1W0WA

Crystal structure of hla-b*2709 complexed with the self-peptide tis from egf-response factor 1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
molecule tags Immune system
source organism Homo sapiens
publication title Thermodynamic and Structural Equivalence of Two Hla-B27 Subtypes Complexed with a Self-Peptide
pubmed doi rcsb
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2004-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0wA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1w0wA01
5B21A 1OF2B 2Z8WC 1RPQA 3DRTA 3ILQD 5J1SC 5E08H 1AHWA 1QLEL 4O2CB 4QT5A 2GI7A 3RL2B 1KC5H 3KYOB 3OL2A 4JFXB 4U7MA 5TDNB 2X4OB 5AYQA 2YK1L 4GG6E 5CD3A 2NW2A 1T3FB 5IK3A 4GAGL 1LDPL 2VDQH 4EIZC 1BOYA 2C4XA 3GRWA 5GS0H 2W1NA 3U0TA 3S97C 1EHNA 3ARGC 4JO4L 4LRIA 3V5HB 4DZBB 3DOSA 3STZA 1DN0B 4KQ3L 3PL6A 1NMCB 1AQKH 3AXLB 4GOSA 2DF3A 3RVTC 1J0ZA 1T22B 2BY0A 3IU4L 4YXHL 3WBDA 2YOCA 4XPFL 1ORSB 5LGHL 4FTVB 4TUKH 4OLZH 5IESH 4XXDB 2CPCA 1HXYB 3NZ8B 5KSBA 5KVEL 3RBGA 3PHOB 2YD8A 4NOFA 3FAWA 1NGZA 1WITA 2CJUL 3LY6A 4E42B 4UMGA 1DN0A 5CJ5A 3KR3H 4IRJB 3CFBA 3VMOA 3IETB 4UOW1 4JZOB 5C0DB 1X4YA 2D7OA 3DUUA 3GB7B 3BD3A 1BPVA 3ABZA 5F7DA 5MEPB 4KXZH 3KPRB 1FVDB 4J12A 2FBJH 2WBJC 4KROB 3TGXA 4U7SA 5C0RH 4F2MB 4Y5XC 5C09E 5DTFB 2EXWD 1RUAH 3B8YA 3N1QC 5TQ2L 4U31A 3EDEA 1AGCA 3ZKXB 3DPBA 4F57L 1UJ3C 2EDJA 1AHWC 1I9RL 2E7MA 3U7YL 4KTEL 3C9NA 3UJJL 1FFOA 3JV6B 1J0JA 3FO0H 5GRUL 1JVKA 3QA3A 1NBYA 5L2KD 3PWVB 4Q2ZB 1MRFH 4YHNB 5HDQH 2FGWH 2WUBH 4U1NB 2XXMB 5C08E 1ZLSH 3UC0H 4BUGA 4CVWA 2FYYA 1TIUA 2IALA 3EYSL 3MMEA 2DMCA 3MSPA 4LLAA 3SKNB 2AW2A 4HK3N 3WFHB 3PL6C 2YC1A 5FAAA 5I8KH 4OCRH 5I1HH 4FG6D 1CICB 5F9DC 3BHBB 2VDQL 3RWEB 2OJZL 1LO0L 5T3XH 4HV8B 1J8HE 1VGKB 2B0SL 5LJYH 1N5AB 1U3HD 3HI5H 2NY7L 3CVHH 1EEYB 3OR6A 4QOKD 3JBG7 1JPST 3DTXA 5FK9A 5IT2H 2IQAA 2FHFA 4NJ9H 4PB9L 4RFOH 5EC2B 3GMRA 1DDHA 2XN9D 4JFFB 4U1HA 1U3HC 5JNYA 3I2CH 4O5LH 4PLKD 2DM4A 5F6HJ 2HRPL 4NQTA 2Q7YB 1KN4L 4DK6A 3ZL4L 4WTWA 3CSYB 4DKFL 1QG3A 3ARFC 1LO2H 3NABL 2P8LA 4QHLB 2UZYB 1OP3K 1NGQH 2LTQB 4FXKA 1KACB 1WAAE 1XGPA 4EUPG 4R0LA 2IANB 4PFEA 1JWMA 4LSVL 1IC5L 3RKDC 4XP4H 2Z31C 1UWEL 3MRJA 1SBSL 4Y4FC 2ADFH 4HKZA 4KKBC 3UYPA 2M8XA 5I15L 2IFGA 3R4DA 1WBZB 5F7YC 4D94A 4KZDL 2R1WB 5EIQA 2G75A 4NWTL 5BV7H 1IKNC 3QQ9C 2EYSA 1WEJL 2BCKB 4PRID 3Q3GA 1IEAB 1R5WB 2EIZA 3BPOB 3HZVA 1G9MC 4QF1B 1S7RB 2X4UA 4P2RA 3GJEB 4MDJB 3PP4L 3VA2C 1EEQA 2MHAA 2EICA 2VISA 4JCLA 1OAZH 8FABA 5E8PA 4HIXH 4U0QB 3EOAA 5DMIL 5JIIA 4G9FA 3AREC 4FP8L 2A6IB 1U0QA 1ZHKA 4KRPC 2ZG2A 4XCFL 2JJSC 4HIHB 1J86A 4J8RB 4WGVB 4KK5C 4JZJA 5DD1H 4PJ7B 3G5ZB 3I02B 4M7LH 2DD8H 1QFHA 4XAWL 2ADGB 1BZ9A 2EDFA 3QI9B 1SM3H 2BJMH 1MFCL 2BDNL 4JKWA 1BJMA 2Q76B 4CNIA 3UTPE 1VPOH 1JNNH 3BAEL 4O58L 3BKML 3UZQA 4KJPD 2A73A 5TDOB 4CVUA 4G80B 1RZ8B 3Q6FB 3ULVH 2QR0B 1QSFB 1TVHA 4LCWB 3X11A 1DBJL 1CU4H 4QWWC 1KYOK 1T1YB 4YBQC 5JO5A 3SKJH 1UXWB 4MAUL 3GRWH 2F19L 3CXHK 3ZTJH 1VDGA 2A6IA 4P48A 2IMNA 3PJSA 5E4EB 2DKSA 5H8DA 1KPVA 1EEZB 2D0GA 2Q3ZA 3UEZA 3SGDH 3MRBB 4M1CD 2K7PA 2QSQA 5IB2B 4FQXB 4W6YB 4YBQD 4Y4FA 4EN3A 3QUMA 1U6AH 1VGEH 3O6KH 4K3DL 1UZ6F 3U0PA 3W9EA 5FGBA 2R23B 2GJ6D 5I1CH 2AXGB 3VU2A 1PX4A 4P3CH 2R8SH 5D7SH 3BWAA 3GSUA 3HN3A 1KN2L 4CUCA 1H8SA 3S35L 4LF3A 1UB5B 3QFDA 2AABL 1RJLB 3P77A 4GW5A 3O4OC 5E2WH 4KQ4H 2CR3A 5GRVK 3UZVB 3PIQA 2X44D 4PGJA 2QADC 1MIML 3AS3A 3DV6B 5HDBF 4L4VB 2WSKA 4YR6A 1TZHA 1RHHA 5C6TL 3BPCB 1H9VA 3CFIC 4FFZH 4TSCH 4PJCB 3ZT7A 5DC4B 4L1HA 1HE7A 1CE6B 5C0EA 1OD7A 1PLGL 5J06A 5F9OH 5FCSH 2YK1H 2ZG3A 4X7DC 1D6VH 1UKSA 1TVHB 1BGXH 1M7DA 1DQLL 1ODAA 1AGFB 5D2LB 4JPIA 1XIWB 5JXAL 3I75B 4JGUA 3BRGC 4BJLA 1CD1A 4UV7H 4LPCA 3FQRA 4TQEH 3PGCB 2E5EA 1EO8L 1DANT 3T0EC 1B0RB 3PP3K 3VFTA 4MS8C 4OUUA 4J3OC 3W11C 3VFUB 5F9JA 4FQXA 4GXVH 3ROLA 1OQOA 2OM5A 4KRPB 4Y4KA 2DLEA 3SE8H 1KOAA 4R4BA 3MYJA 5EO9A 4NIKB 5MEOB 5LVEA 1BAFH 2BY3A 4WW1A 4ZODA 4XPBL 1IAIL 4YBLB 4FFVC 3BPLB 1JMXA 1HI6A 3QQNA 1JZ2A 5IW1A 5D1QB 4U3CA 1GSMA 4FQIH 1ZHKB 3MZGB 4YHNA 4ZFOB 3F6IA 2A38A 5FHAH 5F9AC 3CD4A 4BSWA 3QUZD 4RDQG 2WLZA 1N7ML 2XYCA 1MFBH 1OAKL 2FL5B 1QD0A 4YDIH 5I19L 2VISB 4QHNB 5CEYA 3BJ91 5DRNA 3FT2B 2NTFA 3MV8B 2IAMA 5BVJA 1JF1A 3MV7A 4YPGA 1CDIA 5DYOB 5HYIA 2Q76A 1YPZB 1FC1A 4IIQA 4ZFZA 4OJFL 1DQMH 2EKSB 4HBCL 5F7DB 1CGVA 4PG9A 1FBIH 3QDMA 3DVFA 5E2WL 1HNFA 4JFYA 4MJIB 4P3WA 4Q6IB 3T77B 5I8EB 3OGCA 1F6FB 5BZDA 4HK3J 3EHBC 4WDIB 2UZIL 1N8ZB 4YAQB 5C0DA 5HI3D 4ELMB 1A7NL 4ZS7L 3KLAB 4W4NA 4J4PA 4X6FA 4KAQL 3VG0H 2HP4A 4YDIL 2R0WH 4I4WA 2F58H 3U2SB 2FEEL 1Q9LA 4XMKL 4MJIA 3MREB 2HLFD 3DTXB 1IC5H 2XNAA 3V0AC 5GSVA 3W5MA 5C3TA 1S8DA 2ZSWB 1RZ7H 1A64A 3MOBH 4Z7WF 4MQXC 3MV11 1E0OB 1F11A 3VXRE 4UIKH 4W6XB 4TRPL 4EDXA 1C08A 2R0KL 4HIIB 3PQYB 4Z0XB 3WS6A 3UTTD 4DGVL 3RHWF 3BHBA 2BX5A 5DRNB 4FZEH 4YK4B 3EZJB 3PWPB 5KOVC 3RTQD 4R7NA 5HGHB 1NBQA 3ARYA 5F72S 1R3HB 3RDTA 2J4WL 3ARBB 3H8NA 4Z7NF 1A7QH 5IVZB 5DRWA 5HI5C 3IJSB 4F7PA 4LSPL 4PY8J 4MD4B 4NQED 3QYCA 5E9DD 1CDYA 3PWVA 2PO6B 4JGJA 1CXHA 1RZIA 5FYKL 4PJFB 2DQJL 2IEPA 2VLLB 1TTFA 5T33L 4YUEH 5GGUA 3C9NB 4I3SH 3QI9C 4PTTA 2X2YA 1P7HL 1W0WA 1NGYB 2FX7L 1X7QA 5E6YA 3G08B 2DN7A 2NZ9D 4RX4D 4XZUA 3JUYA 4WUKL 4MX7A 4K7PY 5HGGS 1F3JA 2AJVH 4HULB 3O0RH 4ODTL 3QEUB 1A47A 1WIOA 2EEDA 4HKXB 2W65B 3WXVH 5JZ7D 4R4FL 1UCBH 3DUUB 3GB7A 1D6VL 1A6ZA 2P5WA 5A2JH 1QFOA 1JBJA 1FORL 3RWHB 3WLWD 1JZ7A 3FN0L 3VXTA 3BGFB 3WIIH 1Q9KA 3M8OL 4BKLB 2A77H 1IGFH 4CMMA 2O26U 1OD9A 3BD4A 1JV5B 1A1NB 4L8SB 1RJZB 8CGTA 1F5WA 3F5WA 1Q0YH 4DUXA 5J11C 25C8L 3FOLB 4KTYA 2KKQA 3IDIA 1LHZA 4HS3B 3BRFA 3AREB 4QOKE 5EBMA 3VGEA 1DJSA 5I1AB 2HG5A 4WHTB 5DXWA 4EN3D 5HDBE 4GS7C 2QQKH 5HHNB 1OB1A 1MCKA 4WI6A 3BQUB 5GRUH 3TBVB 2VR5A 1I1AA 1MAML 5DJ6A 1NBVH 1TNMA 5D7IA 2GW5A 3GMNA 4AM0B 3O3DA 2NMSA 5ID0B 1QHOA 2R29H 4X6EB 4HWBH 4RGOH 3S35X 4XX1E 5CINL 4JQVA 2X40A 5TDNA 5GHWL 1NBZB 5CLWA 4QRPE 4YX2H 3FOMB 1HSBB 1QRND 3CFEA 3O3UN 2VUYA 4LCWA 1CG9B 3PWLB 3REWB 3HE7C 4PDCE 4IRZH 3ZYIA 1EXUA 3WN5C 1J1XH 4TSAH 5L88H 5F3BB 4LEXL 5ESQA 4UNVA 4DTGH 2XQYG 4XNZB 3DO7A 1FL6A 1MQKL 3ESUF 4LSTL 3RNKB 3IXTA 1OT2A 4KI1A 2A2QT 1BIIA 1YJDL 4N1HB 1QO3A 3U1SL 1UKTA 2V6HA 3WDHA 4UILL 3OKLA 4NDMA 3SE3C 2GITA 1CLOL 4AZ8A 4MMZC 5C0CD 5DRXA 2HFEB 4XB8A 4OZHA 5CP7B 1HZHL 4G8GE 2IGFH 1T4KB 2CXGA 2HLAB 1CICC 4HUVA 4B53A 1AHWB 1UJ3B 3BEWB 5D72H 3O6FD 3NPZB 3BUTA 3ZKXC 3QEHB 3CLEH 2WP3O 1B0GB 1W0WB 3EOBA 1JGDA 3V52L 2B1HH 2ZPKL 4PJDF 1UT9A 3EW3B 1CICD 3H9HA 5B3JE 4HX1B 2IC2A 2YA2A 1HHKA 2SEBB 1XH3B 4WV1A 4JPVL 3NFSH 3Q3GB 2Q87A 4EZMA 2XQBL 4QRSB 4L3EE 4RQQB 4S1SH 4UAOB 1W0YT 4Y19D 5GGSA 2QQQA 5E2TL 1C7TA 5EBLA 4G7VL 1FVEB 4LSUL 4AJ0A 2XZQL 4ORGB 3HG1D 1CE1H 3NAAL 2NY7H 1F8TL 1UM5L 1K6QL 3TT3L 5JHLL 4PRAA 2HT3D 2DLFL 4QXTA 2RCSL 1JL8A 4W70A 4Y5XB 2R0LH 4CADA 4ETQA 3DBXA 5ACZA 1N3NB 1R3JB 4ODVL 4Y5YC 1IGYB 4Z7QF 1G6RB 4ZUUA 2XXCB 2I24N 3QP3A 1TJIH 1UZ8A 4LASL 2C3HA 2BNQB 4YIQB 4OLWH 4YEFA 2NY5L 5C9JA 4BSVB 5DSCB 5AZEL 4IRJC 4S0TD 5AD0A 3QZWB 2DM3A 3ZDZE 5ALCL 1KV3A 1NFDF 2K7QA 5KW9H 5GGTL 2YRZA 1QFWI 3KYMA 1CR9L 4G9DA 3ZHLA 1FIGH 4OCWL 1B3JA 3BVNB 4I0PB 4Z76B 4P2QB 4IRJD 5GZOD 2C9AA 2ESVE 1IAOA 4XVTL 3QXTA 4XCYB 5BZWA 1I9RH 1SJVA 3MODH 2AJYL 1CFQA 3S88L 2VLKA 5JR1H 3V6OA 1L0QA 1XF2A 3LEYL 3FT3A 3CVHB 1BD2D 1VFBB 5KVEH 1EJ6A 5E94A 3W39A 4FZ8H 3GBNH 4WI5A 2XWTB 5CSGA 1NCBH 2FYYB 3Q6GL 4CAGA 5I74C 4ZUSA 3BIAX 2Y07H 5CSBA 2C7UB 2OK0H 3L9RB 2DIJA 5FXCH 5JIHA 1P5VA 2MCPL 3KPPB 5SWZB 2FIKB 3QQ4B 2R4SL 4PS4L 3T0EE 3K0WA 1O5DT 1X3DA 1X5YA 1X5XA 1HI6B 5JLZA 4YHYC 2AAVA 5EFIB 3L3IA 1H3XA 3BZFB 4WW2A 3PHQA 1G0XA 1G9NL 4IRSA 4QHKJ 3CXHJ 2DQHL 1P7KB 3ARUA 3S34L 3IDGB 3JTTA 3EJZD 3CFJA 1EUUA 1FAIL 1U2CA 4I77H 1UZ6E 5EB9A 5FDWA 3VH8B 4O2FB 3SDDB 4GLRI 1Q1JL 3BKCH 2ARJQ 2FNBA 5IFHL 4LP4A 5C09B 4X6DF 3KJ4B 5HYFA 1HSAA 2HKFL 1INQA 2FH8A 1MUJB 5C70A 1RURL 1MHEB 1N64L 3T0DA 3EYFA 5IF0B 4AYFA 1HXYA 1T03L 4PV9A 1N6VA 2DKMA 5L2JA 4XP4L 1CZ8H 4HQQL 4OGAD 1WT5A 1YUHA 3C8HA 3QISA 3TCLA 3TFKA 3GSXB 4OFKA 3KYNB 5F93C 4L4TD 1C5CL 2AXFB 4LSSH 3TZVB 5KANG 4L3ED 2VXUH 2NX5B 3INUL 4KI5F 3WNLA 3QDGE 1KTKE 3MRDA 4H88L 1RK0A 5D72L 3LKQB 4OGAC 1MQ8A 3WNPA 2JJUA 4R97B 1A9EA 2W65A 1RIVH 5E7FA 5FYJE 5GS0L 2HVKB 3IFPA 1VHPA 2OL3A 5BVPL 5IBUB 3MUZ1 4PB9H 2F74A 4P2OD 5A1AA 1UB5A 5MENA 4PJIA 1B4JH 1AD9B 3VMPA 1AXTH 3IS0X 4JRYA 1WZKA 2SEBA 4PJ5E 4GS7B 3P4LA 4L8CB 2CK2A 4IEFB 2GUOA 4QXGL 1KJ2B 4GQPH 3ZDYF 3VXPA 4FNLH 1EO7A 5E8NB 1GGIL 3V6FA 3D3VA 2VZUA 3WFBL 1C5CH 3W81A 2AJ3B 4Z7VA 1T1YA 2IQ9H 3KYKH 1UJ3A 4GMSH 3OXRA 3W0WE 3LN4A 1MF2L 4D9RE 2O5ZL 1HIMH 4ORZC 12E8H 5BS0D 1DCLA 1CK0H 2HT4C 1CWVA 3QUYD 1E27B 2D2OA 4GKZB 3V52H 4L3EA 3V6OC 1LWRA 1D9KD 5FHAL 3DVIA 4UDUB 1YECH 5CJ8A 2ZUTA 3G04A 2ADGA 4GUPB 5ESQB 3C09C 3GEWB 5HGDA 4HLZG 3V4PL 4HJGA 4D9QD 2CMRL 4XPBH 3TBTB 1F02I 3WIFB 1T1WA 2BNRB 4FQ1H 5IIEA 4QRUB 4UTBL 1JHKH 4WEUD 1MIEH 2A77L 4BFEA 1OAUL 2VL5A 2VAAB 4HWZB 5EZLB 5GGVL 3KPSD 1CFTB 1F00I 3T0AA 3PABB 1A3RL 5D1XD 1FJ1A 4XCEA 5F7WC 1XR9A 4WHDA 1FNAA 2C3VB 1VACB 4WHYH 3HMWH 1BFTA 1KTLA 4U1MB 3SCMB 1S7RA 4NM4L 1QKZL 4J3XA 2E27L 3IFOA 4JN1L 4KJWD 4WENB 5CILH 3HE6D 4XP5L 4AEFA 2R9HC 4JRXA 5D1XC 4F3FA 2P48B 1MAMH 1GJIA 1G7JB 4K55A 4LQFH 3C2AL 4HKZB 3K1DA 4JO3L 5KSAD 5F9OL 2NY5H 5EIVA 1DQTA 1UQSB 3BZDA 4P4KD 2IPTL 1ADQL 1RJZA 2IAMB 4JPWL 3WMSA 5BVJB 5MHSE 4YFLI 5F7FA 2E9BA 3GMMB 4HD9A 3U0WH 1D5XA 4N90E 4KK8D 5HHPA 3DLQR 4UT6L 4Z77B 5I1DB 1I85A 4P4KC 3T09A 4PBWD 4UIMB 5E8DH 3T8XB 3SN6N 1WFOA 3AM8C 3A67H 3HLAB 1XF3A 2NNAA 5KN5B 3LPGA 4UQ2A 5DF0A 3T0ED 2P5WE 1FCCA 5EUKB 4OB5H 4RMQA 3MYJB 1LGVA 4LPXA 5LGHH 5A43C 3H0TB 1XGTB 1JZ6A 4PB0H 4YHPA 2R2HB 4L9DA 3KPMB 3R0NA 2EYRB 4KZEL 2I5YH 3P9MA 1BD2A 3DVNB 4ACPA 3VFRB 2NY1C 1G7QA 2BVOA 3WFHA 1D5BA 3G5VB 1TFHA 1I8LA 3MR9A 1A8JH 3ARGD 2XTJB 1YNKH 5A2FA 1HDMA 3MRKA 4R26H 3ULUF 4I3SL 1QYGL 5D2NE 2IPUG 1NGXB 3EIFA 3PQYE 5D5MB 1HYSD 1IKFL 2R56L 3AAZA 1FFNA 4PJEA 1KBGL 1JYXA 5LCVL 5AG8A 5C71A 3GMOB 3A67L 4L8DA 3WXWL 5K9KA 1FVCB 1S7XB 1R6VA 3DXAB 2V9TA 2VZTA 4JVUA 2AEQH 3GMMA 3DROB 3BPLC 4YBHA 2EH7L 1H3PL 1I8KA 3AB0C 2VLRA 3S5LB 4M48H 3KPTA 1HOCA 1H3TA 5IW6A 5JW4R 1QRNA 2GAZA 2PYFB 4F2MA 4GAJL 4L4JA 4X5WB 1UVQB 1EH9A 5HI3C 1KCGC 4LLYA 1JFQH 4KUZL 3EDDA 3L3KA 4F3FB 1RD6A 3WFDH 4MD0B 5KSUB 4JFEA 4P2QD 3BT2L 2X09A 5JOPE 3KLHC 3ARDC 4UIMA 4JQXC 5I19H 5AYUH 4U1MA 3UTSD 2M2DA 1XIWC 5SX5H 3IB4A 5HPMB 1K8IB 1JPGB 3LKNB 2R0KH 1S9WA 1OGTB 1CLZL 1JGVH 3KXFA 5D70H 4NWTH 5BV7L 2D4DA 4WW2F 4DN3H 2ESVA 4S11A 4ZFFA 2CLVB 1XCTB 2ZUYA 3OZ9H 2A1WH 3RPIB 4P59L 3D85D 2R39A 5DMKB 4ZDHA 4EBQH 4LNRB 1U8NA 1C5BH 2A6JB 4ZNEA 5CEXA 2X4NA 3D18A 2JB6B 2AJYH 2G5RA 4L9LA 1KB5B 1VEOA 1YEFH 1JHTA 2X5PA 2J5LC 4YHOL 1VADB 3GSNH 3I2CL 2VSCA 1UM4L 3LKPA 4FG6C 4F7MB 3C5ZB 3SGKA 2FL5A 4ONGL 3ULVE 4M43L 3DVGB 4HWZA 3I02A 1FE8L 3SE9L 4F9LA 2IADA 2YSSB 2OYPA 3AMKA 3GSQA 1G84A 3D0LB 2R56H 5D7JA 1BBJB 3EOAB 4K8RL 1MRCL 1A1MA 5DQJA 1OCWL 2VDPL 4WWID 2VXSH 1XCQA 2XT1B 4UDUA 4XNUH 3TO4D 2UV3A 5FUZH 4XMPL 5GSRA 1IZKA 2F54E 1UM5H 4EVNB 4RWHA 3GJEA 4MDJA 1A3LH 2AV1A 4NO3A 4OUUB 4UV7L 2NLJB 4QGTA 1DBAL 4KI5C 1O0VA 3UPAA 2VDOH 4MCYA 4N9GA 1VKXB 4OCSL 1XR8A 3GK8L 3MGOA 4JFPB 5C0BE 4DK3A 2DJ4A 3BH9A 5DD6A 2W0PA 4ZO6A 2Q3AA 1Y6KR 1NDMB 4P57B 4PRDB 3UYRL 5CSZA 5D9SB 3L1OH 1LK2A 1EAJA 3VE0A 2R8SL 3OJ2C 3TC9A 4ZPTA 3QQ9D 2E7LE 2HT2D 3VWJC 4LSRL 4Z8FL 2EE3A 1T5WA 3QZWG 4YZFF 4OKDA 4NWUH 3ULVC 1EV2E 1L8JA 3GSXA 3PGFL 2OR9H 4U3HA 4U1HB 3I85A 1TJHH 3IRZA 1S7TB 3OKMB 4G43B 3ZT5A 1JZ5A 1WAAA 5LXGH 1NCWH 3S3JA 4JFED 4L29A 2QQLL 4ZO8A 3UTSB 2YZ8A 3GHBL 3ILPA 1ED3B 1IAIM 3KGRA 3RGVA 3L3OB 1XGYH 4FA8A 1T5XB 4ZFOL 1ZLUK 1INDH 3X13B 3KLSA 2YD5A 3RVUC 3LV3B 5JTWA 1YECL 2WW8A 3VFVB 3LKQA 5J6GA 2QTEA 4ZQKA 4MA8H 5I2IB 3CFJB 4ZXBB 3FJTA 3WS3A 2RBLA 5DVLA 2YC1B 1N2RB 4XVJL 1A14H 1JHKL 4KJPC 2X4TA 3RVUD 3UCRA 4FQ1L 5L6YH 3CUPA 4GRLB 3L3JB 5EUOB 4G6AC 2R69L 1IQWH 1KB5H 2BHZA 1JI1A 1GC1C 4PV8A 5CZVH 1NBYB 3PV7A 3QA3B 4H5SB 1QLFB 5EU3A 3LMJH 1KPRA 3QQ4A 2XRAH 3RJDA 3VRJA 4HXBL 1T1ZA 4AEEA 4B7IA 4JZNB 4HG4K 1AGCB 1GHFL 2VB5A 6FABH 1HIML 3IT8D 4GMTL 1PSKL 2C4FU 4JVWA 4YHKL 3BGAA 4DFHA 3TPUE 3QI9A 4M7KH 3JTCA 1IGIL 1VFBA 4WW2B 3N85H 1QUNA 4GFTB 3HAEB 1YNLH 5DLML 3HFML 5BXFB 3MA7A 1CFQB 1MRDH 1NCUA 1JJUA 5KS9E 3R06A 3RGVD 1WV7T 1TVBB 5CJBA 1I9JL 1QRNE 1T1ZB 2QADD 3BAEH 4O58H 3MGAA 4NQEB 3KPPA 5CBAA 3UX9B 4CVXB 4DEPB 4H5SA 3INUH 1FGNH 2ICWI 5F1NA 4WCYH 4YQXL 1JHLH 3ARDB 2F53D 4P9HH 1UENA 5ICXB 1OGAD 3SO3C 1LNUA 3O8XA 3CUPB 4LVNB 3MV9A 4QXUL 4JEGB 3M17B 3DECA 1G7MA 3WFDL 5JPMB 4MJ6A 5INDA 4HJJH 1YZZA 4ZD3H 1F4WH 4R0LB 5AWNL 1HKFA 2YD9A 5IM7A 1KFAL 3STBA 1UYWH 3R0MA 2Q7YA 4EI5B 2HWZL 1K2DA 1JGEB 1A9BA 3VFNB 3HUJE 5FOBA 1QA9B 3MLXH 3T2NL 4L29B 4PV8B 1JRHH 3V2AR 5DUBA 2VXVH 2G2RA 3DNKA 5BS0A 4Q9CA 5HHMD 3OKMA 4UT6H 4DZ8A 2X41A 3OR6B 1ULVA 4OFYD 2CGRL 3Q1SH 4TVPH 4PR5B 4R90H 3TO4A 2VE6A 4OLEA 4UB0L 4XVSL 4MNHA 1FNFA 3QCVL 5E8EB 3WS3B 4AIOA 2LFGA 2GJ6A 2XPGB 2EE2A 5LQBH 4QYOB 4HXBH 1KGCD 4CU7A 3BP6A 5C08B 1OW0C 4LHUD 1A7PL 5ISZB 1WIPA 3OKNB 5I1JL 1AC0A 1D9KB 5J12B 1Z9SA 5A3IC 3P11L 5ETUA 4QRRD 5GS1A 4XI5C 3T04D 2QBWA 1KXVC 4PJGF 1PW3A 5HJ3A 1LD9A 1IGML 2Z93A 5FM8A 1LNUB 3O8XB 5FA3B 2QHRH 1FN4B 1WFUA 4QRTA 5D5MF 4TVSa 3SDYH 1R5VB 2XZAH 4HH9A 2VXQL 1B2WH 1R5IB 3QXAB 4HDIB 4OAWB 1U41A 3QULA 2N7AA 4HFWB 1YDPB 5D8JL 5IMOA 1OTUC 1FL6B 4PP1C 4XVTH 1JNLH 3NTCL 2CRYA 1FSKC 1MCNA 3JWDH 5IOPB 3CZFB 5IEKA 2PCPA 5I1EH 1S5IH 2P43B 3GI8H 4H0HB 4V3DB 4OI7A 3SOBL 1NDMA 4EKXA 2G5BB 1RFDH 4DWHA 2XKUA 2BVPA 3MRHA 5DEFB 3X3FL 1MI5E 4BZ2L 2X1QA 4XRCA 4FQQA 1WZMA 5HDQL 2CO6B 5L6YL 5I6XC 4AM0A 3VWKD 4X4XA 1JHTB 4LQ1A 1A6AA 2BFVH 4Y4HB 1MH5A 4PRIE 3RWJB 5I9QC 4PJAA 3FQTB 4KKNA 2A6JA 1GGTA 4RBPK 1U8QB 2P5WD 5JIPA 3ULUD 3MV9D 1CR9H 4LDLB 4XC1L 3REWA 4OV5A 1N6UA 2NX5D 1DUZA 4GRLA 2ESVB 2ZNXA 2E3VA 1CDHA 4XMLH 3V0WL 5FO8A 5F88B 4P2QE 2FWOB 3MLYL 3GIZL 3MRCB 2V7NB 2WM0A 3QNZB 5EH1A 1Q1JH 3BKCL 5F97E 4L8BA 1JPGA 3WHE0 3F12A 2MKLC 5FUOH 1K5NB 4K7FA 5A40E 3GKWH 1JGUH 3VGAC 3QI9D 4ZPVB 4A6YH 1G1YA 4O5LL 3X13A 1KB5A 3SDXE 3QDGB 3BQUA 2FRGP 4XBEL 4LLYB 3L5XL 2HLFC 5EU5B 5EU4B 1T03H 2P4AB 2MTPA 1NUGA 3FZUC 5C0JB 3UBXG 1VFAA 4WWKC 5E0QA 3QUXC 3T0XA 4PRBB 4NKDA 4Z0BH 4LSVH 1I8KB 2CLVA 1YQVL 5FYJU 4JFQB 5DQ9B 3O6FA 1PFCA 5BV7B 1PKOA 5F7NC 1IGCH 4JQIH 4M6OL 5ITFA 5AWNH 4MA1C 1DFBL 1IILE 5HBBA 1RUMH 1WZLA 1MRCH 3WKMH 3MXWL 2ZCHH 4LFHD 2GTZB 4IS6B 3NMEA 2F5BL 4LNVA 2H32B 3S36L 1Z2KA 5KS9F 4UTAL 1C16B 4X5WA 5IWLC 1BEYL 1E28B 2ENYA 2D7QA 1D5MB 2JB5H 3FO9A 3MRFB 4QXWA 4UU9B 2V2WB 4JRWA 1U6AL 3O6KL 2XTLA 2VLRB 3BD5A 5HHOE 4LCCA 1UXSA 3LH2H 4EDXB 4OF7A 3FO9B 3MRFA 4PJEE 5BO1L 3O41A 3QXDB 5FGRA 4BFGA 5EOQH 5E2JA 1UGNA 5GSVB 1A0QH 5H35A 5KTEH 4NJAH 1NJ9B 1ROWA 2IBGA 2X4QA 4NKQB 5L2KA 2Y5TA 5F71A 4P0DA 3IVKB 3IDJA 1NAML 2MSPA 2YXFA 3CFKA 3NFPA 2NW3B 2I26N 1T21A 4KJWC 3EJYC 2R9HD 3MRLA 3O6FB 4N9OB 3SDYL 4ELMA 3TH2T 3KR3L 3P9MB 4RGNC 2P45B 3TA3B 1F4YL 3H42H 4M5YL 4X4YB 1YEJL 4M1DH 4HEPG 3EJYD 4LGPB 3K2UL 2OL3L 1KNOB 1QBLL 1QFUH 4HLJA 1FBIL 2FEDC 4XP1H 3L95B 3MREA 2DTSA 2NY0D 4LFHG 1YQ2A 1XF3B 1EVUA 4MA3B 3DGGA 1YPZF 4Z7OE 3GJFK 2BNQE 4OD2B 4K7FB 3ALPA 3V6OE 4U1JB 3PDGA 5B38A 2LAGB 2FEDD 1FNEA 3QAZB 5FKPA 1TQCB 1HH9A 5CCKH 4AENA 2WUCH 3IDJB 3WJJA 4QOKB 2E8ZA 3U30C 4OM1H 2LAAA 1A6TB 3EAKA 1HKLH 3CFDA 1AR2A 1FDLL 3BOVA 4LPYA 2NY6D 3L5WB 4U0RC 1XF5A 1BX2A 2OR7A 4XPHH 1XF4B 4Z7NE 1PJ9A 2ZUXA 1IQDA 1FO0L 3RWJA 4FFEX 5F7KC 4OV6F 1OPGL 5FF6A 2FECI 5EU7C 3ZL4H 3ARPA 5I18L 3GMPA 5MEND 4AK1A 1RJCA 2X7LA 4PJHB 3HRZA 1CGSL 1Z9OA 3PABA 3HI6H 4NN7C 2ZKHL 3CFKB 3NFPB 3EDJA 3G6JF 1AGFA 5D2LA 1GAFH 3SE9H 4KRNA 3UJIL 3OMZA 1HZHH 2QKIA 3VFMA 1ZHNB 3S35H 1J0KA 3HS0B 2JCCA 1OP5K 2CXKA 3R8QA 2FJFB 4WW1B 3O6FC 3HNVL 2L0DA 4RFNC 3MR9B 5EZJB 3IFNL 2VZ3A 4NKOB 4X9HA 3ROLB 4M8QB 3BX7C 3FQXA 5B39G 4A6YB 4G6FD 1F58H 3U9PH 3QDJE 2JKXA 4TUOB 1VFAB 4YWGL 4TSBH 5GJSL 4MNGE 4UIKL 3V0VA 3QUKA 4JKPH 4XC1H 4OLYH 4GRWE 3QPXL 5DWUL 1CDBA 3AB0B 5MI0B 1FIEA 5C08A 4EN3B 3VRIB 1PSKH 4ONOA 2WQ8A 3QG7H 5HHPB 3ULSB 3L7FA 3FFCA 3B2UD 1EEZA 1KPVB 2FWOA 2PR4H 3LKOB 4HCRL 4TNWF 5L7XH 4M93C 3U4EB 2CRMA 4K3JL 1JFQL 1U3YA 4NOBA 1J0IA 4BZ2H 3V6BR 4H25A 4DVBB 5BQ7A 4MA1B 3ALXA 4YHML 1M6OA 2I25N 3BGMA 1KLUA 2QQNH 1FG9C 3LQAH 3Q6FA 4JO2H 3RI5K 3VXMD 3N85L 3MLSL 4G80A 3WFBH 2VAJA 3VXMB 4U3XA 1G0YR 2WAHA 1LEIB 3HA0A 5EOTA 3SDDA 3OF6A 4J3VA 5FA4A 1ZA3A 1CF8H 2YXMA 1OCWH 4NT6A 2XTJE 3ZTNL 1FJ1B 4RBPH 2F53A 3FONA 4XCEB 5AZ2H 3WJLA 5EIIB 1KBGH 4XNZC 4PY8I 2VXQH 1HEZA 4NHCL 1G7MB 1SM3L 2FB4L 4JLRB 4LRNL 1KCRL 5L2JB 1C5BL 2I9LA 1MHHA 5JXEA 2EXWC 4C4KT 2GY5A 3WHXB 3FN0H 1MAJA 4QHUA 2F8VA 5CBAB 4I9WE 1YMME 3GSNL 2V2TA 4XCCL 1RZ8A 1JWUA 2E6JA 4WFEE 2H45A 4CVZB 4HC1A 3VD4A 1M71A 1DSFH 3MROA 4KMQA 4ODUA 4LSRH 3IU3A 3FFCD 2BCKA 4OKVB 1YEGH 4IJ3C 3C8KA 1EGJL 4R7DB 3LB6C 4NO5B 4NUJA 3CH1B 3EO1A 1I7ZB 5F21B 4XRCB 1G9EA 2JLLA 4PJFE 3RWCA 3HRPA 2VIRA 4Y4KD 2R1XA 4KQ4L 4PRHE 4HPOL 3ARVA 1CLYL 2YN5A 2HJLB 4RGNB 3VD7A 2NY4C 1MCWM 3K4AA 4XNUL 3D39A 5KSAB 1QEWA 2B4CL 4OF3A 4EUPH 4ISVB 2VE6B 5C0BB 3MBXL 4E5XA 3CU1A 4DKEH 3WNOA 1P9MC 4ZUSB 4XCCH 3WLBA 4N0CD 1IEAA 2EIZB 3ARTA 4PJHF 4V3EB 2DQDL 1RUKL 3LEXB 3E3QA 1A2YB 4K94H 3NCCB 5H37G 3U7WL 4LHUG 2XWTA 4W4OA 4MD5B 4Y2DA 4PJIB 5MENB 4MNQD 5LGJA 1S9YB 3MRRA 3WO4B 5HGBB 3RA7H 5ETUB 1YC7A 4G59A 4GRWF 5ACZB 1JNNL 3RHWK 4OQTH 1LO5A 1P84J 1YN7B 3H3PL 2AK4B 1BWWA 4POZD 3BP6B 4JM2D 2A9MH 3DX7B 3FTGB 4LVOB 4OGXH 4ODXA 4Q97A 2DQEL 2VQTA 1AO7A 3KPNA 2MPAL 4RRPG 3VXRA 4OZGA 3BWUC 5LGJB 1TJGL 3QJHA 3B9AA 3RWDA 4POZC 1D9KC 5J12C 1W72B 2DBLH 4MMXC 3C5ZD 3DWTA 5D70L 4G8FA 5BS0B 4G43A 5ECJE 5EU6B 3SGKC 5GJSH 1T7XA 4QRRB 4B5EA 1HXMA 1K8DB 3LQAC 3CCHA 3BYYA 4JREB 4MNGB 1AO7B 1NEZB 3EOBB 4YDLB 5ADPL 1QEWB 3BN9C 1YN6A 4TTDD 2WBJA 5IM7B 1LK2B 3VH8G 2O61A 2GY7B 5IFJA 3GJFB 5JOEA 3BI9X 1NUFA 1T4KA 1P7KA 3N9GL 1LP9B 4KRPD 3E6FA 1ACZA 3MNZA 1FVDA 3RUGB 2F9BT 4PJ5B 3U7AA 1JP5A 3UJIH 1OY3B 4XPFH 1F4XL 4DOHB 2I27N 4JDZB 1VESA 2W0FA 5E5MA 1B88A 5I1LB 5DD5L 2H3NA 5EN2B 3K74B 3D6GA 3E3QC 1TDQA 3IFLH 1FFOB 5GRJL 4E42A 5B8CA 4W81A 2WWMD 4U6HB 5HYJB 2EC9T 3I3EA 3L9RA 1P6AB 2C7UA 3KLDA 4KK6C 1DVFC 4U49A 5IKCA 4ELMF 3PHOA 4N8CH 3TFKD 3BFOA 4MDIB 1FNHA 1UEMA 5KVMC 5D1ZB 3NZ8A 5D1ZC 3VXRD 1HSBA 5ALCH 2HLAA 1T89C 2R1XB 1FC2D 2YUXA 4XGZB 4DN4L 1KCLA 4Z7WA 1X5HA 4K94L 4UTBH 1T22A 3U7WH 1KEGL 2X4TB 3NCYP 3U36B 4OLYL 43CAA 3UZEA 4IDJH 3L3DA 3FAXA 3FFCE 3KPQB 3SQOH 4OZIF 4R7DA 2XZZA 4EQ3A 5C07E 2YPLA 3U6RB 3TVMA 4Z95L 2P8PB 3I6GB 3EDFA 1XZ0B 5F1IB 4NBYB 5HHXL 4OSUH 4FQLL 3VRJB 4NZJA 4Y1AA 1MIMH 5ICZA 2Q6WA 3DYMA 3MLUL 1KJ2H 1OAXH 4LIQE 3HC3H 3AMLA 3MRGB 5MP6H 4K94C 1I3GH 1CZ8L 3A6CL 5I73B 2YD6A 4MHHI 5F7MC 1DLHA 1RQ5A 3VMNA 4W68A 3AXLA 4WI9A 4YHLH 2CO7B 2JJWA 3DBXB 3VXTB 4CADB 4ETQB 1HH6B 1MFAL 1FFPA 2EDKA 4JFFE 1QR4A 1IGTB 4YXKL 5DA4A 1LEIA 3QCTH 1W8NA 1C5DB 4P9ML 4X7TB 4U05A 4O51A 2DWDB 4LLQA 2G9HA 3QIUC 1U3ZA 2NW2B 4PJ8D 1MIEL 1V3MA 1P4BL 4ZOEA 2BOCA 3G6JB 3S34H 3C6SB 5JQ6H 2VNCA 2MMXA 3GI8L 1SVCP 1OGAA 4OIIL 5EBLB 2B5IB 4KJYB 4ODSH 3H7LA 4IM8A 4JY6B 4BFIB 1BJ1J 3QCVH 1B90A 1MY7A 2NXYB 2W9DH 4PJ8C 4UB0H 1AI1H 1QSFE 4LEOA 4I3RH 3QEQB 3VD3A 1YEJH 4M1DL 5GSRB 3GO1L 1QKZH 1NAMH 1RSFA 3W11D 5EZJA 2AJSL 1FZKB 4N0CA 2JK5A 4RIRB 3HCVB 2JB5L 5SV3A 1T6WA 1GGCH 3JWOL 4P5KB 4Y1AD 4ZOCA 3LQZB 1GZPA 3MCLL 4FFVD 3NIFF 1T0MA 3K2UH 1WC7A 2YD1A 5J1AB 3SCMD 5C2BL 4EUPA 2Z9TA 5FCUH 1CVRA 2ORBH 4Z78A 1SYVA 2GK0A 5T1LA 2A6DA 1FL5B 1MCPH 4G9FE 1T80A 3MO1A 1CCZA 2B1AL 3QQ3A 4YHPB 4R0LC 5I30H 2BNRD 1REIA 3RZCB 1MHCA 1P53A 1XF5B 1D7FA 1MFDL 1ZA6A 5DDHA 3D0LA 5MEQB 3SO3B 1TJIL 4D9RD 4GW1B 4NRYB 1JIBA 2AXJA 2DJSA 3C8DA 1B0WA 2OQJA 3RVWC 1D5XB 4Z0BL 1GGUA 5E70A 3DYPA 3WFCL 4OCWH 4XHQA 3BP4A 1N8ZA 3PQYA 5IB5A 4MQ7A 3TO4C 3TBVA 1IL1A 4JB9H 2AGJH 4U33A 2MKWA 3RVWD 5JHLH 2APWA 2VZOA 3GMQA 1EMTH 4ODTH 3MXWH 2CIKB 4EIGB 5KSVB 5FM5M 3QUML 4JRXB 1GAFL 4F7EB 1BOGB 3H3BC 3E8UL 4XAKD 3UJJH 1J12A 3KWWB 4NM8H 5GS1C 3TO2A 1H3UA 2P7TA 2DMKA 3U0WL 3WYRA 3CFCL 5A16B 3UTOA 1AJ7L 2Z8RA 2Y07L 3GKWL 1ZHBB 1TTUA 1FNEB 2X05A 4XPGL 1J8HB 4OFYA 5EZLA 3OB0H 3NIDE 4NRYA 1GZQB 1FIGL 1SYSA 3C5JB 3KPLB 4X5LA 2Y25A 1EFQA 4NKMB 2H2SD 4GKNA 3PL6D 4L5FL 3TBTA 1A21A 3FQNA 5TFSH 4MSWB 2KL6A 4JB9L 3B8SA 4B0MM 4CDGC 3R8BB 2NX5E 2P42B 5GS2D 4IHOB 5K9OA 1CD8A 1NC2A 3BW9A 4GKSA 2GAZB 1QRNB 4LK4A 3FRPA 4EN3C 1JCKA 4BH8B 2VLMD 1JUFA 1NAKH 5EULV 3TBWA 3PWJA 4R97C 1OSPL 1X7QB 5CP3H 3SDCC 5TQ0L 4GG6F 3G5XB 4WI7A 5I66B 4WFED 3B9DA 1I1YA 1CD1B 1T21B 3WUWB 2GTWB 3H9SE 1CXIA 1T0MB 2EDXA 1J8KA 1R0AL 1P7QA 4PGEA 2QADB 4MD4A 3E2HA 3MJ9L 4DN4H 2HRLA 3FO0L 2PTTB 3IAQA 4PJIF 4WFFD 1VFOA 4PD4K 4JCMA 3KPRE 3BGFC 3T08A 5ICYB 1YY8B 3W9DB 4OT1L 3KJ4C 5IBLD 1A6UH 1KIRB 3UPRA 1KJ2A 3G5XA 3DMMB 4ODHL 1T0NA 5LKNA 4X9BA 5KJRH 2Z35B 5EUOE 4P9HC 5EG6C 4X9FA 4LHUA 1ZGLA 2ITCB 1QSFD 4CKVX 4I18B 5IV2A 4DCQA 3FQNB 2Z91B 3GNML 3TT1H 1CFSB 4BSJA 1U93B 3W9EB 3QH3A 3MCLH 4RGOL 3Q0HA 2PF6A 3P4OB 4LCUB 3SCMA 5I1JH 1RK0B 5IHUL 2ARJB 3MRBA 1ADQA 2J8UB 4M9OA 2HJFA 1JFMA 1LDPH 2Y7QA 4UQ3B 4NNPH 4K3GA 4P5TA 4Q6YA 1F90L 4ZS6D 2BNRA 3LDBB 3NA4A 2OZ4H 3SDAD 5HYSB 4Y5VB 3SDAB 4Z5RB 1AQKL 3UYRH 3ULUH 2R69H 4GMSL 1Q0YL 3H3KA 4H1LH 2ZOKB 5JOPD 4MZ2A 3U1SH 3SBWA 3N0PB 4JFHD 1BWMA 3MBXH 4RAUB 2A73B 2R23A 2YEZB 2IAMC 2XN9A 4FQLH 32C2A 1MEXL 1NUDA 3VH8A 4BQ8A 2NY2D 3V4UH 5F7LB 2ATKA 3Q1SL 2CGRH 4TVPL 2G60L 3P73B 1UWGH 3QNZA 4QWWD 1A7RL 3GHEL 4K2UL 1UH2A 3EUUA 3PHQB 1ZEAL 2IAMD 2CQVA 1BM3H 1IAKB 2PW2A 3TJEL 3HMXH 1MI5D 5E2VH 5GHWH 3D69A 4M1CC 5SWSB 1VEPA 3SDCB 1IAKA 4JO1L 1I1FB 1PAMA 5IOPA 4PJXE 2FIKA 1T7ZA 2EC9U 3C2SA 3QFJE 2DIBA 1U58A 3QNYB 3NGBB 5FUZL 3D3VE 1XT5A 4G6KH 4AL8L 2VXUL 1WVZA 3FRUB 4R3SA 1S9XA 4JRYB 1HHIA 1RUQL 3QWOA 3V0WH 2W9EL 2OTUB 3D5OF 1WBZA 4GLRH 5E94B 3D87B 5JDJA 5HYJE 2E6PA 2CH8A 1DLFL 3SDAA 4JZJB 4WIQA 2Q8BL 4NQCA 4DAGH 3P2TA 2M26A 3P9LB 1RUPH 5BZWB 3OPZL 2AJSH 2DYPD 2AERT 4B41A 4M1GL 4ZS7H 3V95A 1NSNH 1CD9B 3OKEB 2FD6L 5IQ9B 3GSWB 3O9WA 3VXPB 3CCHB 1L0YA 1IAII 1ONQA 3EGSB 4WO4A 3OG6B 5TGBA 3ZZ1A 1QVOB 1FZOA 1BQSA 3GSRA 1SEBB 5E5UB 4PV9B 3E2HC 2DQUL 3CMGA 1Y6NR 1MRDL 3N9GH 1LD9B 1I1CA 4U1GB 4QKXB 5DD0L 2BRRH 4CU8A 1INQB 1N6QH 4PP2A 4JFDE 3IDMB 4LLUA 4JAMB 4AY0A 2GQHA 2BC4A 1GRWA 2Q86A 3EFFB 4O2FA 1ZTXH 4PRAB 2AK4A 4OBRA 5FDWB 2EH8H 1DR9A 4OGXL 3S9DB 5L0QB 1FORH 3HE7A 4N8VB 1FAKT 1H3WM 3ZSSA 5HGBA 1I7UB 4WEBL 4WU5B 5FUCC 1DDHB 1EX0A 1UXWA 2DL9A 4RQQA 4YHMH 1AGEA 1JTTA 5DUBB 2AK4E 1QSFA 4NKIH 1IKFH 3ZE0E 3X17A 4Z8FH 1MUJA 1NEUA 4FXLA 1U8MA 1U8KA 4PRHA 3NBNA 4E41B 1MOEA 5TDOA 4E0RB 5HVGB 4JM4L 4OFVA 4OI8A 5KS9A 2HJLA 4NC1E 3W82A 5J57B 4K8RH 2QEJA 4BH8A 1PVHA 1DQQA 3LN5A 3NACL 2HH0H 2QQLH 4LLDA 4OZFH 5IBTL 5K9JH 1EO8H 4NQSB 1TZGL 2AS5M 1EBPA 3RWCB 3MRIA 3MUGA 4IRSB 4L4VE 1XGYL 1FSKB 1L0XA 5DT1L 2BMKB 3HC3L 1SY6H 3RGHA 4ENEC 2HFGL 5CIPB 4NKMA 2MFNA 2NXYC 4KAQH 4PJ8B 2LABA 3IETA 4WWKD 4PRHB 4F7CA 5C92A 5C09D 1BIHA 2DB8A 4DKFH 5A16A 5EU3B 4YGAB 2H2PD 3P4NA 3ULVF 3Q48A 5C0CA 1V7ML 4JO2L 3MOBL 5J6HB 3SDXA 3ARWA 3I6LE 4JPWH 5FB8A 1CLYH 4Z7OF 4PJ9B 2AV7A 2A1WL 3OX8B 2H2PC 2VDLL 1MJUL 4NGHH 5JUEH 1G6RA 4ZUUB 4DGVH 2QSCH 5EOCH 5ID1B 2IANA 4TSCL 1JWSA 1N0LA 5I74B 1ZA3B 2ZUQC 4PJFF 4JZNA 5ADOL 1WBXA 1BHGA 3T4AB 4OIBA 4C59B 2WY3A 4G9DB 4Y7MA 3RU8H 1MI5A 1J18A 4AH2B 4M4PA 5D7LE 4PGDB 3LAFA 4XCFH 5GGVY 1WF5A 3ARGA 4LRIC 3NCBB 1R24A 3V7AG 5CGYD 1JPSL 5DK0A 1CIDA 5T1LD 4BSVA 2OL3H 4FNLL 2LU3A 4CMMB 4AEHH 4BKLA 3VXRB 4NZRH 2A9ML 1X5ZA 1MCQA 4BUHA 3D85A 1P4IH 4H1LB 4F8TA 2NXZC 1NMAH 2EEBA 1CLZH 4DAGL 1KPUA 3MLSH 3ZKNC 1TETH 5CAYB 1WFNA 2O5ZH 4HMCA 4P57A 1ETZB 4PJXB 4EUPB 2HMIC 1FNGB 2YPKB 3VWKB 1IC7H 5JXED 1G7PB 3K80A 4Y16A 1ETZA 2BSTA 1BECA 4ZTOL 2NLJA 1S7TA 1I75A 5D2NB 5C0AE 5D7KE 2L7UA 2IH1A 2J6EA 3IDYC 5GXBB 5IR1B 5F7UA 4S0UC 2VLKD 4M3KB 4LBEA 5DEGB 1ZT7B 4PJDE 4GW4B 3RWGB 2JCCB 3T2PA 1IE5A 1YEDA 1CG9A 3PWLA 5EBWA 3TV3H 4OB5L 2AK1L 3H7BB 2DWEB 4AQOA 4J6RL 3KPOA 2IQ9L 2Z31A 3ETBF 3IJYB 1R3KA 1A5FL 3PNWB 4M6ML 1MEXH 2PXYB 4FHBD 5HHVH 2X7LB 4CMHC 1WBXB 3O3DB 1IKNA 1V8HA 2W92A 4XMPH 4H26B 1IGTA 1O7VA 1WBYB 1P2CA 2B4CC 1NSNL 2RCSH 5E6ID 4PGBA 5EOCJ 1VA9A 2GEEA 1A6VH 2IPTH 1NGZB 3STLB 1WSST 2GIYA 1PLGH 3FOLA 5E6IC 3OBAA 4JO1H 4JJ5B 4Q9QH 1ZK9A 2VR4A 1BGXL 4FTVA 4KY1L 4ZFFB 2VO5A 3P4NB 2H41A 4BZ1L 2DQDH 1NBZA 4UT9H 1PKQA 3TN0C 1XMWA 5HDLA 2KDGA 1CBVL 1IC4L 4ZFGL 1CLCA 5DRZB 3MLPA 1FL3B 4NNXA 5J89A 4FABL 4B50A 1EA9C 2EDRA 5FKAB 3SKMA 1ACYL 2FJHA 3TN0D 3QDMB 2ZCKL 5T5NF 2I07A 1FZMB 4JY4B 3QUYA 1ERNA 5F3HA 5T1MB 4JN1H 1HN1A 1ZGLB 1O7SA 4PRPD 3TZVD 4YDVA 1KJ3L 4HIEB 1DL7H 1XCTA 2NY4B 5GS0C 2YKLL 3MOAL 2BFVL 2NTFB 4PYGA 1HNGA 1QLRB 2NY3C 1X5AA 4JM2B 1NGQL 5CEYB 5C3LD 3ARDD 3QHFH 1MCPL 5HPMA 2NY1D 4Q0XH 4W6WB 1KCUH 3IVKA 3NVQA 2D31A 2P5ED 5C86A 5JPNB 3EO9H 1QFUL 2R4RL 5BMFH 1NCAL 3QWQB 5J11B 3NGBC 4KWUA 4XMLL 1K9TA 2KH2B 3P4MA 5I75B 3MCG1 4NCC1 2J12B 4JRYD 2YRPA 2XKSA 4PRNA 4GT7A 4N5EC 1DVFA 2YA0A 4I8DA 3BH8B 4WY7H 1QZ1A 1QACA 4H8WH 5J9PA 1S7QB 1G9MH 1T89A 5B39A 4HIXL 2JTDA 4HS8H 1YY9D 3EYOB 1WCBB 2IH3A 3PWJB 3RVTD 3OAYK 1NL0H 4E0RA 1PY4A 3PGCA 3LH2L 1EEUA 5TDPB 4WNQB 3S36X 4WU7B 4X98B 5AZEH 1S7SB 4JHAL 1TQCC 2WIIA 2NTSP 4PY7B 2PO6A 1AGDA 1R0AH 3IYLW 4YPJA 3QIWA 2X1WL 3NIGF 5D5MA 4JDTL 4OFDA 1R3IL 2YA1A 4OLXL 2CLRB 5C0EB 3QCUH 5TGBB 5DRWB 5GZOC 5IB1B 4ZSOE 1D5BB 1ZHBA 3VXSA 3C87A 4PGZA 4YR6B 4MJ5B 4H88H 1RZJH 5FO9B 4XVSH 2AEPL 4Y2DD 1BD2B 3B2UC 2GSIA 2JIXB 3EFFA 3CFCH 3MLYH 3SJVE 2OX5A 1ZVSB 1G9NC 2N4IA 5EBGA 1U42A 1KT2A 1QFWM 4LAQL 1ES0A 2W0KA 5IMKA 2W0LA 5KBNC 4RMUA 4MXWH 3L5WA 2IWGA 5SX5K 1K4CB 1WK0A 3BWAB 4YK4C 2AJZB 1A2YA 1NCTA 1I85C 3IFOB 5TFSL 5JW4Q 1DUYA 4XBEH 5D93C 1QVOA 1J10A 4YJZL 3MRNA 1UYWL 4HW6A 3KNBA 4EXKA 1HQRB 3MCKB 4LLMA 5KVGL 4XNYL 5GRXG 5FO8B 2XWBA 4XNQB 2RJMA 1YNLL 2ICEA 3AGVA 3UROR 5ESVB 3PP4H 4M62H 3WUWG 1T6VN 2Z92A 1GH7A 1MLCB 2B0SH 4WI3A 3FN9A 4N0CC 4P46C 1QLEH 4K9EL 3C6LC 2NQCA 1FPTH 3EO0B 2PNDA 2J6EH 2NY5C 3FQTA 4PJAB 4LLDB 3TIDA 4JANB 4NO5A 1G7HB 1ZEAH 1X5FA 1RZFL 1Q72H 1Q94A 4FXGB 1I8MB 2XN9B 2X9YA 4LU5L 5IUSA 2VN7A 1T2QH 1BLNA 5TPWL 1G7HA 5L88L 5D1XA 1SYVB 5IHLB 1FLTX 3A6OA 3T4YA 1UWXK 3T0EA 2KZ1B 4CJ0A 1WWAX 3GGWB 3SGDI 3LQZA 3HE6A 3CDGB 4Y4KC 2R4SH 4XX1G 2X4RA 1CLOH 4UILH 2CDGA 4FQ2H 3AS1A 3QB7C 3T3PE 1N5YH 1TETL 2J8UA 2VZSA 4F7TB 3RTQA 2OP4L 3MUY1 1DANU 4QRRE 4U0RB 3P4OA 2APXA 32C2B 3ULVD 2LU7A 4HHAB 5BS0E 4F58H 4Y2OA 2EYSB 1EJOL 2V2WA 5FYJH 1KJVA 3VXMA 4JN2B 1K4CA 1KCSL 4G6JL 4TTDC 5J13B 1B9ZA 5IV2B 2YD3A 3MJ9H 3RDTC 1RUKH 3WO3B 3TVMD 4OCXH 1S7VB 1HWHB 4GQ9H 2XV6B 1KJVB 1EHAA 4P5TB 3EOYG 5I71C 4QHLA 3QUMB 2A6KA 5F1KC 3S88H 1QSEB 4AIXA 5KJRL 3MLRL 3RZCC 1YJDC 1TZHB 1RZJC 3TO4B 4H8WL 1CT8A 1SMAA 3GMLA 4LIQH 4ODSL 2A6KB 1KJMA 2CDEA 1CE1L 4YFLF 3QDME 3WFZA 1K85A 2WWMC 5GJTL 1A7QL 1CL7L 1AI1L 3X11B 2BERA 1DVFD 1OARH 4MXVF 2VRAA 3LCYA 4X7SH 3WXVL 2F5BH 3DYOA 4NC0B 4KK9C 2CK0L 3MRPA 2PKDA 3E6HB 4QNPF 4YDJA 3KJ6H 5MP6L 4WNQA 3DARA 1QP1A 3VW3H 4R3SB 5DFWH 1HHHB 3RNQB 5IEHA 3R1GH 1WLHA 1CXLA 4F9LC 1L7IL 3GKZA 2B1HL 4M8QA 7FABH 3V7AE 4PJBB 2E9WA 1KTRL 3F7PC 4KTDH 4PBXA 4Q9QL 2D7PA 3ZDXE 2FJFA 4D8PB 3ZLQC 5DUML 4LRNH 1T20A 1LMKA 2ZZUT 3ARDA 3O6ML 2CUHA 1T0PB 1LO4L 1HK6A 2OXGA 4XC3L 4Z7QE 4R9HA 5IFHH 5IJVA 4FQPA 3V4UL 4ZOBA 5DD3H 3HRZB 3VXOA 1SHMA 4U1LA 5EN2A 3QPQD 3QIUB 1AXSB 1K4DB 2XRAL 5TJWK 1R5WA 2C5DC 4KK6D 5CGTA 2P24B 1PGRB 5FF6B 4D9LH 5DK2B 2OR8A 3C6LA 5EO1B 2XY1A 4NRXB 1TVDA 5IQ7H 3BKJL 5DT1H 3JVGA 3E6FB 3L3IB 2YR3A 1GGCL 1MJJB 4JY5H 4GRWH 1S9KC 1KEGH 2P49B 2EZ0D 4C54A 2Y06H 5C0CE 1W72H 5GS2H 4XNQA 3FN3A 5FO7B 1J8HA 3PGDA 5KVDH 4Y1AE 5INCA 8FABB 2FO4A 1BVZA 1NDGA 4LPWA 3B5GA 3P40A 1JF6A 3DURA 1M7XA 3HZVB 4QF1A 3DGGB 5E99H 2XA3A 1CDCA 4ZOAA 1VENA 4A2MA 4NPYA 5DQDH 3QBTB 3QJHB 3RWDB 5C0AA 5KAQF 2X70B 5FYKU 2E7LA 4O4YH 1MFEH 3LVEA 3QIBC 3D2UB 3VI3F 3V5HA 4HFUL 5M7QA 3HPJA 4HLZH 2O5XH 3BPOC 5B39B 1MFBL 3MLVH 4RGMC 2MCPH 5ADOH 3IAGC 4NQDB 4GRWB 5ICYA 2BVYA 1C1EH 4ERSL 1RIUH 2XZAL 1KTDB 1ZMYA 5A3ID 1IEBA 5K33A 2YUVA 2DBLL 5TH2A 3VXSE 2FECL 3QDAA 1GZPB 2PTTA 5IMLA 2V2XB 1F42A 5DI8A 3LPWA 3QIWB 4WHYG 3H9ZA 3MV8E 3HCVA 1F3DJ 1OLZA 2C1OA 3E1F1 4LCYA 4JDVA 3WUZA 1G1CA 4RAVB 4D0CA 5JQHC 4P99A 3UTSE 3QQ3B 3MNVA 1KLGB 4DVRH 3HR6A 4C57C 5IHZA 3JVGC 4LCCB 3LS5H 3D39E 3D9AL 4MA8L 2GK0B 5T1LB 5FYKH 3L3HB 2OI9A 1RUPL 4N0YL 1YMMB 4Z9KB 5EU6D 4N5UA 1XGUA 3QUYB 4P3CL 1FNGA 4U6VL 3JSSA 2HFEA 1Y18A 3FFDA 1FVEA 3QHTC 3W0WD 1NAMB 2ZSVB 2ZKHH 2VOTA 2AJXH 4OF8A 5I6XB 5AAMA 2VKXA 1GC1H 3MJ7A 4F15C 5CJQL 2OJEA 3PDOB 1NCNA 3UTQB 3DUSA 3GBMH 4YXKH 1UJTA 1NQBA 3MJ9A 3PWPE 3VW3L 3WHXA 4O9HH 1U8PA 4PJ5D 2XZQH 5TE4H 3MBED 3EBAA 5ERWB 3QO0B 1NH6A 3K1KC 4JLRA 2CIKA 2WV3A 3GIVA 5MEPA 1T1XA 2DLGA 1E4WH 2FO1A 3OKKB 3FCTA 3ARSA 4V2BA 3VI3E 4KDVA 5EIIA 4MB3A 3MBEC 1JNJA 4X7TA 3S8WA 2JJVA 4NO0D 5FKAA 3SKMB 3OXSA 4ONGH 4H26A 4KMLB 1TZIA 4HWUA 3B3IA 1I1AB 4NZRL 4XVUD 2EE9A 4CN6A 2GKIA 3HC0A 3X3GH 4HSQA 5CD3B 3SDCD 2GYSA 2CDFB 5JW4N 1FV1B 3BGMB 4N0UA 1PD6A 1DLHB 1CBVH 2ZUQB 4ELME 2LU4A 4GW1A 2EECA 4XGZA 1FNSH 1G7IB 5C0AD 3I3DA 2YD7A 3VXUA 4DKDC 4C56D 4JG1L 2ADIB 2XOTA 3FZUD 4HCRH 4CGTA 3QUZA 1OARL 3VFGL 2R1YA 5D7IF 4NCDA 1WQVT 1B4RA 2VLJD 4BH7B 4WUUA 3H9YA 5IR1A 2OI9C 2NZ9C 2A74A 1J05B 2CUIA 5I2IA 1GCFA 3QDJB 5DJ6B 5CEZL 2VC2H 5IBLC 3T0WA 2OTPA 4GJTB 1HHJB 5IB4A 2V17H 3RGVB 1SJEB 4Y19E 4XXCA 4TSBL 2Z31B 4NFCA 3O3AB 1PG7L 2HG5B 5I1AA 4Z7WB 2JIXD 4CN4A 3T65B 2HT2C 2PYFA 4JKPL 3GUTA 4WEBH 4AIZA 4N1EA 3MGTB 3GSNB 1JN6B 5EBWB 5CHNA 5GGRB 4HZAA 3LRSA 4L8SA 4PTUA 1BFSA 5I1CL 3DGCR 4LVNC 5ALBL 4TOYL 1FRGH 3H3PH 4KPHL 1WWCA 4X8XA 3NFNA 4I2XB 3QEQA 1DQDL 4PB0L 1MY5A 5ENWA 2HFFA 4QY8B 1GIGH 3FL7A 1BVKB 2V2XA 2CKBA 3BH9B 1OGAB 1W72A 4PLOB 2Y6SC 4IOFD 4POYA 4H20H 2EDQA 1UACH 2YPKA 4ZS6C 3RDTB 1R3HA 1F3JB 2EDLA 3HMXL 2Y36L 1LP9A 3DXAE 3IKKA 1U8LA 5K9QI 2ICWA 1OWRM 3VFRA 4KV5E 2BSSA 2W91A 2FX9H 3BUYB 3VFWB 1YMHB 1OW0A 4LLWA 3OTTA 4LSSL 4X8JB 3O81A 2DYPB 3MNVB 4WW2C 1I8IA 2P1YA 4ZO9A 1T66C 4NQUA 3I84A 3MJ8B 4PP2B 1EHLH 2VLLA 3M07A 4S2SB 5D7KD 3BP5B 1HXMB 2X70A 3NAAH 2VKWA 4Y2DB 3F7VB 1T7WA 4PUBH 3ZE1E 3QFJA 4AT6A 3SDXB 4XC3H 4QCIB 3MFFB 3U2SA 1A6TA 3O9WD 4HPYH 2NY0C 4U2ZA 4ZUTB 1EERB 2BSED 4H0IA 4OM0H 3V6ZA 1I7RA 4G5ZL 3ARBA 1JGEA 1JF5A 2FSEB 1LK3H 1RMFH 5B4MD 4FQHA 3CK0H 2AJXL 3DV4A 5IVXB 4JR9L 4YAQA 3HHRB 3IKCA 5CIPA 4NC1C 5JXAH 1LO0H 5T3XL 4QGYA 1AKJD 4WI2A 3M1BA 1PZ5B 3O3EB 1F90H 4TQEL 2NY6C 1S5HB 4JY5L 2NY3D 4ZUWA 1ZVYA 2QLVB 4ZDHB 5DJXA 1EK3A 1Q9LB 2Y9RT 4RFNB 1SMOA 4YPGB 1KN2H 5HGAB 1Z0NA 2HH0L 3MNWA 3VGGA 5I30L 5IHBA 1U95A 5D8JH 4F57H 1FLRL 3QNYA 5DC9B 3TNMA 4X6FB 3ZT6A 5DD5H 5HPOA 2V2TB 1G9ML 1VPOL 3SKUD 3I6KA 1L9MA 1I1FA 4NN7B 1JPTL 4OLZL 3LEVL 3U4BH 3R06B 5IESL 5SWSA 1BQHA 5HHOB 5BZDB 1KENH 4O4YL 2I9LB 3TP4A 5BRZA 3WIFA 4JFEB 5JW3L 3WN5A 3HAEA 4UT7L 2BMKA 2PW2B 3QG6A 3MRIB 3MUGB 5JHDB 5EO1A 2ATPA 4MAYB 3MNZB 5D6DA 2BNQD 1FZJA 3GFUA 1AC6A 1Q9WB 3DSNA 3HB3C 1DQQB 3LN5B 3VG0L 2ATKB 3IJHA 2AKRA 1A3RH 1AXSA 4HAFA 1C1EL 5JORA 2XWJB 3ZE2F 1NEZG 2HKHL 2BP3A 4LLUB 1U8KB 1ZWIB 3HB3D 5DVNA 5DK3A 3B6SA 1CS6A 4L8DB 5D96B 5K9KB 3ARBC 3KJ6L 3B2VL 5FYLL 2DI9A 3HC4L 4XNXL 3QR2A 2GTZA 5DMIH 4TNVF 4M61A 3C60B 1AIFA 3LEYH 2V17L 4QRPD 2D7TH 1IM3A 1HHGA 5ITFB 5J7CC 4ZNEE 5MEOA 1TCRA 2V9RA 1U8IB 2JF1A 3M8OH 3U30B 3TA3C 1GVIA 3VFTB 3VJ6A 4XI5D 4KKAC 3GO1H 2OK0L 1N7MH 2R2HA 1LO5B 1NGPH 4TPRH 3S3PA 5J8OA 3QFJD 2ARWA 4YDJB 4QNPE 3P0GB 1CXKA 3VXUE 4F33A 1W0VA 3O45A 2X9XA 3HNTH 5GZND 4XWOC 1ONQB 3UPRB 5ANMA 4UNUA 4JRXE 2EDTA 3FB7B 2DI8A 4OQ1A 4NC2B 3MUJA 4P23D 4JRYE 5D6DC 5E7BA 3BDYL 4M93B 4WFGD 4C55A 2VR9A 1ZHNA 1E4WL 1G6RL 3U48A 3HAEG 1MLBB 1P7QB 5ELIA 1I3GL 2YPVH 4OLUL 4XP5H 3CH1A 3EO1B 2WBKA 3D9AH 1N64H 2D9CA 1A02N 2R0ZL 2H6PB 2AXGA 2V7HB 3NCJL 2DQFB 5I17B 3ZE2E 1ZS8A 4K7PL 4X99A 1U58B 4Z95H 3HR5A 4MZ3A 2YUZA 4JFDD 4YBLC 2RAMA 1X5LA 4CW1B 4WFGE 1HHGB 1T7VA 3TT1L 5CKAA 1SJXA 2V9QA 2EYTB 3QG6B 4IDJL 4MCZB 4Y5VA 3GSQB 3TPUB 4NJAL 6CGTA 4K9EH 3K8LA 1KCUL 3CMOH 1MNUH 3JWDL 4HXAH 4ZMAT 3UDWA 4UQ3A 1SYSB 2EYTA 4MCZA 4G9FB 3QEQD 3CZFA 2PYEA 2R29L 4WO4D 4PRHD 1H0DA 1KLFA 4WWKB 2EH8L 4JHBA 2XKNA 3I6LD 1UM6H 2W07A 3GMPB 4FQJL 4P2OC 1I9JH 3PWPD 4RAUA 1BOGA 5DJXB 3IGAB 3V79C 2ESVD 1BZ9B 3PG2A 3DJ9A 5CZXC 1MJ8H 5D7JD 2I9TB 1F4XH 5I1GL 1IGJA 2Q20A 1U8NB 4LNRA 4Z5RA 2CLZA 4WFFE 3RZCD 4JHAH 3QEQE 4HC1H 5L8KB 1QFWH 1Y0LB 5CS7A 4HWBL 5ESAA 5D7JC 3QCTL 4P9MH 2FJGB 4ZYKB 1HCVA 1JGLH 3MRLB 4NM8L 5TQ2H 1U8JB 5AUMA 1K8IA 2ARJA 3V6ZB 1U95B 4Y4HC 4KK9D 3PWNA 3Q5TA 4LOUC 4OD2A 4D3CH 4DZ8B 3U7YH 2CJUH 3S7GA 4D0DB 2YKLH 5F8QC 2Z91A 3SDDC 4LKCA 2R1WA 5LGKA 5DQDL 5C0ND 1A6VL 3TFKC 3BESR 4NNYA 3ZMRA 1B6UA 3V0VB 2VERN 1T2QL 3EYVA 5TF0A 4PJEF 3V8OA 2CMRH 3TYGH 1W8OA 4HV8A 3MLXL 3T2NH 1MJ8L 2ZUWA 4AL8H 3ERYA 2VDML 3TA3A 5E4EC 1TMCA 4I0CC 2R0ZH 4J1UB 1OAYL 1E6OL 1N59B 1T0NB 1PYWB 3DV4B 3DROA 2WINB 5F1OB 1KIRA 5FM4A 4XBPB 1P84K 4X6CB 4EJ1C 4ODHH 4GO6B 1I7RB 3UO1L 1AQDB 1FVCA 5J1AA 4WY7L 1IM3B 2GJ6E 3MV9B 4JFFA 4WCYL 4YQXH 3P4MB 2KBGA 2CLRA 4DUVA 1RURH 4OQTA 2HJKB 4AT6B 4UI2A 4UT7H 1IM9B 3WCYA 1A7RH 1OSZB 1KULA 3ARZA 1S7SA 5C07B 3WKML 3H9HB 3TBSA 3G5VA 1L7IH 3RWFA 1JYWA 4N0RA 1N0XL 3DX8B 3BE1H 3HE6C 4MJ2A 4XPAH 3EOTH 3AVEA 3EFDH 3L7EB 1WCBA 1CGYA 2IH3B 4HK0B 1OTTD 4PJ9D 2HRPH 3WE6B 3IJHB 1CFNB 4JO4H 5KSBE 4PJBF 4F7EA 4ZTPH 4OLVL 4Y16D 4ZSOA 3MRQB 1F8TH 3RVXD 3HFMH 5J13C 4MSWA 2MOVA 2XICA 3BDYH 1DZBA 5I73C 2GFBB 3N50A 4H8WC 1EHLL 4GKNB 1P9MA 5FV2A 5T3XE 4HMEA 1GZQA 4JZOA 3RJQB 1HH9B 3WL9B 4OZIB 4RISL 1RJYB 3TNMB 1ZT4B 4P3DB 4P23B 4GG6A 4YUEL 1EXUB 2IBZX 5GRJH 4RMTA 2IPKA 3UJTH 3QUZB 3GSNA 3MGTA 5E8OB 5J0BA 4NQVB 3L95A 3VD9A 4FQCL 3M1BB 3DRQB 3VGHA 1RAMA 1S9VA 2A9NL 5T3ZD 2J8UF 4PGBB 1CN4A 1T83C 4PS4H 4ESKA 1A6UL 4N5ED 3MO1B 4OF0A 1UCTA 5EU6E 4JFZL 2AJUH 2FHCA 3DI2B 1S9VB 2XG4A 5DJ0B 1NC4B 2GSGB 4GG8B 1YJDH 4BH7A 1CFTA 5LXGL 3HTLX 2BVUA 3MRHB 3HZMA 1FNSL 3QZWA 2C3GA 1DBKH 1IGIH 3NPSB 5D4QA 5DJZA 1T1WB 3MLUH 4P5KA 3TH4T 5IIEB 3BP7A 3FO2A 1P7QD 4GW4A 3ZHDA 3STLA 2J3SA 5JHDE 2PUQT 5EA0H 3WIHH 4GUPA 3JWOH 3MJ8A 1T5WB 3AS2A 2IH1B 3NCJH 2DM7A 1UXSB 3QULB 1DQJA 3PUCA 1TENA 1A6ZB 3AFLA 1U8OA 1E27A 4NN5B 4R2GC 5CD5D 4YC2C 2GFBA 5L9DH 1ZANL 2ED7A 1RHFA 2PXYA 3LKSB 4Y2DC 2Z93B 2VUOA 4NHUB 5C8JB 2ERJC 3C6SA 1XFPA 5E2UL 2XG5A 2G5BA 3K2MC 4S10A 3KG5A 1JTPA 1A3LL 1BREA 5GGSB 4K2UH 3MTRA 5F89A 1IC4H 4OZFG 3RWGA 1U91B 2EIBA 3IRPX 3S4SB 3L3GA 1MCWW 3B9KC 4JDVB 4C56E 4KROC 3VXQA 1IGFL 4MHHG 1QR1A 3S37X 1U91A 2V5YA 4ZO7A 5HVFB 4OCYH 5GGRA 4XTRC 4FFYL 4G8FB 1URLA 2IADB 4J3UA 4X6CF 5GGQL 5FA3A 4HWBA 3HZMB 2YS4A 1ZHLB 1I3RA 2Z8SA 5B22A 5L8LB 1ZANH 2JCCF 1V7MH 4I0PC 1CF8L 3C5ZA 5JOFA 1TJHL 4X6CA 3OKNA 1IT9H 2FX9L 5EORL 2P8PA 2W9LA 2UUDH 3I6GA 3SE8L 3QDJA 4QHMB 2Q1EA 3D0VB 4QYOA 2BXZA 3DO7B 1ZLUH 4JM4H 5DZNA 5AEAA 4X5XB 5CBEB 4PJ9A 3JV0A 1M4KA 4R8WH 1NMCC 4MXQA 1J1OH 5DI8B 3TIEA 4NQDE 3S96B 2AEWA 3DHMA 5KG9A 4FFYH 4P9HL 4QRQA 4LHJB 2HKHH 5C0BA 2Q6WB 2CDFA 4HKBA 3DI3B 3WD5H 1J0YA 3WL9A 3KLAA 2BNUA 1CGTA 3GMNB 4M8VA 1ZT1A 3OXSB 2BY2A 5T1DH 4IBLT 4AEHL 4GXUM 3U4AA 2O5XL 1ZTXL 3KDMB 3L3DB 3FCTB 2AQ1A 5HHNA 3M17A 3CGTA 2NY4D 1UVQA 3OX8A 2BVPB 5DEFA 2BRRL 3IDIB 4GBXA 3MJ6A 1AP2A 3C8KB 4G6KL 1DQML 2IMMA 1AKJB 3TVMC 5C1MB 4DW2H 5C0CB 2BVEA 4Z7WE 1OAZL 4CVZA 1ZE3C 4OZHE 1FLRH 5LG1A 3Q5OA 2R0WL 1L6ZA 4KHTL 1CFVL 3TN0B 1LP9E 3DXAA 3GSVB 2UYLB 4BSWB 2HTKC 3MJ7B 2DQIH 3MACL 4PLJD 5CP3A 5EU6A 3RA7L 5K59F 1J1XL 4TSAL 2DD8L 3VFPB 4G8EA 3U46A 3TWCH 4NRXA 3NACH 1BVLB 2CUMA 1WWBX 4NQSA 4FABH 4NSKA 5EC1A 3VG9B 4XZUB 3SGJC 5JMRA 1NCCH 3DX7A 3FTGA 5IFJB 3QSKB 1MJ7H 1WZ1L 1A1OA 3OJDB 1TMCB 2UVFA 2XPGA 4BM7A 2BNUB 1NEZA 1I4FB 4G6AD 5DC0A 2FDBP 4R4FH 2NY2C 4PJGA 1M7DB 4H25B 3BQUD 2J6EL 4J3TA 4J3SA 2NNAB 1EO5A 4X9IA 4JGMA 5KN5A 5MI0C 4O9HL 1SEBA 2G2RB 5KAQG 1H15A 3BN9D 1AE6H 2K3TA 4OZGB 5MENE 1K2DB 2H1PH 3B9KA 3HE7B 4N8VA 5HGHA 4EI5A 3KXFE 5F96L 4KKLC 3JV5A 4GKOA 3S37H 1S7WA 5KVFH 4J1UA 3O45B 3DXAD 5CSZB 4TULH 2EDHA 3MA9H 4UT9L 4NJ9L 5D6CA 2JJTA 1CL7H 4G7YH 3RGVC 1ZHLA 2HTLD 2XNAB 3OB0K 3JXAA 1QSEE 2EE6A 3SHSA 3HZKB 4N9GB 1WFTA 1VKXA 1S9XB 3VJ6B 4I4WB 2AV1B 4NO3B 5IROA 2J2ZA 1CT8B 1YEGL 3ZKQD 4HT1L 2VITA 3ET9F 4CJ1A 2P8MA 4WWKA 2HVJB 2FJGA 2QV2A 4ZNCD 5JIKA 2NY1B 3L3GB 5FYKD 1F4HA 4L8SC 2VLJB 5D9SA 5T33H 2D4FA 3P9LA 5HI4C 3HKFA 3SGJA 5CJQH 1QPXA 3GGWA 3BKYL 2YBRB 3EZ8A 3T0EB 1J1PL 5AZ2L 5GGRY 1ZWIA 5SWZE 5I1KL 3W0WB 2EH7H 3HI1B 5HI4D 3KPSE 3BEVA 4XHJC 2P24A 1NMAL 4GKZA 3ARBD 1VERA 1V05A 4NZDA 2DQFA 5I17A 3I50H 1DQJB 3E3QE 3C08L 1I1AD 5JA9A 3VXOB 1A7NH 3HI1A 1A4JA 4H0GA 4MAYA 4NO0B 1XGQB 4P4KB 5E1AB 3BT2H 1DBKL 5HYEA 4NHUE 3WJJC 1HQ4A 2CK0H 3OXRB 5FYLE 2FHBA 3MV7E 3LIZH 2IPUK 4HUKB 4NQCE 4XAWH 1DFBH 5CJOH 4X6DA 3ISWA 4NKIL 2P47B 5EUOA 1RZGB 2AEIT 1RY7B 3X3GL 3UC0L 5T5FL 1F4YH 2DQEH 3H42L 3ZE0F 1S9WB 1V5JA 3IDUA 3FB7A 4N8VG 1E4XI 1F6AA 1N2RA 4KU1A 1IRAY 4X0KB 3QIUD 2DJUA 4M03A 5KVDL 1F97A 5HGAA 3VFVA 4PJ7E 1W0VB 3OAZK 2VXTL 4YXLH 2VH5L 4LAJH 2JELL 3QAZC 5E9DB 3IXAA 4KFZC 2C3XA 4MVBD 1NCWL 2ZOKA 1S5HA 5E99L 3ELAT 3AU1B 2V5RA 5DWUH 1KNOA 3CSPA 1MLCA 4MJ4A 1X5GA 5EOQL 3BN3B 3HI5L 1U8HB 3QIBD 1YMMD 2PETA 5CCKL 4GAJH 4PJXF 2IPKB 3PDDA 2GJZA 3C60C 3U9UB 1KJMB 2CDEB 2RQ8A 4P5TC 3T3PF 4PLNC 2RFXA 4ENED 5F7EL 3CLEL 3RFZC 1RHHB 2I5YL 3KNBB 1LE5A 4U6TA 1EFXA 2MNUA 5IB1A 4XPAL 1YUHB 2ZCLH 1KF9B 5DHVH 2YD2A 2FD6H 3O8XD 5GGTH 5DR5H 2IANE 5IQ7L 3AAZB 4KJQD 4FQ2L 2VLKE 2AJZA 5H35B 4YO0A 1AGDB 2I60H 1MHEA 1DTUA 3MRKB 4GRMB 2GTWA 3B6SB 4LF3B 3BPNC 3GSUB 3WSQH 4MX7B 4MAYC 1HILB 1SBSH 5IMMB 1HOCB 2VDMH 4Q6IC 3DETC 4MCYB 1AR1D 3TBYA 5DJAB 3PV6A 7FABL 2IBZY 4MA7L 1HILA 2KUTA 1KFAH 5IMMA 1NC2B 3BW9B 4GKSB 3TT3H 4GBXD 1JYNA 3TBSB 2JJTC 2HFGH 1NKOA 1KN4H 4LP5A 3SOBH 4AMKH 5ITBL 1N0XH 2KPNA 1LEGA 1Z0MA 1ZKAA 4G42A 1FFNB 2FCBA 3E2HB 5BRZB 3V4PH 4G6ML 2DRUA 2YSSA 3QDGD 2F54A 2B39A 3O6MH 4UINH 4JDTH 1FDLH 4I2XA 3NFNB 3HUJA 5I1DA 1AQDA 1LQSR 3QHZL 3MLVL 5C6WH 5DJDB 2CRIA 4Y19A 1QFWL 3CVIH 2DBJA 5LBSH 3ZSTA 3MNWB 3QRFM 2XWJA 5JORB 3RUGF 3FT4A 4YE4L 4JFOA 5FCUL 1S7QA 1AKJA 3QRGH 3UYOD 1C08B 2NXZD 3J8F7 4YDVB 1MF2H 4L9LB 1FAIH 2ATPB 3E8UH 1MNUL 3KPRA 3ZKMD 4B7LA 3CX2A 2ZCHL 2X1PA 4JHWL 5HYSG 2HMID 1IL1B 2N56A 4PJDA 2PR4L 4XVJH 4KTEH 3ZKMC 4GMTH 1LEKB 1T04B 3BXNB 4X0KA 2HA1A 3ROOA 5DMYA 1L7TL 1OGTA 3MOAH 1BP3B 5C0IA 5C0NC 4U1JA 5B38B 4QTIH 4LSTH 4QRQB 4G8GA 1JNLL 2VAAA 3NTCH 4J7RA 4YFEA 1JRHL 3O3BA 5GIRA 3BDXA 4JHZA 3TIEB 5E56A 4Q6IA 3K8MA 2P5EA 2EC8A 1R3IH 2BNQA 4OLXH 4YIQA 1HINH 3AY4A 4HC1L 4OSUL 4KH2A 3MODL 3ILQC 4BZYA 1A0QL 1FYTE 5TQ0H 1V3JA 1A4JB 1PX3A 3GDBA 4L3EB 2FBOJ 5BRZE 3U0TB 4QHMA 3MV8A 1FG2B 4L4VD 4OM0L 3MLTA 1U8LB 1PKQE 4FTVE 3Q6GH 3LD8C 4WGWB 1C16A 3HUJB 3LN4B 1IGMH 4GRLD 2CKBB 4QT5B 4RRPA 4PJAF 3OHXB 5D1QA 5DEZA 3O6LH 4FS0A 3EDKA 2IJ0C 2VLJA 2HAZA 4G42B 1OWWA 4TN9A 4MB5A 1ZA6B 1F13A 3V6FB 4YDKH 1BQLH 4QTHB 3G6AB 1N5AA 1SEQL 3O9WC 4R4BB 1IBGL 3S37L 1YEKH 3RAJL 4DJMA 4ZXBC 2OJEB 4XPTH 4L8CA 1K3ZA 3UDWC 1KUMA 3KHOA 3EYOA 3RWEA 2J8HA 5B4MC 4NKDB 4QO1A 3HZKA 4ONFL 3NZHH 2DLFH 4HUVB 2ICWB 2W9DL 2FLRT 3H0TA 4D9QE 1A22B 3L5HA 1D5ZB 2YMXL 1NFKA 1NFDB 2W38A 5HJ3B 1F4WL 3VWKA 4JPIB 2Y6SD 2ITDA 4NQEE 3OR7A 1UWXH 3L3HA 4LASH 1LO3H 4MXWL 4XP9L 5GRZA 5FHBH 5ISZA 2QHLA 4M7KL 5JPNA 2ZOLB 2VDNH 2WBJD 3MV9E 4WFHD 3MXVL 2X6MA 4S1QH 3FQUB 2GUOB 3ARFA 3N1GC 5F8RC 4XH2B 4GAFB 2FBJL 5DJZB 4BZ1H 4ZAKA 3PP3H 4WUUD 3U82B 3NOIA 3FOMA 1J7VR 5TH2B 4FRWA 2VDKH 3P77B 4KGLA 5HHOD 3JV4B 2Y1VA 3IXAB 5KSBF 2DWDA 4HS8L 2J4WH 1XGRA 3BO8A 2KZWA 3IDNA 1VEMA 5ABDE 1D6EA 1OL0A 5I8CB 1VACA 4M6NH 3FHQA 3OV6A 4L8BB 2WIMA 3DRQA 2NY6B 4PRIB 1CD0A 2XA8L 4G6FB 4MNQA 4E9LA 4DKEL 2OR9L 3F5WB 3SJVA 1E6JL 3TZVC 4LPVA 2XZCH 4R2GD 4OZHF 5CD5C 3VXNB 4P3DA 1MI5B 3MQIA 2OXHA 2EDNA 3K4ZA 1YEHL 3DUSB 2FATH 4R96B 2OP4H 1TVBA 3BYTA 1EUTA 3MPCA 4PLKC 2DOCA 3V5KA 1EPFA 3ES6B 5TE6L 3W2DL 2F8OA 1NAMA 2DQGH 5IK3B 5K9JL 1FO0B 4PD4J 4Q7DA 4HPYL 5A2LH 1A4KA 4F8QA 3SKOA 3DMMD 2VL4A 1ZV5A 5FGCB 3GBNL 1A7PH 3WN5B 3LSOB 3B9KD 4K3EL 4O2CA 3RL2A 5J6HA 1CFNA 2RHEA 4HIHA 5C7XL 2B2XH 3P11H 4KKBD 1YN6B 1KLGA 1U8PB 2D7NA 5E4IA 3RRQA 1ZXQA 3DX9A 3OAUH 1AE6L 3DX8A 2VITB 1EAPB 3X14A 2FR4A 5LBSL 1YA5A 2UWEE 2H3NB 4P2RB 3D1MC 1R5IA 3QXAA 4HDIA 4X4ME 2LVCA 5EZIH 1MWAL 4HG4J 3SGEI 4WTZG 2BHUA 2ZSVA 1AD9A 5L2KE 2C3WA 4KVCH 3ULUE 3ARED 1I9EA 4X5XA 4E41E 4OFPA 4TUKL 35C8L 2VXTH 3IDYB 4YXLL 3EJJX 3G6DH 4FTVD 2OI9B 4KDWA 3GI9H 3ZKSD 3B4NA 4ZXBA 4RZCA 3RY6A 4RWYH 5E00A 4Z0XA 5IVXA 2D0FA 4H1LG 4RAVA 4D0CB 2F8XC 1BQLL 3R1GL 4OF6A 3D85B 1F11B 3G9VA 5JPMA 4IRZL 4UZGA 1JYVA 4NRZB 2C1OB 4LCYB 2A0LD 2F58L 1RK1A 3LQMA 3JTSA 1P1ZA 1SJHA 1YYLL 4MJIE 3AUVA 3DURB 4Z7UE 5IMLB 1NLDL 1XH3A 4X7EC 4TOYH 1I7UA 1OP3H 5AAWA 1TLKA 2WZPD 2B1AH 4EXPX 3NH7L 2YWYA