4HWZA

Structure of hla-a68 complexed with an hiv derived peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-68 alpha chain
publication title Structural basis for the differential classification of HLA-A*6802 and HLA-A*6801 into the A2 and A3 supertypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hwzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4hwzA01
4ONHB 4Y4KC 3NA9L 2DS4A 1CQKA 5KSAD 2MCG1 4Y4HD 4X7FC 2ICES 5J0BA 2KQNA 4X6CF 4UNUA 1MIML 2YC1B 2R1XA 3SGKA 43C9B 4HIHA 3EUUA 3R0MA 3DROB 2ADIA 4UQ2B 1I9JL 2IADB 4KVCL 3B5HA 1RIUL 4NN6B 3O9WD 2FEDD 5DD1L 4ZUWA 4OZGE 1JPSH 4KV5F 3HE6A 1TQCB 3CX2A 2VMFA 3VD9A 1NAMA 5E56A 1XIWA 3BXNA 3CDGA 2F58L 3JBG7 5GS2H 1GC1L 2GJJA 2R1XB 4HIHB 4MSWB 3TA3D 4ZUWB 5IHUL 2DIBA 5I1IL 4RBPK 5DMIH 3PV7A 1T89C 1UQSA 5JOFA 1T2XA 1NAMB 4OM0H 1YMHA 4YPGB 1RUML 2ZCKL 3RY6A 1MPAH 1VERA 3BXNB 3GIZH 3I3DA 5A2IH 2HJKB 2AJSL 5CIPH 1CE6A 4L4TA 3H9SE 5FYLL 3KPMB 2NW3A 4R90H 3IGAA 1BF2A 4OAWA 5EWIL 1NCAH 1DN2A 1UQSB 2WLZA 4FHBD 5JOFB 2EZ0C 2YRZA 1U93A 2V5YA 3ARDA 3HZYA 4WHDA 1CE6B 4L4TB 2UVEA 1J18A 1DANU 3IGAB 2BOBA 4OAWB 4R0LA 1LO3H 3ZHDA 3WN5A 1I85A 3VDAA 1U93B 1QLFA 5CBEA 5T1MA 3SCMA 5BRZD 2RB8A 4O9HL 5F9JA 3VXSE 3ARDB 3HZYB 2ZCLL 3C6LC 5DD3L 1NFDE 5C0CE 4MJIE 2CPCA 1KB9J 2BOBB 2Y7QA 4LCWD 4R0LB 1XF4A 5IUSA 5MENE 4QRPE 3WN5B 4NO5A 4UTBL 1NBVL 4F37K 3ZDYE 1UWEL 1QYGL 1QLFB 5CBEB 5T1MB 1D5IL 5F9JB 5DQDH 4PGDB 4HG4K 2FYYA 1NUGA 3CU1A 4G8GB 4XAWH 3QIWD 2Y7QB 3R1GH 4M4RA 4OF0A 1A02N 1XF4B 2Y6SD 5H35A 3P40A 4NO5B 4WTXA 2CDEA 4NN5C 5E00A 4FMFA 4BQ8A 3TV3L 2OL3H 3QO0B 4RGOL 2DDQH 3BAEH 3DUUA 5IFHH 1A9EA 2QQKL 3HB3C 2FYYB 4BJLA 5IHZA 3LMJH 1Y6NR 2UVFA 4I18C 5H35B 3ARFC 4L3AA 2A9ML 1CFNA 2CDEB 3OR7A 5E00B 3MROA 4NQEA 5E6YA 1CFSA 1CCZA 1I7ZA 3DUUB 1A9EB 5ITBH 2VXUL 1NPUA 4H0IA 5IHZB 2WWKO 3GSVA 3TFKD 5JUEH 3ZT7A 2PTVA 3QIBA 1FVCA 1CFNB 3OR7B 5IP4A 1FORH 3MROB 4NQEB 1CFSB 1VPOL 3F7VB 1DBAL 1I7ZB 3T1WA 2IFFH 4P9MH 4FFVD 2YD5A 3MUHL 4X9BA 2VXVH 4RFNB 3GSVB 3LKSA 1QFOA 4PGZA 3SY0A 4UQ3A 1OW0C 3QIBB 4GXVL 4LPYA 1FVCB 1EFXD 1EZVX 1NBYA 4GAJH 5EUOE 3CXHK 1MIEH 3IDGA 3LH2H 1A6ZA 1PKQA 5CSGA 3PUCA 1CLZH 3TNNA 3CFKB 3LKSB 1ZAGA 2AJUH 1ADQH 3SY0B 4NQUA 1I8LA 1KIPA 2W60A 5IVOA 1XEDA 3IDGB 1YEGH 3MRJA 5HY9A 4BYHA 1A6ZB 1PKQB 5CILL 2JCCA 3IU4H 3C2AL 3B5TA 8CGTA 3TNNB 4OUUA 1N3NA 5FK9A 1ROWA 3VXMD 4LPXA 3W9EA 2PYED 4XVTL 3M07A 1KIPB 1Q9KA 1QFPA 2W60B 5HY9B 1IAIM 3MRJB 3PL6C 5ESVA 3JTSA 4PJ8A 3RNQA 3O4OB 2JCCB 5F3BB 3E8UL 1WBZA 4K71C 2R8SH 4H5SA 2WSKA 5H37H 4OUUB 4JKPL 1N3NB 1WFUA 5FK9B 3W9EB 4YGVB 5E99H 5GGTH 5JW3L 1IZJA 1QZ1A 2EIEA 1Q9KB 4OGYH 5IIEA 4P48A 4X9GA 5M94B 3ZSTA 3PHQA 3T2PA 3CLEH 2NMSA 1KTKE 5ESVB 4PJ8B 3RNQB 2EYSB 1XMWA 2ESVD 5J56B 4POYA 1F3DH 5D5MA 4X80L 2CKBA 4H5SB 1F58H 4FMKA 3QI9C 1DBML 5DD5L 5FGRA 5IBUB 3RVUD 5SWQB 4XP5L 3FFCA 5EO9A 4I48A 5IIEB 1G9ML 4V3EB 3C87A 3PHQB 4XH2B 2DQTH 4OV5A 1YEJL 3DX6A 4E41A 5DK2A 5D5MB 1INQA 2CKBB 4MA8L 5CUSH 3UCRA 4AM0B 5D71L 1VGEL 3HI6H 2HWZH 4PY7A 3LRHA 1LK3L 4P3CH 5KW9H 3FFCB 5EO9B 4I48B 4HPOH 2JLLA 3WSQL 3K1KC 2F9BT 2AGJL 4GT7A 1CICD 5I1KH 4OV5B 3AGVA 1P4BH 3OAZK 3DI2B 3DX6B 3BZFA 4E41B 4J4PC 2APVA 1IGMH 2XTJB 5DK2B 1W0YT 2XRAL 3MOBH 3TVMA 2IAND 2GSGA 3VJ6A 5DC4B 3MRHA 4PY7B 5C2BL 3GSNH 2LFGA 1NLDH 1A3QA 4LSPL 1A7OL 2PW1A 2NY6C 4O4YH 5B8CC 4XB7A 4L8SA 4TYUA 2R29L 4N68A 3REWA 2EXYC 4BQ9A 3BZFB 1FGVH 3U1SL 5HVHB 3OZ9H 2GSGB 1MWAL 3VJ6B 4ZDHB 4HX1A 2W0PA 3LN4A 1J9CT 4RMSA 4EUPA 4U33A 3VRLE 4BUHA 3TJEH 1BGXH 4XGZA 2F54D 4PTTA 1H3GA 5CEZL 4WFHD 4L8SB 1JRHL 3REWB 3NCYS 1A7NH 1GGIH 4HK3J 3UPRA 3JVGC 5JW4N 2OXGA 3BUYA 4UV7H 4PJDE 4HX1B 2QEJA 7FABL 3EKCA 3LN4B 2COQA 4FZ8H 1CR9H 2W59A 2BSSA 5K9QG 4XGZB 2BNRE 4YFLF 4PTTB 1ZVSA 1A1MA 3LD8B 1K85A 2V9TA 3BDXA 3GK8L 5CP3A 2VO5A 4POZC 3UPRB 1MAMH 5I8OL 4K55A 4OIIH 3BUYB 3Q0HA 3ILQD 2E9WA 2VDMH 2FZ3A 2R15A 1QBLH 1HDMB 1L7TL 4G8EA 4B41A 1HZHL 5IFJA 3I50L 1MAKA 2BSSB 1NL0H 1ZVSB 1A1MB 5D93B 5FUCC 1YNLH 4XXDA 1MCEA 4LSTH 4S1QL 5JXEA 4ZXBD 2DIAA 2QQQA 3W9DB 5FCUL 3SE4A 2VLKA 2I27N 2AK1H 3O3EA 4JRWA 2FZ3B 1UXSA 3KPQA 1OF2B 1UKTA 5B38A 1SEBA 5KSBE 1KIQA 5D9SA 1YYMH 5IFJB 1Y6KR 1LO5A 2FH6A 4XXDB 2DLHA 3RZCB 4BH8A 1CDGA 5HGHA 1TJIH 1DZBA 15C8H 2VLKB 4U6VL 1H3PH 2BVEA 1HH9B 5F7WC 3O3EB 3WHE1 3V7AE 2AXFA 1UXSB 2HH0L 3KPQB 5B38B 4JY4A 1SEBB 1KIQB 5D9SB 3CD4A 1LO5B 4TULL 1Q0YL 3BN9D 2P46B 3L3GA 4KUCF 3BZEA 2NY2D 4IOFC 1LEIA 5HGDA 1V7MH 4BH8B 5B3JF 2XQBL 5HGHB 4JY5L 2PXYA 3DMMB 4HEPG 3SN6N 1CLYL 4XBEL 5D1QC 5E4EC 1A6TA 1F6LL 1T3FA 3AB0C 5FHAL 1F4HA 1W8OA 2AXFB 3ARED 3LQZA 4LQFL 4JY4B 3OF6D 1FYHB 2UUDH 4M7KH 3RKPA 5CD5C 1A7QH 3OB0K 1IQDA 5T3ZH 2FBOJ 3L3GB 3BZEB 3WDIA 3F6IA 1LEIB 2DBLH 5HGDB 2E7LE 1FNFA 5T1KA 4K7PY 3BW9A 2O93L 2PXYB 1CGSL 2YA2A 2J8HA 4P23D 1A6TB 4F15B 1T3FB 1MCOL 2EEBA 3LQZB 5GRUH 3U4EA 3K81A 4MNGA 3IDIA 1DSFH 4XPBL 4YHKL 4NCC1 4OCYL 3TF7A 3W11D 5T1KB 3BW9B 1MFEL 2B0SL 4PJ5A 4DGVL 1OT2A 1KV3A 1MRFL 1CDIA 4WUUA 1S7WA 3BKYL 4MNGB 3IDIB 3BP4A 1IKNA 4YHML 5KJRL 3E2HA 3EYQD 4ONGL 1CXKA 4PJ5B 3MLWL 2DQJL 3TH2T 4MAUH 3ZYIA 4O02L 1K9TA 4KGJA 1S7WB 2ZPKL 3W0WD 4W70A 5L88H 1DQLH 1W72A 1A6WL 1F3RB 1G7HA 4YDJA 4H88L 3T0EA 3BP4B 3SQBA 4HS3A 3C08L 1MHPH 3E2HB 1FNEA 1XCTA 4JQIL 3BGMB 5GS0H 4CMMA 5D2LE 4KKLD 5T3XD 1YY9D 4IRJC 5IMMA 1KJVA 3NGBC 1S78C 2ZJSL 4L5FL 5JIIA 5ADPH 4OIAA 1U8PB 1CU4L 1W72B 1G7HB 2DQCH 4YDJB 3UP1A 2IBZX 3T0EB 4FTVE 4HS3B 4KJPD 5J6HA 1FNEB 1XCTB 3IJHA 2RGSA 3MV01 3X3FH 4CMMB 1PFCA 2NZ9D 4XXCC 2GEEA 1ZEAL 5IMMB 1KJVB 4Z7QE 4NOFA 3BPNC 3OAYK 2XQYK 3MV11 4KK6D 5E03A 3SO3B 3QIUC 4JR9H 3KYNA 5J6HB 1C5CH 5CSBA 5EIVA 1YDPA 3IJHB 5DUPL 3DLQR 4GW5A 4B50A 4R8WH 2AJXH 1OTTD 4NQCA 3VDCA 4EI5C 4NNPH 1F5WA 1A5FL 5EORL 3KYNB 4JVUA 5AZ2L 4H0GA 3EAKA 5E2WL 5T3ZE 3NAAL 5SWSA 4IRZH 1YDPB 2R4SH 5DMKA 3RRQA 2H3NA 4GW5B 1EJ6A 4NQCB 5GRVK 1AI1L 1RU9L 1RV6X 1RZKH 5CEZD 3L7FB 3PP4L 1T83A 1NC4A 3GDBA 2R1WA 4Z7VA 1MREH 1P9MC 2E3VA 4RDQF 5SWSB 1A0QH 5DMKB 3VXME 4QTHA 2H3NB 3QCTL 3G6AA 1ZT7A 1JZ2A 4EBQH 2BX5A 4DTGH 4K3HA 5LKNA 4L8BA 4BZ1H 1NC4B 2R1WB 1V3MA 4Z7VB 4ZFZA 4NZTH 1HK6A 4PTUA 4WVRA 4C59B 1MRDH 3ALWA 3UTSD 1JPSL 4QTHB 3G6AB 2V6HA 1RMFH 3L3OA 1ZT7B 2XKSA 3LQAH 1U8HA 1BFVH 4N1EA 3WEXA 5F7HA 4PJAE 4FABH 3IXAB 4S1SH 5JIPA 4L8BB 2ESVE 2VJXA 2XG5A 4ZFZB 5AZEH 1T1ZA 4Q9QH 1X5ZA 5DMIL 3L3OB 3RAJH 4WEMB 2L4OA 3NA4A 1J8HD 1ONQA 1U8HB 2FHCA 4OM0L 4ZFGH 3WEXB 3GIZL 5IMOA 3JUZA 3IDMA 4GUPA 4PUBH 4Y1AA 3LEVH 2HKFL 5EOCH 3AM8C 1KF9B 4R90L 1T1ZB 1V3JA 1NCAL 2W9EH 4F58H 3VA6A 3ZL4H 1ONQB 2EDRA 3ULUD 4I0PA 5GGSA 3AMLA 5IMOB 2JJWA 3IDMB 3BGFB 4Z95H 4GUPB 3C09B 4Y1AB 4FQXD 3N0PB 3ISWA 5TGBA 3TBWA 5BVPL 3K80A 1MQ8A 2YD6A 1LO3L 1HYSC 5KOVC 1Y6MR 4JRYE 4I0PB 1C12A 4N5EC 5GGSB 4BFGA 5BV7B 4TVSa 1Y0LA 2APWA 5JZ7C 1MFDH 1PVHA 1B4RA 1JGUH 5KBNC 5C0DA 1Z9SA 5TGBB 3TBWB 3MJ9H 1EAPA 5E5RB 5MI0B 1HQRA 1N8ZA 3QEHA 1KYOK 1C12B 1UCTA 2NCMA 1Y0LB 4WFHE 2C3XA 5HD8D 5ERWA 2XY1A 3O2VH 2BOCA 4WW2A 1MJJA 4XAWL 3R1GL 1EAPB 3H3BC 1G0XA 3IDYC 1NMBH 5C7XH 1N8ZB 3QEHB 2WBJA 1QR4A 2WIMA 1CK0H 1OAKH 3IETA 2X10A 1KCUH 1LO4H 2OL3L 4IOIA 4OLYH 5ERWB 2DDQL 3BAEL 5IFHL 5DSCA 4LLDB 2UWEA 1P7KB 2BOCB 4WW2B 1MJJB 2Q6WA 1VSCA 5CAYB 4HS6A 3GMRA 3MBXH 3UO1H 3LN9A 2WBJB 5FM5O 1K5NB 1ZHLA 5BS0A 3IETB 3UX9B 3U0PA 4NJAH 3HS0A 4IOIB 3W2DH 3OJ2C 2LAGB 4LVHC 4F8TA 5DSCB 5ITBL 2UWEB 4BSJA 1TJHL 5HHOA 2Q6WB 5JUEL 4W4NA 4HS6B 3GMRB 4XMPH 4KZDH 4QRRD 1ZHLB 2P47B 3D6GA 1FORL 5BS0B 2V2WA 2BVUA 3IYLW 3U0PB 3HS0B 3K4AA 2FO1A 2IFFL 4P9ML 2NY7H 2VXVL 3WUWG 5HHOB 1NFKA 5F7FA 4X8XA 5CFHA 3IAGC 2OTUA 3QJFA 1MI5A 1VENA 3VGHA 5DJAA 4GAJL 5DVKA 4U1MA 4FNLH 2V2WB 1MIEL 3LH2L 1SBBA 5J89A 4JQXA 4TQEL 3IF1A 4KQ3H 5I73C 1TTGA 4APQD 5C0GA 5AAMA 3PWLA 2OTUB 2AJUL 1ADQL 3QJFB 4D9RE 1MI5B 5E08H 1I7UA 4GRLA 3GRWH 4PS4H 4U1MB 4BKLA 5ILTH 2X89A 5I71B 1J10A 1YEGL 3N1FC 4YHYB 4M1CD 1S8DA 3IF1B 3IU4L 3ZLQC 5IMKA 2C3VA 3GMQA 3FZUC 2Z31C 2ZKHH 3ARBA 2NXZB 3SKMA 1VDGA 4LGPB 5C0GB 1MVFA 3PWLB 2DKMA 5E9DE 1ZHBA 1I7UB 4GRLB 2DWEA 2WANA 5TQ2H 1WAAA 4BKLB 2CIKA 2ZNWA 1CGXA 3GSOA 3TT3H 1S8DB 4KKBD 1UM6H 4MA1C 5IMKB 2C3VB 2R8SL 1JJUA 3SKMB 1ZHBB 5E99L 5GGTL 3B5GA 2DWEB 1JF5A 2CIKB 3CK0H 3EDJA 5ID1A 1KJ2L 3GSOB 3OAUH 3CLEL 1MJ7H 4EIGB 3DETD 2YOCA 4LSRH 4XI5C 2QQNH 3RPIA 3DVGA 4ESKA 3EDFA 2BY2A 4S1RL 32C2A 5ID1B 3MJ8A 2DQTL 4U7SA 2GQHA 3IXTA 3O8XA 2DKSA 5B4MC 5CUSL 4CN1A 2D4FA 4QY8A 2WLYA 3HI6L 2HWZL 5LGJA 3RPIB 4UDTB 3DVGB 5KW9L 4P3CL 4HWUA 4KK8C 5T1DH 2EDNA 4HPOL 32C2B 3MJ8B 4HUNB 5I1KL 3ZKMD 4MAYD 4P2QD 3MJ7A 1P4BL 3IXTB 1IGML 3O8XB 5MEQA 3WS6A 2YHGA 4WFFE 3VI4F 3SE9H 1IL1A 4QY8B 5LGJB 2FL5B 3GSNL 1PGRB 1NLDL 2J8UF 3VWKC 1MCRA 2DM2A 2J8UB 4L3CA 1KXQE 3MGAA 4O4YL 3CFIC 4MYWB 3VGEA 4ZNEA 3MJ7B 3CU7A 1FGVL 4YC2C 1XT5A 5MEQB 3OZ9L 1IL1B 4YWGH 4MS8C 1E27A 3E3QE 2DJSA 3RVWC 3TJEL 1BGXL 4L3CB 4Q97A 2EKSA 4Q0XH 2MPAH 4MVBA 1A7NL 2B39A 1ZS8A 3KPSA 1GGIL 4HF5H 4PJBF 1TJGH 2AJVH 4UV7L 1E27B 2R2EA 1C7TA 4Y5VC 3CCHB 5C09E 4YNYA 5FHBH 3CZJA 4FZ8L 4GW1A 4X4MA 1CR9L 4Y16A 2WBWB 1ZLWK 5A3ID 1RK0A 3B9KC 1PW3A 1I9EA 2EKSB 1RUKH 3Q5YA 2VB5A 4NUJA 1ZS8B 3KPSB 3L3JA 1H5BC 4TPRH 3CSGA 3BQUC 1MAML 3SDYL 2VDML 2R2EB 4OCLC 1QBLL 3C60A 4YNYB 4GW1B 4Y16B 1LO2H 1RK0B 5CZVL 4RBPH 1NL0L 5GZND 1YNLL 4MD0B 3HZKA 3ORJA 1GVIA 3S4SG 4LSTL 3UTSE 2DKUA 2XZZA 3R0NA 4G8GD 1OL0A 4H25A 8FABA 3M45A 4NUJB 3L3JB 2GW5A 4HZAA 3SJVA 5GGQH 4C54A 4LGSB 2AK1L 4KROD 3C60B 1FQ9C 4ZS7L 2FBJH 3NCFB 4KK5C 1YYML 3VD3A 4KI1A 2NY1B 1OLZA 5L2KA 1I1AA 2ICWJ 1WTGT 2JJTA 3HZKB 4RAHA 4EN3D 4WHYG 1MVUA 8FABB 4H25B 4MQ7A 3QDJA 1TJIL 1SVZA 15C8L 3SJVB 3LPGA 1H3PL 1QSEB 1LE9A 2BERA 4KQ4H 1LWRA 1A8JH 5L2KB 3ARWA 1I1AB 4GRMA 3PJSA 3TBTA 1CGUA 3NABH 1MVUB 4KY1H 3ABZA 4GAFB 4MQ7B 3QDJB 3HUJE 3RDTD 1G7IA 4HLJA 5I1AA 1GC1C 4D9LH 1LE9B 5KS9A 1CL7H 4K3GA 2BHUA 3VD7A 5DJDA 1IGYB 4M7KL 1NGXA 1A7QL 1HCVA 1Z2KA 4GRMB 3PJSB 5T3ZL 4Z8FH 3TBTB 2CGRH 5FECA 2DBLL 4FS0A 4G9FD 1CLOH 3MUZ1 3QUYA 3MBED 4G43A 4LLYA 1G7IB 1UG9A 5I1AB 1QSFA 3I6KA 3X17A 5GRXG 4PLJC 4EXPX 1KT2A 1KUMA 3MGTA 1JWUA 1HINH 5DD0H 5KS9B 5GRUL 5C07A 4QO1A 5DJDB 1NGXB 5B3NA 1EO8H 1U8KA 1DSFL 4D0BA 1RJLA 4ZPTA 2OI9A 5FECB 2D7MA 4P2OD 1KLGB 3QXDB 4HBQA 3QUYB 3GSUA 4G43B 4LLYB 2YD3A 1QSFB 3I6KB 2BSTA 1KT2B 3MGTB 1JWUB 1RZJH 1FZMA 1QEWA 5C07B 2SEBA 3BP7A 3OGCA 1SMAA 1ZGLA 3CH1A 5DDHA 1U8KB 4D0BB 4ZPTB 2OI9B 3QULA 5EU5A 1GYAA 4Y7MA 1DVFC 2R9HC 5AG8A 3GSUB 4MAUL 2IWGA 4UNTA 2BSTB 1I4FA 1FZMB 1QEWB 1NLBH 2SEBB 3BP7B 12E8L 1N5YH 3OGCB 5L88L 1ZGLB 1HE7A 3CH1B 1CDJA 1DQLL 5DDHB 3GNMH 3QULB 5EU5B 1MHPL 2KKQA 5DFVC 3MRLA 5GS0L 1DFBH 3ZDZF 4CBPA 1I4FB 5FM8A 2X5PA 3H8NA 5ADPL 1U3HC 3BRGC 4NKIH 2VR4A 2DQCL 1RULH 2ZNXA 3ARRA 1T04B 1MJ8H 2IMNA 4UOW1 3X3FL 3STBA 2X1QA 1GOFA 4KRPB 1D6EB 3QB7C 4ZQKB 4P2RA 1M05A 1TXKA 3QXUA 5E8EA 2BHZA 4U7KA 3TO4D 2HTKD 5DUML 1LK2A 1SJEA 1QFWM 4HH8A 4OI8A 1FPTH 1YEFH 2C5DC 1C5CL 1NAMH 3P4NA 5JMOC 1T89A 4MNHA 5I9QB 5C0BE 4R8WL 1ZV5A 2AJXL 3G6JA 1TVDA 4N0FA 1M05B 4GQ9H 1MQKH 4H1LG 1LEGA 4NNPL 5E8EB 4HIEB 2MCPH 1LK2B 1EO7A 5D96C 1SJEB 2QLVB 4E41D 3QCVH 1OP5K 2R4SL 4MNHB 4U3XA 3TT1H 4QWWD 1HQ4A 3G6JB 4F2MA 5H2BA 4N0FB 2J7LA 4PJXA 1FNAA 1LEGB 1CGVA 4OZIA 2AAVA 3AY4C 1A0QL 1IC4H 1IAMA 1YN6A 1TZHA 3FO1A 4WRLA 4CW1A 4NO3A 4MJ6A 4EBQL 4F2MB 5H2BB 3QBTB 2X9WA 4DTGL 3MJ6A 4PJXB 5HXMA 3C6LA 4D0DA 4R26L 5J11C 3K7UA 1JCKA 4BZ1L 4OZIB 4XBGB 2ICCA 5E8PA 1EMTH 4NZTL 1MRDL 1TZHB 3FO1B 1OGAE 1RMFL 4CW1B 3LQAL 2V2TA 1FP5A 4MJ6B 2GY7B 1D7FA 4F33A 1BFVL 4FABL 4GW4A 2XWBA 3C6LB 3N50A 4RZCA 4CJ1A 2X4RA 4S1SL 4D0DB 4XP1L 5IG7A 3G5VA 3EDEA 5E8PB 1IC5H 1B6DA 3QQ9C 4D9QD 5AZEL 1DBJL 1N59A 4XPFH 4Q9QL 1DBKH 4U1SA 3UAJC 3RAJL 2V2TB 4OI9A 3MUJA 3IFOA 4F33B 3MRIA 3SGJC 1K3ZA 4I2XA 4QGTA 2XT1B 2XWBB 4PUBL 4RZCB 2X4RB 2MKLC 3RU8H 5EOCL 4XVUD 5IG7B 3G5VB 2PR4L 2D03H 4ORGA 5FGCB 1N59B 3HAEH 2VUYA 2EIZA 3F65A 3BPOC 1D9KC 4U1SB 3ZDXE 1D5XB 2W9EL 4F58L 3IFOB 3ZL4L 4NRZA 3MRIB 2DRUA 3IDNA 4I2XB 1M4KA 5FOJA 3DVIA 3HC0A 5E2TH 1TPXC 5I8CA 2ZUXA 4GLRH 1TLKA 2FIKA 5CEYB 5JXED 3RZCD 2R23A 4RMUA 5SX5H 3RBGA 4ORGB 2EIZB 1UJ3A 2VLKD 5EB9A 2DM4A 2DLEA 4XNZC 4LOUC 4NRZB 1G9MC 3IDNB 4C57C 1NCCL 1ZWIA 3HC0B 1MFAH 1PDKA 1NGWA 5I8CB 2JE8A 2E7BA 3UTPE 1MFDL 2FIKB 2R23B 4KUCD 1BLNA 4MA7H 4OCSH 3ZSSA 3MJ9L 3DMMD 4RGNC 1UJ3B 4PJIF 2N7BA 3KHOA 4HAGA 1TIUA 2CLRB 1CXFA 5D7JC 2WMPA 1ZWIB 3MRQA 4L4TE 1KEGH 1NGWB 4JVPA 4Z6AT 3LQMA 1BLNB 3X12A 3AS3A 4GSDH 4K07A 1S9KC 1PQZB 5C7XL 4K23H 5EN2A 1T20A 3HRZA 3UMTA 3MFGB 5E8OA 3MRQB 1CK0L 1OAKL 1G7QA 1KCUL 1LO4L 4OLYL 2GI7A 2BRQA 5LJYH 3L5WA 1EHAA 3X12B 3WLWC 3WMSA 4OD1H 4PRIA 4JRXA 4JFQB 2BRRH 4XPHH 1WCQA 5I1CL 4I5BA 5EN2B 1T20B 3HRZB 5F7UA 5E8OB 3B9DA 3FT4A 1RZ7H 4MZ3A 1G7QB 4WHTA 4D94A 2ZZUT 3Q2CA 4NJAL 2BY1A 1OQXA 4PY8I 3L5WB 5GS0D 3MYZA 4JFFD 4WGWB 2N1KA 4PRIB 4P9HH 2D0HA 3L5IA 4XMPL 4I5BB 4KZDL 4LPWA 3FT4B 4XP6H 4WHTB 4NUGH 1IM3A 4M00A 5D7LD 4CN6A 2NY7L 5F71A 1G6RH 2HLFC 4K71B 3O3BA 5TPWH 4JPWH 5TFSH 4A6YA 5TE4H 3WO4C 3RWIA 3MLPA 2HFGL 1DQMH 4F7TA 3UZQA 4RX4D 4FNLL 4O51A 2AKRA 3HCVA 2OZ4A 4LPVA 1IM3B 4NC1C 2CUIA 4JFZH 4NWTL 2WQRA 3O3BB 4JFXB 2DI8A 5ANMA 1WUNT 4N1HB 4PDCE 3BHBB 4A6YB 3DOSA 2WNGA 4X5LA 5IB1A 4NQEE 5E08L 3DX8A 3FQRA 1OAYH 4W68A 4F7TB 1NQBA 3DVFA 4IDJH 4PS4L 3MLZH 5ILTL 4O51B 1YPZA 2AKRB 3HCVB 4OI7A 2YPVH 3HE7C 3MXVH 3V7MA 1A7RH 1AXSB 4LLMA 5C1MB 4FFEX 3PHOB 4X6EA 3O2WH 5ANMB 2ZKHL 5DD6A 1HKFA 4PJHA 5IB1B 1TDQA 3DX8B 1YUHA 3FQRB 4RA3A 5TQ2L 1CXLA 4HWBH 3ET9F 5F7DA 5HPOA 3K8MA 1YPZB 5B8CA 1FVDA 3T0AA 4OCXH 1YYLH 2R2CA 4X4XA 5DMGD 2ATKA 1H3TA 1CIDA 3TT3L 1OTSC 1UM6L 2YXMA 4X6EB 4MQXC 5DD6B 1PLGH 3VXNA 1YEKH 3TLRA 4Z7OE 3QH3A 1YUHB 2G9HA 5J13C 1PKQE 4R4ND 5I30H 5F7DB 3B2VH 2NY6B 3CK0L 4LSUH 5EA0H 5B8CB 1FVDB 2VR5A 1XGPB 4X4XB 2ATKB 3OAUL 1MJ7L 1LO0H 2NY3B 1F4YH 1OSPL 3P3YA 3JVGA 4EUPH 1W2KT 3VXNB 1ZLVH 3N1QC 3IKCA 3QH3B 2QQNL 3ARGC 2G9HB 3SDXA 2IPKA 4LCYA 2JCCE 3SOBH 3SKJH 4XCYA 3PGCA 1J12A 2WAHA 3CVHH 2MWCA 4KC3B 4OF3A 1JNLH 1Q1JH 3IKCB 3T3ME 4HLZG 3SDXB 2IPKB 2Z8RA 5T1DL 2FGZA 4LCYB 4FQHA 1P84J 4XCYB 3PGCB 3KYOA 2CO6B 1RI8A 1J5OH 4GKSA 5CGMA 4HFWA 5HI3C 2DBJA 3SE9L 4DN3H 1UWXK 4ZTOH 4X7DC 2P5WA 3OKDA 4NSKA 3D3VD 1YNKH 4P2CG 3P11H 4JM2C 1RZGA 4FQHB 4RFEA 2AJZA 1T1WA 1GAFH 2VN4A 1INDH 3HRPA 3KYOB 5D5ME 4ZD3H 2C7UA 4NWUL 4GKSB 2JB6A 4JFDD 4HFWB 5HI4C 4R7DA 3FFCE 3OHXA 2WWMC 4Q9BA 4YWGL 2VLRD 4NDMA 2ZUQC 2P5WB 3OKDB 4NSKB 4F80A 1F3DJ 3ULVD 4KJQD 4IRSC 3CIQA 1KLFA 1RZGB 4QXGH 2AJZB 4RFEB 1T1WB 1BVZA 2BDNH 3V4PH 4E41E 1R0AL 4GS7B 2XTJE 3LEYH 2C7UB 1FBIH 4Q0XL 2MPAL 2JB6B 2DYPA 4HF5L 2EDXA 2H2PC 1FLTX 4R7DB 1TJGL 2AJVL 1C5BH 3OHXB 4LSDA 2F5AL 3ARQA 4OFKA 4NDMB 2X44D 5GGVY 4YIQB 1CDUA 5I18L 1XGYH 4QRUA 5FHBL 5HHMA 3S97C 3DV4A 3QDGD 5J3HC 4M7ZC 1KCRH 4K94H 2H32A 2H2SC 1S7XA 5BO1H 4TPRL 1FAKT 2K9UA 3KPLA 1LP9F 2VIRA 3QXWA 4XCFH 1UADC 1MCWM 3S3PA 3DHMA 3IS1X 1LO2L 5HHMB 3DV4B 1OD9A 3BISA 3N9GH 2B1AL 3O6FC 2W91A 4LVNB 2H32B 1S7XB 2RBLA 1CXIA 4KXZH 4U1JA 2XI9A 5GGQL 3KPLB 2VIRB 5BQ7A 3BPLC 3NFNA 3ZTJG 2FBJL 2F19H 1KB5L 4XP9H 4I3GA 5IF0A 5KANI 1Z0NA 1P6FA 4D9QE 4OTXH 4ETQA 1UT9A 2NX5A 1QG3A 1U8MA 2A6IA 4U1JB 4WO4A 2FECL 4KDTA 3VMPA 5BQ7B 4KQ4L 4L1HA 1XZ0A 4Y2OA 5ICXA 5IF0B 4NYLA 4ZYKA 5BCAA 3MO1A 3NABL 4ETQB 2AJYH 4KY1L 5IGXH 1SY6A 4M8QA 4OCNC 2NX5B 5A2KH 1U8MB 4WO4B 3R8QA 4D9LL 3DBXA 1CL7L 5DGQA 1GGTA 5BS0D 3N1MC 4Z7WA 1XZ0B 2XZCH 4HUMB 5ICXB 4Z8FL 1MOEA 4NYLB 4ZYKB 3MO1B 3O6LH 1P5UA 3STLA 1NCNA 2CGRL 4NBXB 1EPFA 2VLKE 2Z93A 4XXCA 4M8QB 1CLOL 5JPNA 4U2YA 3I2CH 1NCBH 1F4XH 1HINL 3DBXB 5DD0L 1J0IA 1AGCA 3DJ9A 2EEDA 1AO7D 2DI9A 1JWMA 3P4OA 5FO7A 4Z7WB 1EO8L 3O4LA 4CADA 2FIRT 3STLB 1M7DA 4PBVC 2Z93B 1IEBA 3NIFF 5JPNB 4G42A 4FG6C 4EI5A 4P5TC 3OKYA 3BE1H 1RZJL 1I1YA 1AGCB 1JWMB 3P4OB 4LLUA 5FO7B 4AEHH 3O4LB 2VQTA 3SDAA 4Y0GA 4CADB 2FATH 3QG6A 1M7DB 5E8NB 3GB7A 5GHWH 1IEBB 5CP7A 4G42B 3RJQB 2EDLA 1EHXA 4EI5B 3JTTA 1I1YB 2X89D 3C2SA 1N5YL 4Z78A 4LLUB 1SVCP 1MY7A 4OKVA 1KELH 3SDAB 4F7PA 5ECJE 5C0IA 5JDSA 1IQWH 3QG6B 5DA0B 3GB7B 4RQQA 1LD9A 3VD4A 2CR6A 5CP7B 2Q1EA 2VXQL 4MNGE 1UCBH 3BKMH 1DFBL 3PGFH 3NIGF 3JTTB 5ISZD 1UEYA 2VXSL 4LAJH 1DUZA 3TWCH 4Z78B 1JZ7A 4KK9C 4WFGD 4MX7A 4NKIL 4OKVB 5ACZA 4F7PB 4IMKA 1RULL 4PJ5E 5HVWA 2FX7H 5JDSB 5IEKA 1MJ8L 2Q76B 4RQQB 3RX5A 1LD9B 5JO5B 4WUUE 3AU1A 3GSQA 1KB9K 3MLVH 5EIIA 4LF3A 1AY1H 4MHHI 5CJOH 4MD4A 3QUZC 3ZKNC 3KNBA 4G6ML 2CD0A 3DV6A 1BM3H 4MX7B 5ACZB 1CVRA 3OKOB 2XZQL 3U7WH 5I74C 1FPTL 1YEFL 5IEKB 3SDCC 1HOCA 1NAML 2A73A 3X3GH 1A7BA 5KN5A 3AU1B 3GSQB 3RKDD 2VDRH 3UYPA 3UTTA 3OL2A 2MFNA 4GQ9L 4PLOB 1MQKL 3CMGA 4LF3B 2IQ9H 5EIIB 5ETUA 1CD1A 3K3QA 3T0EE 4MD4B 1F6AA 2EEAA 3KNBB 2FX8H 2I5YH 3DV6B 1EEYB 2HT3C 4UV4H 2V17H 5IVXF 3TN0A 4TSAL 4WGVB 5IHBA 2B2XH 1HOCB 3PWUA 4ZUVA 3QCVL 4N0CC 1JHTB 3C8DA 5KN5B 3UBXB 4HUVB 4UAOB 4C56A 3F7RA 4RMVA 3TT1L 3UTTB 1PBYA 1O0VA 5IT2H 5CJ5A 5ETUB 1CD1B 2JELH 1WC7B 4AZ8A 4ODVH 3S88H 4GBXA 4DWHA 3OMZA 3PWUB 3QEUB 1IC4L 5I75B 1KXVC 4XRCA 4ZG1A 1OARH 5BV7H 3HFMH 1L0XA 4C56B 1NUNB 4KI5D 1CIUA 2DQGH 1M71A 4EOWH 2DJ4A 2OCFD 1DN0A 4Y2DD 5CJXC 5LBSH 1FYTA 5E6ZA 4GBXB 5B39A 3C5SA 2CR3A 1UZ8B 4XRCB 3STZA 1ITBB 2K3TA 4NQCE 3U7AA 1OTUC 3A67H 4LLQA 2BXYA 4L9LC 1M71B 4F7MA 1TMCA 3RGHA 5SWSE 1V05A 3WE6A 5B39B 3C5SB 3SBWC 4MVBD 4NP4L 1IC5L 4P2YA 3STZB 1QBML 4XPFL 1DBKL 2K7PA 4LLQB 2H45A 1GHFL 5FUZH 2P7TA 4JDTH 4F7MB 1TMCB 1U8JA 4Z7VE 5JIKA 3V52H 3G9AB 3RU8L 3K0WA 3WE6B 3IJSA 4YBLB 3MA9H 4Y8DC 1VESA 2D03L 5F70A 5C08A 3PP3K 1E4JA 2E7HA 4HULB 3P9WB 5AYUH 3Q6GH 3S4SA 2FEEI 2R69H 1GRWA 4L8CA 3C60D 2KZ1B 2P7TB 2NY1D 1T1YA 3OX8A 5E2TL 1U8JB 3ARUA 4U6HA 4EQ2A 3IJSB 3NIDF 1REIA 5KSAA 4Y4HA 1U8IA 5C08B 3AFLA 3SJVD 1QSED 3S4SB 1WIPA 3TCLA 4L8CB 5L7XH 3ZE1E 4B5EA 2VKWA 3S37X 1LE5B 1TTFA 5IK3A 2B1HH 1U95A 1KG0A 1T1YB 3OX8B 1I1AD 1MFAL 5HHQA 1BZ9A 4U6HB 1N4XH 3CFBA 1SM3H 4I9WE 1PZ5A 2Z8SA 4MA7L 4OCSL 3DURA 1SQ2N 4Y4HB 1U8IB 2E9IA 5HGGS 1U8LA 4D0CA 3S3SA 3ULVE 5KVEH 3TCLB 4Y1AE 4N0UA 5IK3B 5HHQB 1U95B 1KG0B 1KEGL 5KAQF 5F1NA 1BZ9B 4HWEH 3TA3A 2IF7A 3CFBB 5C0ND 1PZ5B 1CWVA 4OF8A 1ZVHA 5BW7C 3DURB 3QEQA 4HUUA 4GSDL 1UA6H 1U8LB 4K23L 1VA9A 4MNQD 4N0UB 3ALPA 3DGGB 1MCJA 1U3ZA 5F1NB 3TA3B 1ZKAA 3G5XB 4WU5A 3C9NA 1G7MA 3QEQB 1CD0A 4HUUB 4OD1L 2VKXA 1NMCB 1XGUA 3T77A 4LSSH 4QHKI 2BRRL 4XPHL 5C07D 2WP3O 3SGDH 2M26A 5ICZA 1RZ7L 3QPQD 1T7VA 5FAAA 2QTEA 4ZOBA 2AK4D 3B8YA 5FYKD 4WU5B 3C9NB 5KZCD 1G7MB 4NKDA 3FT3A 3RP1A 3GKWH 1TFHA 1XGUB 4P9HL 3T77B 4JDZA 4GRWB 5BRZA 4UT9H 4YHZH 1QLEH 2DMBA 4HMCA 4JHBA 4Q6IC 1IARB 3FB5A 1WWCA 5ICZB 4XP6L 1OP3H 4NUGL 4JKLA 4P4KC 3BZ4A 3MCKA 4LCWA 3RQ3A 2XWTA 1G6RL 2NR6C 5F9WB 5TPWL 4JPWL 2VAJA 5TFSL 5DTFA 4NKDB 3FT3B 4NQDB 3D39A 1HHHB 4UB0H 1HHIA 4H8WH 4JDZB 4JQVA 5TE4L 5BRZB 1DQML 4ORZC 2JB5H 5EOTA 3FB5B 1MHCA 4J3WA 5CBAA 2UWEE 5I1GH 1H0DA 3QIWA 4Y4KD 3MXWH 3BZ4B 3MCKB 4K3EH 4JFZL 2PNDA 2XWTB 4LCWB 2BXZA 4U1KA 5DTFB 5HJ3A 3D39B 2FRGP 1HHIB 2DQHH 4KRPD 4JJHA 4IHOA 5F1IA 5BS0E 3RL2A 4CVZA 1OAYL 3S5LB 4S2SA 4KUZL 4IDJL 3MLZL 5EOTB 1MHCB 5CBAB 3EFDL 2YPVL 3MXVL 3T2QA 4EEEA 5HHOE 1H0DB 2PF6A 3QIWB 1A7RL 2W1NA 3VGAC 2LU3A 3I6LD 3FCTA 4PJFA 4U1KB 3WNNA 5HJ3B 2FJGA 3OR6A 2EECA 4RSVA 1JK8A 4IHOB 1T7XA 2LTQC 2R39A 1G7LA 1RIVH 4YFEA 4CVZB 4OD3H 1FC1A 4S2SB 4HWBL 4X7EC 2BY3A 2CQVA 1L0YA 5I6XC 5FYJH 1FO0A 1VKXA 1YYLL 3HNTL 3TFKA 4FQQA 2VSCA 4H1LA 3FCTB 1WZLA 4PJFB 1MI5E 4XMLL 1NGYA 1PLGL 2FJGB 3OR6B 1JK8B 5ITFA 3VWKB 1G7LB 2OR7A 4P5KA 1KSRA 4AL8H 5I30L 2WP3T 3B2VL 4LSUL 2BSRA 3RWJA 1FO0B 1VKXB 4EQ3A 2X1OA 1LO0L 3RHWK 1D5BA 4FQQB 4H1LB 2EZ0D 1NGYB 5ITFB 3DO7A 3TYGH 2Y5EA 3GMPB 4XNYH 1IILE 4P5KB 3OB8A 3B9KA 3Q6FA 3SOBL 1T03H 1R3HA 2BSRB 3H6JA 3MYJA 3RWJB 2DB8A 3SKJL 3ZYJA 4MDJA 1D5BB 3CVHL 2FB4H 2EDOA 1JNLL 3EOAA 2MOVA 2QL1A 3VU2A 1Q1JL 2OR9L 3DO7B 1WAAE 1VFOA 3TESA 3V79C 1WFTA 1T80A 1CXHA 4RCAA 4R97C 3WIHA 2D7PA 3C6LD 4LSQH 1OCWH 3B9KB 5DVMA 1PY9A 3KLDA 3Q6FB 1L8JA 1R3HB 3MYJB 2P8MA 1J5OL 1R3IL 4MDJB 2QKIA 3PWNA 4X99A 4M9PA 5CWSA 1H5BB 1I7TA 2OQJA 3EOAB 3OG4B 2PYEA 4FQ1H 4DN3L 3KJ6H 4RGMB 4ZTOL 2JKXA 3IRPX 3VFOA 1UACH 5IESH 3D0VA 2VLLB 1YNKL 4XPAH 3P11L 4JG1H 4JVWA 1IE5A 1GAFL 4WCYH 1INDL 3VFNA 4ZD3L 1KC5H 2P8MB 2QHRH 4JN1H 5CWSB 3PWNB 4X99B 1BFSA 4P57A 4HJGA 1I7TB 2OQJB 4LGRB 2PYEB 1OOAA 3WL9A 1A7PH 5GS1A 5LXGH 3VFOB 3J8F7 3D0VB 2WINA 4QXGL 5K93A 1I3UA 2BDNL 3LPFA 1E4XI 3V4PL 3VFNB 3LEYL 3LS5H 1FBIL 3S37H 4P57B 1AE6H 4HDIA 3ARFD 1T7ZA 4W6WB 1W8NA 2EKJA 2NY4C 5DGRA 1ETZB 1LQSR 3VXRD 1C5BL 3WL9B 1QSVA 4YEFA 4QHUA 3K4DA 1XGYL 1BIIA 4KRNA 2WINB 1CDYA 4DVRH 1G7PA 1QR1B 3TPKA 3NA9H 5HYSA 5GRWA 4K94L 4DFHA 4HDIB 2Q3ZA 5DJYA 4O2EA 4KI5E 5FYKU 5BO1L 2P45B 5GJTH 4XCFL 1AC0A 3UJIH 4GG6A 4QHUB 4HBCH 1BIIB 2EC9T 3V6ZA 4TUJA 1BECA 1CICA 3ARVA 3PDDA 1ZHKA 1G7PB 4ZNEE 5HYSB 4OIBA 2IANA 3S36X 3WUZA 3N9GL 4PLKC 5E2VH 1LMKA 5DJYB 4O2EB 3GSXA 1XCQA 5ESQA 1FRGH 1C7SA 4GG6B 1CE1H 1J88A 4WY7H 3A6BH 3RWCB 4JFHE 4TUJB 3V6ZB 4U1HA 3W82A 1CICB 2F19L 4PYGA 1ZHKB 4XP9L 5DK0A 1BQHG 1OP9A 3KPSE 5L6YH 4Y8AA 3MRBA 4OTXL 4MB3A 3L3HA 5C0FA 4WNQA 3NZ8A 3LKNA 2ZCKH 4GXUM 5FDYA 3GSXB 4M8VA 1XCQB 4X4ME 5ESQB 4HUXA 5MERA 2F54A 2HFTA 4LHUD 3ZHLA 5HDBE 3PXJA 4U1HB 2V5SA 3DX9A 3BH8A 5DK0B 1I3RA 3MRBB 4HJ0C 3L3HB 2AJYL 5C0FB 4WNQB 5E4IA 4YDLC 3NZ8B 5IGXL 3GBML 3LKNB 3LQAC 3BP6A 5AUMA 5ENWA 3HHRB 4X5WA 5F6IC 2R0WL 3UDWC 4HUXB 3TPUA 5D70H 2D7TL 2DTMH 5MERB 2F54B 1N2RA 4X0KB 4OQTH 3SE3C 2XQYG 2X7LA 3DX9B 3OKNA 2XZCL 3BH8B 1I3RB 2J88H 1I1FB 3AS2A 1A2YA 4OCRH 3SJVE 3BP6B 4TNWK 5AUMB 3B8SA 3I2CL 2V5MA 3M17A 5L2KE 2JF1A 3TPUB 1F4XL 3MV7D 1N2RB 2OS7A 3FO2A 5C71A 2CJUH 2X7LB 3OKNB 4ZXBA 2DWDA 3QDJE 4WI7A 5LGHH 2BJMH 1A2YB 1JPTH 4EIZC 1D6VH 3HZVA 1JBJA 3X14A 5JTWA 1BJ8A 3RFZC 5D6DA 3M17B 2KBGA 2VZ3A 5K9QI 4Y89A 3BE1L 1CD9B 3FO2B 1YN7A 1IC1A 3P2TA 4AEHL 5KSVA 2HVJA 4Q58C 2DWDB 4G80A 3D2UA 4ZXBB 43CAA 5B38G 4ZAKC 2FATL 4KTDH 4DEPC 5T5FL 1MFBH 2AEPL 3HZVB 3X14B 5KS9E 5EULV 1A3LH 4ELMA 5IQ9A 1QHPA 1MRCH 5KVGH 1YN7B 3KYMB 3ZKQD 2XA3A 1MHEA 4ODSH 5D96B 5KSVB 2HVJB 4G80B 3D2UB 1KELL 43CAB 4Q7DA 4J4PD 3RUGF 1IQWL 3VXPA 2W9LA 1QSFE 3QRFM 2UZXB 2ARWA 5T33H 3WFEH 2DI7A 2IH1A 4ELMF 5HTSA 5C07E 4ELMB 3ZZ1A 3BKML 5IQ9B 3PGFL 1JF1A 6CGTA 2ZG3A 2J5LB 3H9HB 4WU7A 2NY6D 3TWCL 1MHEB 5FYKE 4PRPD 2EXYD 4HG4J 4JZJC 2NY3D 3VXPB 4EJ1C 4S0UC 4P23A 3T08A 2I9LA 2IH1B 5AAWA 1OPGH 5ALBH 2APXA 1JF1B 3MLVL 1AHWA 4WU7B 1AY1L 5CJOL 5E6IC 1J05A 1BM3L 4JDVA 3VI3F 4HPYH 3U7WL 3NACH 1EVUA 2EDDA 4P23B 3SDDC 3X3GL 4KKAC 2I9LB 1IGCH 3G5YA 2AXJA 3QNZB 4PV9B 3AVEA 1I9IH 1FNHA 1AHWB 5SV4A 2IQ9L 5KTEH 1J05B 1KFAH 2FX8L 1OAZH 2I5YL 1ACZA 4UV4L 4JDVB 5EC2A 2V17L 1DR9A 4ZODA 4TNVK 3K1DA 3T3PE 4POZD 5GISL 2B2XL 5F3HA 2PW2A 5D8JH 3G5YB 3W0WA 3SKNA 5ESAB 3KJ4C 1NCTA 5IT2L 5JA9A 5GGUA 2JELL 4ODVL 3S88L 1JL8A 4Y19D 2XOTA 5EC2B 5EOQH 3KHQA 1FGNH 2HTLC 1NUFA 5F3HB 1KBGH 2PW2B 1D3CA 4AT6A 1OARL 2CLVA 4P2RE 5BV7L 1TNMA 3BUTA 4FFZH 4X7SH 3W0WB 2D7QA 2DQGL 3SKNB 1XGTB 1GZQA 5I17A 4EOWL 4PJ9C 2FHBA 2A6KA 2IFGA 5LBSL 2DN7A 5K9OA 2FD6H 1EUUA 1MCIA 3PG2A 2XA8H 4KAQH 3G6JE 4AT6B 2CLVB 3A67L 1GZQB 3MNWA 4ETYA 5I17B 4NNXA 5D7KD 1FN4A 5JHLH 2A6KB 3U46B 1X9QA 4TVPD 4IOFD 5K9OB 4X80H 4RGNB 1TNNA 4XP5H 4HKJA 1P4LA 4PJXE 5HBBA 1G9MH 1CZ8H 3MNWB 5EBMA 4NNXB 5FUZL 5CD5D 4JDTL 1FN4B 5E70A 1J7VR 5HHMD 4OZIE 3V52L 3BMWA 4P49A 4DJMA 4MGXA 4Z76A 4Z7UA 4IIQC 1IT9H 3MA9L 3CFCH 4RRPA 3RTQC 5IB2A 1LK3H 1IGJA 1BOGA 1P4LB 3Q6GL 4RDQG 2R69L 5EBMB 1T2JA 5FO8A 1WWAX 3CUPB 1KJ3H 3MGOA 5FUOH 1SBSH 4U0QB 4LP4A 3BI9X 3ELAT 5F7KC 5IB2B 5J12C 1IGJB 1BOGB 4J6RH 1BJMA 1A7OH 5L7XL 2YKLH 1AQDA 3U83A 4J3SA 2B1HL 1ZSDA 5HHVL 1X5JA 3V8OA 5D7IA 3JWOL 3U1SH 1N4XL 5FGCE 3MGOB 2L7JA 5SWZD 3V6BR 2P1YA 3ZE0F 2NX5D 3WXWH 1BBDH 4I2XE 4MLSA 2ADGB 4F9PA 1JTTA 5KVEL 1IAII 2PO6C 4HXAH 5DUBA 4ZFOL 4XWOC 3QXAA 1ZSDB 5D7IB 3T65A 4HWEL 5IROA 3U9UA 4OZFA 4ZFFA 4A6YH 2VTFA 2PCPA 2DAVA 2W0FA 3NFPB 3LPWA 1J8HA 1UA6L 4IRJD 1OAUH 1S78D 4LMQI 1I8KB 3IU3A 1Z9MA 2DF3A 5EU3A 2VYRE 2ZG2A 5DUBB 3T4YA 3QXAB 3JV4A 3T65B 4I3SH 3U9UB 4OZFB 4ZFFB 5C8JA 5KSUA 2PCPB 1R3LA 1BEYL 2W0FB 2ZUVA 1J8HB 4P4RA 1UFUA 4ZMAT 3IU3B 4LSSL 1YY8A 2YPKA 3LS4H 3QIUD 1Z5LA 3T4YB 4FQXA 3JV4B 5CCKL 2IPTH 4YAQA 1MNUH 3O4LD 2FEEL 2NY5C 5C8JB 5KSUB 1R3LB 3O2DH 5IJKC 3GKWL 4P4RB 3H0TA 4P46C 2E9JA 2ERJB 1YY8B 2YPKB 4UT9L 4EI5D 3EHBC 1B0WA 1FLRH 3O6KH 4YHPA 5F7MC 1QLEL 1Z5LB 4FQXB 4YAQB 1YC7A 4PJGF 3S3JA 4XP4H 1QVOA 1N64H 1BFOA 2Y23A 3H0TB 4UB0L 4H8WL 5DEGA 5J13B 4YHPB 1U0QA 4DGYH 3HMXH 3S35X 2JB5L 4P3DB 4ZPVA 5I1GL 3I84A 5FO9A 3MXWL 1QVOB 4K3EL 4PRIE 1HXYA 4JRXE 4OJFH 1BFOB 4TSCH 2E7CA 1FNGA 2DQHL 4NZJA 3RPKA 3PGDA 3EDKA 4PG2A 5EU6A 3AAZA 2Y36H 4Z7NE 1P7QD 3U30B 1QACA 3CSBA 3TJHC 3IAPA 4U31A 5EPMA 4ZPVB 2ED8A 4AIXA 2Y06H 5A43C 3LEXA 3Q1SH 1HXYB 1JHKH 5CS7A 2KDGA 4NFBA 1FNGB 2R2HA 3PGDB 3RIFK 2CRMA 2IEPA 5EU6B 3AAZB 1RIVL 3AROA 4OD3L 1FIEA 3DYMA 5EU7E 5GQBA 2X41A 4OZGF 4RWYL 3U79A 5EPMB 2QADC 4NO0A 5C70A 1M7XA 2VDLH 1F2XK 3LEXB 1HI6A 5L8KB 1OSZA 2R2HB 5K33A 4QRRA 2IPUK 1LVEA 2Y25A 2FJHA 4JM2F 2HJFA 1CDCA 4IRSA 4NQXA 4JM2B 4AL8L 1MF2H 4B7IA 3P77A 4NO0B 4TUOA 5ANME 3H7LA 4LBEA 1HI6B 3F12A 1OSZB 3TP4A 4C56D 2ZPKH 2ZUQB 4QRRB 1WLHA 3AUVA 3TYGL 2FJHB 4JO3H 1YPZE 2HJFB 4L4JA 4XNYL 3SEPA 5HPMB 2IQAA 4IRSB 4NQXB 4NZDA 1RHHA 2Q8AH 2J3SA 4Q2ZA 4R96A 2KH2B 1T03L 4TUOB 2BVYA 4JN2A 3P4LA 4LBEB 3WJJC 4APQA 3F12B 4PJHE 2FB4L 5FIEA 4YZFE 1HYSD 3EYVA 2YD9A 2ZJSH 2D31A 5DLML 4N5ED 1AIFB 1RZJC 2IQAB 4U1GC 1RHHB 1EERB 5JZ7D 4LSQL 4Q2ZB 1OCWL 1WIUA 4R96B 3WHE0 4K8RH 5DF0A 1MY5A 5M95B 3VE0A 2G60H 2CRZA 2B8OT 2RFXA 4JN2B 3O6FA 5JW4Q 4APQB 1L7IH 3EYVB 3H9ZA 4KJYA 2D31B 1VACA 4PJ7A 4KRMB 1QBAA 4FQ1L 3KJ6L 1NFDF 4JREB 4F8QA 2MKWA 1NFDB 5HHXH 1UACL 1FVEA 1QTYT 1DQDH 5IESL 4AG4H 2RCSL 1WZ1H 3RI5F 4JG1L 1DLFH 4OGAD 3QUXC 4WCYL 3VE0B 4WEBH 1X44A 3I9GL 3ZDYF 3O6FB 4JN1L 1DANT 4AEIH 5IOPA 4HC1H 5D1XC 1VACB 4PJ7B 3OPZL 3SDXE 1A7PL 4LRIA 4WTWA 1WEJH 5EORH 5JW5B 1FVEB 2B7DT 3NAAH 4YFDB 4UBDC 3EO0A 4LMQE 1JMZA 3LS5L 4M62L 4OLWH 3S37L 1JPFA 1E6JH 3WFZA 5IOPB 1AE6L 1GCFA 4K9EC 1NBZA 1A22B 1A4JB 43C9A 4X6CA 5FUCE 3O6MH 2NY0C 3F5WA 2ZWLT 3EO0B 3HE6C 4MXQC 4KDVA 4DVRL 2EDWA 4B0MM 3QCTH 1XIWC 4QNPE 4G6FD 1JPFB 1BWMA 5A40E 4HIJA 1NBZB 2NXYC 4HZLA 4OGXH 2P5WE 4WTZA 1ORQA 5GJTL 4X6CB 4CAGA 4MSWA 1VEOA 3UJIL 5CIPA 4HBCL 3VGBA 3LKQA 3WDJA 3F5WB 1XF2A 2QQLH 2UZIH 3WJLC 1Q9OA 4MAYA 4P2QA 5F72S 4HSQA 3RY6C 4Q9CA 5E2VL 4YPGA 2OM5A 4HIJB 3PABA 4HZLB 2LVCA 1ORQB 2HJKA 1G1CA 4R3SB 1FRGL 2O61B 5CIPB 1CE1L 4WY7L 3LKQB 4UT7H 1E0OB 3A6BL 1XF2B 3ROLA 3KPMA 5DQJA 3Q48A 1Q9OB 4MAYB 4P2QB 5L6YL 1E4KC 3IDUA 3QEQD 4TTDC 5EUOF 1X7QA 3ARDC 3PABB 2EDQA 3FO9A 5F8RC 4RMTA 2C4FU 5HHME 4U3HA 4IOSD 1FSKB 1BVLA 2VOTA 3KR3H 2HKFH 4KJWC 3ROLB 4LCIH 2YR3A 4WUKH 3BMVA 5DQJB 3FRPA 5FEBA 3U2SA 3HPLA 3FZUD 2Z31D 3R06A 3SCMC 1ZLUK 4BSVA 4V1DA 1X7QB 3FO9B 4GFTB 4EVNA 2VZOA 5CINH 4JZNA 5BVJA 5D70L 2DTML 1BVLB 1J11A 1CGWA 4OQTL 3KXFD 2NTFA 4GMSH 4IDLA 1F8TL 5BVPH 3QWOA 3U2SB 2J88L 3HPLB 3R06B 4UINH 4NQDD 2W0LA 1G0DA 1BJ1H 4OCRL 5JOPD 5SV3A 1RAMA 4BSVB 3D25A 4V1DB 3HI5H 4EVNB 2OJZH 1BP3B 3P73A 1EGJH 4PGDA 4JZNB 1XGQA 4URTB 3UROR 5BVJB 1PKOA 4JZOA 1NKOA 3KYKH 3ZTNH 2CJUL 2OXHA 2NTFB 1TQBB 4YEEA 4G8GA 3QWOB 5T1LD 4HJJH 2NX5E 3ZYOA 5LGHL 2BJML 1JPTL 5JIHA 4U1LA 1A47A 2R56H 3D39D 1D6VL 3D25B 4XI5D 3V0VB 1K8IA 3P73B 2K7QA 1XGQB 3QO0A 1RJCA 1UB5A 4HCRH 4OFVA 4WI2A 4JZOB 2RJMA 4LASH 3FQXB 4EN3A 5FYJD 3EJZC 5I74B 4KTDL 5B4MD 1MFBL 4U1LB 3KPPA 1K8IB 4KROB 2VLMD 1A3LL 2NPLX 4KK8D 3FOMA 4Z7WE 1MRCL 1UB5B 5KVGL 3V2AR 4N90D 5EZOH 4EN3B 4ODSL 5J4MA 3NCCB 4X4YB 3QIBC 3RDTA 4KHTH 2WQ8A 5T33L 3WFEL 3KPPB 5DZLA 1RY7B 3VWKD 4WFED 3MODH 4NM8H 1JNNH 3FOMB 3F7VA 5CJXA 1TZIB 3O4LE 2H9GA 1A14H 3HR5A 2CRYA 4YBQC 2PUQT 1TJHH 4JHWH 1R6VA 1G9EA 3ROOA 4G9FA 1KTRL 3RDTB 1ADQA 3MBEA 4NN7C 1MCPH 2F8XC 2Y07H 1UEMA 3VA2C 4MS8D 4DK6A 2FCBA 3VMNA 1V3KA 1MCNA 3M8OH 2A6JA 1OPGL 5ALBL 4OSUH 3RVWD 4KRLB 2H9GB 4NQSA 3HR5B 1QLRA 4LIQE 3CFEA 4OQ1A 1U2CA 2D9QB 4HPYL 3CFKA 4P2OA 3ROOB 4Y5XA 3BZDA 5A2FA 4G9FB 3NACL 1I8LC 3MBEB 2F8OA 2ICEA 3VRLF 2N4IA 5JORA 1H3VA 1IGCL 2A6JB 4XHJC 1L9NA 2ILLA 5CGTA 3O4OC 1I9IL 4KKCC 3B9KD 4TQEH 4E5XA 4G7YH 4NQSB 5KTEL 3BOVA 3GUTB 1QLRB 3FB7B 1KFAL 1OAZL 3CFEB 1BQUA 4JFEA 5HSFA 1S7QA 1EFQA 2X4TA 4P2OB 4Y5XB 3TC9A 3BQUD 2ICEB 4P9HC 4R2GC 3VRIA 1P69B 3U4AA 5JORB 5D8JL 1HN1A 4F7EA 3TH3T 2A9NL 2WBKA 4PJ8C 4LLWA 4ZUUA 4WI3A 4GQPH 4MCYA 4E5XB 5F3BA 4ODUA 1K8DA 4CL7A 4JFEB 5EOQL 1S7QB 2X4TB 5DEZA 1FGNL 1BIHA 2F74A 4CVXA 1UC6A 4FP8H 3VRIB 1KBGL 4YGVA 4F7EB 4FFZL 4X7SL 4JGMA 4C83A 4LLWB 2HLAA 4KK5D 3L3IA 1I75A 4ZUUB 2GTZA 3EOTH 4MCYB 2EYSA 4L4VA 5DFTA 4ODUB 1K8DB 2NYYC 2FD6L 3NZHH 2XA8L 4CVXB 2F74B 1ODAA 4WHYH 5SWQA 1AR1C 4KAQL 3UTTE 5KSBF 3T1FB 4C83B 4UZGA 1EAJA 2HLAB 3L3IB 3TO4A 3REVA 1KJ2H 2HN7A 4XH2A 2GTZB 2XTJC 2X4UA 1VEMA 1KXTB 3O45A 4LQ1A 5JHLL 4L4VB 2DOCA 4L3EA 3RNKA 4HMEA 5J1AA 1U42A 1J1XL 2WWKT 4AM0A 2DLGA 4C56E 2XG4A 5K59E 2BNUA 4S1RH 1CZ8L 4U7MA 3S36L 5D2NA 3TO4B 3REVB 2HN7B 5FGBA 2X4UB 4BQBA 3O45B 2CIIA 1ZLSH 3GI8H 4M48H 3TVMC 5HVHC 4L3EB 3RNKB 5J1AB 4AQ1B 3VFGH 1IT9L 3UYOD 2HT2D 5DJXA 5HYQA 3CFCL 1OHQA 4FFWC 5HHNA 25C8H 4PLJD 2BNUB 5E5UB 4Z18A 4HGMA 3HC4H 1FYTE 5D2NB 5FYLD 4OCWH 1AP2A 1HCFX 2CIIB 1JFMA 2X1WL 5F9AC 1E28A 1KJ3L 2QR0A 5FUOL 3F7YA 1SBSL 1PY4A 5DK3A 5DJXB 5HYQB 4ZDHA 3CFDA 5HHNB 1ORSA 3HA0A 5EG6C 1HWHB 4LCCA 1RPQA 2NLJA 3LD8C 4J6RL 1BQHA 3KGRA 2IH3A 1CFQA 2YKLL 1AP2B 4LEXH 3BEVA 4BFBD 4CKVX 1E28B 2QR0B 3F7YB 5FYJU 1DVFD 2R9HD 4XHQA 3CFDB 1ORSB 2GK2A 2EDTA 4LCCB 5IWLA 3WXWL 1BBDL 5D93C 2NLJB 1BQHB 3DSFH 3RVVC 1T5WA 2IH3B 3MCG1 1OD7A 1CFQB 3SPVA 2E8YA 4HXAL 4U3CA 3L6FA 4KTEL 5ICYA 4LSVH 1B2WH 3BEVB 5DFVD 4X6FB 5TE6H 5C08E 4A6YL 5DJZA 2JJSA 4CVUA 1OAUL 1HDMA 3EFFA 1T5WB 3UTOA 1JNHA 3SPVB 1RURH 1U3HD 3MV8D 2MTPA 3AXLB 3L6FB 4I1NB 1KCKA 1T22A 5ICYB 5D2LF 4I3SL 3SE4C 4FQCL 1BFTA 3K2UH 5DJZB 3W9DA 4XMKH 3SDYH 1F02I 4RISH 2PTTA 1OF2A 3EFFB 4HEME 5CZVH 1JNHB 4H20H 3LS4L 3KDMA 3IRZA 2HAZA 3OKMA 4FTVB 1VFMA 2G75A 1T22B 2IPTL 3RZCA 1MNUL 1UKSA 2E6PA 2X09A 3EYSH 1WV7T 4Z7QF 2WZPD 3TZVC 3O2DL 2V9QA 1HH9A 1UZ6E 2PTTB 5ACLA 4ZS7H 1YEHH 4XTRC 4N0UE 3TH4T 3O6KL 1FLRL 4UNVA 1FO0H 3KDMB 3OKMB 4J3OC 2G75B 2PXYC 5I6XB 4H1LH 3D2UD 3QEQE 4F15C 4K94C 4XP4L 1N64L 3DMMA 4L8DB 3MRGA 4ZS6C 3IDXH 4MD5B 3LV3A 4J3VA 4PGEB 1UJTA 1P6AB 4LAQH 2ED7A 3RA7H 2FJFA 5F6HJ 4DGYL 3OBAA 3HMXL 1WQVT 3KVQA 4HWNA 5CJQH 3UZVB 1IAIL 2AI0H 3P30H 3MRGB 3AS1A 1HNFA 4GRWE 4OJFL 4BSWA 4TSCL 3LV3B 2XKUA 1S3KH 3K74B 2Y36L 5BJTA 3DRQA 2FJFB 4P99A 4AIZA 1QP1A 2ZSWA 3WNOA 4LHUG 2A77L 3NCJH 5EO0A 1SJVA 2Y06L 1T0PB 3Q1SL 5EBGA 1JHKL 4M1GH 4BSWB 5BRZE 3WIHH 3L5XH 3KG5A 1DJSA 3O41A 4G8FA 3E2HC 2ZG1A 2H41A 3DRQB 5BJTB 3I3BA 4AIZB 4LCWE 2EE9A 2ZSWB 3QQ9D 2VDLL 4JFFA 5EO0B 3D39E 4K3DH 4MXVE 5T5NF 4PJAF 5JMRA 3UAJD 1NMAL 4YGAB 5FKAA 3O41B 3T0EC 4G8FB 4ODHL 5F88A 5D7LA 4IS6A 1MF2L 4YJZL 3BGMA 2H6PA 1HNGA 4JFFB 1FZJA 3EJYD 1D9KD 2VLME 3SHSA 5FKAB 12E8H 1U8PA 4RX4A 2QSTA 4JO3L 2Z0BA 1WWWX 5F88B 2AQ3A 5D7LB 2Q8AL 3HMWL 4IS6B 2HG5A 3QAZB 3WIIH 4ODWA 4PJFE 2H6PB 2J8OA 3OSKA 1S7UA 1FZJB 5F9OH 1CXEA 2NY4B 3A6OA 1WISA 4LOUD 4DZ8A 5DMYA 2J1KA 4XPGL 2P8PB 1MJUL 3QCUL 3V95A 4NZUL 2EDJA 5LAXA 5GGRY 3E1F1 5I19H 4ZO8A 4OBRA 4K8RL 2HG5B 5AWNH 2G60L 4ODWB 1X5IA 4G6AC 1S7UB 4RGND 1L7IL 1OWWA 4HIIA 4DZ8B 1MCKA 3WO3B 4JLRA 1S9VA 1U58A 1WT5C 4U6XA 5DUMH 5HHXL 5LAXB 3S6CA 1DQDL 4AG4L 1WZ1L 2W92A 1DLFL 2VC2H 4WEBL 1FFPA 1XR9A 5I1HL 4AEIL 2CK0H 4HC1L 4ERSH 3IS0X 3UEZA 4HIIB 2NQCA 3I3EA 1T83C 4JLRB 5DWUH 1S9VB 1U58B 1WEJL 3L7FA 4U6XB 4JO2H 2C26A 2BMKA 1INEH 3CNKA 1FFPB 3WLWD 5FA4B 4OLWL 1XR9B 4PRHA 3HR6A 1E6JL 2X05A 4RMRA 3VXUA 1P4IL 1OWRM 3MRPA 1FIGH 1R24A 3WIFA 5IB3B 2UUDK 2X4QA 3O6ML 4HW6A 1J0ZA 3SE3A 2M8XA 3U9PH 3VG0H 2BMKB 3GJFH 1SY6L 2MQ0A 3T09A 4XC3H 2PYEE 4DKDC 4PRHB 3QHZH 4WI6A 4OGXL 5F6IB 3VXUB 1JYWA 1JGEA 3BKCH 3IXAA 3MRPB 4LLVA 2EDKA 3KLAA 1WFOA 1F11A 1R24B 4R26H 3WIFB 2X4QB 1CN4A 3S7GA 4TOYH 2QQLL 4ZSOA 3MLXL 2UZIL 4JANA 3BEWA 2HLFD 1BX2B 1EA9C 2DLFH 2CLZA 4IJ3B 2O5YH 3PQYD 2OLDA 4S1DC 3C09C 1JGEB 3D3VA 2YRLA 5GRJH 2P24A 4LLVB 1T1XA 3KLAB 1F11B 2XV6B 4XP1H 2B20A 2MHAA 4L9DA 4UT7L 2MSPA 3H7BA 4ZSOB 3V6OA 5H8DA 1I1CA 4JANB 2J12B 3BEWB 1DBJH 4JFDA 3QR2A 3ALXA 1FFRA 2CLZB 2DM7A 1KACB 4I0PC 1S9XA 5BV7C 4KMQA 2VLRA 4UOW0 3DO3A 5EBLA 3D3VB 1RZFH 2P24B 4M6ML 1T1XB 5GGVH 3WFCH 2MHAB 3KR3L 3HE7D 1QFWI 3H7BB 2FWOA 2PR4H 3OJMB 4LCIL 4WUKL 3MJ9A 4HFUH 3ZKXC 4DEPB 1JZ4A 4JFDB 2A2QT 4MJ5B 1S9XB 4PJEA 2X4NA 1IM9D 3V0WH 1JN6A 2VLRB 3CDYA 4GG6E 5EBLB 1A64A 1TVHA 3VXOA 5CINL 5FYLE 5SX4I 3RVTC 4DN4H 4WWKC 5J7CC 2FWOB 3QDGA 4N5UA 4JZJA 4X4ZA 5IW1B 2IANE 1OTSD 4GMSL 1X6NA 4OGZA 1MH5B 4FZEH 4PJEF 2D2OA 3GHEH 4MQXD 4UINL 4PJEB 3C6SB 2X4NB 4N9GA 1JN6B 4OKDA 3HI5L 1NCCH 3MLTA 3OG6B 1AQKH 1F3JA 2IAMC 1TVHB 2OJZL 3VXOB 2A38A 1EGJL 2ZSVA 4WW2C 3KYKL 3ZTNL 5IB5A 3QDGB 1DL7H 4JZJB 1WBXB 3PWPD 4HJJL 1U9KA 2WBJC 4GMTH 3SDDA 4OLEA 2R56L 4N9GB 3TO2A 2E9BA 3RGVC 2F54E 3ARGD 3D85D 3MLTB 1F3JB 4RAVA 2ZSVB 4HCRL 4H0HB 1A6PA 4LLDA 3MACH 4LASL 5IB5B 1P7KA 2I26N 4U0RC 3SDDB 4RA0C 2CH8A 5F93C 3KPNA 3TO2B 3TPUE 1K5NA 1QUNA 1YA5A 5J1TC 5EU6D 4RAVB 1EX0A 3LY6A 1HILA 4JO1H 3JWOC 1EHNA 4HLZH 2ZOKA 5I0ZA 5EZOL 5FM4A 4KMLB 1JGVH 1HYRC 1JRHI 3OJVC 3KLHC 2YRPA 1F13A 4KHTL 2R0KH 5I1CH 3GIVB 3KPNB 1KJMA 3MODL 2RHEA 4NM8L 3BESR 1JNNL 4JM2D 1HILB 4AQOA 1T4KA 2ZOKB 1A14L 4YXLH 2AW2A 4NO0D 5DQ9A 5SX4H 5T3XH 4X6DA 4JHWL 1NKRA 5HI4D 2RQ8A 5IFAH 1MCPL 2Y07L 5I1JL 2WWMD 5I71C 1KJMB 3GRWA 2X9XA 4YHYC 3M8OL 1OQOA 2ENSA 2A6DA 4JQXC 4OSUL 1AO7A 4IRSD 2B5IC 5AEAA 1T4KB 2PN5A 2QBWA 1QQDA 1IKFL 2NXZC 4X6DF 5DQ9B 1NGPH 4X6DB 1I7RA 1JI2A 3UC0H 4GRLC 2H2PD 2HFGH 2P44B 5J8OA 4ELME 2A6DB 1AO7B 1S5IH 4NGHL 1ZTXL 1TETH 1R5WA 1PAMA 1QQDB 3UJJL 3ARBC 4G7YL 4NWTH 4OFIA 4M3JA 1NCWH 4IIQA 5J3HD 5EO1A 3RTQA 2EO9A 1I7RB 2H2SD 4YHNB 4QLRA 2P42B 3MLRH 4V2BA 3VFVA 5C0CD 2VSDA 4MJID 3ILPA 1DBBH 5BOZG 1R5WB 5LWYH 1Q38A 5F89A 5DR5L 4IIQB 1RZIA 5MEND 1DLHA 5EO1B 3O6FD 2OTWA 3RTQB 5D4QA 3WNMA 4FP8L 4H8WC 1KOAA 1AD0B 4KGLA 5ISZA 4XWGH 3VFVB 2OMBA 3ILPB 1RUQH 3EOTL 5F89B 2GK0A 3ZTJH 1RZIB 3RKDC 1MUJA 1DLHB 3NZHL 2OTWB 1FG9C 3LN5A 2GIYA 1C5DB 5J12B 3SKUD 3O3AA 5ISZB 1MCCA 1HEZA 1EVTC 3O0RH 5FCSH 1MLBA 3O8XC 3QQNA 1OSPH 3E6FA 2GK0B 4L1DA 1MUJB 4M93B 3LN5B 3W0WE 5IVZA 4UDTA 5GS2D 3ARYA 3O3AB 2EH8H 1HEZB 3PE9A 1B88A 3UBXG 1MLBB 3P4MA 1S5HA 1ZLSL 3GI8L 3HUJF 4M48L 3WS6C 3E6FB 4HUWB 2R0LH 5T3XE 2X9YA 3VFGL 2DQEH 2R4RH 3PDGA 3HN3A 5IVZB 2FL5A 25C8L 4U4BA 4I8DA 2J8UA 1HHKA 3HC4L 5I66A 1JTPA 4WI9A 4XNMB 1WITA 4OCWL 3ZT5A 3P4MB 1S5HB 3WCYA 4NHCH 1BQLH 1FFOA 2DQDH 3V5DA 1GSMA 2P5EA 1YEIH 4BM7A 5IJKA 3QUMH 2VISA 1LDPH 3VFTA 1N6QH 1KCLA 4FG6D 4P5TD 1HHKB 1Y18A 4OB5H 4Y2DA 5I66B 1G7JA 4OZHA 2FR4A 4NWUH 4LEXL 5FOBA 1FFOB 4K3JL 3S9DB 3V5DB 2P5EB 4PJBA 3OXRB 3UXFA 1BQSA 2VISB 3LZFH 4KDWA 5B39G 2O5XH 3VFTB 4Y16C 1NANI 4FRWA 3QDHA 3CCHA 2JIXD 3DSFL 1Y18B 3SGEI 4Y2DB 4I13B 1A6VH 4OZHF 1R0AH 5C0AA 3GZKA 1LDSA 4Z7UE 1G7JB 4OZHB 2FR4B 4LSVL 1B2WL 5FOBB 2NY5H 5TE6L 4PJBB 2F5AH 3S96B 4V1DD 5CHNA 5I18H 5CEZE 4G8IA 4PIRF 3RY4A 1RURL 4MCZA 4KK9D 5C0AB 4MD0A 2FLBT 4FQJH 3SE8H 4X7CC 4LEOA 4PB9H 1VEPA 3IFPA 3K2UL 3FONA 5KG9A 4XMKL 1T6VN 1WJ3A 2VH5H 2VZTA 5CHNB 4RISL 5AG9A 4MWFA 1B9ZA 2JJTC 5INDA 4G8IB 4H20L 5D7IE 2AXGA 3QUZD 4MCZB 5TQ0H 3ZKND 4YDKH 1EV2E 1FH5H 4LEOB 2B1AH 3BSZH 3SDCD 2VZSA 1D5MA 3EYSL 3IFPB 3FONB 1FFQA 5KG9B 3OTTA 4NC2B 3ZYZA 1QSEA 3QXVA 4YHIA 4MWFB 1YEHL 5B22A 5E2UL 5INDB 1KB5H 1VFUA 2AXGB 1FO0L 2HT3D 3QO1A 4QHMA 2E6QA 1J0KA 2D7NA 1D5MB 5TF1H 5DHVH 1J8HE 4N0CD 3IFLH 3IDXL 2GAZA 2HT4C 1T7WA 3H42H 4P3WA 5EIQA 4YHIB 3JWDH 1IGYA 4LAQL 1Q9LA 5E8DH 4PB0L 2W9DH 3RA7L 5D7SL 4F37F 3BPCA 3QO1B 2XNAA 5CJQL 4QHMB 2VXTH 3QUYC 3ZE2E 4CNIA 2GY5A 2AI0L 3P30L 3ULUE 1L6XA 2GAZB 4U6TA 2CSPA 1VCAA 3GSWB 4MNQA 4OM1H 1S3KL 2OI9C 1Q9LB 4HWZB 1SJXA 2ID5A 4TUKH 5C9KA 3BPCB 2CUHA 2XNAB 4CNIB 3NTCL 1N7MH 1KLGA 3QXDA 3NCJL 3H9YA 3NFSH 1MCQA 4LPCA 1OTUD 4M1GL 3BD5A 3WIHL 3L5XL 4MNQB 4FA8A 5KVDH 2AEWA 2FNBA 5GSRA 2UY6A 3QUXA 4NCDA 2AK4A 3D87B 2EXWC 5CGYC 5JOEA 1JI1A 1OAXH 4K3DL 3ECBA 1II4E 5D1XA 1AFVH 1AXIB 4Z77A 4XNXH 2BNRD 4OLUL 5MP6H 5IQ7H 3QG7H 4RFOL 5GSRB 1S9WA 4ALAH 4ODXA 1YJDH 3QUXB 2AK4B 1CFBA 4JKWA 4JFED 3SO5A 5KZCB 5F7LB 4KRPC 4ZO9A 3ECBB 5D1XB 4GXUN 1UB6A 5EU6E 4IBLT 2XKNA 4Z77B 2ORBH 4CDHA 2YD8A 4AK1A 1S9WB 1T66C 3D18A 4ODXB 4MXQA 4Y4KA 1T04A 1P7HL 5I9QC 3S5LG 2KUTA 3ZDXF 3WIIL 3B9VA 5F9OL 4DW2H 2VXQH 3EYFA 1D6EA 3I6GA 2ADIB 1UB6B 2HVKA 4ZQKA 2XKNB 1U2HA 1P2CA 2EDBA 2HFEA 3EOBA 2VXSH 3BH9A 5HDQL 2NY0B 3OKKA 3HE6B 4DQOH 3D18B 3WJLA 5I19L 4L4VD 5K9KA 3BRDA 4Y4KB 3BWUC 3PDOA 1J87A 5AWNL 1XIWB 3CDGB 4X6BA 1HKLL 1X4YA 3ESUF 3EYFB 3FHAA 3KLSA 4K9EH 4QRRE 3JTCA 2NXYB 3I6GB 2HVKB 1QSZA 2YXFA 5DRXA 1P2CB 2HFEB 3EOBB 3BH9B 3L5HA 4G6MH 3Q5OA 4HIEA 3OKKB 5EFIA 1CBVL 4ZNCD 2XZQH 5K9KB 5HI5C 4L3ED 4HXBH 1NFIA 3PDOB 1YMHB 1E4KA 3FFDA 2VC2L 4J7RA 4X6BB 4JAMA 2CK0L 4FQIH 2Q8BH 3L3KA 1IAOA 4ERSL 5DRXB 1NH6A 3WYRA 5IV2A 2NW3B 1U3YA 5DWUL 4O2CA 4KPHL 4JO2L 5EFIB 4TSAH 1INEL 1NFIB 2BSED 3DX7A 3FFDB 1VGKA 3MRCA 1J1OH 1U3JA 3D9AH 1BVKA 4JAMB 2AQ1A 1KENH 3L3KB 1IAOB 3FN9A 5DJ2A 5IV2B 3VG9C 3IDJA 5BZDA 3GMOA 1FIGL 4O2CB 1JZ5A 5BZWA 5D1ZC 1G9NH 4XBGA 3U9PL 3VG0L 1GIGH 5GJSH 3F62A 1DQTA 3DX7B 1VGKB 3MRCB 3S34L 3SCMB 1NCDH 1BVKB 4XC3L 4PJ7E 3QHZL 4RNRA 4ELKA 3RVXC 3VGFA 3BKCL 5DJ2B 3IDJB 5BZDB 3GMOB 5BZWB 4QHNA 3QA3A 2CDGA 4TOYL 4QXWA 4P4KD 3UPCA 2NR6D 4QHLA 4LNVA 3EYOA 2DLFL 3HAEA 2O5YL 4OLZL 4PP1C 4RNRB 4JCMA 5JPMA 4ELKB 2MJWA 4Y4FC 5GRJL 3MLSL 1U41A 4QHNB 1UM5H 5J1SC 3QA3B 2CDGB 4NP4H 1XF1A 1ACYH 4QHLB 1IC7H 3EYOB 4Y5YC 4GOSA 3HAEB 1QBMH 4U6YA 1XR8A 1OLLA 1D5XA 4X6CE 5JPMB 5ADOH 1GHFH 1QPXA 5C0JA 3OAZH 5HGBA 1RZFL 4XCCL 2DIJA 1ZA3A 3BDBA 5GGVL 4FTVD 3WFCL 1MFCH 5CEYA 1G0YR 1AKJD 4N0YL 1UJ3C 4KV5E 4HFUL 4I18A 3ARFA 5GGRA 1ZXQA 4U6YB 1XR8B 1GPOH 3VXRA 1WVZA 4NN5B 3V0WL 2APTA 3CFJA 5C0JB 5HGBB 1F90L 5EDXA 1ZA3B 2F53A 2XTLA 4TRPH 4DN4L 4P2QE 1X5LA 4J23A 3C5ZC 4JG0L 3GBNH 3GMMA 3QT2A 3TBYA 4I18B 3ARFB 5GGRB 4FZEL 2ENYA 3GHEL 3D5OF 4PJIA 1J1PH 3VXRB 2HA1A 5HYSG 1I8IA 2CLRA 3CFJB 1AQKL 2CUMA 3MRRA 4X98A 3VFWA 5T3ZD 2F53B 1K4CA 1DL7L 1IFHH 3EO1A 3GMMB 4UQ3B 4Z7OF 1IVLA 2BNQA 3TBYB 2FLRT 1NBYB 4NN7B 2XACC 4M6AA 1PQZA 4LKCA 1OW0A 1QRNA 1RIHH 4GMTL 4RWHA 4PJIB 5L8JB 3RL1A 1I8IB 4YK4C 3CX5K 3CGTA 5DC0A 3MRRB 4X98B 3VFWB 1FE8H 1J0HA 1WBYA 2VDKH 3VXQA 2VWEE 4CMHC 3WXVH 3MACL 1K4CB 3QFJA 5I76A 3C8KA 1H3UA 3EO1B 2BNQB 3BJ91 1RUAH 4V1DE 2UZYB 4LKCB 4JFQA 1QRNB 2YWYA 1BAFH 2YS4A 2O5ZH 3RL1B 2JCCF 3FTGA 1OAQH 4LHUA 2VDQH 1EEZA 3K2MC 4MQTB 4JO1L 1WBYB 2X4PA 3VXQB 3EZ8A 3QHTC 1G6RA 4G3YH 2EIDA 3QFJB 5I76B 1JGVL 3C8KB 2XXMB 2X70A 3T3MF 3V5KA 4PD4J 3IT8D 1NDGA 1QFWL 1AXTH 4R2GB 4F9LC 2R0KL 1EK3A 2D4DA 3FTGB 3JTSB 3NCMA 4JFYA 4LHUB 5EU7C 4UTAL 1EEZB 3PL6A 1WBZB 5FFLA 5HYJA 4LNRA 1BJ1J 4G8GE 2X4PB 1G6RB 1ZT1A 4YXLL 4BZYA 3LRSA 5T3XL 3T0BA 2VERN 2MMXA 4Q9RH 2X70B 3V5KB 4ENEC 4P59L 1NDGB 3M1BA 2C1PA 5IFAL 3IKKA 5JW4R 2C9AA 1PG7W 1RSFA 3DUSA 3MV7A 4JFYB 2QSCH 1X4ZA 5D5MF 3PL6B 5CZXC 5HYJB 2X6MA 4LNRB 4OFYD 4QYOA 4GH7B 4F57H 1ZT1B 1QBBA 3WKNA 4JFXA 2XN9A 3LRSB 1NGPL 1SYSA 1OY3B 3EIFA 5CLWA 4YFLI 3H3KA 3BHBA 3QI9A 3UC0L 2NY4D 3M1BB 2C1PB 3OB0H 2YSSA 4HWBA 1ZGLP 1YQ2A 2GJ6A 3DUSB 3MV7B 4A2LA 5IBLC 1S5IL 1INQB 2CKBH 4AJ0A 1TETL 4QYOB 3F7QA 1AXSA 3VDBA 3QWQB 1NCWL 2XN9B 3PHOA 1SYSB 4OV6F 3QI9B 1CTNA 2YA1A 2Q20A 3JV0A 2BVPA 4JRYD 4OT1H 2YSSB 4UIKH 2VUOA 2N7AA 3CAFA 5TDNA 4KUZH 2GJ6B 2VZUA 1U92A 3MLRL 2NY3C 3MOAH 3EFDH 2XICA 1DBBL 4HH9A 4N0RA 3TVMB 5LWYL 4J4PA 4EI6A 4G9FE 3MRHB 5SX5K 2C1OA 4PLKD 3HG1A 3VFPA 2BVPB 2OSLA 2PW1B 4LDOB 4W4OC 5TDNB 1FNSL 2GT9A 3BGAA 4XWGL 1U92B 4YXHH 3EBAA 4JGUA 1RUQL 4PRPA 3GBLA 1XGPA 4HH9B 1VFAA 3HNTH 3CVHA 4EI6B 1X6LA 3KAAA 2C1OB 4XMLH 1YEDA 3FL7A 5DA4A 4EUPB 3HG1B 3VFPB 2OSLB 5JQ6H 1X5KA 3NVQA 3B2UC 1YNTA 3IFNL 2A0LC 1TCRA 1FG2A 4U2ZA 3LDBC 1EEQA 1ZA6A 2GT9B 3D69A 3O0RL 3FHQA 4PRPB 4JFEE 1VFAB 3CVHB 4HJ0D 3GJEA 1YEDB 4PRHD 2HRPH 2CO7B 4OLVH 1IEAA 1YNTB 5GRZA 1WF5A 3VXUD 1TCRB 1FG2B 1GGBH 1ZA6B 2OYPA 2EH8L 3D69B 1CLCA 2IGFH 1OT1A 1ZK9A 5IR1A 4LU5L 3VH8G 5HHPA 4HKXA 1C1EH 3OAYH 3GJEB 5TE7H 2R0LL 4XAKD 2VL4A 4ZOEA 1KNOA 2I9TA 2DQEL 2R4RL 3ARTA 4G8EB 1D5ZA 2OR9H 1IEAB 2ARJQ 4M43H 1KGCD 3DIFA 2LAAA 4GS7C 5CP3H 1FV1A 3LB6C 4L4VE 3VW3H 4Y19A 5IR1B 1R3IH 1JGDA 4NHCL 1BQLL 2DQDL 5HHPB 4HKXB 2J6EA 1UXWA 3TZVA 1KNOB 2I9TB 1YEIL 3ULUL 3QUML 1D5ZB 1LDPL 3WKMH 2X1XR 5JXAH 1UM4H 1N6QL 1JV5A 1I3GH 1K2DA 2VR9A 3DIFB 4OF6A 1K6QL 5M7QA 1FV1B 5CSZA 4OB5L 1BPVA 4L3EE 3VXTA 4Y19B 4PPTA 1JGDB 1TCMA 4Z