOC 3K81A 3KLSA 4DCQA 3VWJB 3HC3H 4NKQB 3LQZA 2NR6D 2OTPA 3OB0K 4YK4B 4M8VA 1OSPH 4JO2H 3TPKA 3G5ZA 3NABH 3VFOB 5L8LB 2VDQH 4QXTA 1L9NA 4M02A 1RY7B 3EYQD 5FB8A 1NCDL 1TMCB 2FR4B 3RKDC 3N9GL 3QAZB 4FQ1L 3IETB 3OKKB 3UMTA 5FKAA 1A22B 1QPPA 3MCKB 1FBIL 4AM0A 4GXUN 1IRAY 4PJ7A 2GJZB 4XB8A 1ZT4B 3BP6A 5HPMB 1BWWA 5GGVH 2G5BB 4JQIL 1QBAA 1WAAE 4HT1H 2CH8A 3MZTA 4H0HB 4N0UB 2HJKB 3VXMB 1E6OL 2NY0B 3Q2CA 2PYED 1YC8A 2OJZH 3WNLA 1K9TA 2VXTH 3BPCA 4ALAL 1YC7A 3P11L 4M5ZH 4XXDB 5CZKA 3WFEL 3QIBD 4U6VL 4LLVA 3V5KB 1X3DA 4ZOCA 1RUML 2P4AB 5J3HD 1LEIA 1F2XK 1S7RB 3GSUB 5H8DA 3U4EB 4MAYD 5IB2A 5FCUH 5GRYA 3BPNB 3LCYA 3UJJL 2VDLH 1CXEA 4KK8D 1YNKL 4L4JA 4LRIA 3KPQB 4KK6D 3OBAA 4LPWA 4NC2B 3I75A 2FO4A 1MCWW 1SJHB 1EMTH 3SY0B 4L8CA 4XCCH 5E8NA 3RHWK 2R2EB 3B9AA 1G7JA 2R0ZH 1NLBH 4FA8A 2HT4C 1KB9K 3D2UD 5EIVA 4PJEF 2MWCA 4K9EC 4RGOL 1MCOL 3WUWA 1IM9B 1C08B 3M45A 5DO2C 2JCCA 5EU5A 4XGZA 3WS3B 3VWJD 4JM2C 3IGAA 4J7RA 1S8DB 3E6FA 4D0BB 4ZAKC 3ABZA 3S88H 5E24E 3EFDL 2LU4A 4NIKB 5DJZB 5FO8B 4J2XA 4X8XA 2P8LB 2YD3A 1TJHH 1WCBB 4Y4KC 1YEHL 4R97C 3GKWH 3FO2A 3UBXG 4H0GA 2IMMA 3L6FB 4TSBH 2OL3B 1QSFA 1XIWA 2BCKA 3CZFA 32C2A 4S0UC 1UM4L 4RMQA 3QI9A 1JWUB 1U3YA 3FQTA 4TUKL 1T1ZB 5B39B 5FYKH 4NQDE 2PXYC 3FOMA 3VRJB 3GM0A 1IBGL 4U0RB 3WUWG 1N3NA 1AD9A 1FE8H 3VXMD 4NQDB 2X1WL 2NY0D 4UNVA 4NQEB 3MRJB 1UJ3B 2ADGA 2FGWH 3DUSB 5J9PA 3EAKA 1BZ9A 1LE5B 2Z4QB 3AXLA 2D9QB 5L2KE 1U95B 4J3TA 5HDLA 4F8QA 1A7BA 2OLDA 1CLYH 2CQVA 2APBA 1NBYA 1CICD 2DWEB 1G9NC 2HVJA 3RWDA 2DDQL 4OUUA 1JUFA 3PQYB 3BEWA 2PW1A 4FXGB 4IDLA 4FFWD 1I1YB 1IGML 4D9QE 1XGRB 1A64A 2G9HA 4PJFA 3MYJB 3SJVB 1A3QA 5A2JH 1F3JA 5T3XL 3SDCA 4X7EC 4P2QE 3QPXL 4XMKH 1KPRB 4X5LA 4H20L 3A6BL 4MNQB 4P2QB 5LAXA 3RVWD 3BIBX 4X9BA 3IU3A 5IJKA 4XMPH 1TTFA 2DI9A 5I66B 3CLEH 3QXAB 4LIQE 3SDYH 1N2RA 2YHGA 3MOAH 2A73A 3UTTB 2IQAB 4M6OL 4HH9A 4ZUVA 2ZCHH 3CSBA 3GJFH 4BZ2L 2EYRA 5J1AA 5GHWH 5J6HA 1OLLA 3ARPA 2FX9L 3IDUA 1HWHB 3H3PH 2FNBA 1A21A 4OV6F 1AP2B 5HGHA 3IDMB 1BFOB 4GQ9L 4YDIL 3MNWB 5I1GL 3HI6H 4N8CH 3TBVA 3AAZB 4B7IA 1A1MA 4DKAA 4NUJB 4ZFOB 3QEGH 3CUPB 3V0VA 3O3AA 2DQEH 3ULVD 5GISL 4LHUB 5JOFA 3U6RA 1MIML 3QIUB 1XFPA 4YDLC 4JEGB 1JPST 4MAUL 4HDIA 1EK3A 4M9OA 4IOIB 4RZCA 4NQED 1G9EA 4OCXL 3B9DA 3MLSL 4ELMA 1KN2H 3FRPA 3O2VL 2HG5A 3FMGH 4G6KH 3RZWA 1EJ6A 3LSOB 4E0RB 4QT5B 4MJ6B 1P1ZA 2VWEC 5SWSE 5EULV 4P5TA 5DJ6B 3PQYD 4HF5H 2W59A 2IMNA 1XH3A 1MRCL 2B0SH 4XP9L 3CIQA 2AJVH 4JZNB 4ODTH 3REVB 3IJSB 3RIAF 3S97C 3SJVD 3OXSB 1GH7A 4BSJA 1OTTD 4MXVF 4Y19B 3WFCL 1MVFA 3PP4H 5LCVH 5CP3A 1G6RH 1I1AA 4MNQD 1IKNC 1P4LB 1S9XB 3BEVB 5HDQH 3AM8A 4WW2F 4ERSL 1A6VL 2VN4A 2ZUYA 2AEWA 4NDMB 3UTTD 2QSCL 3E6HB 1N0XL 2DLFL 1T4KB 5C9JA 3HE6B 1C5BH 1FZMA 2CK2A 3O6MH 1BLNB 1NBZB 2QQLH 1JGVL 5IQ7H 3GB7B 1WGOA 3MBXL 4HK0A 4YUEL 5EZLA 1FPTH 3S98A 4LSUL 2QKIA 5IB3B 1QRKA 5I1AA 5IKCA 3LKPB 1JPSH 1KIPA 4WV1A 4MD5A 4HCRL 4HIXL 4HXAL 3RWEA 1UM5L 3HNSH 4JDTH 3QEUA 4MNGE 1T2XA 3SPVB 1UADC 4H26A 5F7HA 4R8WL 2AK1L 2VXSH 3HUJF 1ED3B 2I24N 4LSRL 4LASL 4MNGB 4POUB 4LHUD 1A1OA 1IKFH 3OJDB 2UUDH 2ZUXA 1TJIL 3QIUD 4XVJL 4K71C 1T2QH 3ECBA 5HHPA 2ZKHL 3QQNA 4NOBA 5EZOL 3OKDB 4AH2B 3FT3B 2VZTA 3QFDB 3I3EA 5EDXA 1P2CB 5DLMH 5DURD 3ULUH 1S7WB 3L3KB 3O3EB 4LEOB 3BN9D 1RU9H 4F9PA 1OP3K 1Y18A 4TYUA 3SGDI 3F62A 2A6DB 4GKNA 2CRMA 2OMNA 5BCAA 4PJGA 5DJCA 2ARJA 3ZE2F 4EIZC 1C12B 4PV8A 1NAMB 2NY3C 5LKNA 1PSKL 2CSPA 4NN6C 4HFUL 3C6LB 1JGDB 3FQWB 4L1DA 2P5EE 5EO0B 3NA9L 4JHWL 5JQ6L 4L5FH 4LCIL 3E1F1 5DRNA 5E00B 2VDRL 3MJ8A 3G6DL 4Y19D 3K1KC 3D2UA 1GZQB 3HNTH 2VDNL 1FNSL 1SY6L 5E8PB 3KDMA 3HPJA 3UTSE 1ORQA 4E41E 4IBLT 4QRSB 3FONB 4U1KB 1MHEA 3HAEH 4K7PH 3KNBA 4WDIB 1DP0A 1P69B 4JR9H 1T83A 3UZQA 1FLRL 2XI9A 4KKAC 3SDDC 5F1OB 5ADOL 1HINL 1V7NL 1WFTA 2W9DH 1EJOH 4W81A 5I73C 1ZT1B 3RAJH 1Z6JT 5INDA 1SYSA 3DHMA 3QWOA 4Z7WE 5E2TH 4QHLB 5L9DH 3ZKNC 4P0DA 3L1OH 1QFPA 2Q86B 2IBBA 3STLA 1DANT 2AERT 4KUCD 5IEKB 2X4OA 4G7YL 4LLYB 3TO4D 2BJMH 1JRHI 2XWTB 4XP1H 3JTSB 1X5FA 4NWTH 2HJFA 1ZA6A 1BFVH 3SDXE 4OLYL 3PWPB 3LDBC 3P4NB 1IZKA 1F5WA 4WFGD 1TITA 5ANMB 4BK4A 1OD9A 1KB5A 2FIRT 2VL5A 4LQ1A 1TVBB 4ZUSA 2DYPD 3CU1A 3O2DH 3F7VB 4PRAA 3UZEA 1CICA 3F7YA 3QRGH 4HX1A 1LP9B 4WU5A 1JZ7A 1EFXB 2BVQA 3LEVL 1PW3A 4OCRL 1S7VA 1EAPB 2ATKB 4I0PC 4OQ1A 5BMFH 5B4MC 3BAEL 1AJ7H 2BY0A 1G0DA 3MYZA 3OMZA 1FNHA 4HS6B 4DUVA 3PGDA 1BWMA 3ARGC 4JHAH 2BRRL 3SKMB 1F3RB 1TLKA 3UTQA 3MLXH 4Z8FH 1FNAA 3GMNB 4JZOB 2X4TA 3Q5OA 4HZLB 5I8OL 3C9NA 3N85L 2DWDA 4BH8B 4K7PX 4JFDE 1MCBA 3LIZH 1PLGH 3LHPL 5I6XC 4CW1A 3MCLL 2CKBA 1NDGB 3RDTC 1GSMA 1KPUA 1VACB 4XNZC 4JFDB 1RZIA 2H8PA 4I9WE 2C4FU 1VEOA 3CK0H 5BZWA 1A3RL 2O5ZH 1LO0H 4JFZL 2J8UA 1JRHL 4PFEA 3TYFA 4BFIB 4MD4B 5T1KB 1TZIA 4AIZA 1HHJB 4R26L 4Q9RH 2DQJH 1DBKL 3JSSA 1GCFA 2XA8H 1I8LA 3F6LA 3E8UH 5HYEA 1DL7L 5CBAB 2WBWB 3VH8A 4HWUA 3D0LB 4JAMA 4X7SL 3IFLH 1UYWL 1IGYA 4Z7UE 2HFGH 4UQ3A 1RK0B 2LFGA 3H7LA 5FGBA 4HLZG 3D39D 1E4XI 3P40A 3ISWA 3HR5B 4P5KB 1BQHB 4FFZL 3IJHA 4JPVL 1KTDB 3PWPD 1DBBL 4ZXBB 1MRFL 2VLRE 1INDH 4TVPH 3FZUD 3WJJA 3MV9B 5KSBF 5A2FA 4O2FB 2MFNA 1QFWL 3DETC 2DLIA 1I9EA 4XRCB 1MCJA 1EFXD 5GS3A 4IRSA 3VH8G 2IAMA 3E2HA 2ZG1A 3FTGB 5IVXF 1HZHH 3O41B 2O61B 2AQ3A 4ELKB 3MRRB 2EDHA 3QA3B 1Q0XH 3QO0B 2DQHH 3K1DA 1FFQA 1OY3B 4HS3A 3EYUL 2YPKA 5JIIA 4NJ9L 3WO3B 3MNVA 3VJ6A 2GKIA 2ZUQC 2GITA 3QDGA 1EZVX 1D9KB 5I8CB 4GAGH 5ICXA 4O5LH 3MRMA 4FG6C 4HK3J 1R3IH 1H3WM 2SEBA 1I8IA 3RI5K 3SE8L 5I75C 3KXFD 1CGYA 4XNYL 4G8IB 1QQDA 3RWIB 4L8DA 3UYRL 1YEDB 1FLTX 1F4HA 1YUHB 1E4XL 4WTZA 3MA7A 3LV3B 5CBEB 4OLXH 4YPGA 2R0WH 5D2NB 3FN0L 3IF1B 3U7WH 1H5BC 1KACB 1YQVL 1MCEA 2R39A 3BP4B 4ORZC 1A0QL 3DX6A 5IMLB 1YN6B 4GRLA 5C3LD 4G80B 4ZSOE 1NMCC 4G42A 4U2ZA 4OJFH 1KENH 4J8RA 4PTTB 2D4DA 5AD0A 1WEJH 2FX7L 4QXUL 2FLRT 3MV8A 3U83A 4R4ND 3VD3A 2FJGB 1NANI 4IRZL 2BSED 4DOHE 5AG9A 4JKWA 2IADB 1BVLA 4S2SB 4HKZA 4URTB 5C0BD 4ZXBD 4LNVA 3FN9A 2Q7NA 3MV9D 4P3CL 2O5YH 4M00A 2EDWA 1OAXL 3TNNB 3B6SB 4ZD3L 5A2KH 2Z35B 2XN9E 3HS0B 5IWLA 2EZ0D 4MXQD 4WY7L 3PDOA 5E9DA 1WZLA 5TE6L 1K4DA 2VABA 2G5RA 3MJ9H 3GHBH 1S5IL 8FABA 2C26A 1UQSA 5GS1A 1IAIH 1QG3A 4ZOAA 3P0YH 4U6YB 4IRJC 4NNXA 3V5HA 1C5DB 1E4KA 4TSCH 5DHVB 3T0EC 4ZUTA 1HE7A 1U2HA 1SMAA 4OFDA 2QEJA 1D9KD 3S4SG 3QUMH 3R1GL 1GYAA 2X2YA 4XVUD 4AG4H 4F15C 2C1OB 4JVPA 4S1SL 2E7LA 1JGUL 3MV7D 5HJ3B 3QCUL 4K9EH 4LSTL 3BDBA 3LQAL 2E9IA 2NY6B 2K7QA 3BUTA 4P46D 4Y2OA 5D6DC 2XWJB 4L3ED 3NPSC 2ZUSA 5BV7B 3HMXL 3LMJL 4ONOA 4ZUWA 1KIQB 2YC1A 1XCQA 3S37X 1ORSA 3UROR 4PJBF 1R3JB 5TF1L 1QRNB 1ADQA 4S1QL 4RGNC 2O5XL 3J7HA 4NQSA 1SBSL 1IAKA 1CN4A 4LLUB 5CSZA 2H9GB 4V1DA 4NFBA 2X4SA 5C7XH 4QRRB 1ETZB 4F58L 3M1BB 1WSST 4NO2A 4U31A 1RIUH 1K8DB 4KJPD 4PB9L 2EDRA 4Q74A 1MVUB 1X5XA 1NJ9B 3HRZB 3FOLB 1CFQA 1X7QA 1OP5K 3I50L 1P7QA 1KJ2H 1NBVL 4LCWA 2QHRH 4U1LA 5CP7B 1S78D 4KKCD 4JFQB 3P4MB 1AFVH 1H3GA 3PABB 4NN5C 1QNZH 4QGTA 1I7RA 4R7NB 4HKXA 2WANA 3MFFA 3JWNC 3ILQC 4C59B 3ZKQD 1S9VA 3G5XB 5IEHB 4P4KC 2FL5A 3ARXA 5HHNB 2HP4A 2FIKB 4FTVA 3DYMA 4NZTL 4KHTL 3UBXB 5CEZL 1B3JA 4QTIL 4J4PD 5IF0A 4LLWB 3ZHKA 4D9RD 1JTOA 1PYWA 5CWSA 4PR5A 4M43L 5DHYB 2JCCE 3N9GH 1YDPA 2WP3T 4FQ1H 1MFCL 2F53E 3WUWB 1FBIH 3TWCL 4GKZA 3GMRA 4O02L 4JFFB 3MA9L 3K46A 2GW5A 4JZJB 3C08L 2F53B 1G7PA 4QYOB 5F88A 4V3EB 1U0QA 3UCRA 1BIIA 2BHZA 5GZOC 5DFWH 2EYSB 2VITB 3OGCA 1QSFE 2NY6D 43CAB 3SBWA 1EDQA 3MGTA 1NFDF 5B3JE 4ALAH 4XVSH 4CADA 4KRPB 3P11H 1QA9A 4WEUD 1LO3L 2QQKL 3LEXA 1OW0C 4U6VH 1AQDB 2JELH 1RUMH 1QRND 4OFIA 5ECJE 3OF6D 1YJDL 1SM3H 2ITDA 3AREB 1EEZB 5H35A 3ULUD 3P9LB 3D39A 1MI5B 3L95B 3UJJH 3T3ME 2HAZA 5CSGA 1YNKH 4QRRD 2R1WB 1H15B 2VQ1B 3DI2B 1V8HA 3H9SE 2WWKT 3LQMA 1PKQB 2LVCA 1IGJA 1BZ9B 1YPZA 3MBEC 4GXVH 3PWJB 4LDLB 4N0FA 1QFOA 3U79A 1XGUB 4OZHA 4WWKC 4OZIA 4YFLI 2NPLX 3H9SB 3BP7A 3AMLA 1MCNA 5D72H 1B4JH 4NO3A 5KS9B 5D1ZB 1JWSA 4RGOH 1MCOH 2X4RB 5TQ2H 3LQAC 5D1QB 4U1NB 4PJFE 4OD2B 4N0CA 2EIZB 1U8NB 5EOTA 3RWJA 5TFSL 1MCWM 4GH7B 4RFNC 1SYVA 3EFDH 5EZJA 2ZSVB 3SDAA 2A6IB 4RRPG 4PJIA 3MRLB 1IEAB 4E42B 4KKLC 5D7IF 2GK0A 4QRPA 1YEHH 2OI9A 3OR6A 4PJCF 4F33A 2W60B 3FFCB 4OV5A 1HHKA 3EFFB 1A6ZB 1UM4H 3W39A 1BD2B 2Y1VA 5AZ2L 4J1UB 4JFFD 5HI5D 2XOTA 4ZUVB 1K8IB 1XF3B 4HH9B 3UYPA 1RZJL 3WIIL 5K59E 4IEFB 3KXFA 2AEQL 1IBGH 4NPYB 4PJ5B 4L3CB 3VD9A 5J6HB 1J05A 1ONQA 5FHBL 1VPOL 3BIKA 3Q3GA 3QQ9C 1HSAA 1VGKA 3GEWB 1X5AA 3VFNB 4RQQA 4DN4L 1JYNA 1U91B 1TNMA 4CAGA 3CVHB 1E28B 1YECL 2MOVA 4S1DC 3CDGA 1T66C 2YZ8A 4HIEB 3U82B 4FRWA 4KK9C 4KGJA 2LU3A 1O7SA 3CC5B 2IANA 3ARED 4PP8C 2KDGA 4PY7B 5SX5K 1PGRB 1MI5D 5JHLL 5HYSB 1U8QA 4PJXA 5IB1B 4ELME 1FNEB 1XF4A 4R9HA 3VA6A 4KJQD 5T3XH 5IOPA 1HSBB 5C0BA 3QPXH 3MRHA 5JA9A 3QR2A 4Z7OE 2VUOA 3U9UB 5IVZA 3DVIA 4H20H 5DRZB 3A6BH 3SQOL 7FABL 2B2XL 2GTZA 4F7PB 5TF0A 4NO5A 1RJLB 1NUNB 2D7MA 3L3GA 2GSGA 5MERB 1OAKH 2CXGA 4Z7VA 1CFVL 4LMQE 4M6OH 1T03L 1PAMA 3OG4B 1EO8L 2H26A 1F02I 5DEFB 3TPUB 1DDHB 4BZ2H 5C2BL 1MQ8A 5C0JB 3QNZB 4HC1L 5DUPH 5C71A 3GJFA 1I7TB 4HUKB 4QF1B 4GQ9H 4YDIH 4MA1B 5I1GH 4A6YL 4JLRA 4KK5D 4Z78A 2XICA 3VRLF 2UYLB 1R5VA 3FFCD 2NY7H 2X4PB 3ORJA 4EUPB 1R3KB 5CD3A 2HN7A 4X4YB 1HKFA 2HFEB 3QDMA 3OJMB 5T1MB 5C9JB 1B90A 3PL6B 1MIMH 3T2QA 4PJ5D 5DD6B 4XCEB 1RUPL 3ZE0E 4EI5B 1UH2A 4XNMB 4P46A 1A8JH 1UWEL 5DQDH 2NX5B 4Q2ZA 2VIRB 4OCXH 2V2TA 2QR0A 3MLSH 1L0YA 1LDPH 4QRTB 2F8XC 1C7TA 2C3XA 1AR1C 1QSVA 2Y6SD 3EJZC 1BJ1H 3VFVA 3ZHLA 2BY1A 3MJ6A 2E6PA 5C0GB 4DGYL 5HY9B 3MJ7A 1TXKA 3VXPA 3DXAB 2PCPB 1J9CT 4EXPX 1V05A 4ONGL 1CDUA 4GG8A 1MRCH 4XP9H 4DFIA 2A0LD 3WNMA 1JFQH 2M26A 3TGXA 1IAOB 3FQNA 1UT9A 5HHPB 4LCCC 1LMKA 2DS4A 4YHPA 3WFCH 2X44D 2ILLA 4ZS6C 3IDNB 4WIQA 1AQKH 4R90L 5BS0B 4PJGE 3GJEA 1KIUA 4LNRB 2YD7A 3LKQB 4ERSH 1A6VH 1G6RA 3PHSA 2X4NA 4NCC2 3BZDA 3EO0B 2QSCH 1N0XH 4TULL 2DLFH 4OF8A 3EGSB 4TQEH 2AXHA 5FECA 3QUXC 1A7RL 3HZKB 3TFKD 2NNAB 5EBWA 2H2PC 3L5IA 3MBXH 4YUEH 2BVPA 5EO1B 2R1YB 4LSUH 4OZFH 2IPUK 1PBYA 5KTEL 3QWRD 4YHOL 3B9VA 2X05A 4ODSL 1F4XL 5SWZA 2WP3O 3HPJB 2AJUL 4HCRH 4HIXH 4K07A 4HXAH 3KJ6H 4ODUA 1ORQB 4XBGA 1FL3B 3GDBA 3JVGA 4R8WH 4U6HB 1ZK9A 4LSRH 4LASH 1Q9KA 1QSEA 3RY5A 3PL6D 4PG9B 1TJIH 4GRWH 4I1NB 4XVJH 5IFAL 4FQPA 4IHOB 2IALA 2ZKHH 3AC0A 1TNNA 2CLVA 2VTFA 5EZOH 5KVDL 3CCHA 2NX5D 2XKSA 4PJEB 1CL7I 4M4PA 5FA3B 3VMPA 4N8PA 1OSZA 4PLJC 1GGIL 5A1AA 1RULL 5DA4A 4PJAA 4LFHD 4Z95H 3DXAD 4KI5F 3RGHA 2XZZA 1PSKH 5I30L 4HFUH 4NRYB 3TBWB 1B6DA 4NRZA 3I02B 4PRPB 3NA9H 1UG9A 4JHWH 4JKPL 5JQ6H 4LCIH 3QWQB 2VDRH 4EVNB 1JZ4A 4ZUSB 2L7UA 1CDHA 1YMMB 3BXNB 2VDNH 4FMKA 1FNSH 3CFCH 1SY6H 4JM4H 3DO7A 1NGYB 5DVKA 1XR9A 3TBSA 4G3YL 4KJYB 5BS0D 3T0VA 4LLMA 3W9EB 5FF6B 1DVFB 4JM2F 3I2CH 3T1WA 1JNNL 3TJHA 3VE0A 4CVWA 1EVTC 5DTFA 5DQ9A 3NVQA 4K7FA 3CXHJ 4X98B 4P5MB 1FLRH 3HAEA 4JQVA 4RMTA 5ADOH 1HINH 2W91A 4D0DA 4Y4HC 3LVEA 3MJGX 3VWKC 1MCFA 2A74A 3GIVA 5EU3B 4LF3A 2CDFB 1LEGB 4XWGL 4WEBL 3LD8C 1GZPB 1CL7L 2DKMA 4LCYB 4OLWL 2H32H 4PY8I 4H88L 2W9EL 1MHHB 2OTUA 4JY5L 4G7YH 3KPMB 3C5JA 2V2XA 3SGDH 2Z31C 5F71A 1SJXA 3MODL 2D03L 4OLYH 2FRGP 4RA0C 2RFXA 3SGEI 3ZDZE 1JNHB 3L5XL 1MCDA 2YA2A 4JQXC 4NT6B 4L8SC 2DTML 4NRXA 1AGDA 5D6CB 5E94A 1QLRB 4ODXB 5GRJH 3ULVE 4BQ9A 1P9MA 2YBRA 1NGWB 3PF2A 3OKYA 4W6WB 3O2DA 2MHAA 5FOBB 3LEVH 1FL5B 3QO1B 4CVZB 1MJUH 3GBNH 4GAYA 3HFML 1AI1L 4PP1D 3BAEH 2FDBP 5I16B 1CU4L 1FO0B 1QR1A 2VAAA 2NQCA 1CGVA 3S96A 3MUJA 43C9B 1VFAA 1MCCA 2BRRH 2IJ0C 4MHHG 4PRPD 4CVUA 5SWQA 5E6IA 4R2GB 2B4CL 1JF1B 2XY2A 5F9WB 3FL7A 4GUPA 4LQFL 1YMMD 3N85H 1FZOB 1BVKB 4TOYL 3LHPH 1ZLSL 4LU5L 1I9IL 1Z9MA 1DVFD 2LVEA 5I1EL 3QEQA 2Y72A 1KXQE 5HVGB 1G7LB 1KEGL 3KPTA 1I7ZA 2R1XA 3NA4A 4X8JA 4BSVB 4EDWL 1A3RH 4XCNB 3G5VA 2I25N 1JRHH 3T08A 4PP2B 2GT9B 4F7TB 1NDMA 3K80A 3MLYH 4HS3B 1T1WA 2D31B 1S7QB 3PWVA 3QDGE 1DBKH 3D48R 3JXAA 4QY8B 4OKVB 3QUKA 5DMKA 4I77L 3VFMB 1ZWIB 1DL7H 2J88L 3WJLC 1WVZA 1MWAB 4AEEA 3BH8A 3QDGB 4HJGB 4X7SH 1N6UA 1UYWH 3WL9B 1H3TA 3DVGB 4G9FB 2GQHA 5FCSH 4HWBH 2HYMA 4MXVE 3KWWB 1CFNA 5JW4N 4FFZH 1MCPL 1DBBH 4DKFL 1MRFH 3NAAH 4P2OC 5GS0D 5DVOA 1A4JB 3L3OA 4EN3C 5FKPB 4CKVX 1JPGB 1WF5A 4C83B 5IBLC 1Z5LA 3LZFL 3QULA 3IAPA 5HYJA 4WW2B 4PGBB 2PTVA 3BE1L 1QFWH 2OJEB 2BSTA 2V9RA 4HJ0C 1AGBB 4G42B 3MV8E 3BJ91 1UVQB 3CFEB 4XHJC 1FQ9C 2R2HA 4X4XB 1LD9A 2JIXA 3OQ3B 5HGAA 3QHFL 5JORA 5C0AA 1HEZA 3VG9B 4G8FB 3CFDA 2QQNL 1ZSDB 4IM8A 2FWOA 4C58B 1CDYA 1IGIH 3S4SB 5KBNC 4R2GD 1Z9OA 3OHXB 1LO5A 2FBOJ 4O9HL 3GUTA 3ARBD 4FQ2L 5E9DE 3H8NA 1A6WL 4F2MA 1EHXA 3HUJB 4PRHB 3MV11 1TDQA 4KWUA 1MIEH 5K9OA 3L3DB 4HG4K 3SE8H 4X6EB 4XNYH 2W92A 2BNUA 5EN2A 2KH2B 5KSVA 3SHSA 3HCVB 3DVFA 1E4XH 1QPXA 4Y4FC 3O4LE 1ZA3B 3DJ9A 3IJYA 3P4OB 4KHXL 4RMSA 1J1OL 1RZFH 5JO5B 3ZTJG 3G6JF 1T6WA 3O4LB 1YQVH 1NLDL 3K74B 1A0QH 3UX9B 4H8WH 5I8EB 3RVXD 4JFPB 1VGEL 2E7LE 2VLJB 5I17A 4FQCL 3V4UL 2UY7A 4WW1A 2B4CC 4G9FD 1NCTA 5DDHA 1P7KB 4B41A 5GGUB 4RCAA 3W2DL 4QXUH 2LTQC 2PNDA 2VE6A 2NTFB 4KKBD 2FJFB 4MDJB 1MLBB 2Y7QB 1BQSA 3VRIA 5DZOA 3VFGL 1Z0MA 5ESVA 1XCQB 1CDJA 2V7NA 3GM8A 1FFOA 1OAXH 1RZGB 1IGFL 3TM6A 4V1DE 4ZD3H 1X9QA 4YDVA 3K8LA 5H37H 4BSWB 2EDNA 3LN5A 4WY7H 5TE6H 5DJAA 3N0PB 3IS1X 1U8LA 2EDJA 4HIHA 5J1SC 4LCWE 1CDIA 1S5IH 1D6EA 4U33A 3CDFA 5DF0A 5HYIA 4GMSL 4XAWL 3EZ8A 4Q9QL 3MJ9A 4U1LB 1Q9OB 4H25A 4NKIH 1CD1A 1FFNB 5E4IA 5DI8A 1XCTB 5F3HA 4IJ3C 5L0QB 4NNYB 4FTVE 2FSEB 5HHQB 2IGFH 3T0WA 1I85C 1WV7T 1U92B 4PRHD 3MXWL 1HHHB 2GY5A 2HFFB 3AS3A 3HZVB 3MR9A 5GSRA 4S1SH 2A6JB 3QUMA 3WHXB 3QCUH 3RPKA 2DQIL 2GIYA 4LRIC 4F57H 1BFTA 2AK4D 3LQAH 2ICWA 3GSNB 3X12A 2EEBA 3HMXH 1FCGA 3LMJH 3EBAA 1NANH 3IRZA 2BVTA 2CLZB 4HUVA 3MRGB 5TF1H 3IDIA 3V7MA 1LK2B 2O5XH 3WMSA 5FYJH 5KG9B 4LCUB 1SBSH 4X7FC 5HYQB 2R4SL 5DUBB 5FYLL 5IR1B 1KCUL 2H45A 5FDYA 2ZNXA 3S9DB 4WO4B 3V7AE 2FLBT 3NPZB 5A40E 4PB9H 4Y4KA 2DQDL 2E7HA 3T04D 3NCMA 5MHSD 1BAFL 3VFUB 3I50H 4CADB 1PZ5A 2NW3B 1D5ZB 1NBVH 1L6XA 1EHLH 2VZOA 1KJ2A 3JV0A 1U8HB 1H0DB 2LABA 4RFOL 2G60H 1KIRB 2ITDB 2PXYA 3IXAB 4NM8H 1JL8A 4ZQKA 3QI9C 1N8ZB 1N6VA 4ISVA 2HLFD 2IPKA 3C8DA 3VFTA 5IMOA 4NNPL 1CFBA 4BKLA 1CF8L 1T21A 5LGHL 1Q38A 4KHTH 1YPZE 1FV1B 3MRBA 4QTIH 2V5TA 1XMWA 4OZHE 4OZIE 3PP3H 1YEJL 5GGSA 1N5YH 1JHKL 5TGBA 1ND0A 1R24B 4U6XA 5DK0B 4OI9A 3ROOA 1ZT7B 4TRPL 3L3IB 3SKJL 5T3ZD 2FYYB 5C09D 1N4XL 1MFCH 3B9KA 2XWBA 4YAQB 4P4RA 4O02H 3OKMA 3CJJA 3MA9H 4LP4A 2YUVA 1RJYA 2UZIL 3C08H 5JHDE 4OF3A 1ZHLA 1LEKA 4NQVA 4DVBA 4PJIE 5TDNB 3GK8H 3MUGA 5LJYH 1SYVB 4QRPE 5D7JA 3MRPA 5JHDB 3NOIA 5I1LA 4YGVA 1GRWA 2B5IC 5GRVL 5KSBB 1YN7B 5FGCE 2ZG2A 2I60L 2H6PB 4U1HA 3U2SB 5MI0C 2QQKH 5F89B 2CRYA 2WIMA 3MRDA 4FQQB 3KXFE 1EERB 1JHTB 1YJDH 5C0DA 1KLGA 3KPPB 4WHDA 1DE4A 1JN6A 5FYKE 3DRQA 2Q76B 3WKML 5IVXB 2VR5A 4MJ5A 2YPLD 4U1JA 1WBYA 4WO4D 3LS4L 4JGJA 3DYPA 2PW2A 3BKMH 3MRQB 1ZLWH 3OXRA 5IB4A 3D0VA 5CKGA 4O00A 4TTDC 4Y1AA 3A6CL 1IJ9A 2IANE 3T0BA 3TIEB 4EKXA 5HHOA 1LNUB 3D87B 5F70A 4Z5RA 1C5CL 4PJXE 1A6AB 2YMXH 3PGCA 4U4BA 4AEFA 5I71C 3KYOA 3EJYD 5DC4B 3WKNA 3FO9A 4QEGA 3ARDA 4PRID 5TFSH 1QYGL 3BW9A 1XGPB 4C56A 1BX2A 1QO3A 3QCTL 3FB6B 2R23A 4Y5YA 3NCJL 3C60B 4O51B 2R4RL 3JZ7A 5IVZB 3T2NL 4OI7A 3IDXL 5CD5C 5D5MF 1H3UA 4Z7VE 4BH7B 3ARBA 2C7UB 2F54B 1NCAL 4G7VL 1N59B 2XQYG 5MEPA 5AZ2H 1U3HB 3DURB 1QBBA 2XNAB 5DZLA 1QFHA 4P5TC 3W0WB 3KG5A 4I4WA 3TNMA 1PEZA 1RZJH 3WIIH 5C0ND 2WSKA 2AEQH 5J0BA 3RHWF 1IC4L 5GSVA 1MCSA 5B22A 2X7LA 1U8OB 3ES6B 1CVSC 1VPOH 1ROWA 3PWUA 3FAWA 3O6KL 4DN4H 1D5XA 5KVGL 2Z8VC 3QUYC 2Y5TB 1OWRM 4QHMB 3VXNB 3ZDXE 4UU9A 3QDME 1G0XA 1RZ8A 2R56H 4PLKC 4NKDA 4K23L 3BRDA 2NCMA 3AM8C 1VA9A 4K55A 3D3VB 3HPLA 4F37F 3G6AB 5T1LB 2NR6C 4N68A 2OTWA 4K3HA 2ATPA 1J0YA 1XZ0A 5JHLH 1XR8A 1HHGB 4X6CA 4X7TB 3EYOB 4AIOA 2RGSA 5C08B 1M6OA 4LBEA 3X14A 1MUJB 3GSOA 3CGTA 4HEME 2VLKD 3EYQC 2V2TB 5I74B 2BDNL 2BVOA 4Y8DC 3RVUD 3RBGA 4A2LA 4ZODA 1S7UA 1L7IL 2BSRA 3SQOH 7FABH 4WV1C 1VFBA 5BVJA 2MKLC 3QJFA 2GCYB 4Q6IC 1EX0A 1NCBL 2MPAL 2A6KB 2EIDA 4KGLA 4TVSa 2B7DT 1CFVH 3MLTA 2GJ6B 4HIIA 3BGFB 5HHME 4AQ1B 3QZWG 1EO8H 4LLQA 3GMLB 3MV01 5C2BH 4HUMB 3P73A 5HHMB 2ADIA 3O81A 3QDJB 2VZ3A 5DS8B 4HC1H 2F5AL 3GSXA 1X4ZA 2EKJA 3C60D 3Q6GH 4UDUB 5CILH 4PJBB 3R8QA 4KV5F 4TN9A 1P5UA 2QADC 5DK2A 4A6YH 2PTTB 3PIQB 4IMLB 1X5KA 5J3HC 4GKSB 3ZKXC 2X5PA 3CFJB 2Y4SA 1R3HA 2X4NB 1FGNH 3B3IB 3W0WD 4HPOH 2WWMD 4HMDA 1YEKL 5EO9A 4KK8C 3H2WA 5GRZA 5AUMA 4KK6C 2OL3L 1H3XA 4JN2B 1T0NA 1RUPH 5IVNA 2AK4A 5CUSH 5SWZE 3VFWA 2XXMB 1UWEH 3Q6FA 5TQ0L 2JB5L 4HGWA 1GGBL 3NGBC 3GBLA 3ULVL 1QLEL 5L2JA 4R4BA 5GS2H 2JJVA 4MCYB 2KKQA 3VI4F 5IFJB 3DRTA 4FP8L 1HIML 3OKLA 2HT2D 3BVNB 5CEYA 1HKLL 1QSEE 5TH2A 5BOPA 4DGYH 2X41A 1MCLA 3CX5J 3VWJC 2Z93A 1K3IA 3D3VD 5EB9A 4P23A 5T1LD 2PR4L 3VXOB 1FNGB 1KELL 4OM0L 4TNVK 5I9QB 1WAAF 5C08D 3T4YA 5KAQF 2BK8A 2DB8A 2CLVB 1HILA 3O3BA 1W0WB 3CCHB 2E27L 2ZG3A 1G7HA 1JZ8A 4PJAE 1MCQA 1M71A 1JNLH 5ITFA 4R90H 5MENE 3DGGB 4NBYB 1RVFH 5ICYB 4PJHA 1FRGH 5MENB 2GUOA 2XTJB 4TULH 1E4WL 2WBJD 1GGTA 3ARQA 2CIKB 3RL1B 1C16A 4R96B 4Z7QF 4Q7DA 1NFDB 2NY0C 2Q6WB 3QDJD 1P5VA 2A83B 1YYML 1IILE 5I1DB 2B20A 5KTEH 4FZ8L 5C09A 3GJFK 1F4XH 2EKSB 4M9PA 4ODSH 4XNXH 1X5HA 4EI6A 1BP3B 3GGWB 5CEXB 1CICC 5CIPB 1U42A 4OZFA 1F11A 3C5SB 1NFIB 3RTQB 2APVA 4HCRA 1UCTA 4FFWC 4GW4A 2NY5L 4MQ7A 4K7FB 1ES0A 4PJ8B 4DN3L 4N0RA 4NO0D 5C8JA 5BRZA 3MSPA 4OAWA 2XPGA 1VB9A 4FZEL 1KLUB 3V9FA 1OGTB 1BOGB 2G2RA 3X13A 3IKCB 4K94L 4B0MM 1RULH 2NMSA 3GMMA 5IV2B 1SEQL 3BMVA 4ZDHA 4XMLL 2BNRA 5J13C 2YPLA 4BQBA 3B2UD 5I30H 1GHFL 3EOAA 1J87A 1QHOA 5D7IB 3IFOB 4XP4H 1U93A 1DQML 4LLDA 4JKPH 1XEDA 4PJCB 2R29L 5L6YL 1I8LC 2VISA 3L7FA 4F9LC 4M8QA 3PV6B 3HTLX 5ICZA 2W65A 3I6LE 4G3YH 3DSNA 3VXTB 4H0IA 4X80L 4N5UA 4ODWA 4BQ6A 1SY6A 2QBWA 2OCFD 3ULVC 4XT1C 1QEWA 4NHUB 5JW5A 2XTJD 3V5DB 1CIDA 4PRIA 1UENA 4N1CA 4LPUA 1ZLVH 4PV9A 1NCNA 1XF2B 4NKOA 3WJJC 1B6UA 1J18A 5J7CC 3QEQE 4XWGH 4WEBH 3BKCL 1CL7H 4TUJB 1Y6MR 4GO6B 4KU1A 4OLWH 1S9YB 1H3VA 1DQQA 1T20B 5DJ8B 4H88H 2W9EH 4JY5H 1EA9C 1JTPA 4IRSC 2K1MA 2H32A 2IAMC 2XFXA 3E2HC 4OM1L 5FYJD 2R1XB 2C1PB 4ZNEA 1AIFB 5IT2L 4PJ8D 2D03H 1H8OA 5CJBA 4CNIB 3RZCB 1YMHB 1NDMB 3BP5A 1A9EB 1F2QA 4YHNB 1Y0LB 3L5XH 4Q9CA 3FB8B 1QOKA 1OTTC 1GGUA 2ESVB 4L4VE 3DV4A 4UOW0 4YXKL 4X7CC 1DBML 3O6FB 3VXQA 1TZGL 2UUDK 4CMMA 5C0FB 4PGCB 4L4VB 2VAJA 3ARWA 4Y2DB 12E8L 1FVEA 1MFNA 3EOBA 4N0YL 1M7IB 3BO8A 1OTUD 5J11C 1CU4H 3RWFB 1JGEB 4JE4B 4FN0A 4OLZL 5F96L 3GRWL 4LVNB 2VQTA 3NZHL 5HYJE 1JP5A 4TVPE 1U58B 4YXHL 2HVKB 1T04A 2NY5C 1HCFX 4EJ1C 3THML 1BF8A 4LQFH 1KUMA 4JFEB 3HHRB 1KJMA 5EBLB 5EC2A 4TOYH 3QDHA 1FYTE 3DX9A 1ZLSH 3ROLA 2HFTA 4LU5H 1I9IH 4GRLC 5C0AE 5I1EH 4ZFFA 2I9LB 4ONHB 2AI0L 1AC6A 1FYTB 5D96B 1BZ7B 1KEGH 3VXRB 3D85D 4G8GA 1N64L 4Y89A 4EDWH 1FG2A 4K94C 3QBTB 4XC1L 4G6FD 3RNQA 4Y5XB 4JRYB 4W6XB 4RGMB 3C5ZB 2E8ZA 4GT7A 4XWOD 3SGEH 4I77H 2OK0L 3KPLB 5EUOA 3ZYJA 3MMEA 2J88H 3VXSA 4M1DH 4ZPTB 3QG7H 2FJHB 1CK0L 1P6AB 5IESL 4KRLB 1P53A 4APQD 3IFPB 1T2JA 3SCMD 3CU7A 5K9OB 3JBG7 2NW2B 4WGWB 5I19L 1OB1B 5IWLC 4HWNA 1NGXB 4OD3L 4QTHA 4XPHH 2N56A 1MCPH 1MH5B 5J6GB 3RZCD 4HWBA 4JPIA 1CQYA 1KGCD 3NFNB 1ZHNB 3EO1A 4MNHA 4P2RA 2DLGA 2ESVD 3CZJA 4WFFD 1E4KC 5EU4A 3LZFH 2I5YL 1I7UA 3BE1H 3O6FD 2YUZA 3LPWA 5JOPD 4WNQB 1QFWM 2E5EA 4Y2DD 3GMOB 4GW1B 4G9DB 1REIA 1FN4A 4RX4A 4JG1L 4NFDA 5LGJB 4XCCL 5IHZB 4NHCL 3H0TB 2QQNH 4PLOB 1DUYA 3MUZ1 5FK9B 3LH2L 1AO7A 4M3KB 4HIJA 1HQRA 5TDPB 5JXED 1AHWA 4YDJB 3WHE0 4NJAL 4XCYB 4O9HH 5HPOA 4FQ2H 3BUYB 3O8XD 2OSLA 1A6WH 1V5JA 2VDMH 3RWCB 4U1SB 3DWTA 4NUGL 5E0QA 1A4KA 1IZJA 1SJEA 3TA3A 4UAOB 3WFHA 4TUOB 3TO4C 1MHPL 2WBJA 4C55A 3AUVA 3VXRD 1U8LB 2EE9A 3B8SA 3NACL 5D7KE 5L7XL 1Y6NR 1B0RB 3RGVD 4M1GL 5IVOA 3M07A 5JMOC 2BXYA 2HJLB 1NBQA 4W68A 4JRYD 4KHXH 1I1FA 3P77B 1J1OH 4E5XB 3NIDE 5AEAA 5EG6C 1NLDH 4RA3A 1YY9D 1X6LA 4UV7H 1YNTB 2EIBA 1OF2B 1VGEH 3UTPD 1BHGA 3V4UH 5C07B 5FM4A 1NCUA 4AT6B 2UZYB 3FFDA 1F4WH 4N8VA 4PBXA 3S3JA 3C8KA 5HDOA 4PREB 1K4CB 4NO0A 5IJVB 4C4KT 2BMKB 1GGYA 5DMJB 4UTAH 3VFGH 3O9WA 2K3TA 4WI7A 4PGEB 3HE7D 5KAQG 3FQXB 3QXTA 4BA8A 4JM2B 3CSYA 3EOYG 3ILPA 4Z7WF 3RI5F 4WU7B 3F7RA 4J3UA 4ZAKB 1IM3B 4I2XB 3ZKSD 5HGDA 2MKWA 5KN5A 2D7PA 4LKXA 1KPVB 1DN0B 3OSKA 4CN6A 4XMKL 2DOCA 3EYFB 3L5WA 3RKDD 4HUWA 3GNML 2UVEA 4GMSH 3RX7A 4XAWH 3WIFB 2VLME 4N8VG 3SBWC 3SDXF 3FO1A 1AD0A 3IDJB 1BJ1J 4IMKA 3TZVB 1E27A 3C2AH 3WDJA 2J1KA 1B0GA 1AKJD 1T6VN 5LWYH 2CRZA 5A16B 2BZDA 3D25B 5ESQA 3DHJA 1QVOA 3MXWH 4JFHD 1EPFA 4HAGA 1HK6A 1HH6A 4D9LL 1N26A 1IARB 2DQIH 5HHVL 3BRFA 4P99A 5HD8D 4LKCA 1MY7A 2YRPA 5FA4B 3DTXA 3HI6L 2D9CA 1IL1A 1UWXH 3FZUC 5H37G 2JLLA 5F7UA 3EOTL 1YA5A 3CX5K 4JFXA 1T1YB 2BNQE 5DJ0A 3Q5YA 3GFUA 4HGMA 3HMXA 1F3DH 3H42L 1SHMA 5HSFA 3WSQL 2EDEA 2P1YA 2BNQB 2R4SH 4L29B 1Z9SA 5J12C 4N0CC 4PJ9B 5DR5L 5FYLH 4QOKE 3DVNB 2I26N 4KI5D 5C07D 4DVBB 1KCUH 2XQBL 5L8JB 4CRPA 4QOKB 5I18L 4I0CC 4H1LB 4PJDF 2ZP0T 3SDAC 3FKUS 3O45B 3QPQC 4KUZL 1D5BB 1EO7A 3LS5L 1PY9A 1DLFL 5M95B 2P42B 2OI9C 5F3BA 3FMGL 4OUOA 5DO2D 1KCSL 4UDTB 4KTDH 1IFHL 4JM2D 3F7PC 1CG9B 4HF5L 3MRCB 4MB4A 4R0LB 2BC4A 3VD5A 3C6SA 3ARYA 4MCZA 1RUAH 4ZAKD 4NNPH 4ODTL 4L8BB 5JW3L 1ZVYA 4Z7UF 1T0PB 1ACYL 2L0DA 5LGHH 4L9LA 4UT9H 3BZ4B 3BQUD 4J3VA 1BGXL 4Y1AE 3SE3A 1NL0L 3OR7B 1JHKH 3PP4L 5LCVL 2GK2A 1X5IA 3H9HB 5HHOE 5JUEL 5FFLA 2Z92B 4EZMA 2JKXA 3MRNB 5DRWA 3TZVD 4DZ8A 5E2VL 5E8OA 2D7QA 1HHIA 3F6IA 1JMXA 3LB6C 4JJ5B 4UUJA 4FOMA 4C56E 1CXFA 5J4MA 3WFBL 4OFPA 1EBPA 4Z0XA 2C3WA 2QQLL 3D85A 2V7HA 2P7TB 3A67L 4ZO6A 4R4NC 1FVCA 1KLFA 4F7MA 2AEPL 1QO3B 5H2BA 4FQJH 1AC0A 2VWEE 5IM7B 4RDQF 4ZXBC 2CUMA 4MJIE 3UBXI 3TO2A 4OT1L 3SO5A 2ZCKH 3HNSL 1JK8A 3QT2A 4JDTL 3QEHA 1IGTB 3JTCA 3V6FA 2N7BA 4MJIB 1R3LA 4AMKL 2WLZA 3SE9L 1V3MA 4APQA 1INQA 4PTUA 3SCMA 3MOBL 4X99B 3WKMH 1GOFA 1IKFL 2EZ0C 4JANA 4PJ9D 5BV7L 4MLIA 1GJIA 1J8HB 2AKRA 2VZVA 2FH8A 3LS4H 1TQBB 1TZHB 2GJJA 4I5BA 1U3JA 4NBZB 3PDGA 2EC8A 3ULUL 4HFWB 3TIDA 1RU9L 3A6CH 3NIFE 3QZWB 3SKOA 4GFTB 1F58H 3WE6A 4CVXA 1IT9H 3J8F7 1JMZA 1J0HA 1SMOA 1C5CH 4OLVL 4X6CE 1O7VA 2Y07H 2ZSWA 3FO0L 3PWLA 5ENWA 1K3ZA 2JJUA 1ZE3C 1CLCA 2UWEA 2P8PA 5ILTL 4R7DA 4S0TD 4UOJA 4X6FB 3MXVH 5J06A 5F7LB 1FSKB 5T3XE 3JV4B 3QCTH 2YK1L 2X1XR 4P46C 3NCJH 4NSKB 3QJHA 3G6JB 2HLAB 2R4RH 1CGSL 3T2NH 5JXEA 1T7YA 3IDXH 4GSDL 2JK5B 1NEZG 5GQBA 1BJ8A 4XVTL 1EIBA 1V7ML 3O8XA 4P3DA 3QUZA 5F8QC 1ZGLM 1NCAH 4G7VH 2DKUA 2R0LH 5E5MA 5KSUB 2EDXA 1ZGLA 1VHPA 3MRFA 3WEXB 5F1SA 2VXQL 1IC4H 2Q3ZA 4KJPC 2CRIA 5DYOA 1WBXB 3RGVA 1RJZA 1H3PL 4KROB 3O6KH 1XF5A 4M5YL 5KVGH 4GW5B 3B8YA 4OGXL 3BD5A 1T89C 3RWHA 5E8EA 5CKAA 3ZLQC 1S78C 4KKCC 4J6RL 2PN5A 4JCLA 4JREB 4P9HH 4K23H 1WBZA 2X4UB 5H94B 3GSWB 5F6IC 2AXGB 2KUTA 4NN6B 2QL1A 4H5SB 1JV5B 2AK4E 2HH0L 3QUXA 4F7CA 5J57B 5ESAB 2AV1B 4RISL 1R5IB 2X1PA 2CIIA 2VH5L 4J4PC 4P57A 4ETQA 3BKJL 1JPFA 4I3RL 3NIGE 1Q72L 1CT8A 1X5JA 2Y9RT 4C4KO 2IH1A 3EYVA 3RUGA 2BDNH 3QRGL 3HE7A 4UTBL 3CD4A 1L7IH 3BH9B 4G43B 3SKUD 1TTUA 3M17A 4FMFA 4OCLC 3FCTB 1RURL 4NYLA 5GGRA 1OGAD 2MPAH 5CHNB 4PJ7F 2XG5A 3JVGC 4HKJB 3WFZA 5JPMA 2J12B 3DX8B 3SDDB 3EUUA 4JHAL 5I73B 5DD5L 4Z8FL 4I3SH 2I9TB 1WC7B 2Z91A 4QHUB 4MDIA 1OQOA 2F5AH 1EVUA 4PRDA 2RCSL 5KJRL 1F6AA 4JJHA 5F7FA 4DKEL 4HV8A 3QFJE 4PJHE 4HC1A 1K5NB 2BSSA 1AGFB 1AKJA 3KLAA 4YHIA 5IQ9B 4X6BA 3HC0A 5DZNA 2GYSA 3L9RB 3QFJB 2ORBL 4PJHB 4A6YA 3ULUC 3GIZL 1M7DB 1K2DA 1T7WA 1YEKH 3UPRA 2OL3H 5JW4R 4WHTB 1EEYB 2AJZA 1UWGL 2XA8L 5C09E 3UTZA 5TQ0H 4KROD 2JB5H 4WUKL 1GGBH 1KCGC 4POZD 3O11A 1FFPA 3MRKB 3ELAT 2XIDA 4EDXA 1P6FA 1GIGL 1A1NB 3IFLL 1BF2A 1NGZB 3TJEH 1HIMH 2XZAH 2P5WB 2JCCF 1S7SB 3HZMB 4I0PB 3TBYA 4UBDD 1HKLH 2EYTB 5EC1B 1B0WA 5ACZA 2Y5EA 2FGZA 3JUZA 4R3SB 5BRZE 3ARGB 2PR4H 1Y6KR 3TN0A 3CVHL 3K7UA 3VWKA 4QO1A 4PRBB 4GRWE 2P8MB 4OGAD 4OM0H 3GMQB 4YR6A 4NM4L 3VCLB 4RFEA 5BXFB 4POYA 2E27H 3OX8B 5IIEA 2PYFA 5I6XB 1I4FB 2BNRE 5B3JF 1BPVA 1F00I 1F42A 1V3JA 1UXWB 3RDTB 4XNZB 5EU6E 3I6GA 4QRQA 2N1KA 1OT2A 2AXFB 4KKAD 2WINA 5DVNA 3MROA 3SDDD 4XCFL 5EU6B 5GGTL 2EH8L 3IDGA 4GBXA 1VKXA 5DEGB 3BQUA 5TDOB 3HI1B 3T3MF 2NXZB 4XNQB 1MY5A 4CL7A 1X4XA 1YYMH 1T0MA 1IEHA 1HYSD 4QCIB 3LKNA 4FZ8H 1CVRA 1OD7A 4LIQH 2NY4C 4XH2A 1PX4A 4PRIE 1VADB 3LKRA 4JRXA 3OG6B 2NTSP 1A7NL 1JCKA 3AREC 3NTCL 1I8KB 3P9MA 2NY5H 4I18A 2Q7YA 1A9BB 3HG1B 1SEBB 4PJFF 4PRNB 3L3HA 4DN3H 2R0WL 5DQJB 4KJQC 4ZPVA 5FM8A 4ETYA 3VXUA 2FD6L 3VGBA 5GJTH 5C6TL 3U0WH 3L7EB 4Y16B 5E6IC 2QQQA 4FZEH 4GG6A 1KC5L 3QNYB 1CD0A 3TBTA 2N7AA 4F7EA 2YRZA 5M7QA 3T2OA 4TPRL 4W4NA 4WFEE 4K94H 5D7LA 2AJYH 5B8CB 1FVDB 1KENL 1DLHB 2P5WD 4ZUUA 1SEQH 1HH9B 1N5AA 4I0PD 5B4MD 4ZNEE 5DSCB 4XMLH 1Q94A 3D69A 4MX7A 4YIQA 5KANG 5IK3B 4PB0L 3ARGD 4WJ5A 4L4TA 1GHFH 2YSSA 3GMPA 5K59F 2VRAA 1T5XB 1KG0A 1DQMH 3CPLA 2QSQA 2ZUQB 1CFSB 4YNYA 5D5MB 2BHYA 5FIEA 2ADJB 1HXYA 1AE6L 1QFUH 3TH4T 1WWCA 3RIFK 4IIQA 4X80H 2CD0A 3RDTD 5I75B 2ED8A 2V5RA 1KJVB 1TETL 2E6JA 1AXSB 3G04A 4RAHA 5DJYB 3MJ9L 1A6UL 4ZS7L 1ZHBA 1N0LA 1M05B 5EORL 4YHKL 5D1XB 3OV6A 2OQJB 1T22A 5D93C 5BW7A 3O3UN 3VFSA 1H5BB 2NXZD 3N1MC 4LAJH 4ELMF 1CE6A 4TSCL 3VD4A 1KJ3L 1I3RA 2P24B 4PD4J 4KDTC 1KFAL 3G5YA 1QBLL 1NMCB 3BFOA 2E6QA 4MA7L 4Z7OF 3RWGA 3BKCH 5ISZB 4CJ0A 1E6JL 4AG4L 2P44B 3IU4L 1A2YA 4XPAL 4G8GE 2YD2A 3FB5A 1HI6A 3CFBB 4EQ2A 2WQRA 4JY4B 1LQVA 1HOCA 3HG1D 5DUMH 2A0LC 3UDWC 3QXDA 5IT2H 4X5WB 2YS4A 2RJMA 3V8OA 5EUOE 3DROA 4FXKA 3VXSE 3B5TA 3LRSB 1KT2B 4KY1H 4Y16D 3KPSA 1JI2A 4YXKH 3BHBB 1DBMH 1TZGH 3QIWA 1T7VA 4D2NA 4ZYKB 3DIFB 1F4AA 4Z76A 4N0YH 4MWFB 3FQRB 3F12B 5FO9A 2OP4L 3PNWB 1AGEB 2VSCA 3TVMB 4Y4FA 2DICA 1U8JB 2DMKA 4MZ3A 4OLZH 4P2RE 1T1XB 5F96H 3GRWH 4IRJB 2NLJA 3NZHH 5KSAD 3T0EB 1CD9B 4MNHB 1X5GA 4YXHH 3ZE0F 1QNZL 4JFYB 3HLAB 3IXTA 2KQNA 3THMH 1NAMH 1OGAA 1BBJB 1DQJA 3ETBF 5EUKA 4TTGA 3NZ8B 4QRUB 1DTUA 2YA1A 3T77B 1RAMA 1J11A 1O5DT 2AI0H 4YO0A 4K3DL 1N64H 1TQCC 3JV6B 5IG7B 3NPSB 1AO7E 3DX7A 5D1XD 4RGNE 3VI4E 4XC1H 3G08B 4QHNA 5DJDB 1FZJB 4MQTB 1MJJB 5JIPA 1KBGL 1NUGA 3DMMD 5C0CA 1CLOL 3DV6B 1NGQL 1KNOA 4RGNB 2OK0H 1WQVT 2QTEA 4YH6A 3VFPA 5F9JB 1CK0H 5IESH 4G6AD 3ARVA 3NCYS 5HGGS 1CXKA 5IROC 5ISZD 3GSRB 3E3QA 4UINL 1IQDB 4PJGF 3SGKA 5I19H 2MNUA 1JPTL 2OXHA 4OD3H 3WCYA 3WN5A 1BFSA 1NPUA 3U0TA 5JZ7D 2P47B 3RPIB 5I8KL 4XVSL 2UVFA 5ETUB 1FL6A 1DN2A 4K8RD 4NN5B 4CN4A 5HI4C 2JELL 6FABL 3AU1B 3BWAA 4NQXA 4X5XB 2V2WB 5AG8A 3K2UL 1SM3L 2I5YH 3NN8B 4CMHC 1I85A 3EHBD 5T33L 2DI7A 4P4KB 4WFHD 4Z7QE 2WW8A 3BGMA 5JDSB 3FRUA 3FT4B 4N90D 5GS0L 4YFDB 1NSNL 3R06A 4RNRA 1P7HL 3I85A 3VA2C 1BREA 3TVMD 4JG1H 3MO1A 4GXVL 4NHCH 1YY8B 3MRIB 1FIGL 4HUXA 3ARFA 3LH2H 1A7OL 1B4JL 1EH9A 3NFPA 5D72L 3T0ED 1MHCA 4X0KB 5TQ2L 3T1FB 2ITCB 3MNZB 3MUY1 5E7BA 4J3OC 4NJAH 4UIMB 3AGVA 5MP6H 5FXCH 2VERN 4MSWA 3DBXB 3REWA 4NUGH 5JNYA 1EHAA 4JPWL 4KMQA 4D0CA 1QKZL 4F37K 1MHPH 3KLHD 4Y5VA 4Z7NF 4FQHB 3NACH 5L7XH 2GAZA 4XX1E 3QQ4A 3H6JA 3EJJX 1LE9A 3QH3A 4M1GH 1N6QL 4LOUD 4MLSA 3HI5H 4JCMA 2XYCA 5GIRA 5DMGD 4F3FA 1KTLB 4YQXL 1IEBA 1ZMYA 4YBLC 2NY1C 5JIKA 2HKHL 3WNOA 4OZ4A 1NMAL 1U8PB 1KCVL 5IB5B 3LRGA 3OKEB 1JWMB 1T7ZA 5KW9L 3RX8A 2JB6A 5EIQA 1HDMA 5E7FA 3V95A 3L3JB 2GSIA 3ESVF 5BJTA 1KYOJ 3MBEB 1J1XH 4NQCA 4U1IA 4MD0B 4WWKB 3N1FC 2H41A 25C8H 1LHZA 3QSKB 3U9PL 5EBMB 2J3SA 1Q9LB 4WI9A 5B38B 4M61A 5L2KB 4MA3A 1FZKA 1G7QA 1PQZA 3G9VA 3ILQD 3B9KC 5IMKA 4X83A 4OCSH 3TH3T 1FC1A 1DVFC 1F97A 1HXMA 5KZCB 2KZ1B 1XT5A 4BUHA 3TT3L 3T0XA 2H3NA 2J8UF 3CFKB 3WS6A 5D7JC 1S5HB 3T4AB 3EKCA 4I3GA 3RP1A 3GNMH 3KR3L 4J23A 3MGAA 3BZFB 3ZDZF 3STZB 1IM9D 1FNLA 3O4OB 1OAKL 5DVLA 5D8JL 2I07B 1OP5H 3S5LA 1FJ1B 3ULVF 4JDZA 1UH3A 1G9ML 2VC2L 1MCKA 4JDVB 2WIIB 4ONFL 1T5WB 3EYSL 3QNXA 4P2CG 4D9LH 5GZOD 5CEZE 5DUPL 5MEOB 5HHVH 2NYYD 4LGSB 2E7MA 1MNUL 5GS0C 4XBPB 3BDYH 3H7BA 5INCB 2DQFB 2NY7L 3EOTH 1W72B 3GI8L 2GTWB 3NFSL 4K2UH 1ZVSA 3H42H 1U8KB 2A2QT 3KPRE 5D2LA 3WSQH 3BZEA 4HW6A 5DR5H 3HZYB 2X70A 1G7MA 4ZTPH 2XQBH 5C0IA 4LEXH 1FG9C 3KPRB 3S5LG 4NQDD 3MREA 5DQDL 5D9SB 3RVTD 3ARDC 5BQ7B 5I18H 3LN4A 2YWYA 1LDPL 1Q9WA 3RNKA 3W9DA 4KUZH 4Y5YC 2IPUG 1IGCL 3LS5H 1DLFH 2EO9A 2QHLA 4UQ2B 1CCZA 5F1IB 5K9KA 2BHUA 1UKSA 1I8MA 4KFZC 2IQ9H 1KCSH 2ZUWA 3ARBC 1IFHH 1G7IA 5BZDB 4OB5H 4CUCA 1JYXA 5MEQA 2FEDD 5F7DA 3PHQB 4O2EB 3WLWD 4WUUA 5SWSB 1JFQL 1WZ1L 3VGEA 1XGTB 5JW3H 2E7CA 1ACYH 1KGCE 5KZCD 4GAJH 1DEEA 4D9QD 1UH4A 2VDOL 1NEZB 3QUYA 1BGXH 1NL0H 2BVYA 1NC4A 3T8XA 2LE9A 2VOTA 5JUEH 1AQKL 4P2QD 3PXJA 2IG2H 4WHCA 5E2VH 4U3CA 1C7SA 1TVHB 2V5MA 1XGYL 3FB7A 4MVBD 3IYLW 1TJGL 2W0FA 5HHXL 3IRPX 3FRPG 3ZYZA 4KKNA 3RY6A 3RVXC 2UWEE 4JVWA 1UZ8B 4OSUL 2F5BL 1RK1B 4TQEL 2VR9A 3KPNA 1VFMA 5ENWB 4NBXB 3WFBH 3QDAA 4AENB 5C0EB 3CXDL 4NP4H 5C86A 3QQ9D 4O4YL 5T3ZL 3A67H 1Q1JL 4JFOB 4Z77B 5DHVH 3GI9L 1MLCA 2D7OA 1S7XA 2AEPH 4KKBC 5FO7A 4Q6YA 2X4QA 4FXLA 3MGOB 4U1MB 3DMMA 2ID5A 1KULA 1HQ4A 3MQIA 4OT1H 3PHOA 4Q6IA 1EXUA 2D0GA 1UXSB 3KJ6L 4OCNC 4KK9D 1CS6A 4AK1A 3U30C 4AMKH 2IH3A 3SE9H 4I48A 1TCRB 4LK4A 2ZOKB 3GSQA 1NC2B 3MOBH 4PGDA 1CD8A 3GSNL 4U2YA 5JLZA 5BV7H 3B9EA 4LCCB 4CU6A 2ICEA 3DUUB 2PYEA 3O0RL 1WTGT 2EDTA 3VFRB 5DWUH 3GSVB 1WWWX 5TE4L 3QIBA 4M7LL 5DRXA 4M7ZB 4RAUA 3CSPA 4OZGA 4YDKH 4MAYA 4Z95L 2ZOLB 3TF7A 4XP5L 5A3ID 4N9GB 1J0KA 4OLVH 4YHZH 4C54A 2BOBA 1QLFA 2V6HA 3QUXB 3FO0H 4LL9A 3F5WA 5SWSD 2VLLB 1PEWA 3TC9A 3RUGE 2YEZA 2X89D 3O3DB 1OP9A 4HKBB 5ILTH 4PD4K 4X6DA 4HHAA 1LWRA 4LVEA 3ARRA 1R5WA 2YK1H 3CH1B 2IH1B 4AEHL 1S7TB 1AGCA 2P5EB 3U0PA 3CFCL 4JM4L 4OGYH 4JB9H 2DBJA 1CGSH 2HRPL 5EFIB 5ID1B 4GSDH 4JY6B 4BFEA 3X11B 1RHHB 3I2CL 3BJLA 4XVTH 3VWJA 4FNLH 1V7MH 3PP3K 3PWNB 3UTSB 1N7ML 1S9WB 4E41B 2J5LC 2VN7A 4P23C 1S3KL 3HE6D 5E1AB 2XKNB 2VXQH 4FQXB 4LVOC 2Y25A 1Z9LA 3WLBB 4Y8AA 1TMCA 2FR4A 1H3PH 4M5YH 2GEEA 3ME0A 4LHQB 4FABL 4OGXH 1F6AB 1F6LL 3EJZD 3IETA 3OKKA 4Z7WB 5A2IH 1CXHA 3MCKA 2J4WH 4X4MA 4J6RH 2BOCB 1U36A 3U46B 1MEXH 2R2BB 2GJZA 1D5MB 1ZT4A 5IBTL 5HPMA 4FFVD 4PY8J 5I76B 2BERA 2APFA 4PGJA 2HLFC 3SE4A 1NC2D 2HH0H 4N0UA 2HJKA 3VXMA 4RISH 2FZ3B 1MAKA 4ODHL 4M4RA 2VH5H 3BKJH 4AQOA 2R8SL 2CLRB 4I3RH 1CFTB 1Q72H 3SDXB 3GO1L 4XXDA 1RMFL 5FDWB 5GRJL 3DGCR 4XC3L 4YC2C 4QWWD 3V5KA 1J7VR 4UTBH 2W38A 5DJXB 1RUQH 1S7RA 3FHAA 3GSUA 3U4EA 2B1HL 1RURH 3VGGA 2EEDA 1QR4A 1MJUL 1YEGL 3R8BB 3GBNL 1L8JA 1U8MA 1ZLWK 3IVKB 3PJSB 5AWNL 2C3VB 5ERWB 3HMWL 3I3BA 4PG2A 3KPQA 2CDEB 4Y4HB 3QCVH 3C6LD 3X17A 2H2PD 1SJHA 3SY0A 3DYOA 5DD5H 3OKNB 3QG6B 4O2CB 2R2EA 5DD3L 5JTWA 2RCSH 5KJRH 3LKSB 2EXWD 2P5ED 1F8TL 2MCG1 4DKEH 1IM9A 1C08A 3AB0B 3GHEH 1A6TB 3WS3A 3UTSD 2QSTA 2Z31B 2ORBH 2WUBH 4OFKA 3CX2A 4PJDE 1JZ5A 1S8DA 4D0BA 3GIZH 4E41D 4HD9A 5DJZA 5FO8A 4PJDB 4FQXD 2P8LA 2Y06L 2GFBB 3MLYL 1DUZB 1UWGH 1WCBA 2HTKC 4L8SB 4YBHA 5J56B 2IBZY 4F9LA 1YPZF 3BKYL 3OL2A 4WUKH 3L6FA 4OZHF 4OZIF 2OL3A 1DBJL 1IC1A 3B2VL 1GIGH 4JRXE 1UB5B 1D7FA 3RL2B 5AYUL 1JWUA 1T1ZA 2Q1EA 4ZO8A 3UO1L 3V6ZB 4LPVA 4HWBL 1LQSR 4Z7UB 3VRJA 1IMHC 3EJYC 3KJ4C 5C6PB 2EE3A 3VXUE 1UFUA 3CVHH 5B21A 3JWDL 4NQDA 4AIXA 3I6KB 4K3EH 4NQEA 4NKMB 1ZAGA 3MRJA 1UJ3A 3DUSA 3NAAL 4GG6E 4PJIF 1UGNA 1LE5A 2Z4QA 1U95A 5D7LE 4NM4H 4HUUB 2VLRB 4M3JA 3T0DA 4MB5A 1I1RA 4JKKA 2DWEA 3BPLC 3PV7A 1SQ2N 3N1PC 2O26U 3PQYA 1JF5A 4FXGA 3L5HA 4XXCA 4IS6B 4GRMB 2ZCLL 4L4TE 1I1YA 1XGRA 4PS4L 2CO6B 4ORGB 3MYJA 2C4FT 2ED7A 3D69B 3SEPA 2PO6B 4U1GC 4XCFH 4YIQB 5GGTH 5CJOL 3SJVA 2EH8H 4Y4HD 1LDSA 5I1CL 3SKNB 4HWZB 4JO4L 1IGIL 4EIGB 4MS8D 3CSGA 4MB3A 2F58L 1KPRA 5E99L 2C5DC 4NQTA 4MNQA 4P2QA 3RRQA 2DD8L 5EBGA 1IQWH 3QXAA 5I66A 4MVBA 2F74B 3UTTA 5GXBB 1KXTB 1GAFL 1MIEL 2IQAA 3LPFA 1VFOA 3LKOB 4OCYL 1A7QL 2XZQL 2Z31D 4JFDD 5IGXL 1A7NH 4TNVF 3NTCH 3WNNA 3KYNB 3ULSB 1MRDL 4PJXF 4UT7H 1XGQB 3IKKA 4P2OB 3W82A 5T1KD 4I9WD 4KQ4L 2OR9L 4EN3B 1RZFL 1AP2A 1T3FB 4EUPH 2FD6H 3IDMA 2UZXB 1BFOA 2VUYA 3U36B 5C6TH 3MNWA 3AY4C 4D3CH 3AAZA 1KC5H 3RVUC 4NUJA 4ZFOA 4H8WL 2V9QA 3KPOB 4TPRH 4XTRC 3CUPA 4RIRB 1YNLL 4Z7VF 3TCLB 4YBQC 4LHUA 3V4PL 3MLVL 4ZSOB 3BWUC 2IFGA 3QIUA 5I2IA 5IW1B 4CU7A 4PB0H 5EPMA 1BEYL 2AJ3B 4NOFA 3WFDH 4IOIA 2Q3AA 2VXUL 3SQBA 3KPSE 4ZO7A 4OFVA 4DOHB 3T09A 1FAKT 4WTZG 5CMAB 1M7XA 2VLRD 1MFDL 1F3DJ 4G8EB 3ZMRA 2WBKA 3LSOA 1AE6H 4E0RA 4QT5A 1BQLL 5DJ6A 5E2UL 3JTTB 4RAVB 3ZDXF 2EC9U 2XN9B 4DZBB 4JZNA 1TETH 3REVA 5IHLB 4WEMB 3IJSA 1A6UH 4ZS7H 2PO6D 3DARA 2MTPA 5DGRA 5E6YA 3OXSA 5EORH 4YHKH 4DAGL 1UB6B 4LHUG 4Y19A 4ZFZB 2EH7L 4MHHI 1OTSD 2BP3A 2CDGB 4NKIL 1OGAE 4B7LA 1KJ3H 1KFAH 1P4LA 1QBLH 1S9XA 3BEVA 4MA7H 1CGWA 4MXWL 4DCQB 4WHYH 1NUFA 1UA6L 3LQZB 2IGFL 1E6JH 3IU4H 4NDMA 4XPAH 1IC7H 3E6HA 1NAKL 1T4KA 5FUCC 3G5ZB 5IW3A 4AYFA 3HE6A 1BLNA 1NBZA 1AY1L 4QXTB 4F57L 3GB7A 5C0CE 1KSRA 5FB8B 4XNUH 1J0JA 4QHNB 5IB3A 4DK6A 3LKPA 4PJ7E 3K