4HWZA

Structure of hla-a68 complexed with an hiv derived peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the differential classification of HLA-A*6802 and HLA-A*6801 into the A2 and A3 supertypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-68 alpha chain
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hwzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4hwzA01
2RBLA 1P84K 5I30L 4YDIH 3MV9E 1S7WB 2YPVH 1JGLL 2D4FA 3UC0H 5EA0H 5C70A 2R8SH 4R90L 5EOQH 1A3LH 3UTPD 1PYWA 5GS1C 4EUPB 3GI9H 1ZGLB 2OK0H 1SYVB 2FHBA 5IIEB 1QACA 5DXWA 4JO3H 3S88L 3NCJH 4JZJA 3IFOB 4OAWA 4U2YA 4I1NB 1AHWB 1UFUA 4JZNA 2E7CA 3TH4T 2I07B 1RJZA 3OX8B 3STLA 3AVEA 4HUMB 1FL5B 2YEZB 3RL1B 5B38G 4NHUB 4R96B 4XPTH 3V4VH 3STLB 2AJSL 25C8L 3DUSB 4S1QL 1I1AC 3LV3A 2X41A 4UZGA 4DGVL 4J8RA 3E3QE 4NO0B 5K9QG 3BVNA 4PJEF 4PGDA 4R4FH 3FRPA 1B0RB 1JHKL 4ZQKA 4R97C 3AFLA 5EWIH 2A9NH 5KSVB 5C08E 2XYCA 1WAAE 3LCYA 1U95A 4G8EA 4JFDD 4JCLA 3IU3B 4UUJB 3JUYA 4JR9H 2AP2A 2A6DB 5T3XL 1IQWH 2Y4SA 3QG7L 4JN2B 2JJVA 4OGXL 1QLFA 3C9NA 4IHOA 4JPIA 2GW5A 3C6LD 5GGQH 2P46B 3FO9B 1BX2A 4MA3B 4TNVF 5C0CD 1FN4B 4PJAB 2X9WA 4D9LH 1KENL 4TVSa 3TO4A 5BV7C 5F7FA 5F1IA 4RMTA 3UAJD 4L8DB 3E0GA 3CK0L 5GS2D 3HC4H 4XBPA 3UZVB 4G6ML 4WTZA 1R5VB 4XI5D 5DD0L 4F7EA 1FORH 1S7QB 3C2AL 4L1DA 5F7EH 1CXFA 3TPUA 4PJDB 4ZOEA 4NPYA 3FT3B 4RGNE 4CMHC 1LO4H 2I27N 4WFHD 4NQCB 3CVIH 4HUUB 4XVSL 4NPYB 5IKCB 4HQQH 4P2QE 1QSFB 3BFOA 1X5JA 4GKSB 2C4XA 4WJ5A 1AGCB 1DJSA 5IT2H 1CICC 5F3BA 1U0QA 2DYPA 1VSCA 2E6PA 2NR6C 3FONB 3TBSA 1KLGA 2HFGH 1ES0A 1EFQA 4UDUA 4D3CL 1LDSA 4X5WA 4FQ2L 1QRNB 5DRXA 1OW0C 5DTFB 5EU6E 3V0WL 3KJ4B 1I9IL 3V4PH 3LKPA 3Q3GA 4JFDB 4LP4A 1H3PH 5DHYB 3GHBH 1NCCL 4XP9L 3DX7B 4S1RL 3TV3H 1ZT4B 4YE4H 3S35L 1CFQB 4RWYH 3VFUA 1RV6X 4KMQA 5CHNA 1G7JA 2HLFC 3KPPA 4LVOC 4U6XB 4CRPA 4XP5H 2X4UA 5E94A 4MS8D 2ICES 1RZJL 5A2FA 5IEKB 3UYOD 2BVYA 5ADPL 3SGJC 3W2DL 1NFIB 3D3VE 5HDOA 1EERB 1J88A 4EKXA 1LP9F 3HRZA 3SO3B 4OD2B 1A9BB 1SBBA 2XNAA 1YA5A 3D18B 1NFIA 3CJJA 3MOBL 3X3FL 3BN9C 1GHFH 2IGFH 4HG4K 1BFVL 1T7YA 4Z0XB 1UT9A 2VDNL 4FZEH 3TP4A 3Q6FA 4JKLA 1K8IA 4ODSL 3SCMD 2IPTL 5EBMA 1Y6KR 4PJBE 3BP4A 3OPZH 4K3DL 5F6IC 5CD3A 4YHOH 1BQSA 3O9WC 1A1MB 2FH6A 3TBWA 3VWKA 4PJFE 4OLWH 5MEQA 1JFQH 2NXYD 2YD5A 3V0WH 2RIKA 3GB7A 1A1MA 1SJHB 3TBWB 2QQNH 2XXMB 5K9JL 5D93B 1KIRA 4DN3L 2QSTA 1MY7A 1RURH 4JFQA 1ZS8A 4X4ZA 1XZ0A 1YN7B 2VDKH 4NCC1 2EXWC 5DZOA 2MOVA 1T7WA 5ICYB 4EN3D 5IUSA 1V3LA 3U9PL 4RMRA 1XZ0B 4OCMC 3D85D 3T09A 5GRYA 5GGVY 2CJUL 3A6CH 3DTXA 3SE3C 3MLTA 2AK4B 1DVFD 5LGHL 1GH7A 5T1MA 5J1AB 5CJQH 1WBYA 3QHZH 4HCRL 5EO1A 2K3TA 1IGYA 1B88A 5JXED 3O6FA 3LD8B 5MHSE 4P2YA 3IFNH 5KVEH 4M9PA 1UVQA 2GCYB 4XHJC 4Z5RA 2R1WB 5SX4I 4H25A 4WNQB 4KROC 4QTHA 3SKJL 2O61A 5CKGA 2PO6C 1TMCA 4Y5XA 5IROC 3PWVB 1AFVH 1PEZA 4QF1B 2YD3A 5KVEL 5CP3H 5GGQL 5E00B 3FQTB 3IAQA 1D5BB 3X14A 4RNRB 2HT4C 3QG7H 1CF8H 1JZ3A 3K4ZA 1XEDA 2JJWA 1KCLA 3EOYG 2Q1EA 3C8DA 2VLRE 1RIVH 4I48A 3MRQA 3PDOB 1NCDH 4LDLB 1IQDB 3QSKB 4U0RC 2R29L 1BFSA 2HMIC 1BOGA 3DRTB 1OWWA 1QSVA 4K7FB 3F8UB 4HKZB 1BZ9A 5B3JF 3WHXA 1YY8B 4YDLB 4R4FL 1CXEA 1KFAL 3TGXA 3WIIH 2GUOA 3FO1B 4N0FA 1FZKA 1X5AA 2GJZA 4P5TD 2LTQB 5MI0B 2LVCA 3LKNB 1MFBH 4PRPD 4JFYB 2DLIA 2X4RB 1K8DB 3CPLA 3VGAB 2ADGB 1NCTA 2ZG1A 3ZDZF 3VWJC 3O3UN 1MELA 4U1LA 2W91A 3HC3H 5F9WB 3REVA 2DWEB 1TCMA 2GSGA 4ODXA 1MLBB 2V7HA 3KG5A 4NC0B 4Y5XC 5F6HI 4NRXB 5HHQA 4P59L 1DLFH 3MOBH 4NBXB 5GSRA 3SOBL 3RZCA 1D6EA 1JF6A 2W92A 2ZSVB 4XNMB 1ORSA 5LWYH 1IT9H 1EXUA 4YXKH 5C9KA 3DVFA 4X83A 1SEQL 2YPVL 5I0DA 1R3IL 1DN0B 4QXTA 1HINH 3VFRA 3FCTA 4BQ9A 1JRHH 4I77H 5K93A 4JM2B 3DXAB 1M7XA 1S7XB 3WFDL 3VG9C 2JCCB 1BP3B 4H26A 1HKFA 3ULVL 3THMH 2FRGP 3GHBL 4ZODA 3GMNB 1Q0YH 2G5RA 4DFIA 2QQLL 2O5XL 4PFEA 5DVOA 5H37H 4MA1B 3AAZB 2DM7A 1OTTD 1HHGB 1FPTH 1A9EB 4JFZL 2O5YL 5J9PB 2APFA 3ISWA 2OI9A 5KVDL 3QDMA 3UBXA 3BZ4A 1JGEB 1FVEB 2YPKA 2JK5B 1MCCA 5EG6C 2E5EA 2X4PA 4RGMB 2YK1H 2EIZA 4GAYB 1ZSDA 4XGZB 1TZHB 2XXCB 4HHAB 5E99H 2HN7A 4G9FA 3R8BB 1UYWH 3I75A 4QRPB 2H1PL 2VLJD 2XZCH 4MJ6B 1NGQH 4J3TA 3WDJA 3W9DB 1Q0XH 3SE4A 5C09B 3T77B 1XF4A 5F7EL 5IB5B 3RKDC 2BNRE 3G08B 1J0YA 4S1SH 3V2AR 4OLEA 1J86A 2GHWB 3BYTA 4Z7WF 4X4YB 3GI8H 3SJVD 4WWID 3B2VL 1U8LB 1NCAL 1B0WA 4XNYH 4IOIB 5I8OL 1QA9B 2D7PA 3DECA 1LHZA 1RZIB 3QDMD 7CGTA 2EKSB 3K3QA 4U7SA 4XRCA 4Z7NF 2VDRL 4R4ND 5ITFA 1U41A 1S9XB 4LVOB 4QWWD 3TIDB 4YHNB 3BKJH 4JJ5B 4JR9L 4NRYA 2A6JA 4YAQB 3IDMA 2OM5A 2CKBL 3C9NB 4IHOB 4JPIB 3T04D 5FYKU 3BSZH 3VJ6A 4V1DD 4ZFOA 4Y2DC 3Q5OA 3VI4F 3DV4A 3QZWG 2P5WE 4DGIL 4ZG1A 1KLUA 1R6VA 1JIBA 3LKPB 4G42B 1YECL 1MCWM 4L4VA 4O5LH 5JOPD 2GK0B 1H15A 4HJGB 3ZMRA 2PTTB 4XHJD 4NUGH 2DOCA 43CAB 1BQLH 4GKSA 3C09C 1H15B 1FYTD 1T4KB 3L5JA 4XP5L 1KTDA 5HYEA 4RAVB 1Z0MA 2IAMB 4Y16A 1N2RA 5DFWH 1UQSB 1YMHB 4UIKL 4OCWL 5I0ZA 3QAZB 2XV6B 1OAXH 4PP1C 1F02I 3KNBA 3QXWA 4HWZA 1H3VA 4ZS7H 3C60D 3U4BH 1BLNB 5FA3B 4QRSA 5IG7A 1HH9A 1KB5L 1LQSR 4A6YH 4ZD3H 4HWNA 1CFSA 3DV6A 5I9QC 4LVHB 3NZ8A 2BC4A 1IEAA 2P8PA 3WLWC 3VD9A 1FC1A 4JFPB 2BERA 2GEEA 1MJJB 3MYJB 4Y4KB 4BFGA 5C0DB 5B39A 4MNHA 4NKDA 1OAZL 1ZGLP 1B4JH 4GXUN 5JNYA 2ZUTA 3RUGE 4DCQB 3OKEB 4J3SA 4M7KH 4QY8B 5EBMB 1AQDB 3QI9D 1Z5LB 5J56B 3TA3A 4ODWB 1LO5A 3P2TA 5D2LB 4N9GB 5EUKB 3MFGB 1M7IB 2D0HA 4I0KA 1AKJA 4HIXH 3G5ZB 1NBQA 2D7NA 4KV5F 3LKSA 4HUWB 1H3XA 5C0ND 1JWSA 1XCTB 2AJ3A 4Z5RB 1DBKL 1MCIA 5ICYA 2QSVA 2ZUVA 1VKXA 5BZDA 2H3NA 1OAQL 3ZT5A 3NBNA 1NL0L 4F7CB 4NZUH 1C5BH 3VFPB 3TO4C 3LDBC 3VWKC 1W72B 5K9KA 5E2UH 4I13B 4L4TA 1QLEH 5T1MB 3VFPA 2GI7A 1OSPL 2QEJA 3QEQD 4ZAKB 4U6VL 5JOPE 4XAKE 2BNQE 4Z7NE 4LSQH 1QRNE 4DGYH 4WENB 4OCXL 4WWKD 2OMBA 5IVXE 4ELKA 2Z91B 5JIPA 4NBYB 3DGCR 4TTDC 4JFEA 2R1XA 25C8H 3D25B 4S1QH 2R39A 1RIUL 3MXWH 4PV9B 4XPTL 3V4VL 3DRTA 3MBEC 1W72H 3MRMA 3VMOA 1NLBL 5T1LD 3L3KA 4LQFL 3MROA 5SWSD 5HHOD 3TJEH 4BUHA 5SWSB 4M43H 5IW6A 4HS8H 1NAMH 4N0UB 1T7XA 1XF3B 4RNRA 4JO3L 3S37L 4PBXA 5K9OB 5DMIH 2WBJB 1IKFL 3GJFH 2WINB 4PJ7E 3VFSA 1AJ7H 2FIRT 4CW1A 4WHCA 1U8QA 1L8JA 5FO9B 5AUMA 1JGLH 1PZ5B 4GRMA 4RAUA 4YXHL 4QHUB 4WI3A 1A7OL 3KPSB 4LDOB 1NDMB 5GS0H 1I1YA 2Q8BL 3IAPA 3SDDC 5GSRB 1EHNA 3PIQB 4NC1C 4EZMA 3ILPB 2NY4B 1DEDA 1QD0A 4UTAH 2WZPD 4PLKD 1JZ4A 1KB9J 3LH2H 5I8EB 1KEMH 4EBQL 2VLME 1S7WA 2B2XL 3O2WL 3B8SA 4PY7B 4M5ZH 3SCMB 3WKMH 3K7UA 4HGMA 7FABH 2CLZB 32C2B 1C16B 4J23A 5FUCE 4U6YB 3LQAH 4KRNA 3VXSA 2DM4A 4OUUA 1FZJB 4Q0XH 3O45B 2W07A 5JXAL 4PIRF 4UU9B 2GFBA 1N26A 4ZS7L 5TDPB 1C5CL 1RVFL 3GGWA 1Q9WA 3KDMB 3N1FC 2MQCA 4Z8FL 4WY7H 5KTEL 2AQ2A 3M1BA 5J57B 3I9GL 5JOEA 4JO1H 1ZLSL 1V7MH 4DN4H 4XNMA 3O81A 3WFHA 3GRWH 2HFEA 3QPQC 3SDCA 2V5TA 1T5XA 3RL1A 5KVGH 5INCA 4O5LL 1CGVA 1IC1A 4LPTA 4LBEB 5DEGA 4PJXF 5E6YA 3G08A 4E0RB 3RJQB 2ESVE 2D7MA 4NO5A 2A77L 1NGYB 3EYVA 3MRKB 4BKLA 1U9KA 3MLUH 4OLXL 3OG4B 1OTTC 5DQJB 4PJGB 1HKLL 3GK8H 5KW9H 4DTGL 2VYRE 4TUJB 4DUXA 2XZAH 2X4PB 4LSRL 4GRLB 1RHFA 3WSQL 2OTUB 1BWWA 2DLTA 3EFDH 3D69A 2BJML 2VAJA 3IXTA 3AUVA 4RX4A 3MLPA 1ADQL 5T1KD 4FNLH 2CUMA 4PJGF 3C08L 3S98A 3LSOA 4OZ4B 3WLWD 1Z3GL 4MNGB 1INQA 2FWOB 5EO0B 5T3ZH 3BKCL 3HR6A 3ZE1F 4Z7VA 1F6AA 3O4LD 2X4QA 1U8OB 3K80A 1KCKA 1NCAH 5D4QA 1FYTB 1KPVB 4F7EB 1JUFB 4QRPE 2G9HB 4MNQB 4NDMB 3FQTA 1BJ1H 1D5BA 3ULVC 1K4CB 4YDLC 4MWFB 1ACYH 5HYJE 2QJDA 2YXMA 4M48H 4HUUA 3I3EA 4ZAKD 2A1WH 3V5HB 4XNXL 3WLBB 4L3ED 4YIQA 1CFVL 3T0ED 3UDWC 1INDH 1U2HA 4LQ1A 5DD3L 4DUVA 4RFNC 4POYA 3MPCA 4Y5YB 2EIEA 3TO2B 3S35X 4P5KA 3JWOL 3CH1A 4MQSB 5DWUH 5HDBF 1QR1B 2YUZA 1MIEL 5JO5B 4OLYH 4ZD3L 4C56A 4OZHB 1F6LL 2EEBA 4K23H 4ZFGH 4L3EA 4LLMB 2GAZA 4YNYA 4JM4L 4FXLA 4TPRH 4P5TA 2WBWB 2H2PD 5CWSA 3TA3C 1W0YT 1NQBA 3FFCE 5IHZA 4ETQA 1FH5L 2QQLH 1QRNA 5I2IB 1YNTA 3MCLL 5HXMA 3DO3A 5EFIA 1KJ2H 1SY6A 4PRHE 3C60A 2BNQD 4L8SC 1KLUB 4KMTL 1RJLA 4U05A 3REWA 1R3IH 1BQLL 1TZIA 4KTDL 2DBJA 5C08A 3QWOA 3IVKB 5IB3A 3REWB 1AI1H 1F90H 5GGUA 2GYSA 3G5YA 4HIHB 2NY1D 5ILTL 1MCWW 1HN1A 1OAYH 5BZWA 1HHJA 2ZWLT 2KUTA 4IOFC 1MFDL 1MHPL 3QFJE 4M93C 1TLKA 5F6HJ 3RWCB 3WIFB 1DUZA 4WI4A 1I9RH 1U3YA 3KYMB 1D9KB 2WQRA 2CR3A 4RIRA 2F53A 4ORZC 5JQ6H 1NGPH 1CZ8H 1HHGA 1A9EA 4UT6L 2BOBA 2UY6A 4PJFF 1TDQA 1U8IA 2QSCH 5EOTB 3E6HA 4YX2H 3A6BL 1J1PH 3SCMC 2HKHH 5DI8B 3Q48A 4NO2B 5J6HA 2BMKB 1HEZB 4IOSD 4NZTL 3PABB 3RVXD 4FOMA 2QHRL 2ZKHH 3C6LB 2C1PA 4LVEA 4JFPA 4HH9A 1DQQA 3TVMB 5CD5D 1XGUB 5FGBA 3CVHB 5JZ7C 3RX7A 1J1XH 3MRIB 3PP3K 1WFTA 3T0WA 1C12A 5TPWH 5KN5B 3VFNA 2VL5B 3MUJA 2GTZB 1BAFL 3U36B 3T0XA 4UV4H 1OSZB 4NZDA 2FECI 4QOKD 4YQXH 4NM8L 2ZOLA 4WDIB 1CVSC 1NGWB 3O6MH 4ERSH 4RBPK 1A4KB 2J6EL 2W9DL 5E8EA 4DKDC 1G0DA 3MRCB 3RQ3A 2ZUQB 5C0EA 3VRLE 1FE8L 3S37X 5IB2B 2XRAH 2VXTH 1R5IB 2BNUA 3U30C 3IKKA 3NFPB 3V6OA 2F8OA 1OD7A 2FLRT 4Z7OE 4W6YB 4HIJB 4JQXC 4QHNB 1XGRA 4JFFA 3KPLB 2Y1VA 4LLUA 5KG9A 2R1XB 1KCUH 1F00I 3DV4B 4PV8B 3ROOB 3WFDH 3DVGB 3QCVH 4BYHA 1F4HA 4I48B 3A6OA 3MACH 4ZO8A 4NKIH 1KACB 4LCWD 1B9ZA 2B5IB 4WU7B 2YD2A 2CIIB 1F3RB 3NN8A 5IVNA 3ILPA 1IT9L 1FAKT 2HJFB 1CXKA 4YUEH 2QQNL 3GJEA 3ARGA 4QRPD 1UM5L 1JN6B 1RJCA 3SOBH 2LV4A 1L0QA 5AAMA 1RUPH 4GQ9H 4LEOA 4YHOL 2X4RA 1SM3L 4OFYA 4P9HC 3IGAB 3O2VL 4Z95H 2YPLE 5HI5D 4GAJH 4ODSH 4WGWB 3CFDB 4L3CB 1FZJA 4K07A 4QHUA 4F9LC 2PCPB 4GXUM 4Q6YA 1BLNA 2YUVA 1GHFL 4XT1C 1QFOA 4GT7A 2V7HB 2P5EE 1MFBL 3BXNA 4MCYB 2DLFH 1TJGL 3MUGB 4OFYD 5DJYA 3RVVD 1KFAH 1RIHL 1HSBB 1RZJH 1YPZF 2WLZA 3FQNA 2QR0B 5TQ0H 4FQIH 3LQZA 4YHYC 3IDXH 1KJ2A 3OB8A 4U1GC 1A5FH 3LRHA 3OQ3B 4S1RH 2YMXL 3TV3L 3T0EC 1GZQA 3ULSA 3V4PL 1HHIA 3G5VB 3Q2CA 4FQ2H 4JN1H 2G2RB 1W0VB 4ODWA 4WEBL 3JWDH 1D5IL 2DTML 3SPVB 4I9WD 1X5LA 4G7VH 5IT2L 1MLCB 1RUAH 4YH6A 1H9VA 3RA7H 5HYSG 2GJ6A 2V5YA 3Q6GH 1NBZB 2EYTB 1I1CA 3O3AB 3VFTA 5CINH 5DQ9B 4JB9L 3MLZL 4N5EA 2DTSA 1N7ML 1UWEL 3ZTJH 1NC2A 3LS4H 1ZLVH 2X1OA 4F57L 5DFVD 4QRRA 2FCBA 3QHZL 4HCRH 1AXIB 4Y4FA 4BFEA 3DUUB 5A16B 1FAIL 4AIZB 4AQ1B 2BSRB 2FD6H 4NO0A 4XWOD 5IJVA 5C0NC 3JWNC 2DWDB 4N68A 5D7SL 1ZT1B 3BOVA 2WIIB 1ETZB 5TDNA 1C1EL 1CIUA 1FP5A 2PR4H 2DMBA 3GJFB 4FABL 1AGBB 4GXVH 5IBUB 2XFXB 3SDXF 3SGDH 2MHAB 5K9JH 5BXFA 5C6WH 3MNZB 3FTGA 3KPRA 4ZTOL 5GRJH 1KTKE 2VSDA 3W0WE 5EIQA 2G75B 1FYTA 4NOFA 1ROWA 5GJSL 3TIDA 3MNVB 3C60C 2CK0H 2DMKA 3HR5B 4K3DH 3AC0A 5MI0C 1N3NB 1ZWIB 4HXAH 1OF2A 3LDBB 4UIMA 1Z9OA 2BVOB 1BQHG 4NWTL 4PP1D 1MUJB 2FJFB 4OD3L 4OLZH 4P0DA 4XCYB 4LOUC 5E6ZA 3FT3A 2O5ZH 5GS2H 5IR1B 1VGKA 4N5EC 4DGVH 5T1DH 5IQ7H 3EOTH 3O6FD 5T1LB 1T03L 4L9LA 1WFUA 1VGKB 2X9YA 4Y4KC 4YHPA 3D0VA 4JLRA 1IARB 2CGRL 1C08B 4RISH 1DEEB 3NABL 3QJFB 4BM7A 4LHQB 2HH0L 3KPRD 2B4CC 1DQJB 2VISB 5CSZB 1T2QL 1KNOA 4JZOB 1KTDB 5D6CA 4Y2DD 1NCCH 3M17B 5DJ6A 2DQTH 1IZJA 2XKSA 4PLKC 3V8CA 4PJCA 4POUB 1XGYH 4S11A 5F3BB 2BNQB 1INEL 4HJ0C 5JO5A 3U0PA 1RUKL 5EOQL 2ZJSL 2A6KA 3CLFL 3BZEA 3R06A 1MI5A 1ZT4A 2P44B 3K8MA 2A83B 1WK0A 2D9CA 5MEOA 3NCYP 2X89A 3QIUC 3RY6A 1RJLB 5LCVL 2H6PA 2RCSH 3HI5L 5I1KL 2EICA 2ORBL 1MCBA 3CVIL 4QRTB 2QQKH 4R7NA 3SE8H 3SO5A 3OHXA 2NY7L 3P0VL 4J3VA 4NGHL 5F89B 3S34L 3L7FB 4N0CD 1IGML 1WBZB 4F9PA 5GGVL 4ELME 2VUOA 3AREB 5AZ2L 1DQDL 5TE7H 1G7HB 4MD4A 1LO0H 1FCGA 3EOBB 1Q9LA 4LSPL 2Y5TB 1J9CT 3BZFA 4LLWA 4MNQE 12E8H 4YBQD 1JWSB 4HBQA 3QXUA 1XCTA 2XQBH 3L5WB 2GTZA 4MXVF 2Y5TA 1LP9A 2F58H 2WAHA 1BBDL 1MNUH 1QRND 2OJEB 1JVKA 3F5WA 3B6SB 3G5ZA 3TN0B 5IMLB 1WZKA 2VE6B 4LCIL 4EDWH 5D5MF 1CG9A 4JVWA 2I5YH 2ICWJ 1D6VL 1MQ8A 1IE5A 4F7MA 3GIVB 4FTVA 3ALWA 1FFPB 4NP4L 3KPQB 4JHWL 5DVKA 2PXYB 4X6FA 4N8CH 1EEYB 4NQDA 4UOW1 1IC7L 1TVDA 4ZUVB 2IBBA 4QEGA 3ZE0E 1T0MA 4HW6A 5E7FA 4NBZB 5I1EH 4CVZB 1ZHBA 6CGTA 1J0IA 3SKOA 1SJVA 3OKKA 1T7VA 5EC2B 1NMCC 4FFZL 3EJZC 5JORA 4X7CC 1DUYB 4JGUA 5EORH 5J11C 2D7TH 4QHKJ 4OV5A 3OGOE 1HZHL 1YQVL 4HBCH 3O0RL 1FV1A 2QHLA 4BH7B 5FOBA 2OS7A 2VDPL 2ZUWA 5FYJH 1T0PB 2ERJC 1XGTB 4I18A 4DZ8B 1K5NB 1U8QB 5A43C 3H3BC 2FGWL 3LKQB 1MFCH 2P5EB 4IRSD 3MV8E 3G6JA 2VLJE 4POZD 1JPFA 2R8SL 3BIKA 5E9DA 1YEJH 1UWXH 4N8VA 1IZKA 3CC5B 3R8QA 3VXOB 4PYGA 4FQHB 1FJ1A 4L3CA 3HZMB 2JJSC 4MJ5A 4UOW0 5KSAC 5C0BA 1YNTB 1XR8B 1OGTA 5KAQG 4WO4D 3RUGA 3P0YL 4XWGL 1FZKB 5EOCL 1KLFA 3CPLB 4K71C 3FB5B 4TUOB 5DJ8A 3D0LB 4UT7H 3T4AB 3NN8B 5C07E 3VA2C 1T1XA 1BBDH 4GO6B 3CMOL 3OKMB 3SN6N 4E9LA 2XQBL 2P8MA 1ORQA 1ZLUK 1QSED 1NMAL 1UJ3A 4UAOC 3QFDB 5FDYA 5B39G 32C2A 1QPPA 1OLZA 1RHHB 1IAII 1HHIB 3MRPA 4LMQE 3C5SA 1NMAH 3FB7B 4U1LB 1UXSA 4GRWH 4NQSB 2Y25A 3WO4B 3OKOA 1HXMA 4KK5D 4HWEH 1JZ7A 5IMMB 1EO5A 1PZUB 3KHQA 3LKRA 5CD3B 3QIWD 1A7NL 4LPWA 5DK0B 3CX5K 3S34H 4W4NA 5D72L 4YHIA 2OR9L 1QSEA 5DZLA 4X5XA 4XBGA 4GS7B 1S7UA 4H0GA 4UNVA 3GM8A 3P0YH 2R2CA 1QNZH 4ORGA 2AEQH 2FECL 3AB0C 4EI5A 1U42A 4XHQA 2X4NB 3SE3A 3C5JB 5INCB 3V7AE 4QYOB 3PGDB 4PRPE 1AR1D 5KS9E 2PXYC 2DLGA 3LZFL 1BIIB 3QNYB 4LSTH 1WIUA 4PJXA 1TJHL 1HK6A 5FKPA 3VGEA 3GSNL 2J3SA 5EU3A 1XT5A 4TQEL 5F7HA 2NY5L 2JK5A 3IXAA 2VL5A 5DQJA 5C0FB 3K2UH 3BDXA 3BQUB 4L4TD 1M05A 5J9PA 1G9EA 1EAPB 1KCGC 3OAYK 3WMSA 2DBLL 1C8PA 3CFCL 4PJ9B 5CILL 1NC2D 1J11A 3QQ3B 4XC3H 3FTGB 4PJIF 4MJ4A 5HGAB 3L3IB 2FATH 4F8QA 5ICZA 5IQ7L 5FK9B 5IB2A 5T1DL 3S9DB 4MCZB 3ZKMD 1X4XA 4FXKB 4CU8A 4TUKL 1JPTL 2GKIA 3GM0A 1ZT1A 2YD9A 5EZLA 4BK5A 1YUHA 2NXYC 1I1AA 2UZXB 4HXAL 2BSRA 2F8VA 2E7BA 1EJOL 4LARL 5DO2C 4J2XA 5E8NB 5GJSH 5J3HC 4F37K 4GKZB 1U3ZA 3G6DH 1D6VH 4DW2L 2DQCH 4XC1H 1MQKL 3BUYA 3QRFM 5FB8B 4ODTL 1I7UA 1CVRA 4GRWE 1MNUL 2XY1A 4HIIB 3NMEA 1V3MA 5F7KC 5ISZE 3UTTB 1T22B 1VEMA 2BVOA 4DK6A 3NGBC 4LGRB 4M6MH 5EUOB 3DO7A 1OTUD 2IC2A 1I8KA 3LY6A 35C8L 1NEZG 4MS8C 5KSBA 1CICD 1ZVSA 4KRPD 2WWMC 3EO0B 4M6NH 3JSSA 1YDPA 3H7BB 4OGAC 4YC2C 4TSBH 4U3HA 1N8ZA 5BOPA 1FAIH 3SKMB 3KVQA 1I3GH 4XBPB 2YUXA 1ZT7B 3RDTA 1SY6H 2H45A 1N7MH 1UWEH 5JW3L 4GJTB 4KTEH 2FDBP 4OLVL 1A64A 4NKQB 2WUCL 1GZPB 1IBGH 1QEWA 5BRZE 4MHHI 1TQCC 4Q74A 5CIPA 2AK1H 5I1KH 5L8KB 1BZ7B 4M4PA 4O2CA 5CGYC 2Y07H 1T66D 3FQNB 4J4PC 4XVTL 4P57B 1OPGH 5KVFH 3DXAA 3QDHA 3MCG1 1GGBL 2FHFA 3BW9B 1IC5H 2ZJSH 4PD4J 4P4RB 4U1MA 1RUKH 2P24B 3ZE2F 5KAQF 3GMPB 3UEZA 2KKQA 1A7PL 1MCLA 4XMPH 5IEHB 5C0GA 4XPBH 3WIFA 1WFOA 3F6IA 4OGYH 5ESVB 4LIQE 1REIA 5H8DA 3HE6A 5EN2B 4BFBD 1QZ1A 4KV5E 1DDHA 4PGCB 1CLYL 5I76B 5IF0A 1GPOH 4PJFA 3P9LA 1LEIB 4MQXD 3D1MC 2H6PB 3QA3B 1J05A 4S10A 4PJFB 3UAJC 3FB8B 4OIIH 4NKOA 1J8HE 1TJGH 5CJOL 4LVNB 4L8SA 4PRNA 4WUUE 4HK0A 5IVXB 4R7NB 2Q8AL 3MZGB 4WW2B 1HHKA 5I1JH 3D39A 5B39B 5SWQB 4OLZL 5IESH 5IWLC 2PXYA 4X6FB 2HTLD 2YBRA 4HT1H 4PJGE 1LVEA 1C12B 3VXME 3BPNC 2ATKB 5IVXF 3G9VA 2WBJC 2VC2H 3MBED 2IALB 4I2XE 1E6JH 5FUOH 4HKBA 1CG9B 5HYIA 5I1LA 2YRZA 1QA9A 4UQ3A 2DLEA 5CGTA 2ZOKA 4Q6IC 4OGZA 1D7FA 2OL3A 4P2OB 3UTZA 2XQYG 5D1ZA 5ANME 1T21B 3NACH 1FO0A 1BGXL 2Y36L 2KBGA 2HJLB 4G9DA 4LLUB 3NH7H 3MSPA 5KG9B 4MDJA 1TJIH 9CGTA 4L29B 4OZFH 2PTUA 4D8PB 5GJTL 1D5XB 1TVHA 4Y16D 2VXSH 4I9WE 3LEVL 4JQIL 5GZOC 1IFHL 4M61B 1VGEH 1NPUA 1RQ5A 1QFWH 1A14L 5EULV 2BRRH 1AXTL 2JCCE 1GCFA 3BN9D 3DGGB 3ARQA 5DJAB 3OR7B 3WHXB 5GS0C 2OCFD 1GGCH 4PGBA 3VXRA 3U2SB 1OAUH 2VERN 3QCUL 3ARUA 3G6JE 3MV8A 5HPMB 2WBJA 1CE1H 2ADFL 2IAMA 4GLRI 4LIQH 2ITCA 1EEZA 4YQXL 3SQOL 4HFWB 5TGBB 4HT1L 3S96B 1A7QH 1G7MB 1FL3B 4PJDE 3M45A 4NQDD 1XIWA 2CUHA 4DQOH 5HHME 1DZBA 1MSPA 5L8LB 1JNLL 3MJ9H 4S0UC 2B4CH 4MJ5B 2ZSVA 3N85H 1ODAA 4FQXD 3AMLA 4GAGH 3VFUB 4R9HA 1P1ZB 4NZTH 2D9QB 4U6XA 1KUMA 3L3DA 5HVHC 4K9EC 3Q3GB 3P4OB 5ACZB 1Y6NR 4MMZC 1NAKL 2XZZA 2YN5A 3RVVC 1JYWA 3ARSA 5F6IB 1HDMB 5KBNC 3EJYD 1P7KA 1Q38A 2NZ9D 4C57C 4ENED 4ONGL 1I9RL 4F2MA 1EZVY 2HRPL 4MHHG 1BIIA 1MHHA 2EH7L 4IMLB 4ODBD 3QXAB 3O45A 1YMMB 1RUPL 4OZIF 3HB3C 5SX5H 4FQPA 4X4ME 2VABA 2NW3A 5BVJA 2IANE 4E5XB 3TBTB 4FRWA 3QIBA 2I07A 3WNMA 5F7NC 1PLGL 3HI1A 4PTTB 1AXTH 4NQXA 4TN9A 1JWMB 4LF3B 3WS6A 2HWZL 4PGDB 4QRPA 5EZOH 3L3IA 2N7BA 4XNUL 1HI6B 4X0KB 4IM8A 1NEZA 2OJZL 3HKFA 3V5KB 4J3UA 1IGCH 5GIRB 1DP0A 1NLDL 4MA7L 1YEEH 4FTVD 1BGXH 3GEWB 1QVOB 3C5ZA 1T04A 4P3WA 2FB4H 2XZQH 1MIEH 1UVQB 1XF5A 1L6ZA 1UKSA 1T04B 1I1AD 4Z9KB 2QV2A 2CKNA 4P2RD 1UCTA 3OKLB 3H8NA 4GSDL 4OM0L 2KDGA 3V0VA 5HY9B 4KDTC 4PJ9A 1HOCA 4UV4L 3MQIA 1WSST 1O7SA 3KJ4C 1RZKL 3HR5A 3EDDA 5E6IB 3B3IB 1UJTA 4LNVA 4CN1A 1JUFA 4PJHA 3ARGC 5IBLD 1S7SB 1OB1A 4V1DA 3S7GA 3U46B 2PYEA 4C58B 3U0TB 1WVZA 4Y19A 6FABH 5HD8D 2XA3A 3N1QC 3ZDZE 2OTWA 2V2WA 1HILB 1OT1A 1X5ZA 2PYFA 2VZOA 3F7RA 2V17H 1AXSA 1A6AB 4MXQC 4FNLL 3L3OB 2JB6B 3DMMA 5BQ7A 1T4KA 3G5XA 1UM6H 2AXFA 4APQA 1BPVA 4PJ9C 1KCVL 2NY5H 2MNUA 5DRZA 2UVFA 1CK0H 5IHZB 4ZFZB 1IAIL 4JJ5A 2W0KA 4XAWH 3KLDA 1RULH 4OUUB 1F5WA 2AERT 5DF0A 3KS0H 4ZFOL 4EI5D 5KVFL 4OV6F 5HTSA 1FVDA 4IRZL 2CLRB 5ILTH 2A73B 4RAHA 5I6XC 4JZJB 1YYMH 1NKRA 2NTFB 3N1PC 4CKVX 1J8HB 2VDMH 5H94B 3NCFB 4R2GD 5HGHA 2C4FU 4XP4H 1BZ7A 2NY2B 4O2CB 4KQ4H 4Z7UB 3I2CH 2OR9H 3T65B 5C08D 3CFJB 5DUBB 3CH8A 4PJ5B 3B9VA 1T6VN 4ESKA 4WY7L 1DVFA 4Z8FH 1BD2E 1NC4A 3OHXB 5FV2A 4HWEL 4Z7UF 3CSPA 3KYKH 3HUJB 1FH5H 1I9EA 4A2MA 2VZ3A 1HE7A 3SDYH 4BH8B 1NMCB 4X6EA 5DJ2B 4QYOA 1I3RA 2XWBB 5D7IF 4Q0XL 5HI3C 4JM4H 5F9WC 3AROA 3EOBA 5C0RL 2COQA 1M7IA 1FDLH 2CDEA 4NQEE 1WC7A 3MODL 4R97B 4PDCE 1A3RL 1GC1C 4M5ZL 4MXVE 1JMXA 1LEIA 2E3VA 1FZOA 4O4YH 4GRLC 1I1FB 3OXRA 3E2HB 4I2XA 1MQKH 1WT5A 2I9LA 3VXMB 1EEUA 2XT1B 3U82B 4Y4HD 3UTPE 4ZXBC 1QSFE 4DKFH 2VQ1A 4YGVA 4X8JB 1HQRA 4G9FB 2EYRB 3D39B 1X5XA 1CL7L 2P42B 1ACYL 2ZSWA 1U8OA 3ARBC 3EYFA 5ISZB 5F96H 1JPTH 4NKOB 4G9DB 3MRGB 1EHAA 1XR9A 5EC2A 2IFFL 2B5IC 2Z93B 4M6OL 5C0AD 2F74A 4D2NA 4FXKA 5ANMB 1AQDA 3ZYIA 5I1CL 3LAFA 3KYAA 4CVZA 3VFWB 2NX5E 4X8XA 3QZWB 3KPRE 1A02N 3GRWA 4DAGH 4KUZL 3FO2A 2FYYA 2EDJA 3QWRA 4G3YH 2IALA 5DDHB 5C0AA 2PTVA 5JXEC 1X5GA 3S97C 1IGFH 1EPFA 2YRPA 4H1LH 2NTSP 4KDTA 5MHSD 5DZNA 5LBSL 4FFZH 2C5DC 5HYSB 3RBGA 3A67H 4L3AA 4M7LT 1ED3A 4ZS6D 5DJ0A 1T1YB 3CC5A 1G7QA 4LSTL 1EEZB 1AC6A 4OLXH 4JEGB 4PJBA 4FQJH 4DGYL 4Y4HA 2BDNH 1SMOA 2VITA 3QH3A 3DMMC 3AMKA 5E9DB 2JELL 4JFDA 4NWUL 3KYNB 3V6FA 2C7UB 1AE6H 4B7IA 1FNSH 4Z6AT 1T5WB 1BIHA 2C3GA 3JTSB 4V3EB 1LE9B 5SWZE 1OAQH 1QHPA 4JO1L 3G04A 1ZLSH 3WXVL 5JTWA 2JJUA 1CQYA 1RAMA 2R0ZL 4QXGH 1OT2A 4M1DH 3RL2B 3EO9H 4ZTPH 2SEBB 3O41A 3C8KB 1JV5A 4XMLH 1EFXA 1JN6A 1UXSB 5DJXA 5EU7C 1BD2B 1LO0L 3H9YA 3ARZA 3BW9A 5AWNH 4MJIE 3BP4B 2D03H 5CUSL 2J1KA 3EGSA 4LU5H 4HWZB 4GKNB 1KEML 2ZCKL 2FIKB 2ORBH 3BGMB 2BC4B 4X4MA 1EXUB 1I8MB 3KYOB 1A6ZB 1JBJA 1F4XL 4HV8B 4CVXB 3H0TB 4E41E 2WV3A 2YD7A 5LCVH 2B39A 2J8UF 5BV7H 1FNEA 4Q9BA 4MVBC 2NY0C 5FYKE 4JCMA 3UYRH 5C0JA 4Y2DA 3KPTA 1S9WB 1F2XK 1L0YA 3QXDB 5I17B 3RVUD 3C5JA 3MRRA 1H3GA 3V8OA 1IKFH 2E8ZA 5E9DD 5D8JH 1WBYB 3U4BL 5IHLB 4LKXB 3TZVA 1ZMYA 1Z2KA 4LHUD 4M43L 1RI8A 2R56L 5DJCB 2R0WH 4PJ7A 3CLEL 4LFHG 2FX8H 3O0RH 5C0FA 1UEMA 2DL9A 4GRLA 1IGIL 2OTUA 2EDBA 4OIBA 4X7SH 5D7JC 3VFMB 1BEYH 5LGJB 4UQ2B 1Q1JL 2X09A 4ZYKB 2AK4E 5CZXD 1QSEE 3B9KD 4CNIB 3ULVE 4HEME 1EMTH 3BJ91 4PTTA 2EDRA 3E6FA 2DM3A 2X4QB 5DJZB 3MOAL 2VIRA 5AAWA 4YK4C 1R3HB 4NSKA 5JPMA 5MEPB 2HFTA 4XZUB 1QHOA 5JUEL 3U7AA 2JIXD 3ZDYE 4PJHB 4RSVA 1K6QH 4P5MB 5E2UL 3NZHL 1FL6B 3CU1A 1C5BL 3U48A 3V52L 4KJWD 4JE4B 2EE2A 1VA9A 5E9DE 3CFKA 3B9EA 2AXJA 2HTKD 4I5BA 5JW5A 3RAJL 3K4AA 3DX8B 2GSIA 4MQ7A 5E5MB 5EZIH 2EKSA 3CFKB 4Y7MA 2VDRH 1UACH 3UPRB 1JZ5A 4KQ3H 3LMJH 2NY2C 4KKLC 1I7ZA 3PXHA 3V6ZA 3W82A 5FFLA 2IJ0C 4DVBA 2IH1A 1ZVSB 1KB9K 4K3EH 1PFCA 4MJID 3UTTA 4KZDH 3L95B 5E8OA 4AENB 2VQTA 3BEVB 3JBG7 4PRID 1LK3L 5T33H 3DROB 3O2DA 3U0TA 5EUOF 3L95A 2H8PB 1I7TA 1P4IL 3MV7B 1XH3A 3DHMA 1OAZH 5L8JB 1N8ZB 3SE8L 4JB9H 1U8JA 3PWNB 3C6SA 1N2RB 2H1PH 3CIQA 2AJUL 1ORSB 4P4KA 4Y89A 3RRQA 1OGAD 3DURA 2FJHB 2GTWA 4OTXL 1H5BA 2YK1L 5EIIA 3RZCC 1A0QH 1X3DA 1HILA 3IVKA 5A40E 4HS6B 2X4OB 3HFMH 4P4RA 4U1MB 3B43A 4R2GB 3P4OA 4W4OA 1Y18A 4G8GD 4MJIA 3UTTD 3HPLB 3ULUL 1LEGA 4OFKA 2EDYA 2AABL 2PO6A 4Q9RL 2BRQA 2O5XH 4XVUD 1P4BH 2A0LC 3BPCA 5SX4H 4ZUSB 3AS0A 1DBMH 2NTFA 4EUPA 2ARJQ 1ZGLA 1U93A 1JNNH 2YMXH 4ETQB 2F53B 1MCRA 2HT3D 4IIQA 4ZOCA 3TJHA 1U91A 2CDGA 1JE6A 1GOHA 1W8OA 1MJJA 3MYJA 2O93L 1MCPH 2YD4A 2Z31B 4G6JL 2OI9B 5B8CB 1Q9WB 1VPOL 3BT2H 3KDMA 4Y0GA 2NY6C 3TT1L 5AYUH 4QTIH 1MJ7L 5IW3A 1SEQH 3LRSB 4HXBL 4DCQA 4MSWB 3PABA 5SWQA 3H42L 4JPWH 1WF5A 1EHLL 3RWHB 1UEYA 1M6OB 2NW2A 2RGSA 5IB3B 1JPSL 1CGSH 4ZUWA 4DGIH 3E1F1 4P59H 3FN9A 4HWBL 2R2HB 4L5FL 2JKXA 1ZE3C 4NJ9L 4P23B 4C4KO 4JFFE 4O02L 4H8WL 3VXTA 1XR9B 1ZTXH 2CDEB 5IVZB 3V5KA 1JHTA 4B41A 2IQAB 4LSVH 4U1JA 4NFBA 2R9HC 3BP6B 2Z92A 3PP3H 3BKJL 2MSPA 3ZTJG 3GZKA 2B1AL 3S5LB 4ZPVA 2VZTA 3JV6B 1OP3H 4HPYL 3KPSD 4KDWA 1T89A 4OJFL 3PQYB 4LHUA 1V3JA 2D4DA 1FNAA 2JB5H 3MO1B 1P7QA 2UV3A 4GKOA 1B2WL 1WZMA 2R29H 3Q5YA 5D1ZB 2Z35B 1P9MC 3CFEA 5D1ZD 4GG6B 2B0SL 5DHVB 4AT6A 2WWMD 3EDJA 3MJ9A 4XXDB 3TBYB 1E4JA 3VGDA 1CF8L 3TCLB 1MUJA 3IT8D 1KELH 1DUYA 3DETC 4OBRA 4ONOA 2O26U 3FN3A 3HG1B 1G9NL 4Q2ZB 2DQUL 4P46A 1F11B 3QIWB 3IRPX 3MMEB 1FE8H 5GS1A 3IDNB 3HG1A 1YJDC 3SKJH 5ELIA 1DQMH 5D70L 1T89C 4LLDB 5DMGD 3MLVH 3AREC 5HHPA 3IDGA 4X7TA 3CU7A 2ZCLL 2AJVH 3DMMB 5BQ7B 4AEIH 4PRBB 1WITA 1FLRH 1FPTL 3MV9D 1LDPL 2DI9A 1KELL 3KLAA 3RP1A 2XOTA 2GITB 3ETBF 4NQUA 5IB4B 3JVGA 3UJJL 5HBBA 5DTFA 3AB0B 2CJUH 2R2BB 1CD0A 1TIUA 2PCPA 1KJMB 4V2CB 1A5FL 2HP4A 5H35B 1L7TL 3FONA 3TBSB 4XCEB 3UTSB 3U9PH 4FQIL 4JY6B 4WFEE 4M7LH 2F53D 1G7JB 1AY1H 2CRZA 2C7UA 4HKZA 5A3IC 1KN4L 3CGTA 3L5IA 3O3EB 4HUVB 1YY8A 2JJSA 3FZUC 5I8EA 1EFXB 5D1XD 1MCJA 4G6AD 5JQ6L 4Q9QH 4OLWL 2FBJH 5F89A 1XCQA 4NIKB 3MXVL 3NCBB 5BO1L 4WHYG 3PGFL 5DK3A 4K94L 2I60H 3BH8A 3NCMA 4DKEH 3OKMA 2IPTH 4HMCA 5D7LB 4UV7H 3LN4A 4JFEE 2AJXL 4RMUA 4KAQL 4KROB 2P4AB 4RBPH 3VA6A 3LPWA 5KSUB 3VXQB 1T1WA 1DR9A 3QHTC 3F5WB 3GKZA 4M9OA 3WV0A 3LEXA 5EOTA 3FT4B 1I1FA 3OKDB 3QULB 2BMKA 5FECB 2YD6A 3LEXB 4NQXB 5IMOA 5GSVA 4GRLD 1YEKL 3F7VA 5ID0B 5DJZA 3H2WA 1UC6A 3RU8L 2LQRA 4MXQA 2HT2D 2R4RH 3CDCA 3ECBA 4Q9RH 4MA8H 5I19L 3ZYZA 4UINL 5HI3D 5KN5A 4K23L 2PW1A 4ZFGL 1PJ9A 1AFVL 3CUPB 5DRWA 1NMBL 4N0YL 3OMZA 5LQBH 3VFWA 4G8IB 5EO0A 5JORB 3LB6C 5ESAA 1HNFA 5HY9A 4ZAKC 4PLNC 4R4BB 5DD3H 4H5SB 3O6ML 4CNIA 1VFUA 3CFBB 5LGJA 3QR2A 5DHVH 2F54E 5CAYB 1R5WB 3U1SL 4L4VD 4MJ6A 2EE6A 2D3VA 3O4LA 5H2BA 1HNGA 2X4TB 5DQDL 1J8HD 1QQDA 5D1XC 3P30L 3VI4E 1J1XL 1H0DB 1MREH 3AXLB 3BN3B 3V5HA 4M8QA 5DD5H 5IOPB 4K3EL 2BSSB 3BESR 4I0PA 5EZLB 4I5BB 2CPCA 5JW5B 5FM4A 3PJSA 4QRQB 5DUPL 5DMKB 2ESVB 1OGTB 3TZVD 1AD0B 3D6GA 1FL6A 2E9JA 3PWJA 4PY8I 4K55A 4Z7WB 1B4RA 1F58H 4YFDB 3A6BH 2APTA 5TF1L 4AMKH 1RK0B 3ARDA 1MCSA 2XKUA 2ED8A 4TRPL 2IH1B 4TVPD 1MVFA 4ODUA 4RMWA 4PV8A 3ROOA 1A6VH 3DVGA 1QTYT 1ZHKB 2PETA 5CSZA 4A6YA 1MIML 3LHPL 1HKLH 1DLHB 3SKMA 4NJ9H 4PS4L 2A77H 1MFDH 5EFIB 1CFTB 2XWTB 4HWBH 1JHKH 4GAFB 1TTUA 5IBLC 1U8JB 1AGDB 2KZ1B 4ZUSA 1A1NB 1CFTA 1EHLH 5ESQA 1HXMB 3VXUD 1GGUA 4MNQD 3O4OB 1D5MB 1I7TB 3MV7A 4NNXB 4KTDH 3EUUA 3QDJD 4UNTA 4G9FD 4L8BB 4KMTH 5GGTA 1CL7I 3U4EB 3BT2L 1MRCH 2IBGA 1U8PA 1MCFA 2A2QT 3H7LA 1NAMB 1FGNL 4RWYL 4FG6C 3SDCB 4RAVA 3FT2B 3P40A 2W0LA 3SDAB 3NCJL 3IETB 1I9IH 2JCCA 3HLAA 5DC0A 4X99A 1U8HB 1XGQB 2HVKA 5DJ6B 3IU4H 4R90H 2IG2L 2ATPB 3VFRB 2EC9U 1YEFH 2AV7B 2FSEB 1U91B 2CDGB 3ZKXC 3MGOB 4CADB 1DBAH 4Z77B 1DE4A 4ODHL 4WO4A 3JWOH 5DWUL 2EDNA 5IG7B 1DBJL 3DETD 3L5WA 2IANB 4G5ZL 3K1KC 3DYOA 1AHWA 1OVZA 4FZ8H 2NY0D 5DYOA 1INDL 1QLFB 1R0AL 3O8XD 4WFFD 1LO4L 4OSUH 2DQJL 2ZPKH 1CDIA 5ICXA 3TPKA 4MNGA 3JWOC 3E2HC 3VWJA 1VEPA 2QKIA 3QUYA 3I6LD 3RHWF 3WJJC 4OZHE 4H1LB 3BDYH 1GSMA 2Q7YB 1DQQB 3TVMA 5HHVH 5T33L 5MERB 2GY5A 2CMRL 3PQYE 5FHBH 2D2OA 5CJ8A 1MJUL 1I7RB 4O51A 4D9RD 3BD5A 4N5ED 4LRIC 1IAMA 4JO2L 2VLJA 4O58H 3QHFH 3LV3B 3KLSA 1A3QA 2XN9D 1P7HL 1IGTA 3IFPB 1CLZH 4K8RH 4JRWA 4NCDA 3T2OA 1PAMA 4LQFH 5EZIL 4X6DF 1NC4D 2XTJB 5FHAH 4PG2C 4WWKA 1Z9MA 1R3KA 1LD9B 1MOEA 3S4SA 5T3XH 2H32B 5A2JH 2AJ3B 1I85A 2DWDA 1FSKC 4ZPVB 1N0XH 3I6KA 3NIDF 3IDGB 1CCZA 3VMNA 5JHDD 4YDJA 5EZJB 4WFFE 4L8DA 5EWIL 5TJWK 3AS3A 4FHBD 4LEXH 3BH9B 4MDJB 3QO1A 1BJMA 2CKBB 2DKUA 4WU7A 2RFXB 3BKMH 1UKTA 1T0MB 3PDOA 3MRQB 2R0LH 2AJYH 1F3JB 3VI3F 1V7ML 1NUFA 3SGJA 4PRIA 2K7PA 4NJAL 2XACC 3HZVB 2FEEI 2FJFA 1XIWD 1JTPA 3WFCH 5E2WH 4KK9D 4PJCF 2EEDA 3RX5A 1XF1A 4DAGL 3O3EA 2EDXA 1CXHA 3MUY1 1XFPA 3QNXB 4HUKB 4XCNB 5EIIB 3ORJA 5F7DB 4OB5L 2YHGA 4HIXL 5E1HB 4PG9B 2DRUA 5ACMA 5JXEA 5DJDB 4LK4A 3QDJA 4LPYA 4Z7QF 2CMRH 5FHBL 2M8XA 4QHMA 3UBXG 5LJYH 1LEGB 2EC9T 4DEPC 1JPFB 2I25N 1EK3A 1J0JA 3GBNL 5C0CB 3VD5A 4LCYB 1JNJA 2VLKD 4JG0L 1OCWH 3TN0D 4OSUL 5FM5O 4EN3A 1AO7E 4BSWA 2J6EA 1R24A 3SQBA 3B83A 1OCWL 1PQZA 1MFNA 4OLUH 4JY6A 1GZQB 2VJXA 1KT2A 4I3SL 1S7UB 1BFOB 3F12A 2JIXB 3WN5B 1P7KB 2AXGB 2J8UE 3FMGH 1CD8A 3DXAE 1YEFL 3ERYA 4PLJC 2H2SC 2J12B 1AJ7L 1K2DB 4K7PH 3ESVF 3MRRB 1FYHB 1YC8A 1NAML 5C9JB 1TVBA 3AU1A 5D5MA 3EO9L 4ZTPL 3GNML 3EZ8A 2HAZA 4OCWH 5FO8A 3WFCL 5C92A 1UM4H 4EEEA 1XAUA 2UYLA 3L6FA 5IQ9A 3FOLB 4KK5C 3M1BB 4O9HL 1NC2B 5ESAB 3OSKA 2DN7A 3LPGA 5IBTH 5C0BE 2DIJA 3RDTC 4M7ZB 4UQ2A 1Z0NA 3HZYB 5EB9A 1CXLA 3RVUC 3HCVA 3NFNB 3O2DH 4K9EL 1X5YA 1J0KA 4M7JH 3W9DA 4OCXH 4OQ1A 2MQ0A 3VRIB 3QIBC 1JWUB 2Z35A 4PS4H 2YRLA 1H5BC 4NSKB 5JPMB 4J6RL 2I9TB 1IAIH 3PGDA 3DX9B 1FO0H 4UI2A 1OGAB 4NZUL 4HX1B 3HE7C 1ZKAA 3NVQA 3NPZB 1FO0L 4X98A 3BMVA 1J0ZA 5FHAL 1DBKH 5D7JA 3JTTA 3WIHH 3CUPA 2V17L 1M71B 1KPRB 1PW3A 3BYYA 1UWXK 1X7QB 3QIUA 4YEEA 1XF2A 3MNZA 1J10A 3BPNB 3U83A 2FLBT 5KANI 3IF1A 5C1MB 1PY4A 4POZC 1UGNA 3UTOA 5DD5L 4P2QB 1SEBA 1SQ2N 3FN0H 4PJAF 4JY4B 3BP5A 3VJ6B 4ACPA 5C09E 4YZFE 5DR5L 4MDIA 5T1LA 1ITCA 3CVHL 2DMCA 1DANT 5IW6B 3B2UD 4KJYB 5FGBC 3RNKB 2YD1A 3VXOA 1Q0XL 4KUCF 5I1DA 4DKFL 3ZKXB 5DVNA 1IEBB 3KHOA 5C6TH 2BSSA 4I0PB 1KNOB 4JZOA 4YGAB 5D9SB 1NFDB 2NCMA 5CD5C 4M1CC 2XKNB 3FCTB 2BNRA 5CZVL 5DURD 4ZNEE 1H5BB 3RVXC 3KR3H 1SBSH 1CT8B 2FB4L 3FQXB 5C0RH 3LKOA 4Z0BL 5DS8B 2HKFL 2DYPB 3G5XB 4NFDA 2D0GA 2AXFB 4UINH 2V5RA 4PR5A 1OD9A 2MKLC 4LASL 4A2LA 3SDYL 1P2CB 1IGCL 3FO1A 3MRFB 3KYKL 2ADIB 3O3DA 1Q0YL 3L7EA 1W0VA 3ULVH 3P4MA 1OAXL 3MRFA 3G6AB 2ED9A 4X6BB 3AY4C 5L2KE 5F3HB 1UZ6F 1SYSA 3EFFB 1SYVA 1AD9A 3OJDB 3PL6D 2Z8SA 5LWYL 3UX9B 2A9ML 3DUHA 2Q6WA 3ROLB 1HXYB 4JDTH 3CMGA 5HGDA 1EIBA 2CSPA 3VFTB 4EUPG 1FHGA 1YEIH 4PJ5A 3ZL4L 4ZOBA 4ZSOE 2VMFA 4FXGB 2CIKA 1L0XA 4YHZH 4UV7L 3CZFB 2NY4C 4KK8C 5EO9B 1CDCA 4XAWL 1BJ8A 3HC3L 1LP9B 2QADD 4Y1AA 2XWJB 2VRAA 4NJAH 3WS3A 3ZE1E 1DL7L 5T1KB 4P23C 1KCVH 1HYSD 1UM6L 4EI5B 2PXYD 1EA9C 4H26B 3DVIA 4H88L 5DT1L 4E0RA 4GMSH 1PSKH 3DNKA 4Q58C 3ALPA 4MLIA 1S9XA 5FEBA 5TDOB 1BF8A 2EYRA 3SE9H 4HC1L 1UWGH 5I8OH 4FQLH 3RTQB 1FN4A 3TJHC 4WGVB 1N4XL 4QNPF 2IPUK 2LVEA 2JJTA 4AL8H 1QLRA 4TVPE 4JN2A 5HYJD 5ANMA 2CRYA 5CGMA 4L8SB 3IDIB 1Q72L 1A7RH 1ONQA 1QO3B 4B0MM 4HLJA 2FWOA 1ZEAL 1LDPH 1IGTB 3IFPA 5EO1B 4UNUA 1NGQL 2ICEB 1UB5B 1S7SA 1URLA 4BA8A 4U1KA 3QUKB 4LFHD 2IFGA 4LCWA 5FYLL 5DLMH 5F70A 2VXQH 4NM4L 1NUGA 3RWDB 5GRUL 1QUNA 2GJ6D 3WL9A 1N64H 1ED3B 3VW3L 1EAJA 3NIFE 1IM9B 4EI5C 2VISA 1U6AL 2O5YH 5C0EB 1A14H 1NBVH 4LDEB 1BQUA 3QH3B 2BVQA 5GQBA 4A6YB 4DZ8A 1VFBA 1T21A 3X14B 2A6KB 3Q1SH 3BIKB 2N4IA 4HGKC 3KXFA 4ZO6A 1MI5E 3QUXB 2A6JB 4XPHL 2HWZH 3HMXL 3NACL 2ADJB 1IAOB 4ODHH 4HF5H 2BVUA 3E3QC 4L4VB 4KZEH 4YXKL 3IB4A 3WNOA 2ADJA 3O41B 2R1YB 3IU4L 1S9YA 5FYKD 1U3JA 4QT5B 5KJRL 2CIIA 1PQZB 1TITA 4NN7B 4OZGA 4RZCB 4PJ9D 4XWOC 4UB0H 4FA8A 3G5YB 3V4UH 3DJ9A 3IJSA 3OPZL 4M7ZC 1C16A 1OQOA 4WHYH 3KNBB 2I60L 4DKEL 2EO9A 2F19L 4X9BA 3IJSB 4ZSOB 4NT6B 1CGSL 1YMMD 1I8LA 5EBLA 1NAKH 3QDJB 1E6OL 4RGOH 2Y7QB 4P2RB 1FBIL 1U8KA 1YEDB 3WCYA 4TVPH 3ZO0A 3HE6B 4WHTB 5EN2A 5GRWA 3FL7A 1MHCA 5E8DL 3D85B 1MRDL 4QTIL 4KU1A 5D2NA 2DQHH 4YXLH 3SKNA 5BRZD 5K9QI 3MRHB 4JREC 4WFED 1L7TH 4P2CG 3KGRA 4LSDA 5MEQB 5ID0A 1DQLL 2YN3A 1LE5B 2VH5H 1CR9L 1LK2B 3W5MA 4QKXB 3OGCB 4KJWC 3L5HA 1HHHA 4AMKL 3INUH 4JDZA 3GMNA 3SDCC 3QRGH 5C0JB 1N5AB 4RA3A 5D1ZC 5GRXG 4PJ5D 4U4BA 1E28A 3T0EA 5C0DA 1JMZA 2EC8A 2Z0BA 3UO1H 1Q9KB 3N1MC 2ADFH 4LIQL 2NY3D 1XGUA 4KVNL 4N90D 4NQEA 4QCIA 1CDYA 4G7YL 3IXAB 2ICWA 3HB3D 5F1NB 4HQQL 1NGXB 1MREL 3EIFA 2P7TB 4H25B 4PY8J 2ICCA 2GJ6B 3MLWL 2OL3B 5JW3H 1F6AB 5MENB 4NQED 5SWSE 5CJQL 5I66A 5E00A 5K9KB 1FG2A 4R3SA 2WMPA 3RUGF 1KIQB 3A6CL 3QIUD 1A8JH 4WV1A 2OLDA 3BMWA 3KPLA 4X0KA 2RAMA 1H0DA 5IJVB 4M6ML 4KVNH 2J7LA 1NMBH 1NDMA 2YUWA 2Z91A 5MP6L 2F15A 2FX9H 5JLZB 2WP3T 3T8XA 4LOUD 2VR4A 3CDFA 4JFOB 5FF6B 3JTSA 1OGAA 4ZAKA 5I19H 3D2UD 3RAJH 2R4RL 4HK3J 1WAAA 1NFDA 4NFCA 1LP9E 2OQJB 1JFQL 3V52H 2NXZB 5IFJA 3ARGB 3CH1B 1QR1A 1JF1A 2XTJC 5J7CC 3TYGL 1T0NB 1EJOH 1FCCA 2V2XB 1JV5B 4O02H 4ZNEA 5I1AA 1N0LA 1NCWL 3MNVA 2A9NL 1AGDA 3O6FC 4XVUC 2DQHL 4K3JL 3IGAA 4L5FH 4YXLL 3S36X 4KI1A 4HWBA 4U1SB 5DURB 2Q8AH 4Y5YC 4LMQI 3GJFK 3BGFC 5FYJU 3QUYC 2EEAA 4L9DA 2DS4A 2NLJB 1MJ7H 2WINA 1TTGA 3RWIB 5IJKC 4J3WA 4PJHE 5I1DB 5J4MA 2UUDH 2J5LC 1MCPL 5IW1A 1RK1B 2H32H 5CBEA 5TE4L 1Z6JT 5J3HD 5DFVC 5HHOE 3OAYH 3SKUD 4ZFFB 1AXSB 4KKBD 2FBJL 5BO1H 4IS6A 5CCKH 4JANA 4N9OB 2AV7A 4ELMF 2KQMA 5D7LE 1YN6B 5SWZD 3VXNB 5DRZB 3UC0L 5D71L 2UZIH 3ZKMC 4BZ1L 1U8HA 1XGQA 3L3HA 1CXIA 2FX7H 1F45A 2DF3A 4ZFZA 3UYRL 5T3XD 3CSYA 2BY3A 5HDQH 2YA2A 3MCKA 4PBVC 1MHHB 4IMLA 5C0GB 5IFHL 2B20A 4Z76B 1NCBH 3DLQR 4DZBB 3VXSB 1LMKA 5DJCA 3SPVA 3FOMA 3BZ4B 4NHCH 4XMKL 5B3JE 1QFWM 3LSOB 4OZ4A 1A4JB 3GSNB 3QDGB 3P9LB 4GRWB 1EV2E 4WI7A 5BJTA 4IDJL 2W9LA 4AEHL 1P6AB 3IJHA 4AEIL 4IOFD 4MNHB 4HKJB 1BM3H 3RVWC 3V6BR 1NANH 2MCG1 5GRUH 4YK4B 3I3DA 2VXQL 3DPBA 2KZWA 4AEEA 1V05A 3ULUE 3VD7A 4D9LL 2DQUH 2NZIA 2FL5A 3B9KC 1A1OB 2NYYD 5TDNB 1ZLUH 5I6XB 2Y06L 1PX3A 3MGTA 3GSVA 3P4NA 3WXVH 1F4YH 2WQ8A 1HSAA 2EDKA 1BREA 4X4YA 1FNHA 3V5DB 3NA9H 3VXMD 1N5YH 3MGTB 3Q5TA 1WGOA 3IU3A 2OR7A 4UUJA 2X10A 3IDMB 2NX5A 4Z7VB 4LPUA 1J1OL 3X13B 4MB4A 3IF1B 1UWGL 4YPGA 4R8WH 4XB7A 3QISA 4HIJA 3U7YH 5C3TA 3PWLA 4OJFH 4N0UE 5C3LD 3EO0A 4UILL 2RR3A 3S4SG 2B1AH 2CO7B 4XXDA 1JPGA 1WIPA 3UXFA 3X3GH 3GSRB 2ZUXA 3KXFE 2GK0A 4KKAC 4KI5E 5I75C 1BEYL 1DL7H 4LSVL 5DGRA 4X7SL 5E2JA 3QEQE 3RKDD 1GC1L 5C08B 1YQVH 4JG1H 4ZUTB 2R0WL 3NCEB 2V7NB 2GK2A 2D7TL 3I85A 3U2SA 3VU2A 1QRKA 3V6OE 3QXTA 2AJZA 3WO4C 4H8WC 3QYCA 3BI9X 4OZGB 3NA4A 1A3LL 3FB6B 1F8TL 4PJCB 5JHDB 4M6OH 5EIVA 4KWUA 1TCRA 3FRPG 1QSFA 1BBJB 3L3OA 3RNQA 2HJKA 4YDIL 4OCSL 2ZUUA 2GITA 1FFOA 2HFFA 1IAOA 3JTCA 1N6UA 5FUCC 4NP4H 2ADIA 2P8LB 5CSBA 4OZHA 4KHTH 3VRLF 1U93B 1J8KA 1CGXA 3W5NA 2VDQL 4RRPG 4KUCD 3T1FA 1KB5B 1K4DB 4O4YL 4EDWL 5D7IE 2DQDH 1YJDL 3KWWB 3ULUH 1A7NH 1A6ZA 1A3RH 5CUSH 4Z0BH 1NBYA 1S9VA 3RPIB 3NZ8B 5ALCL 5A3ID 1S78D 1YMMA 3WFEH 1WFNA 3TFKA 4TSAL 5IEKA 4LSPH 1LO2H 4YBQC 3GMLB 4AM0A 1SJXA 5GHWH 1MHEB 1JHTB 1IGMH 2ERJB 1GGTA 4NQSA 4P9MH 4YPJA 1J5OL 4UDTA 5I8KH 4J1UA 3TA3B 1A6UL 1A4KA 5FM8A 5E8EB 4PB0H 3PWPE 4UBDC 1U3HA 4W81A 4UDTB 5A1AA 4AZ8A 5IMOB 3PQYA 1MVUB 4XAKD 3R0MA 3VH8G 2Q76B 2HFEB 5BV7B 1CGTA 3GIVA 3HZYA 4P9HL 4JFXA 3WEXA 1BQHA 3UP1A 1KIRB 3O6LH 5ITBH 5BVPH 2VOTA 1F8TH 3HC0A 1RULL 4JO4L 5F21B 1KIQA 5GXBB 3ES6B 3I02B 2L7JA 1CK0L 4N0CC 3EYUH 4KKAD 1FG9C 4PJXB 1T20A 5E08H 2DQTL 4P5MA 3NIDE 3OZ9L 1IGFL 1PKQB 3M07A 5F97E 4WI9A 5I9QB 1MJ8L 2BXYA 4FP8H 2ZUSA 3SDDD 3OAZH 2EDOA 5JHLH 1G0YR 3HE7B 1MCKA 1MPAH 3HNTH 5TFSH 1F42A 1IGYB 3WHE0 3HE6C 2Z8WC 4HZAA 2J8HA 5I1CH 3PWVA 1EMTL 1E4WL 3V0VB 3MBXL 3AXLA 3WE6A 3QNZB 3OF6D 4O9HH 4KJYA 5I1AB 1V5JA 4EI6B 4HJ0D 5MENE 2IAMC 4Z78A 3RIFK 1KBGL 3CCHA 1ZLWK 1PZ5A 4GRMB 4RAUB 2FX8L 2PYFB 4XZUA 2H8PA 3SGKA 1F6FB 1YUHB 3UROR 4ODVL 2E7LC 4M1GH 2GT9A 4LHUG 4RQQA 2VDOH 4GSDH 5CJXA 2I5YL 3KYNA 4X80L 4HK3N 5KVMC 2HT3C 2MKWA 3L1OH 4OT1L 4X4XA 3EYOA 4J3OC 1F2QA 2VAAA 3B4NA 2IADB 4GQPH 1IC4L 4NHUE 1U92B 5CBEB 1FDLL 1S7TA 4FQXC 2LU3A 4D9QE 1NFDF 3QEGL 2DIAA 3MNWB 4IRSC 5HSFA 1YEEL 1CBVL 5DD1H 4BFIA 3KPOB 1HWGB 4L3EB 1T2JA 4LLMA 5HHMA 4YNYB 1N59A 3WN5C 3EW3B 5AZ2H 2YA1A 1T3FB 4MD5A 3BPCB 2Q7NA 5E8OB 4JFFD 4AENA 3JV4A 4L8CA 4WEUD 2VKWA 4OAWB 1YEHL 1FVDB 3VE0B 3SEPA 3BQUD 4PPTA 4OF3A 5T5NG 1KYOJ 3TVMD 4HMEA 2F9BT 3EKCA 4NNXA 3V6OC 4F7TA 1YPZA 4RWHA 3W11C 1C7TA 2HVKB 4B53A 1I4FB 4XNQB 3QI9C 3TC9A 1A47A 4HGWB 4XTRD 4X9FA 4YO0A 3D9AH 5D71H 4BZ1H 5BZWB 2HRPH 5E2WL 3FT2A 1A22B 3WNNA 1OARL 5FAAA 3HPJA 3OGCA 2VTFA 1NGYA 1QFUL 1I1RA 2V5MA 4P2RE 3LQZB 3ARRA 4NN6C 4PJ7F 4QXUH 5EO9A 3DIFB 5HPOA 4G8EB 5I73C 4P3CL 3C8HA 3CSGA 1WIOA 2EYSB 4S1DD 2Z4QA 5J12C 1F13A 2EDFA 3VWKB 2FZ3A 2VO5A 3K74B 1WC7B 3QDAA 1S9WA 1AGFB 3D69B 4CL7A 3HAEG 3DI3B 3PDGA 4JZNB 3CXHK 4OD1H 5ACLA 3GSVB 1RMFH 2EKJA 1PYWB 5GPRA 5I15H 2EIZB 3ZKND 1NKOA 3VFMA 3HI6H 3MJ9L 4LNRB 4N0CA 1U58B 5DHXB 2AKRA 5EU5B 3GBML 2AAVA 2NY2D 3A67L 3ARPA 4HH9B 1N0XL 4CJ0A 2QSQA 5EU6A 2M26A 5C7XL 1YMME 3QEHA 5H2BB 1RZKH 3FKUS 5B4MC 5IFAL 4D0BB 3FO2B 1KTLA 3O2VH 2QADB 3QI9B 3IRZA 3RJDA 4TNVK 3MLXH 3WJJA 1KTLB 3P4NB 4O58L 1NDGB 3QCUH 3PJSB 4P46B 5HYSA 1MWAA 3KPSE 1MAML 2ICWI 3RX8A 2CK2A 2FX9L 4YDJB 1RUQH 4MQXC 3HG1E 5IHBA 1OW0A 1RZFL 4OF0A 1DN2A 2YD8A 3FAXA 4MS8A 1RZIA 3K46A 2UUDK 5IM7B 1KCUL 4M4RA 5JMRA 5GISL 3IKCA 4XI5C 3T0AA 2BVQB 2VLKE 3UYPA 1TZGL 3CFEB 2X7LB 2A83A 5EZOL 4HIIA 3PDDA 3F7YB 4O00A 5DEZA 3VGHA 4OZFB 1RFDL 4TTDD 2ITDB 1WWBX 3O8XC 1X6LA 1PLGH 1KEGL 3PE9A 4PG2A 4WWKC 2X05A 3ZKNC 1JPGB 2IG2H 1UXWB 5CP3A 5I2IA 4J4PD 4QRTA 1B0GA 2X42A 1O7VA 2GUOB 2AJZB 2W9DH 3IDNA 4PG9A 4G42A 2DTMH 4IIQC 5D7KE 4QRUA 5D7IA 1DVFB 3UO1L 4NYLB 3GBLA 1AC0A 4OF8A 2AGJL 4WEBH 4X6CA 3VXUA 1WTLA 3VGBA 4ONGH 4IS6B 3QUMH 1RZGA 1VFOA 3HA0A 4K7PY 4U1IA 3NOIA 3B8YA 4Z77A 2Q20A 3IDXL 1ITBB 4CVXA 3GMMB 2P8LA 5E8DH 1U8MA 4AG4L 2G5BB 1IEAB 2P8PB 3VWKD 2V5SA 3GMQA 4QXWA 3B5HA 3TO4D 4WV1C 4KPHL 5JA8B 4DQOL 5C07D 1E6OH 3VG0L 3C6LA 1JJUA 4ZMAT 1MVUA 1NCNA 2KL6A 1AH1A 3CDGA 3T0VA 1N5AA 4FTVE 5CEYB 1G1CA 1JYXA 2DYPD 3PP4H 2F5AL 4PRNB 4XBEL 4Y16C 3QUML 2VL4A 5IGXH 2F19H 3HAEH 5C9JA 2R15A 4HLZH 3DSNA 4LRIA 3BISA 4NKMA 1G6RH 1SM3H 3VGFA 2W59A 3HC0B 4P23A 4EVNB 3FB8A 3G5VA 1XMWA 1IMHC 4H0HB 3TVMC 1M6OA 6FABL 3NPSB 1NGZB 4OCLC 3PHQA 4GW5B 4V1DE 2WWKO 4WI6A 4HUWA 3T2NH 1EVTC 5L6YH 1JGEA 1FVEA 1IBGL 3P30H 3SE4C 4KZEL 4GW4A 3TZVC 4LL9A 3BGAA 1RUML 2YR3A 1U8NA 2Q3ZA 3O6KH 2IQ9L 3DYPA 3VDCA 4XCFH 2XTJE 5I71C 4KI5C 3WUWB 2EDQA 4Y88A 1ND0B 1SY6L 5E6ID 4OZIA 4PJ8C 5J6GA 1W72A 1GL4B 2FR4B 3UJTH 1OP5H 2VLRB 4HIEA 3B6SA 4U6HB 1EHXA 2FO4B 2NX5B 5MENA 1FFNA 2HTLC 2AS5M 1KN2L 1VKXB 4Y4HB 4GG6A 1A6TB 4LCWE 4NQDB 4AIZA 4GBXC 3RWJB 3MV11 2ARWA 2CKBA 4NN5C 4RDQF 3UPRA 4LLAA 3VXSD 2PW2A 3LVEA 4Q2ZA 4QHNA 1KG0A 1NLDH 1VEOA 2FJGA 5DLML 4EDXB 1A2YB 3RU8H 1DSFL 2OJZH 2VC2L 4WNQA 4JKPL 2VAAB 1WAAF 3HE7A 5JW4N 4X7TB 2OP4H 1EUTA 1ZEAH 4MDIB 1OL0A 4PREB 2NXZC 1XH3B 2IQ9H 5H37G 3ULUD 4PTUA 1PX4A 4P2QA 3T2NL 2ADGA 5FCUL 4WO4C 3HAEA 2OX5A 4PJ8B 1BJ1J 1HQ4A 2EH8L 2FATL 2ZKHL 3GMOB 2FJHA 2GTWB 2CLVB 4JRYB 5EU7E 1HYSC 4YBHA 4XC3L 3T4YB 1HQ4B 3MLRH 5TGBA 4HJGA 3PWNA 2IADA 4GMSL 1W0WA 3Q0HA 4KK8D 1CLOH 4N8VB 3FHQA 3T0BA 4QXTB 4BSWB 2BJMH 2ZNWA 4K94H 5L9DL 3KYOA 4UT6H 3HPLA 3PP4L 5BRZB 4HC1A 2XKNA 3RTQD 1XR8A 3TLRA 4R4NC 1A7PH 5ACZA 4HPOL 2Z31D 2GIYA 3L5XL 4IEFB 4UMGA 3GK8L 4LLYB 3T0EE 1KN4H 4LAQH 1MHPH 3W0WB 4HDIA 4F8TA 1CGWA 4JAMB 1KTRL 3DX6B 5IVOA 4TUOA 4WTXA 5DJ8B 2Y9RT 3RWEB 1G6RA 3L3HB 4U1GB 1A9BA 4C56D 4G8FA 1IM3B 5LXGL 3FZUD 1JK8B 4Z0XA 1H3TA 3OKOB 1BZQK 2WK2A 1GRWA 2B1HH 4IIQB 3PF2A 4G8FB 3GRWL 2BP3A 3ROLA 3MV7E 2DDQL 3IJHB 2BHYA 5HGHB 1OP3K 5F3HA 1CDHA 3VD3A 3KPNB 4W4OC 4LCCC 4M62H 1MLCA 4C83B 1CS6A 1FIEA 5IMKB 1C5CH 5BJTB 4DFHA 3TBTA 2RJMA 1R3HA 2E9IA 1T83C 1CBVH 5EU6B 5JXAH 4LASH 1T1ZA 3ZYJA 3QO0B 3QEGH 5C0CE 1ZHNA 3S5LA 3ZTNL 1LEKA 3BVNB 5FKPB 4HH8A 1RFDH 3W0WD 1VGEL 2PW1B 2HLFD 5DMGC 4DK3A 3LKSB 3GSQB 1B90A 3BE1H 5FYKL 3EYVB 3MRKA 4MD0A 3SDXA 2FZ3B 1U2CA 4WWKB 2A6IB 3P77A 1FZOB 3DXAD 1MCEA 4W6XB 4BUGA 3OKLA 1VESA 2Q8BH 1TXKA 4WIQA 4NQTA 2DIBA 1AGEB 1JNHA 5LAXA 3PUCA 5ERWB 4I0PD 3OV6A 5IM7A 4E41A 4OCRH 3B5TA 5GZND 2N56A 1ZSDB 4HPYH 4XGZA 5E6IA 3P9MA 2CRMA 4Y5VA 3UBXI 1MFCL 4Z7VF 4MVBA 5DMIL 3ZHKA 3PWLB 1HOCB 2P5WA 3HE7D 3BKCH 2DI7A 3SDDB 3D25A 2V9RA 4YR6B 3CFCH 2XQYK 1FLTX 1CDBA 4JPKL 2WIMA 4JLRB 2WSKA 3ARDC 3QUKA 5HHXL 3EFDL 1NDGA 4JRXD 4Y5YA 4BELD 4F58H 3LOWA 1U8LA 3D39E 4TQEH 2NYYC 4WI2A 2NZ9C 4K7FA 2LU7A 2H2PC 1ZLWH 3O3BB 4QRUB 4OIIL 1XGTA 4I18B 2CUIA 5ITFB 4V3DB 3T3PF 5KSAA 1IC7H 1I7UB 2FEDC 1P2CA 5EZJA 4Y4KD 3TT1H 2YSSA 5AZEL 1G7MA 4JFYA 1KOAA 1GPOL 4PJBB 4G6JH 3C6LC 5D5ME 5KVGL 4RGNB 2J4WH 2YSSB 1TETL 4X5LA 2VLKB 1KJMA 3CSBA 1CFBA 4WEMB 4OGYL 1LNUA 1NL0H 3QCTH 1UZ8A 5CEXB 2YPLA 1ACZA 1RJYA 3NCYS 4PJBF 3I9GH 1A6UH 2ITDA 5E6IC 3OAZK 4PRIE 3C87A 1IC5L 5MEOB 3S36L 5C8JB 4HS3B 4JDVB 4PLOB 2C1OB 1DCLA 3C60B 5H94A 2YZ1A 1E27B 3CDGB 3GMLA 1ULVA 2R2EA 4AM0B 1NFKA 4F3FB 1NCUA 3O11A 4ZXBA 1KIPA 4YHMH 1IRAY 2OZ4A 1IM9D 1SMAA 3VXQA 5F72S 3IDYC 3VXRD 3MRPB 4XPAL 1AKJB 4H20L 2B7DT 1YJDH 5HDLA 3GMMA 1G9NC 5HHOA 4LRNL 3SDAA 5D1XA 5KZCD 5HGBB 1MCHA 2MQ3A 4JFQB 4GBXA 4XWGH 2D31B 4D9QD 3E2HA 1LILA 1HEZA 4KHTL 35C8H 1V3KA 1CICB 1A7OH 4IRJA 4BSVA 2P48B 1J05B 3I50H 1ND0A 3DSFH 2V6HA 4FMKA 4M00A 1H8NA 4ORGB 2AKRB 5EU5A 3M8OL 1ZVHA 1E28B 3CLFH 4X9GA 2HN7B 4JFXB 3OL2A 3IFLL 1T7ZA 2FGWH 4HAGA 4UTBH 2YBRB 4YGVB 4YHLL 1QR4A 4X80H 3TBVA 1NGZA 1I7RA 4O51B 5D7LD 5FCSH 4M1GL 5IVXA 5MEND 1EGJA 3BPLB 3NZHH 2Q7YA 3V7AG 1EO7A 4WHDA 5JUEH 3P11L 2X1WL 2WBJD 3VXRB 4RISL 4EQ2A 1E4XI 5C7XH 4J3XA 3QQNA 5FDWB 3U36A 2ENSA 1T03H 1HCFX 2R0LL 2H3NB 3GBMH 3MBXH 1CTNA 3GMRA 3QWQB 1KJVB 8CGTA 5C2BH 2NR6D 2PYEE 3OWEA 5DJ0B 4OD1L 3ZT7A 3ALXA 3HCVB 1SEBB 5EU4A 8FABA 3WE6B 2DAVA 4NWTH 2DBLH 4PUBH 4Y5XB 5FO9A 4I3RH 4QHKI 4FP8L 5EU4B 4G43A 1AO7A 1I9JL 1MCDA 3LPFA 1MRFL 3KXFB 1JTTA 3NA9L 2EZ0D 1S8DA 4N8PA 4LCIH 2R4SH 3BWAB 4JO4H 1AD0A 1Y6MR 4FQHA 4PJHF 5JW4R 4PP2B 3BHBA 3QEUA 3RVTC 1T0NA 2YWYA 5ENWB 4Q6IB 4MMXC 2XIDA 4XNYL 2DJ4A 4CN4A 1FZMB 2LU4A 1QNZL 3FQRA 1DQDH 1QPXA 2DICA 2FD6L 1CTOA 4P2OC 3GJEB 4I0PC 2W9EL 4Z18A 3BDYL 3PV7A 1CFNB 3RL2A 5KSBB 5IK3A 4XP1L 5HPMA 4NGHH 5AUMB 4LU5L 1P9MA 2R23B 4GUPB 4P9ML 3VFVB 4ZPTA 3U4EA 3K4DA 5EBLB 2CLRA 2BOCB 2NMSA 2QQKL 1QP1A 4PRAA 1P5VA 5AWNL 5FA4A 2FH8A 3WDHA 5AD0B 2VXUH 4ZFFA 3DRQB 3WFEL 5IFHH 2OXGA 3OJDA 3DOSA 5CIPB 2QL1A 2UZYB 5E03A 5F1SA 3K8LA 4TSCL 3U7WL 1D5IH 1DBAL 3F12B 2EZ0C 2BNRB 2IPUG 2L0DA 4B50A 4GH7B 3BAEH 3L1OL 4PJIE 1EO8L 3SY0B 4G6FD 1DUZB 1TQBC 3ILQD 3QCTL 5DEFA 1MRFH 4FQXA 4NQDE 1I9JH 4HAFA 4PGZA 4LBEA 5T1KA 2WUBL 3OKEA 4QY8A 2XPGB 2XTLA 4KVCL 4LCCB 5FO7A 1JRHL 4DUWA 3NABH 4WO4B 5EPMB 1GVIA 4ELMA 2CGRH 1IILE 2VR9A 4U49A 3RPKA 3L9RB 4PRHA 4QHLA 5J13C 4MA1C 3QIBB 5BMFH 3MOQA 1E4WH 3TF7C 2H9GB 2A6IA 3P77B 3GGWB 1U36A 5BCAA 2PF6A 5LBSH 1U58A 3GUTB 2BCKB 1U3HD 4MNQA 1HHKB 4NDMA 4S2SB 5MERA 4M5YH 3NCCB 1FFNB 1OLLA 1JWMA 1J12A 3EYQC 3CZFA 3LN5B 5EORL 3VXTB 1T1ZB 1OTSC 4L4TB 3RTQC 4YHLH 3X3GL 2WIIA 4ZTOH 3EHBC 4MCZA 1Q9OA 3VWJD 2W60B 4YUEL 3RI5K 5I1EL 5GIRA 4GXVL 4MLSA 2OYPA 5IV2B 4NKIL 3KPRB 3I50L 3JXAA 3NIFF 4NRYB 4I3GA 4TUJA 4YIQB 4KHXH 5D7SH 5CJ5A 3VG9B 3GI8L 3NFPA 4YFLI 3QO1B 3I6KB 2MFNA 1KCSL 3MRMB 1T2XA 1QYGL 2GSIB 5CWSB 3QG6B 2A38A 5L2JB 2ESVD 4L29A 5GS3A 1F4YL 5SWZA 4F57H 4PJAA 4Z7WE 3PQYD 3TO4B 4PRIB 3BPOC 3IDIA 4L1HA 2XZCL 3S8WA 5F9OL 4WTZG 3AM8C 1UYWL 1KXVC 5E99L 5J11B 1G9ML 2NLJA 3HZKA 3PL6B 4I18C 3SDXE 4NYLA 4WFGE 3SDDA 4PGBB 4X6CF 4MX7B 4X7EC 4Y16B 1NUNB 3FB6A 1DQJA 3LIZL 5JDSA 3BEWB 5BOZG 2SEBA 4M62L 1TCRB 4PBWD 3C8KA 2G60L 5JPNA 5IJKA 4C56B 3C09B 2IAND 1ZA3A 1FQ9C 2YZ8A 4U3CA 2FBOJ 1WISA 5GGUB 5FA3A 4P5TB 1VFMA 4HIHA 2X4SA 3PWUA 2MWCA 3EDKA 4LKCB 3TO2A 2B1HL 3THML 2VH5L 2OBGA 3GMPA 4G6KH 5LGKA 1VFBB 4ZSOA 2UWEF 5D96C 4U0QB 4I77L 2YPLB 5HDQL 5TQ0L 2PO6D 3VH8A 3HE6D 3KLHC 1DDHB 4LCYA 1RIHH 4Z76A 4APQD 3KYMA 2VDKL 4ISVA 3KJ6L 4FN0A 5HVFB 3FOMB 2VLKA 1MHCB 1KF9B 4MZ2A 2QSCL 4QRRD 2DLFL 5CEYA 1AD9B 1R3LA 4HPOH 2NX5D 5HVHB 3GSWA 4UBDD 3MRJA 3MRBA 3OKNB 2QKIB 3QUYB 2GJJA 1MY5A 5T3ZE 1P6FA 1GC1H 3RPIA 3TNMB 2IH3A 1AO7D 1Z5LA 3NAAL 1M7DA 3TFKD 3O9WD 3FRUA 5FO8B 3PGFH 4N9GA 3OXSB 4HWUA 1T5XB 4OZGE 4X6EB 5DJ2A 2DQEL 4NKDB 4Q9QL 3FQWA 2AEIT 2XWJA 4M3JA 3UTSE 3WS3B 3QZWA 3QXAA 3OXSA 1S7VB 3X17A 3QDME 2FL5B 2DJUA 3FQWB 1S3KL 3N9GL 5I1LB 4OCRL 2ICWB 1UADC 4M7LL 5ETUB 4OD3H 4PJGA 4OZIB 2WY3A 5HHOB 1UH2A 4K3JH 4ZUUA 3GSQA 1EEQA 4KK6C 4RRPA 1BQHB 5M7QA 4JFHE 4YE4L 2OJEA 3EYQD 3TYGH 4DKAA 4M03A 4BQCA 1HQRB 5DI8A 1U3HC 2CRIA 1JNHB 4D8PA 4P2OA 3RY6C 1R5IA 2BNUB 4JHZA 5MEPA 1JTOA 3EJZD 4JRXB 4D3CH 5JQHC 1ZHBB 1ZA6B 1ONQB 5T5FL 2ZCLH 4JRXA 5EBWB 2OL3H 3GIZH 3IS0X 3TBVB 5JLZA 4XXCA 5GGSA 5DRWB 5JW4Q 3QPQD 1CFVH 4LLDA 2Z8VC 2C3HA 4EOWL 3U79A 2A1WL 1M71A 2ICEA 4ZO9A 4CAGA 1UB5A 3LS4L 1F11A 2XN9E 4S0TD 4BZYA 4TOYL 8FABB 5IKCA 1FORL 4LGSB 3U0WH 2VDLL 2B0SH 4PREA 5CBAA 4AL8L 3E8UL 2AQ1A 4LLQA 5JW4M 1T6WA 1N4XH 1WV7T 4N0UA 4U7MA 3HZMA 3VFGH 5IK3B 4LLQB 4QLRA 3SE9L 2OXHA 1Z3GH 2Z31C 5B8CC 1G6RL 4HCRA 1RURL 4LAQL 2HKHL 4R7DB 3TNNA 3ZLQC 4JFFB 1BWMA 5KSBE 4OGXH 4F37F 1UZ8B 5CEXA 2DJSA 3QJFA