4HWZA

Structure of hla-a68 complexed with an hiv derived peptide
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the differential classification of HLA-A*6802 and HLA-A*6801 into the A2 and A3 supertypes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-68 alpha chain
total genus 80
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hwzA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4hwzA01
1XR9B 4LPTA 2OMBA 4OFYD 4P2RB 3GFUA 4LPCA 5GRXG 1LD9B 3S6CA 3OGOE 4P5KA 2F54D 1DVFA 2R56H 1IEAB 4ZO7A 4UTBH 4AMKL 3BGMB 1UM6L 4HJGA 1I8MA 5KZCB 2Q7NA 1EPFA 2IMNA 5BVJB 5DXWA 1YNLL 4KI5C 4YIQA 3CLFH 4BZ2H 3OZ9H 1N7ML 3ZYJA 3DRQA 1HQ4A 3BHBB 4POUB 1XH3B 1PKQA 4QXUH 3TVMC 1NH6A 4WFHD 1GAFL 4DAGH 1RSFA 2X44D 2DQJH 3QISA 4OF0A 4KJQD 1WTLA 3TBYA 4KPHH 2P47B 3HNSL 5IESL 1QO3B 2O61A 1YMMB 4ZUUB 3Q48A 1GGCL 5K33A 1F4HA 3KJ4B 4YDVB 3IFNL 2F58L 3QXWA 2X4TA 3HZKA 3ESUF 1K3ZA 4X4MA 5DQJA 1TJHL 4J8RA 3EO1B 4YHNB 2DQDH 4TSCH 3B2VL 3WXWL 3O6FB 4LBEA 3MV8A 4G9FB 2XA8L 4PRPE 2RJMA 3ZDXE 3EO9H 4X9FA 4MD4A 3OAZH 4OZGB 4MXQC 3O8XB 4XMKL 1JTPA 3MXVH 4PGBB 5BRZA 2O26U 4JHAH 4H5SB 5CD3A 1G7PA 1HILA 3OJMB 1G1YA 4KK8C 5CHNA 1ZLSH 2Q6WA 3S5LA 1IJ9A 3UPAA 4YXKL 1DLFH 4ZFOA 1A4JB 1EO7A 5TDPA 1U3HA 4GW4B 1ED3B 2XQYG 3QDME 3FFDA 3UJTH 1ZGLB 1EERB 5CSZB 2MFNA 2DB8A 1FVDA 2D7TH 4HDIB 2QQNH 1A6WH 3D0LA 2RR3A 2WBKA 4UNTA 3W82A 5DDHA 5DK2A 3VGEA 3PGDA 4GKSA 5FCUH 2YPVH 3BWAB 4ZSOA 1IGFL 2EKJA 3PL6D 4OFKA 4DN3H 3PF2A 1IGIL 4JM2D 4WHCA 4ZNEA 1F8TH 4N8CH 2YUZA 3U4EA 3VA2C 4PRBA 2ZZUT 3U0PB 5BRZB 4KTDL 4LCWA 1H5BA 4LSUL 1I9IL 5D7SH 5IGXH 4YAQA 5A16B 5E7BA 3DBXA 5JNYB 4H1LH 3DV6A 5T5FL 2Q8BL 2GK2A 2ZSVA 3SDAC 3W0WD 3TVMA 2IFFL 2D03L 5FKAA 1OAZH 1P6FA 2ESVB 4K23H 1JMXA 2YS4A 3QPXL 1CFNB 1QHOA 3PXJA 4GS7B 4OKDA 5FFLA 4Z7QF 2CUHA 4YR6B 4YE4H 5C09E 1WBZB 2PYEA 4ZUUA 5DQDL 1CDCA 3MBEC 1T04B 3MR9A 1AHWB 3GO1H 4ZFOL 2ICEB 1UH2A 2UVEA 4PRNB 2X4OB 5HDQL 2I5YL 2XG4A 1NDGB 3FO2B 1EAPA 1RURH 5LCVL 3V7AE 3C6SB 1R3HB 1A21A 4EDXA 1MFCH 2CDGA 3D39B 3QCUL 12E8H 3BPNB 1JZ3A 1GSMA 1IL1A 1AQKL 2PXYD 1AY1H 2C3WA 4QXGH 4HEME 43CAB 5T3XE 5JORA 3FO1A 4UT9L 2AJVL 5CIPA 3U46A 2VWEE 3OX8B 4KAQH 3P2TA 5D8JH 3U7WL 1FZJB 1GC1L 1QLEH 4L4TA 1QSZA 3DSFH 3GSNH 3WEXB 1JNNH 2W9DL 4O5LL 5EU3A 3VXUD 4U1KB 4LOUC 3TCLB 1RHHB 2GJ6D 4G8IA 4TTDC 4XX1G 2X42A 5FM8A 5KBNC 2FD6H 4NBXB 1M7IB 1AE6H 1T22B 1ZTXL 4D3CH 3GIVB 4HK0B 4E41A 5SV3A 4FQHA 1UM5H 1B0WA 2CPCA 2AJZA 4IOIA 3H3PL 1RIHL 3BDYL 5H37H 5D1QD 2E27L 3GHEH 2EDOA 5IF0B 2GITA 2A1WL 3SCMB 1Q72H 1ZS8A 1AI1H 5DC9B 3OWEA 3UEZA 4HWBA 3RJQB 2UY7A 3X13A 3L3HA 1ODAA 5LQBL 1IGTB 2HJFB 4PJBB 5GS1C 3C6LB 4K3JL 35C8L 4QXTB 1QRKA 1UACL 2HG5A 4WNQB 5EIQA 5FO7A 5E0QA 3RVTD 4ZAKD 1JN6B 2XG5A 2NY2D 1KPVA 3GMQA 3I50H 4B50A 4HIIB 2PXYB 1ZGLP 4PJ8D 4JLRA 2RAMA 1TMCA 2NY1B 1FNSH 3ZKND 1BPVA 4JHWL 4PGBA 4J3XA 3VXOA 2VLME 4G42A 1TCRA 2GTZA 1MFAH 1DQJB 4JFQA 2YHGA 3SGJC 1UWEH 4Y5YB 5I1EL 5E2TL 3MRCA 4DKAA 2HRPL 4Z0XB 4LSTH 5F6IC 3QRFM 4EN3C 4RISH 2FSEB 3ARRA 4MJID 5DHXB 4OZIA 2QBWA 4N1HB 4UIKL 4PJDA 2NR6D 5I74B 1IC7H 5C08A 1IQDB 1WAAF 2QR0A 4N0CC 4WHYH 4ZD3H 2BSSA 1KTDA 1A3RH 3CDFA 1DL7H 4NZTL 1EO8L 1ZA3A 3NTCL 1VB9A 4JPWL 2B0SL 1T6WA 5HDBF 5D1XA 4L3EA 1QP1A 4N0YH 2QEJA 3S97C 2AV1A 3M45A 3MRIA 1SEQL 3C60B 3QDJD 4LOUD 4AT6A 5HGBB 5EU6E 4OB5H 1J11A 2G60L 3DTXB 1LVEA 3G9AB 4MA7H 1D3CA 2HJFA 2VC2L 2AGJH 5IJKC 4P4KA 1UENA 3RTQA 1JZ5A 2BY2A 1JWMB 5MI0C 1DSFL 5E8NB 1XZ0B 2Q8AH 3RVVC 4XNQB 4PREA 4MA8H 1F90L 4M5ZL 2FATL 4S1RL 4KQ3H 2N7AA 1T20B 4BFEA 3ILPA 3CFCH 2J3SA 2Z35B 4LIQL 1J9CT 4ELME 2JTDA 4NRYA 4TSBL 4XNYL 1HSBB 1U8PB 2YD9A 4FNLH 2NY6C 5KSAA 3RAJH 1UJ3C 1T3FA 3CVIH 4GRWF 3U7YH 3ZDZF 3EHBD 3T2OA 4I0PD 3RWIA 1BFSA 4JZOA 2GCYA 3VFMA 1CGWA 4J3VA 5IOPB 3DOSA 2Q7YA 3HS0B 4D94A 1FNFA 1WAAE 3GSXB 2CKBA 1UB5A 2FEDD 5DVOA 1DVFC 2Z4QA 4YBQD 4U1MA 3F8UB 1C5DB 4JQIH 4HKBA 2IPUG 3W0WA 4I3SH 4XP5H 2HTLD 2W65B 3L3JA 1F4AA 2ZUQC 1FAIL 3QO0B 5H2BB 3ARWA 4F7TB 3E3QE 4ZUSB 3BVNA 4I5BA 3LMJL 5D7LD 3RVUD 1KGCE 4PJCA 4Y4FD 3AM8C 4HF5L 5SX5H 1JRHL 1N26A 2W0FA 3PV6B 4F37K 5HHNA 2C5DC 3AMKA 4JM2C 3EOAB 1JF1A 1JWMA 3H6JA 1BAFH 2DQEL 2IQ9L 4HX1A 3EDEA 3WFCL 2GJ6E 2OR7A 1OHQA 2VUOA 4I48A 4G7YL 4YXHH 4JJ5B 2XICA 1W72H 3GNMH 3C9NB 3U4BL 2J5LC 4M5YH 4AT6B 3QI9C 5F9JB 1NGZA 3S35H 1ZE3C 3VXNA 5DJ8B 3BP5B 1V3KA 2KPNA 1DBJH 2GTWB 4JANB 2VTFA 1B2WL 2GSGB 4PJIB 3WNPA 1OB1A 1WK0A 1P9MA 4UTBL 1AXTH 4PLKD 5DEGB 5GGRA 4P2RD 1DBAH 4PRBB 1AGFA 1MPAH 2X4RA 2XZCL 4K71C 2RFXA 2Z91B 3SJVB 3I85A 1R3JA 4XHQA 2UWEE 4KKLC 1H9VA 4UV7H 4YBHA 5CEZH 3L3IB 4BJLA 4HQQL 4A2LA 2ZG2A 5FGBA 5IK3B 3ARYA 4HS3B 3D69A 2A6DA 5L6YH 1I3VA 2B4CL 1BD2D 4HUNB 4LHUB 4HWEL 2OX5A 4PJFF 5ENWB 3B2UC 4ZO8A 1UXWA 4GW4A 3DIFB 2WQRA 4C4KO 2ADGB 2HJLB 3FOMB 4M7ZB 5SWZA 1EEZA 1T7ZA 3P77A 4QTIL 3WIFA 5AG8A 5K59F 3WUWA 3N50A 3MFFA 2Y6SD 4G6FB 4TSAL 4M7LL 4ZS7L 3SDXB 1G1CA 1RJZB 2P8MA 3HUJF 2NY4B 3O8XA 5B3NA 3TJHA 3B43A 1TJIH 1TZGL 3HKFA 3OKNB 4PGJA 3MMEA 2OZ4L 4MLIA 3IAGC 1OGAD 1XEDA 3QEUB 1KFAH 2VNCA 2VLJB 1U8LB 1OQOA 3PL6A 1E0OB 2BHUA 2ZCHL 3ESVF 4UQ2B 1RZJH 4NQEE 1LO4L 4D0CA 2R23A 1AXSB 15C8H 4JFPA 5JW5A 3MQIA 4AM0B 5C2BL 3VW3L 2IALA 1AC6A 3QUXC 1QO3A 2D7TL 1G7IB 1Z5LB 4ALAH 1CDJA 5I1IL 4YHKH 4ERSL 3S5LG 3QEGL 2VL5A 2CGRL 3C08H 4WFFD 3VI3E 1P5UA 1U3HD 2EEBA 1CK0L 4QNPF 2NY7H 4PV8A 5F1NA 3V0VB 5F7LB 5JPNA 3MLRH 5D93B 2C4FU 3SGKA 3CZFB 1UB6A 2APVA 1G0XA 2FRGP 3Q6FA 3CLEL 5JQ6L 3ARBB 4HWBH 3QULA 3QIBA 1ITBB 4X7SL 3GK8L 3WE6B 1XAUA 1BX2B 2EH7L 4U31A 4LSUH 3D39A 1KV3A 1E27B 3IAPA 1DJSA 4GW1A 1WFTA 2OBGA 2ORBL 2DWDB 3IJSB 4NWUL 5I73B 2V5SA 1HOCB 4EXPX 1CFVL 2WZPD 3I6KA 2BOBA 3VE0A 1JZ4A 3C60A 3I3BA 4H88L 5IIEB 5DGQA 2L7JA 1G9EA 3UBXI 1CF8L 4OCYH 4PJ9C 1DQML 4FQQB 3V52H 4M1CC 3DUHA 2NY6D 5F6IB 1JN6A 3BD4A 1GGYA 2HAZA 1RUAL 5MP6L 1A9EA 3PWPD 1RUKL 4PRPD 3FQWA 5EOTA 5HSFA 4ZG1A 1EMTL 2PR4H 4CADB 5LCVH 1YEHL 4X6CE 2ZCKH 1G9NH 4XNXL 4KQ4H 5KVGL 1MFCL 1OAXH 3H9SA 4UIMA 1WWAX 3WL9B 4PJFE 1MI5E 3ZE1F 5FB8B 2GJ6A 5GIRB 3EFDH 4GS7C 1P2CB 5IR1A 4CU8A 4PYGA 5CKAA 1EJ6A 1FGVL 5E8DH 1NFDB 4BQ6A 1FRGH 2BC4B 5F21B 4LLWA 5IQ7H 3GSNL 4XRCB 4R4BB 5CJQH 3QG7H 1N59B 5JIKA 4K3DL 2LAGB 1J5OL 5I8EA 1BBDH 3CIQA 3V8CA 1F6LL 5F8QC 5JMOC 4W70A 3GSQA 3O4LE 4D3CL 4OFVA 3SKOB 4ZYKB 1HDMB 3B5HA 5GZND 1B6UA 4FTVE 3QT2A 3X11B 4JY5L 1G7JB 3QAZC 4RMRA 1W72B 2X4SA 4NQEB 5F9OH 4R97C 4H1LA 1HKFA 5T3ZE 2VLJE 3GHBL 3ZKNC 1DVFB 2M1KA 3L95A 4PJ8A 1T6VN 3MJ6A 4OCRL 4Z7VF 3SE9L 1F4YH 3E6FB 1WBYB 4ZNEE 2HWZL 2J8OA 1S9VB 3JV4A 1ACZA 1H5BC 1T0MA 4Q6YA 1RVFL 4XC3L 3FN0H 1IEBB 4N8VA 4XMPL 1UACH 1KLGB 1WVZA 5LGHH 1OTSD 3MJGX 1WIPA 1EH9A 1Q94A 1YEGL 4N8VB 4L8BB 1UB5B 4JVWA 4MSWB 2BNRE 3TBYB 3TJEL 4RFNB 4A6YB 5CJOL 3MRHA 5KANI 3TF7A 3V6BR 3BFOA 3OKNA 5D7JC 5D1XD 2EE3A 1LDPH 1P7KA 4WWKC 5EO9B 3NZHH 1U58B 1PYWA 1X5HA 3SJVA 4NN6B 4ZAKB 1MWAH 4IRJA 4KK9D 2HT3C 4ACPA 1KB5A 4FQCH 4WW1A 3PQYB 4GG6E 4TVSa 4JM4L 3EW3B 5DWUH 5DHYA 1V7MH 3MXWH 3AREA 4ZSOB 3QDGD 1S7SB 5HYSG 2Z31A 3D25B 4D0BB 5C08E 5I76B 3IU4H 4IIQB 4POZC 1CE1L 4GUPA 1ONQB 3CFIC 5C08D 3RFZC 4V3EB 1UGNA 2HT4D 4OLWH 3DX7B 2F8VA 5IHUH 4FMKA 5KVMC 2C4FT 1I3UA 4WU5B 1UZ6E 2XFXB 4MA7L 1M6OB 4EI6A 4M6OH 2HYMA 3KYMA 5EO0A 4Z78B 3MBXH 4O9HL 4L4VB 5D2NB 5IV2A 4XH2B 4HKZB 2OQJA 1J8HD 2FH6A 1GGTA 1AGEB 2GJ6B 2IBZY 1PKQE 3HFMH 3TZVB 2NYYC 3HC3L 2Z8VC 1X3DA 4MD4B 2N4IA 1YNTB 4EOWH 3ZHDA 4IMLA 2Z8RA 4DWHA 1G7HA 1KG0A 4NC2B 2WM0A 1TTGA 3ZKSD 4FQIL 4RGNB 2F54E 2H8PA 1VGEH 1KJ2A 4J3OC 4XNYH 1JPSH 3EKCA 5I1LA 5EBWA 5ESQB 2HH0L 4HZAA 3RAJL 4LSSL 3PJSB 1QLFA 2Y25A 4OGYH 5CINL 3O3BA 1R5VB 3JTCA 4HX1B 4TTDD 1MRCH 1HYRC 2BRQA 2VKXA 3V7MA 3GSXA 4JO2H 4FP8H 1SYSA 5B4MC 4JQIL 3GUTB 5IVNA 5E6IB 4XTRD 1J88A 4S2SB 4XMLL 2EEAA 4KY1H 3MCLL 2FO4B 4GBXC 4HXBL 2VERN 5CGTA 2R0LH 2OI9B 3BIKA 5MEOB 3QWOA 2AEQL 3F12A 2QHLA 3B9KD 4YHNA 4XP1H 5EA0H 5GQBA 3BKYH 1KULA 4APQB 4PJ5B 3CVHA 3D3VD 4MJ5A 3QO0A 1KCVL 1SY6A 4RCAA 3VGAB 2VXTL 1OVZA 1NBVL 1ADQA 3DX9B 4JEGB 3DO7B 3D48R 2ZOKB 4R7NB 5IB5B 1JHTA 3BP6B 4G5ZH 5K9KB 2IH3A 3EFFB 1CD0A 3PIQA 3VFRB 4LLAA 1XMWA 4GFTB 1TDQA 4KROD 3GNML 5BV7B 1JTTA 5F72S 3DRQB 3OBAA 4HUKB 3PDDA 3GRWH 4XBEL 3BP4B 4JFHD 3AS3A 4I18B 1CWVA 2H32H 3SDAB 4CGTA 1UEYA 2A6JA 5F44A 3O3AB 5KS9A 1DBJL 4J1UA 1WWBX 4TPRH 4F80A 3MZGB 3S37X 3QQ3B 3U36B 4IHOA 1U8OB 5TFSL 4KK6C 3TA3A 4KROB 1X6LA 5D9SA 3HRZB 1IZKA 1RZ7H 1MPAL 1XFPA 1TZIA 1PZ5B 1XR9A 2IADA 3TNNB 1FIGL 4OQ1A 4DGVL 4XAWH 1CLYL 2XIDA 3MOAL 1XCQB 4G6MH 1IC1A 5CEZD 2IBZX 4AEIH 3VXOB 1JV5A 4GO6B 3FOLB 2PKDA 1I85A 4LHUA 4PJEE 1U8LA 1C8PA 2VWEC 3MV01 3K8KA 3DUUA 4ELKB 3QWQB 2AV1B 1ZVSB 2H2SC 1HCFX 1ORQA 3B9KB 4RFEB 3BKJL 3H42L 1R5VA 3FRPA 5IP4A 1R3LA 1NL0L 4BH8A 1OOAA 4W6XB 1F3JB 2VQ1B 5KS9E 4Y5XA 2BVYA 1RK1B 4AQ1B 1S9WB 1OD9A 3SDXA 4MZ3A 1X4ZA 4LLMA 5DD6B 3LAFA 1M7DA 5INCA 1BFVL 1WAAA 3TGXA 2V2XA 3U9UB 3CFBB 3AVEA 1JWSA 2DQJL 3TPUE 4HC1H 1OB1B 1CGTA 5HVHB 4WEUD 5CEYB 4HCRA 4Q6IA 4UNUA 4WFFE 3UAJC 1TCRB 4G42B 3VA6A 4X5WA 2EYTB 3FONA 1B88A 4GLRI 1T1ZB 2UYLB 1IMHC 3W9DB 5ANMA 3GMLA 4FZEH 3BRGC 1BOGA 1MSPA 2D0GA 5T1MB 4WWKA 4XVSL 5GS0C 5ID1B 4NN7B 3DARA 3F58H 3UBXB 3WN5C 4KVCH 1Y0LA 3KYNA 4YHPA 1TCMA 3O6KL 3NBNA 1J05B 2DQCL 4XCCL 4Q2ZB 4NPYB 5C07E 3VXSA 4HBQA 2EDDA 3BDBA 2CQVA 3B6SA 2CDFA 2FIKB 5H35A 5HI5C 1YNTA 4KJQC 1K9TA 5GGVL 1A7OL 2BMKA 3F7PC 4NJAL 2XKNA 2E7LE 4NFDA 4OD3L 4OQTL 4GMTH 3QUMB 4BK5A 1J1XH 1KCSH 2OQJB 3BSZL 1S7QA 4NM4L 3MV7A 3D9AH 1ADQL 5HHOA 5AZEH 2HFGL 1MQ8A 4UT6L 1ZSDA 5DMIH 3WD5L 2QQNL 4AL8H 3QUML 5JW4M 2P5WE 1CTNA 5HI3D 3RWFB 1BOYA 5IFAL 3CSPA 1ONQA 3HHRB 1BM3H 3RGVD 1T7YA 3RVWC 3W39B 4YDLC 4XAKE 2AI0L 3CCHB 3ARDB 3MUHL 2AEWA 4MQXC 1SJEA 5I2IB 5HHNB 5I30L 4OUOA 4CNIB 2IMMA 1GVIA 4H8WC 5C9KA 3SGEI 5HHOE 2OS7A 2N7BA 5IUSA 3JVGA 1D5IH 4ESKA 2O5YH 3OKEB 3KLSA 5C0ND 4PRIE 3KJ4C 4CKVX 3GI9L 5D1ZD 2DM2A 5J1AB 4XNXH 3W11C 5GRJL 5GSRB 1U8KA 1QACA 3QNZA 4IIQC 2YOCA 1WWWX 3GBML 1OP3K 1GZQB 1LO5A 1UM6H 4JO3L 3TWCH 4FFVC 2ICWA 1S7UB 1KPUB 4XWOC 4YHIB 2XWJA 1W72A 4X6DE 2ICEA 3WNKA 4NJ9H 3QIBC 3RWFA 2OTWB 5DQDH 4OD1H 4CJ1A 3HNSH 1AKJB 5E8PB 3JWNC 4K3DH 2P8LA 1CGSH 5B38B 2IH3B 2VLLA 3QCVL 1M71A 3VFOB 4UOW0 4L3EB 3SKMA 4XXCC 4AY0A 1SJXA 3P9LB 3LV3B 2VR4A 4KJYA 3H9HA 1AQKH 1IGYA 1DUZB 1KIRB 5HPOA 3KJ6L 5E6YA 1JUFA 4HPOL 3HNVH 2J2ZA 3WXWH 1MQKL 4EI5A 1NCUA 3ZLQC 4OCXL 5IFHL 4JG1H 5ISZA 1FZOA 4IRZH 5CP3A 3P9WB 32C2B 4NUJB 4S0UC 5DURB 3DETC 1ZLSL 2EDBA 4R6UA 3EFFA 5FV2A 3ZTJH 2NX5D 4PJFA 1MY7A 2BNQA 5A3ID 3PWUB 3GMOB 4XMPH 3O6MH 3QRGL 1VA9A 3ELAT 1QRNE 3QAZB 4R4BA 3FT3B 1X5ZA 3OKKB 1T1WA 3T04D 1HXMA 3BJLA 1A6WL 4NQED 3CU7A 5GJSH 2PW1A 3TJEH 5L0QC 3ZDYF 4NO2A 2XRAL 2E27H 4FRWA 5FKPB 1J87A 1Q72L 1QFWM 2CIIA 3KGRA 5CJXC 5CEXA 2V7NA 4BQ8A 2MTPA 4XMKH 2NX5B 4C56D 4UZGA 3BPLC 5DJ6A 3NN8A 3TO4C 5D71L 1KPVB 3WSQL 2XQBH 4YC2C 1DLFL 3ZT7A 1JV5B 2VDML 3MLYH 4KDVA 2NY4D 1UWGL 5IHLB 5J0BA 3B9VA 5FHBL 3RWEA 4G6AC 1FORH 1T21B 2IADB 4QWWD 2YD5A 3TNMB 5CMAA 1FO0B 3RWCA 3W81A 3UTQB 1WWCA 2EO9A 3RDTC 3D6GA 4DVRL 1AXSA 2DWDA 3QDGA 1MNUL 4F33B 3U46B 4XCYA 1HQ4B 3BHBA 4HKZA 4PB9H 4R0LB 5EPMA 2VDNL 3W5MA 4L4VA 5CP7B 3LQAL 4OT1H 4LLUA 3KDMA 3DGGB 3THML 2XY2A 4LVOB 3ORJA 1EGJA 4L3AA 3KG5A 1I85C 1FL3B 2IH1A 3MNVB 4ZXBA 2CKBL 4ETYA 4X5LA 1XGTA 2NZ9D 4AIZB 2WSKA 5BZDA 1R3HA 4XP6H 1AY1L 5GGTA 3INUL 4WCYH 5KTEL 1FYHB 2EZ0C 5DF0A 3FQTA 1UVQA 3MPCA 1IC4H 2CKNA 3O4LB 4F7EB 1MJ7H 3PNWB 2EO1A 3WIHA 5MI0B 3TESA 3BWUC 2JCCF 5JZ7C 4CNIA 3CD4A 1QLRA 2GHWB 5F3HA 2OJEB 4J4PC 4OM1L 1UT9A 5C71A 4ORGB 3LQMA 3CK0H 4RIRB 1RZJC 1F90H 3RY6A 4WHTA 3MREA 5ADPL 1QPPA 1F2QA 5ESVB 3SOBH 5F7EH 4LP4A 2L4OA 5EN2B 5F96L 5GS2H 5J7CC 3IRZA 4LCWB 3ULVL 3RPKA 5F6HJ 3NCJL 4N0RA 1AJ7L 1MI5B 2KZ1B 2QLVB 3TBSB 4APQD 2AABL 2HT2D 3WN5B 5FA3B 2P1YA 3QDGB 2DIAA 1WC7B 3HMWL 4G6JH 4P2QE 2APXA 3UDWA 2DDQH 5BW7A 2C1OA 1H0DA 3MA7A 4JGMA 3EOTL 5JA9A 3VJ6B 4PJDF 4KV5F 1KB5H 3X3FH 1CCZA 35C8H 4G7VH 1ORSB 4NWTH 2E3VA 1K4DA 3PHQA 3RZCD 3DYMA 1P69B 4I2XE 4LLWB 5AWNH 4UI2A 2ARJA 4U2ZA 2ATKA 2G2RA 2AKRB 3SDAD 1D7FA 2BSRB 2APTA 1YJDC 3L7EB 1MFAL 5ACZB 4PGCA 4LLVA 4FABH 1IM9A 2QQQA 3H9SB 5I8KH 1INDL 2HRPH 5BS0E 2A73A 3KYAA 2R1YB 3IXTB 5GGSY 4G8GD 3GHEL 4HIEB 3O6FA 4JFHE 2B2XH 1NMCC 3VDCA 5HJ3A 1BP3B 4C56E 3QXUA 3L3DB 1J8HB 1T80A 3HZKB 5C09D 5CD5C 5AZ2L 2HP4A 1I75A 4R9HA 1MCNA 3MUZ1 3S34L 4KH2A 4OZIF 1R5WA 4HJ0D 5L7XL 1ZVSA 1PEWA 3N85H 4QRRA 3V5DA 2VN7A 3K2MC 1SBSH 3BI9X 5FUCE 3MRJA 3O9WC 4K8RC 3VFMB 5ADOL 5HGHA 1LEIB 1Q38A 4NQTA 3LEXB 3O6LL 4RMVA 2QADD 4HGKC 1W0VB 4XCEA 5DD0L 4RNRA 3RHWK 2AGJL 4OFPA 1N0LA 2GT9A 4Z7VB 4CW1B 4Y4KD 3HC4L 3FFCD 3MREB 1NC2D 1BGXH 2C4XA 3NFNA 1KTRL 5I1EH 1DSFH 1MCDA 2ZUSA 2V9TA 4OIBA 3OR7A 4HWZB 1JPGA 2YD8A 5EZOL 3SO3C 1AFVL 1BVZA 1G7QA 2VE6B 3I02B 2MQ0A 1LQSR 4KV5E 1HSAA 3A0OA 1IM3B 1U8OA 4HQQH 1A3RL 3UO1H 4ZFFB 1EO8H 1VCAA 2OP4H 2VL4A 4JFXA 1B0RA 4GRLD 2B0SH 5I17A 5CMAB 1N0XL 4FG6C 4YUEL 2FJFB 3VXSE 5BCAA 1VFBA 2OL3B 3ARXA 4FNLL 4TQEH 5F3HB 3EGSA 1NGXB 1KEGL 1A2YA 3A6OA 1NSNL 3L5XL 3D3VB 5LWYL 2V2TB 3OQ3B 3AS0A 4Y4KB 3P4OB 3F6LA 3IGAB 1HZHH 2F53D 1OLLA 3V5KB 1FJ1A 5IMKB 3O11B 3C09B 4JZJA 4JFFD 4POYA 1UB6B 2RB8A 4HLZG 1TQCB 1QA9B 5DJXB 3BZEA 3EDFA 4Z18A 4M5ZH 2E7MA 4LKCA 3HE7A 3LN9A 3KXFA 3ZKMD 5GSVB 5A43C 3D85A 3UTZB 1CFSA 4EVNB 1LE5B 5I8EB 2XNAB 3JWDL 5J1TC 5CP3H 3MNWA 1Q9WB 4UT6H 1MLCB 3C8HA 4RFNC 5GJTL 2ICWJ 4PJXE 1KJ2L 1QSFE 3CDGB 3MLWL 1ERNA 3D1MC 3QIBD 5I1IH 4LRNH 5BXFA 4P99A 3QEGH 4MB3A 4WWKB 4RDQF 2QTEA 4XBGA 3ARBC 1UC6A 3MC0A 4JPVL 5C1MB 3OJ2C 3BQUD 3R1GL 5EC1A 1A6AB 1P2CA 4M03A 4N5UA 5IR1B 3PV7A 2GEEA 3BPLB 5C8JB 3EJJX 5KSAD 1JNJA 2FYYB 3TF7C 3HR6A 1YEJL 4UIMB 4HWBL 2CLZB 5C0BA 2P8PB 4FFZH 4G80B 1IAOA 4YC2B 4FFYL 4HUWB 4NO2B 4JFOA 3LMJH 1A9BB 5DYOB 4Q0XL 1ZLWH 3G6JA 1BIIA 5JIIA 3HE7B 4ODBD 4RRPA 2A38A 3RU8L 5AD0B 2NY5H 1HK6A 1ZHNA 5CUSH 1K4CB 3ARDC 4YHZH 4P23B 4ZPTB 5D1ZB 1DQMH 1EO5A 2OR8A 3UJJL 2JK5A 2ERJC 2W0LA 3UTOA 2AK1L 1VADA 2EXWD 2IPUK 3CVHH 3RWGA 5JZ7D 5KVFL 4U6VH 3VMOA 2EE6A 3IU3B 3ECBA 2B5IB 4OM0H 4KC3B 1OAKL 3Q1SL 4FQLH 5DTFB 1W72L 5AAWA 5HHXH 2EEDA 5L6YL 4MQ7B 1E6OL 4PJBA 3NIGF 3VXQB 4Z7UF 2ZCKL 1IC5H 3OJVC 4WU7B 4PGCB 5HYIA 2J88L 5GGRB 1HHJB 3F6IA 4KRPC 1DUZA 5A2JH 4HUUB 2QSQA 2GY7B 3OB0H 1UADC 3H9HB 5E8EA 4EI5B 3WHXB 1FNEB 2HJKA 4XHJC 4OF6A 3LVEA 1CR9L 3V4UH 3RZCA 5CGYC 1NFIA 1FBIL 3QZWB 4I18A 1NGZB 3LV3A 4M7JL 4DCQB 4WW2A 4RA0C 4NUGL 4X6DA 2Z92B 2P24A 1TZGH 1YEEL 4D9RE 3KPMA 4Y5YC 1I8IB 4NC1C 4GRWH 4LPXA 1ZWIA 4NKMA 1OP5K 1XGYL 3MYZA 3TCLA 5HYEA 3MGOA 3ZL4L 4MSWA 1A7NH 1SEBB 2P45B 3O6ML 3QRGH 3O0RL 5C0CA 4U1IA 5I1CH 1EHAA 3E3QC 4R97B 5I18L 4AMKH 4Y0GA 4H8WL 2VDRL 4GG6A 2GAZB 2V5YA 3ULUF 2P8MB 3N1GC 3LPWA 4R7DA 1KJ3H 1INEH 4P57B 5DJAA 25C8L 5FGBC 3DHMA 1BJ1H 1E4XH 3HNTL 3LRSB 1GAFH 4UAOC 4DAGL 3VG9B 5LGJA 5J8OA 2YBRB 4JFDD 1Q9OA 2XTLA 3WFHB 2BDNL 1HHGA 4S2SA 2BZDA 3F5WA 5A1AA 3U4AA 4X7SH 5IESH 2ESVE 5DK0A 4KKNA 1RZKH 3CGTA 1LP9A 4YXLH 4Q2ZA 4NWUH 4QYOA 3SKOA 1GOHA 1LEGB 2JJSA 3IFNH 4QY8B 4W4OA 3VXPA 5J13C 2F58H 1YEGH 4YR6A 1KN4L 1ZVYA 5DT1L 3MLYL 3VGFA 2BVUA 3A6BL 1RMFH 5FHBH 5MENB 5D5MF 4PJEB 4U1LA 3UPCA 5IT2L 4R7NA 5IB5A 3ECBB 1EFXB 2NY6B 4KFZC 3K1DA 1ZSDB 4IRSC 4YHKL 4ERSH 1LDPL 4JO4L 4PJBE 3MXVL 4QRPE 1U3HB 5FYJL 3VJ6A 2BERA 2LVEA 1SM3H 2NY7L 4ETQA 2R2EA 3QQNA 4F33A 3T0EC 4PB9L 5IHBA 5K9QI 5A2FA 3IJYA 3S4SA 1UQSB 3MFGB 5ICYB 2YD6A 4PJXF 4XPGH 5CWSB 3L5HA 1Q9KA 5C6TL 2LV4A 5IROA 2C3XA 2CDFB 3HLAB 1D5MB 3HB3C 3GUTA 1WZMA 1NEZB 5B3JE 4XP6L 1NBZB 1T83C 3O9WD 1FGVH 5KOVC 5DC4B 4YDKH 3K4DA 2A6IB 5EBMA 3ULVF 3D0LB 1F5WA 3RNQA 3WHE1 1FH5H 3WFDL 4OZGF 5DJZB 4HUMB 3HI1A 1QNZL 1BQUA 3BOVA 4X7EC 3U7AA 2ADJB 4P4RA 4DN3L 2WUCL 4OF7A 4PIRF 1FC1A 3VGAC 3TZVC 4OM1H 4OBSA 2OJEA 4Q6IB 5BXFB 1C7SA 2R1XA 3N9GH 3NFPA 4XGZA 1NC4B 1GZPB 4PRPB 3PWPB 4N0UB 4QRRE 2ED8A 5CHNB 1RY7B 4PR5A 2IQAA 5T3XL 2DM7A 4CVUA 5F97E 1LE9A 4OZHE 4M48L 5GS2D 1PJ9A 3S4SB 2AVGA 4G6KH 2Q8BH 2ZJSH 5GISH 3QEQD 5IW6A 3EO0A 4RA3A 2D03H 3FQNA 1S7XB 2N1KA 5TGBB 5EWIH 4BFIB 1OAZL 1DE4A 4EUPG 3ULUD 2DKUA 1T7WA 4ZXBC 3WUZA 4S10A 1ND0B 4KRPD 4MQXD 4JKKA 5EBLB 2R2HA 4QXUL 4NQDE 4JZNA 4HXAH 3RVWD 2ZP0T 3RGVC 2WIMA 2W92A 3O2WH 3MGOB 5IVZB 1BVKB 4FQ2H 3DMMB 4JKPH 5T1DH 2WINB 1A22B 1MLCA 4WJ5A 4GKZB 4XMLH 3IDXL 4LCYB 4P2OD 1CS6A 3U2SB 3IDNB 3HMXA 1AQDA 1FZJA 4HXBH 2VXUH 4M62H 2V2WB 1XGPB 2F54B 1OT2A 3BPCB 3L3GA 3CVHB 2JE8A 3QXDB 2DQDL 4OZIE 2CMRL 3L6FA 1YUHB 4R90H 4YHOH 5HYJD 3ULVC 4JY5H 3MLXH 3BUTA 1YY9C 4NSKB 5DC0A 4GRMA 2I27N 4CU7A 3PGFH 5FUZH 1LILA 4Z7NE 2BSTA 2QV2A 4NQCB 1NDMB 3K8MA 4P2QA 4RAUB 3G5YA 1A7RH 4DGYL 2CIIB 3NFNB 4JQXA 4P9HH 1HEZB 4LF3A 1MWAL 3M8OH 5D2LB 2OJZH 2B2XL 2KL6A 4D8PA 5DHVH 2B1AH 4BSVB 3LEVL 4JN2A 5IVXB 5DWUL 3VXRA 1X4YA 2CH8A 3FOMA 5L2KD 2YSSA 1U2HA 3MUY1 2W38A 1CT8A 5I17B 4G3YL 3RX7A 3U6RA 1R5WB 3MODH 1ZHLB 5C08B 2Y06L 3T08A 3LB6C 3X3GL 3MBEA 2DWEB 3ME0A 3H3PH 1JCKA 4RBPH 2W91A 5JOPD 4FFWD 3VD7A 2NZ9C 4LLYB 4GRLA 4YAQB 3VU2A 4PV9A 1P7QA 2H32A 2ZKHH 1MIEH 3IDIA 3NZHL 4G8EB 5DD3H 2G75B 4NOFA 4HV8A 4HFUL 1D5BB 1BHGA 2N56A 4NQCD 5C3LD 2KQNA 4GMSH 4EOWL 3TM6A 3RNQB 2X4UB 1S5IL 2OI9C 4YPGB 1OTUC 1U6AH 4KRPB 4QRTB 1XGRA 1FP5A 2R8SL 2J8UB 3VFPB 2X6MA 3TV3L 4LFHG 3U30B 3L5XH 2XZZA 4LSPH 2J6EA 2Y7QA 3LHPH 1Q0XL 4RWHA 5AYUH 3N1FC 1TIUA 1HZHL 5A2IH 3BEVB 1G0DA 4AG4L 4JO2L 1JJUA 5KVEL 4RQQB 5HDQH 4JKMA 4Q97A 1IC7L 3RUGA 3BW9B 3O2DH 5HD8D 3ILQD 1I1RA 3H0TA 3WS6A 4DFHA 3ALXA 1OP3H 1I4FA 3RUGF 5EZIL 2DIJA 3MCLH 4NQSB 3SE8L 4HV8B 4G80A 3IS1X 4OQTA 1CG9A 1WUNT 4WVRA 4Y4KC 4WUUD 5EA0L 3CX5K 4OIIL 5ID1A 4FQIH 1D6VH 5E6ZA 2Q3AA 1H8OA 4U1KA 4UT9H 1A7PH 1EAJA 3E2HB 4MGXA 5T1LA 4LQ1A 4P46C 3F58L 2Z31B 3T65B 4X99B 1WBXB 5HHMB 5F93C 2HH0H 3RL2A 1KJ2H 2UUDK 3KYOA 2DQCH 1R3KB 2IPTH 2LE9A 2DLEA 2W9DH 3J7HA 1A6UH 5C9JA 1DP0A 1GGBH 3DVFA 4DTGL 4OKVA 3MRRA 1CGXA 3MNWB 4PRAA 5J89A 2FL5A 2DLHA 5HI4D 3TH4T 3D18B 4UB0L 3T3PE 3P11L 4L4TE 4NO5A 1X5FA 4TNWF 2DD8H 1ZLUH 5F7UA 3G6DL 4WHDA 4FFYH 1MELA 5C0BE 1QG3A 1I8MB 2V5MA 2NY0D 2IANE 3BGMA 2AK4A 1RIHH 3LEXA 3FT2A 5JQHC 1Q94B 3M17A 2K3TA 4TRPL 3WNMA 3UXFA 2YN3A 1KCVH 2BCKA 2H9GB 3QP3A 3IDNA 4I0KA 4XAWL 2Y23A 4R0LC 3EGSB 4U3CA 3OAZK 4TN9A 3MA9L 4PJ8B 3DTXA 1OSPH 3FB5B 3TJHC 5J56B 4KMTL 3QFDB 4XNMA 5FYKD 1F4XL 3GJFB 4YPJA 1S9VA 3QDGE 1A6TB 3T0AA 3D0VA 1MCPH 3EAKA 4HF5H 5DJ6B 1GHFH 3IJHB 3SE3C 1DDHB 2UYLA 3K1KC 3G6JE 4YLQT 3QDJB 3QH3A 4MVBC 5LAXA 4BA8A 3BW9A 4BFIA 3C8KA 1FYTA 3BT2L 3LS5H 1QQDA 4P49A 3UDWC 3ZT5A 4R4ND 5DEFA 2MCPL 3DYPA 1RZ7L 4FQPA 4O51B 3L9RA 5GZOC 5MEPA 5HHME 2APFA 4PTTB 1KBGH 4WUKH 1XGRB 3RI5F 3U1SH 3OG4B 5I73C 4XVSH 3NA9H 4P4RB 1P9MC 3GRWA 3QHTC 4UTAL 3L3DA 1A0QH 4UU9B 2CK0L 4OUUB 3GKWH 2YRZA 2H45A 3FB7A 3SGDH 1CD1B 1MAMH 1AGFB 4MZ2A 1INEL 5EUOB 1SVCP 3QDJA 1Q8MA 5HGDA 25C8H 5FM5O 2BNQE 2GI7A 3HRZA 4G9DA 4R3SA 5KSUA 4FTVD 1QSED 3UTTA 5H37G 3MRGB 2BDNH 4OLUL 2JJWA 4X0KA 2YRPA 3IDYC 4K3EL 3BGAA 5DJ8A 4GSDL 1IGYB 4S1DD 2AXHA 1URLA 2VZ3A 5F7HA 4XAKD 3WLBB 1WIOA 1RUPL 1FZKB 3MCKA 3MLVL 3WDHA 4N5ED 4FHBD 5FYKL 1IRAY 3BEWA 3IAQA 5DT1H 5M7QA 3MLZH 2IAMC 3A6BH 2EDLA 4H0IA 4Y7MA 3E3QA 1UJTA 3QIBB 4XCCH 3RIFF 4H25B 4HJGB 3MYJA 4NNXA 4TUJA 3DX9A 3CZJA 3MLPA 4X4ZA 4HW6A 5C0AE 4R96B 3KPLB 3SJVE 1YA5A 2MWCA 2OZ4H 1MHHB 1OLZA 1YUHA 1MREH 4P5KB 4Z76A 1T2QL 5I9QC 2KKQA 2YUWA 1DBKH 2ZCHH 3GI9H 1QBLH 1J1XL 3CDCA 3O3UN 3PGCB 1X6NA 5DJAB 4WO4B 1INQB 1T83A 2FO4A 2Q87A 1DEEA 2ADGA 3LSOA 4OKVB 4C55A 4XX1E 1WICA 4GAFB 3DV4B 2X40A 4YDKL 5D7LE 2QQKL 1I7RB 2WWMC 5T5NF 5IOPA 1N64L 2I25N 1VACA 5C0IB 2A6DB 4PRIA 3OXRB 4X99A 5HHMA 3DROA 4DZBA 3QHZL 4QNPE 4ODXA 4NKMB 3HZYA 2EYRA 5I1DB 5I30H 5BOZG 5JQ6H 4AIZA 1OPGH 1OF2A 3THMH 3RWDB 1MRFH 2WBJC 5I1LB 1EFXD 3MNVA 1ZLVK 3BGFC 4G43A 4LVNB 4OZIB 4L8SC 3ZSSA 3QPQD 4WDIA 1JP5A 1UKTA 1RJZA 3NIFE 3R0NA 1U92B 4V1DE 5E00B 1CFVH 3LQZA 5FGCB 3U82B 4RFOL 1S7WB 4UV4H 3ZE2E 5DURD 3UZVB 3D5OF 3CSGA 4N9OB 3E0GA 4MAYC 2G5BB 4KRMB 4NRZA 1JGLL 3EJZC 3VWJA 2VQUA 2ATPB 2DMCA 3JV0A 1WT5A 1U8HB 1KLGA 2IC2A 1FPTH 4G9FD 4RGMC 1I7UA 4KTEH 3C5JB 4M1CD 5JO5B 1S8DA 1T03L 3BN9C 4PJ9D 4KROC 3T4YB 5I1AA 2CO7B 4OD1L 3LQAC 4X6FA 4LPWA 4MNGB 3ARFD 4Z7UA 1FN4B 2X4QB 5ADPH 3RKDC 5KS9F 3LN5B 1FQ9C 1QTYT 5CZKA 5K59E 4X5WB 4OI8A 3A67L 2NXZC 3ULVH 4HUVB 2Z9TA 3MV7B 3EOAA 1EUTA 5C92A 4PBWD 3LPFA 3GMLB 3EFDL 4QTIH 5DD1H 2FDBP 3RVVD 2ITDB 2IFGA 1LGVA 3MV9B 3QPQC 5TQ2L 1NAKL 2AABH 4FFVD 4HAFA 3V79C 3B9KC 3PQYA 4HPOH 4MAUH 4XCNA 1A1OB 4TSAH 4G6JL 2VO5A 4ODHH 2R15A 3GJFH 5C0AD 5CD3B 4LLYA 2F19L 5EOQL 3SKJH 4RGOH 4U6XA 2ZUYA 3V0WL 3CX2A 4R7DB 5JDJA 2XKSA 3R8QA 3MRHB 43C9A 4EI5D 5HYJA 2XQBL 4X6FB 1E6JL 1A1MB 5HDLA 3C5ZC 1VERA 5EU3B 2C1PB 4QY8A 3VXPB 4YFEA 4M1GH 2XTJB 4WNQA 1L0YA 2HMIC 3CNKA 3JXAA 4F7MB 2DQUH 5DK0B 3FN3A 3W9EB 1ZWIB 2EDNA 3VFSA 5L2KB 2AEPL 4EN3D 5T33H 4U1JA 3BVNB 4I5BB 1A6PA 2E7CA 3GHBH 1TZHB 1LE5A 2COQA 3AAZB 3EYFB 1YQVL 2R0KL 5FYJE 2E6QA 2Y6SC 4PREB 5F1KC 2WIIA 4BM7A 1L9MA 4PJ8C 3LZFL 1IT9H 3CC5B 4J3UA 2L7UA 4L8DA 5D6CA 1H15B 4BH8B 2EH7H 5TDNA 3O9WB 5GGUB 4LSRL 3VWJC 3WSQH 1JI1A 4NQUA 4JN1L 3GBLA 4LAJH 4KJPC 3M1BA 2DLIA 1NC2A 1WSST 5L7XH 4YZFF 2HT4C 2ZUUA 3FRUA 2GCYB 1UWGH 3P4OA 2KDGA 5F1SA 1E4JA 4RZCA 4XC1L 2WAHA 3M1BB 5CCKL 1MCCA 4PD4J 3QXTA 3SO3B 1NCAH 1JHLH 2XKUA 1JK8B 4HSQA 2VUYA 4DVRH 5MP6H 2HVKB 1S7QB 1V3MA 4F57H 4X6EA 4O02L 3JTSA 1NC4D 1CIDA 2P5WA 1H3XA 4MJ5B 4OT1L 5MEND 1KGCD 4KQ4L 5KVGH 4WJ5B 1T5XA 3OTTA 3MXWL 3ZDZE 4GRWE 4I18C 4PG9A 4JFZH 3U30C 5D1QB 4PRPA 5EZJB 2P8PA 3RHWF 1W0VA 1CZ8H 4ODTL 3I2CH 3UTSA 4ELMF 1NC2B 1YQ2A 2FYYA 3ARDA 5HY9B 1A7PL 4MAYA 3EYUH 1F6FB 2DDQL 3GSUA 5F1OB 3HE7C 2ZCLH 4Y16A 1H3WM 5EC1B 2H2SD 4YEEA 3DUSB 3NPZB 1HYSC 1MF2H 1YECH 4O9HH 4YDJA 4NWTL 1UZ6F 1VKXB 2VDLL 1S7RA 1XF3B 1YYLL 2VSDA 3HC3H 4F2MA 1RQ5A 2R2CA 3SOBL 3NACL 1KENH 2A0LC 2FBJL 2DD8L 5C6PB 2JIXB 2VLKA 5DD6A 5ANME 2BVQA 1DQJA 4JFQB 5HGGS 1REIA 5I71C 1IGML 4OFYA 5JHDA 3QULB 3U79A 1D9KB 4HIXH 4JQVA 1KLUA 3TYFA 5E4EC 5TE6H 3IDJA 5E4IA 1MFEL 1II4E 3P40A 4OGYL 4TUKL 2WANA 3RRQA 1FN4A 1RD6A 5J06A 1RHFA 3JTTA 3EOTH 3Q3GA 2Y07L 2HG5B 5FO7B 2WUBL 5FAAA 1MY5A 1PDKA 2XN9B 4R26H 1KB5L 3X3FL 1LNUB 1ZANH 4KUZL 4Q9RH 1RVFH 2EYSA 4Z9KB 4YEFA 4QOKA 3FFDB 5JOFA 3N1QC 4I77L 3D87B 3X13B 5CILH 4EVNA 4HHAA 3DX6A 1WISA 5CGMA 3MV7E 4AENA 2I07A 4ZOEA 3N85L 1PZ5A 3OX8A 3EDJA 3F5WB 2A6KB 2DIBA 5JXEA 4KVNL 1WCBA 4ZFFA 1XIWA 1F4WH 2GSIA 3O6LH 4NBZB 5DA4A 4PJCE 4WI2A 2OTPA 3PL6C 3I75B 2NW2B 4P5TC 5E2JA 4QRRD 3HCVA 3PXHA 5F7YC 3SDCB 5F9AC 4G5ZL 1HYSD 3X14B 5SWZD 4XI5D 2YUXA 5EORH 1M7IA 1R3LB 3IKCA 4C4KT 5JO5A 4RFEA 5JHLL 3QUYC 1OAKH 3T77B 5I75C 1T66D 4AIXA 2VISA 3WFEH 1UYWH 4NRZB 2H9GA 1BREA 3U1SL 1YMMA 3TIEA 2ESVA 3TO4B 1LWRA 2JELL 4XWGH 1Q9OB 3WFHA 3NA4A 3G5XA 4OZ4A 4J12A 3TNNA 1WFNA 5D2LF 3MLSL 4MXQD 3ES6A 4U7KA 3RZCB 4WTWA 3FQTB 2VDQL 3MLTB 1U8MB 5DD0H 2ZOLB 2EIZA 1W8NA 1C1EH 1DBBL 1A47A 1HHKA 4NUGH 4HKXB 2DF3A 2EDWA 1Z3GH 2CDGB 2YEZA 5GGRY 1QFHA 1FCGA 5E56A 1AFVH 2X4SB 3T2NL 1SEBA 1IAIM 5LGKA 1YC7A 1U3HC 4WU7A 2DQTH 5DJYA 43C9B 4K3EH 3MJ8B 1M05B 4L8BA 3DGCR 1U8QA 4GSDH 2Z93A 4LVOC 1IZJA 1J86A 1N0XH 3QIUD 4ZS6C 1T1XB 4WO4A 3VXNB 3A6CL 1U3JA 5DD5L 4FTVA 5CSZA 1KIQA 4LHUG 3MLWH 1Q1JH 1NFIB 3HE7D 5LWYH 1UXSB 4ZPVB 1X5AA 1NCDH 1S9XA 5FXCH 1E4XL 4HMDA 4FXGA 3R8BB 1ZHNB 1GRWA 2WNGA 4IDJL 5HPMA 3RA7L 2MKLC 3EYOA 4GKNA 4HC1L 2C1OB 4JG0L 5F3BB 5I1GH 3B9EA 4HUVA 3OKMA 4TOYH 3KNBB 2NW3A 5HYJE 3UYRL 3WUWG 4PRID 4UOW1 1T2QH 1DBKL 4ZO6A 1HQRA 2X4NA 2BXZA 4NT6B 2BP3A 3WJJA 4O58L 4EIZC 2DS4A 2YMXL 5CUSL 3OAUL 4OLYL 4EI5C 3V5HB 4XBGB 2BVOA 1P4BL 1R0AH 4JFDE 2VDPH 1N59A 1MCEA 2AQ1A 4ZUWB 1F3DJ 1K4CA 4R2GD 3V5HA 1CICB 3DX8B 4U6VL 3BQUB 4ODSL 4O51A 1UCTA 3ALWA 4FQLL 5DA0B 4PS4L 3RY6C 2YXFA 2XXMB 3RX8A 4LLMB 1L8JA 1OPGL 3LKOB 3QWRD 1RK1A 4LF3B 3DMMC 3GDBA 1GOGA 4PJXB 1XGQA 3CZFA 3Q6FB 3GM0A 4PLKC 2GYSA 3QUXB 3RKDD 1KCUH 1ZA6A 4ZO9A 3RU8H 3VGBA 3B8YA 4Q6IC 5I66B 3EYVB 3WFDH 2F54A 3BAEH 3BPCA 3L3GB 4E0RA 5FECA 1EEYA 4MD5A 4U33A 3S37H 2VISB 2VLKD 3CVHL 4WV1C 3MLUL 5KSBB 2Z93B 1WJ3A 2JB5L 1ULVA 2UZIL 4O2EA 5CJXA 4LAQH 3SEPA 3ZL4H 3JV6A 4PGZA 1FYTB 2B8OT 1UH4A 4JFPB 3ROLA 5JW5B 3CFKA 1YYMH 3LKSA 1IC5L 1AKJD 3HPJA 4ZXBB 4LCWE 1RZ8B 3CH1B 4TUJB 4YX2L 4YHIA 5DD1L 3KPOA 4CVWA 1JGVH 1UZ8A 5EPMB 4ZFZA 2H26B 4IRSB 3MJ9A 4DW2L 5FYLD 3GSVB 4I4WA 2M8XA 3AAZA 2FL5B 1FGNH 1NCTA 2HTLC 2IQAB 2UWEA 3Q6GL 4FQ2L 4L9LB 1CYGA 1V7NH 5EU6A 1L7IL 5B22A 4NIKB 3ZTJG 5M95B 1X5YA 4PJHB 5DMKB 1XR8B 2FEDC 5DLML 1MHEA 3S98A 4MJIA 2FB4H 4MNQD 3ARFC 4HBCL 2VXUL 1YN7A 2D2OA 1OGTB 4K7PH 1TVDA 3S88L 3X12A 4NN5B 3GMQB 3FZUC 1R6VA 3NPSC 1IL1B 1TLKA 1I1FB 1KNOA 1R3JB 3TP4A 1FO0H 4PJ7E 1FVEA 3WFBL 5MERA 5LVEA 4OCXH 1LO0L 1MEXH 4M93C 2B39A 4XPBL 1KSRA 5SX4I 4LLVB 3MV8E 2FX7L 1MAJA 4DGYH 3KYKL 3NGBB 4UU9A 3ULSB 3MR9B 4N9GA 2B1AL 4IRSD 4U1GC 4A6YH 5KANG 1EBAA 3WMSA 4KGLA 3ZZ1A 1GGUA 3O6FC 2UUDH 4OLXH 3T2QA 4DVBB 3DVIA 3FL7A 2ZSVB 1M71B 1S3KL 1CBVH 3UTSB 1J0IA 3MV7D 1NEZA 1AP2A 4PB0H 1ZT4A 1IM9B 5BS0A 4XP9H 3TVMD 1XGUA 4OI9A 4BZ1H 5HYFA 2K7PA 3QEHB 1QVOA 1V05A 1EHXA 1G6RL 4OF5A 3WIIL 4HFUH 3KPRD 2AKRA 2EYTA 4N0CD 3SDXE 4F8TA 4MA1C 1L0XA 5GRZA 3H3KA 4X6EB 4HS6A 5L88H 3WXVL 1BWMA 2AXFB 3VXSD 5C6TH 1B4RA 2X5PA 5GISL 2DWEA 2IANB 4IBLT 1XF5A 5JW4N 1EDQA 1OF2B 3RPIA 4D9LH 3C2AL 1OGAE 5EOCJ 1FYTE 4HIJA 2WY3A 2WP3O 4F58H 1VENA 2IEPA 3GSNB 4BELD 4NNPH 3GSUB 1WQVT 4FN0A 5AYUL 3T3PF 1KTKE 4ELKA 2WUCH 4JRXA 2Q7YB 2R4SH 5DUBA 2XZAH 2VDNH 3X14A 4MNQB 5F9WB 3T1FA 2EC8A 4QO1A 1JGUL 2QJDA 4BSWB 4WHYG 1P7KB 3Q5YA 5LJYH 4RAUA 1MFDH 4O2FB 1CLOH 4LLQB 2NXYC 4XVUD 1P4LA 5T3XH 5LBSL 1LO3L 1C12B 1S9YA 4Y1AA 3HAEH 2A83B 1KENL 4JCMA 4N1CA 3KJ6H 1DN0B 2H26A 4EUPH 5IB3B 2C9AA 2A6KA 4ORGA 3TO4A 3IKKA 3HNVL 2JJTA 1I1AA 5F1NB 2VSCA 4L3EE 1D9KD 4OSUL 1U93A 3PGFL 1HHHA 4JR9L 1UH3A 3SDYL 3UP1A 3O3AA 1EHLH 4U0RB 5DRWA 3VXQA 3SCMC 2ZUTA 3VH8B 5EU4B 4ZOBA 1NGQL 3CJJA 4YHPB 1TETH 2BJMH 2LU7A 1K3IA 1NAMA 4RMWA 2XI9A 4Q9CA 4X83A 2CLVA 3AU1A 1T3FB 4IOSD 3BX7C 4UT7L 4UDTB 5HHPB 4P2QD 1FZKA 5GRUL 4I77H 3LPGA 3V6ZB 1ED3A 2BX5A 1CQYA 2AAVA 4R0LA 4XNUL 4YDIH 4P5TD 3T8XA 2NX5A 4PLNC 1D6EA 2AS5M 2AJSH 4R4NC 2CMRH 4R90L 2NLJB 2PXYC 4YHOL 5IJVA 5HI4C 1NMBH 3QUXA 2C7UB 3E8UL 3MYJB 3RJDA 1JWSB 2ZKHL 5CLWA 1ZEAL 4P2OA 2FLRT 2GQHA 3VFPA 4DEPB 5E70A 5DD3L 4OZFH 4L5FL 3BQUC 3PP4L 4IS6B 4FZ8L 4F7MA 4DZ8A 5KG9A 3TT3H 3M07A 5C8JA 2CRYA 2EICA 2F53B 5IBLC 2YZ1A 3IDJB 3C5JA 3TJHD 2X4PB 2HFFA 3OXSB 2JB6A 2Q3ZA 4BUGA 1SYVA 4ZUWA 3SGKC 1QLFB 1AO7D 1RFDH 3K7UA 2W9EH 2O61B 3SQOH 2QADB 5FDWA 3CUPB 3MOBL 4FQ1H 4LSPL 4XXDA 4E41E 3T3ME 1Q0XH 3L1OL 5EU6D 1KIPB 4CJ0A 5HVGB 2OL3H 5ITFB 1E28A 5KVEH 5KJRL 5GSVA 1MIEL 4PGEA 3P9MA 4HZLB 4RSVA 5DJDA 3VFVA 3IB4A 5TF0A 3I84A 1NBQA 3GJEB 3TA3B 1F13A 3LDBB 1P53A 4QHLA 5C7XL 3KLAA 4QT5B 4P48A 3QXAA 1WT5C 4PJ5D 4XH2A 3DROB 3LRGA 5TQ0H 5LXGH 3QDAA 3INUH 4OIIH 2FGWH 5K9OA 4YO0B 4L4VD 2X7LA 2ZNWA 4GT7A 1D5MA 3K2UL 1KIQB 1SJHB 1DQDH 5KSBA 1BQHG 4M3KB 5B8CC 5GGUA 3VFWA 2FX8L 2G9HB 1GGBL 5ISZE 1OY3B 1YZZA 4I8DA 3TPUB 4CN6A 1AO7B 4E5XA 5E2WH 2ZUWA 3C60D 2JKXA 4I0PA 1I7ZA 2P5EE 3C60C 3CFJA 3KR3H 1TZHA 2PYFA 3P0GB 4NNYB 4X9HA 3OKEA 4KKCD 5CLTA 5KS9B 1A1NA 2HTKD 4QHNA 4F7TA 4RGND 3ILQC 3QR2A 3LD8B 2EYRB 2EIZB 1T2XA 2Y1VA 1AJ7H 3GMMA 3VDBA 4JRYB 4PRNA 5DRWB 2ARJQ 1GOFA 4TRPH 4Q9BA 4Z5RB 1LEIA 4OZHB 4PRIB 4W68A 3MRKA 2FECL 3RNKB 3L7FA 1RUML 3PABB 3V4PH 3MCG1 4QRRB 4HPYH 2UZXB 1A6UL 5CJ8A 4J2XA 1ZK9A 3WS3A 5FKAB 4LIQE 5KSAB 4P0DA 3RVTC 1HSBA 4KKAC 4ZUVA 4EDWH 1HSAB 1WEJL 1KTDB 4BQ9A 3E6HB 4WO4C 1RU9H 4ISVB 5CJBA 2GJZA 2AJUH 4PTUB 3T0DA 1QKZH 4BSWA 1TENA 4GAGL 1PY9A 4CVXB 2FO1A 4Y2DA 1GHFL 3CSYA 2V9QA 3DURA 4HCRH 4HUXA 3DIFA 1LMKA 2K1MA 1JWUA 4NRXA 3L7EA 3OKMB 4YHMH 2PNDA 4H26B 3NCMA 2P5ED 2IPKA 3B9AA 4MNGA 2E8ZA 2FJGA 5IMLB 2DQIH 1G7MA 4JVPA 1SVZA 4HLJA 1MCFA 2Q76B 3C5ZD 3HAEA 3QHZH 3D2UD 4MA1B 4W6WB 5AZ2H 1AGDA 3NAAH 1NUNB 5FYKU 4PP1C 5FIEA 1FZMA 2H41A 4PJAA 5IB4A 1UQSA 2HT2C 2YK1L 3MX0A 4JRYE 4HK3J 2ITDA 1FDLL 1Q9LB 3MV11 1DQLH 4Q0XH 1A0QL 5C07A 4B7LA 2IGFH 4G8FA 2BRRL 4GRWB 4XCFL 1N5AA 1M7XA 3V6FA 1WF5A 1X4XA 4HUXB 2P5EB 3S8WA 1EEUA 3SDDC 1AD0A 3CLFL 4BZ2L 4YDLB 1OAYH 2JIXA 2VLKB 4MX7A 3V8OA 1FPTL 1RZGA 1YEKL 4ODXB 4OFIA 1T03H 1A6TA 2Y7QB 3EO1A 3P30H 1VADB 1OP9A 2R0ZL 4HMCA 3O8XC 1HH6A 5T1MA 1MCWW 2PN5A 2QSCL 4NHUA 5C86A 3QDHA 4YWGL 4NZRH 1MHEB 1E4KA 3IDGA 5DQJB 5FGCE 3L5JA 3SJVD 4TYUA 4TQEL 3N1MC 1S5HB 4HBCH 1YN6B 5FYKH 3C6LA 4NZJA 5K9JL 1YMHB 5AEAA 3QQ9C 3L3HB 4UTAH 1NKOA 4MHHG 3T77A 1YEDA 4LSVH 5FUCC 4MAUL 5C70A 3GKWL 1PKQB 1XH3A 2G75A 4WI3A 4ODHL 3O3DA 4NC1E 1F58L 1KELH 2ZNXA 3HZYB 3OGCB 3RVXD 1FVCB 1YPZF 5IVXF 1JPFB 1R3IH 4OAWB 4KMLB 2WBJD 2ZUQB 1D5XB 2XTJC 1CXLA 1JTOA 1BBJA 4OV5A 4A6YL 1G6VK 4M4RA 4LARL 4M7ZC 4NGHH 2BY3A 1T04A 1IEAA 4WGWB 4XCYB 2X4TB 1DLHB 3G6JF 3MV9D 3FB6B 5F88B 1WBZA 2PYEB 3GZKA 1K2DA 5I1CL 4YH6A 4G8IB 5TF1L 2DN7A 2XNAA 4DUVA 2VZ1A 3W2DL 1PZUB 2WWMD 1U8NB 1CGUA 2VDRH 1XF2A 5F88A 2DL9A 1HH9B 1NBYA 3JV4B 4E0RB 2X7LB 5F7WC 3MRLA 3CPLB 2FWOA 2PF6A 3HNTH 3PWVB 3G6AA 1ACYH 3I02A 4HUUA 3NH7L 3L5IA 2APWA 1BVLB 1NGPL 4MCYB 1H5BB 3OF6A 1IE5A 5D6CB 5BVPL 5I1KL 1DE4B 4QEGA 3PWJA 3QXDA 4P4KB 4LQFH 4MQTB 3ARGB 5BW7C 1N5YH 4YXLL 3QO1A 3RBGA 5GS3A 2AXGA 1CU4L 2X1WL 4BSJA 2GK0A 1KN4H 3AFLA 1KIPA 5IW3A 3U0WH 2NY5L 4HMEA 4JPIA 3PGDB 4GKSB 3S3JA 3EUUA 3DMMA 3STZA 3MJ9H 3KPSE 2F5AL 3MRQA 5T3ZH 1NC4A 4K23L 1N2RA 1KYOK 4OTXH 4P23A 1IFHH 4ZPTA 4DK6A 3UJJH 3FQRA 2Q86A 1MLBA 5HXMA 5IFJA 3KXFD 2FHFA 2OCFD 1P84J 4AEEA 5IKCA 2BSSB 3IDGB 1ROWA 1RJYA 4XXCA 4AQOA 3U0TB 3TLRA 1I9EA 5HGDB 1D9KA 1Q0YL 2R4SL 3VMPA 2R39A 1D5BA 5JNYA 2YC1A 5IQ9B 3EOBA 2MSPA 3GEWB 4KI5E 1CLOL 5C0EA 1IGCL 3AY4C 1KTLB 1RULH 4TUOA 5FO9A 3NOIA 2J6EL 3BXNA 4MX7B 5ESAB 2YC1B 3MRNA 3QJHA 3RY4A 1RK0A 1UA6L 2DM3A 1A6ZB 3H8NA 1PLGH 1QOKA 1UG9A 5SWSB 2ARJB 4F7CB 3T4AB 4GAYB 5D8JL 5F9WC 4OGAD 4W4NA 3MTRA 3WS6C 4F15B 5J11B 3IVKA 1Y6KR 1JNNL 2VDKL 1EGJL 1L9NA 4L4VE 1Y18A 1EXUB 3EDDA 3PQYD 1GPOL 1MFBL 4U1LB 4AIOA 4NQDD 3MJ8A 3UZQA 1RZKC 2GITB 4D9QD 1N8ZB 2CJUH 3BISA 2R56L 5D96B 3D3VE 4M1GL 3G5YB 4MJ6A 6FABH 1EVUA 3CSBA 3NCBB 1QA9A 5FYLL 3NCEB 1CXIA 2BSTB 3WCYA 1F3RB 3QEQE 2FECI 1U8HA 1UM5L 5D5MA 2VXQH 5E5MA 4YDIL 3IJYB 3ZYZA 2AEPH 4X98A 2VJXA 3ARFA 5TQ2H 4MCYA 1S7WA 2HVKA 2F15A 5L2JB 1YY8A 3OSKA 4E41D 3OKDA 1AQDB 4KMQA 4KPHL 1JF6A 1RHHA 4HKJB 3SY0A 3EIFA 1CVRA 5D93C 1F11A 3V2AR 1YDPB 3PP4H 3MV8D 4F7PB 3V0WH 3L3JB 3TT3L 4AK1A 1MFNA 3O2VH 1C08B 3UTSE 2R9HC 5C0AA 3RL2B 5C0CB 3T2PA 4Y2DC 5ETUB 4ZTOL 1LEGA 1QBBA 1TJHH 1YC8A 3C8DA 3EZ8A 3O4LA 3PABA 2QQLH 2HLAA 3HE6A 4M62L 5CIPB 4TSCL 5TDNB 4LASL 1RMFL 1VFOA 1DANU 3OGCA 1FNSL 4P46B 3MMEB 2GY5A 2ZOLA 1NCAL 4JKLA 2E9WA 3SQOL 1HHKB 4NQSA 4JO4H 2Z92A 3LRSA 4EJ1C 4P46A 5C0JB 3KDMB 1J8HE 3JUYA 4ODWB 2CLRB 5EORL 4WV1B 4YXKH 2XZQH 4NQXA 4MS8C 2CO6B 1NAMH 1FNEA 1KJVA 4HH9A 2OLDA 3RIAK 2YD1A 4XPGL 3MJ7B 3VXUB 4QRUB 1DBMH 4OLZL 2UY6A 3REVA 2MOVA 4N0YL 1J8HA 2CR6A 4DUXA 5HHVH 2JELH 4IRJC 1A1MA 4OCMC 1SEQH 3H7BB 3E6FA 1RZGB 1AR1D 1Y6NR 3VXUE 5F8RC 2NW2A 4RGNC 4ZUTA 3MLSH 4RX4A 5CZXC 5E8OB 1QNZH 1E4WH 1I4FB 3O81A 2X09A 1HNFA 4XNZB 4KUCF 3WBDA 3N9GL 4U1SA 4U6YB 3EO0B 4C83A 1I9IH 1ZA3B 5D7SL 4LSQH 5E8EB 3T2NH 4O02H 5CJ5A 3ZTNH 2DQTL 3G5VB 4M48H 5D7IA 5KN5A 5BZWB 3G6JB 4R8WH 3CFCL 4G6KL 1E28B 3RTQD 1ES0B 5E6IC 3TNMA 3U83A 4JFYB 1F42A 4UINH 1U6AL 4Z77A 1HINH 2NY3D 2EH8H 4PJEA 3N1PC 5DD5H 4KRLB 3VH8G 3I2CL 3LHPL 2CXKA 3EYUL 5D72H 3JVGC 4HKBB 1T4KB 3QIWA 1NKRA 1V3JA 4R26L 1I7TA 5GIRA 1RJCA 5I8CA 1VEMA 1IAMA 3AS2A 3O2DL 2M26A 2ILLA 5FA4A 3W0WE 3LKPB 4WIQA 1CDBA 3QUZA 7CGTA 3IDXH 1B9ZA 2GJZB 2H6PA 1WGOA 4CVXA 2PW1B 3ET9F 4KKCC 4X7TB 1NMAL 3WS3B 3VXMA 2NY1C 4KAQL 1D6VL 5C0BB 2CSPA 5MEQA 1FG2B 1GC1H 1U36A 5TDOA 2VQ1A 4GG8B 3BMWA 3HUJA 3R06A 4UDTA 5IBLD 1QBMH 1YEIL 2GW5A 2IPTL 2DQEH 4U1MB 5DVLA 4TUKH 3AY4A 1ZT7A 3LKRB 4NHCH 3SE3A 4L1HA 1SHMA 5INDB 3QUYD 5F70A 4PJBF 3CDGA 4X7FC 5DI8A 32C2A 4NUJA 4YXHL 1AE6L 3EBAA 3BEWB 4JE4B 3RWJA 4APQC 1QFUL 3BZ4B 4JPKH 1AGCA 4Z7WE 1XF1A 3JTSB 5BVJA 3FO9B 2XWJB 3DXAA 3SPVB 1FDLH 3X3GH 3G6AB 4X80L 4CN1A 1N6QL 4KJYB 4WTZA 2BRRH 3M17B 4K7FB 4Z0BH 2A1WH 4ONFH 4NN5C 5L8LB 1LE9B 4XTRC 4JRYD 1C1EL 1DBBH 3LIZL 1Z0MA 2XZCH 2W9LA 2Y4SA 3LEYH 4B53A 3TEUA 3C6LD 4K3JH 2D9CA 3O3EA 1N3NA 3QCTH 4LCIH 5I8OH 4PRHE 5SWZB 5IMOB 2I60L 1L0QA 4FXKB 5TJWK 2JB5H 2ZWLT 4KZEL 5DUMH 5ACMA 5INDA 1F4XH 1U95B 4JY6B 2NXYB 1S5IH 1B4JL 1TMCB 1QSFD 5DMGC 4NZRL 1JGEB 2YRLA 5E94A 3RPIB 1I3RB 1TVBB 2KBGA 4X4YB 3HG1B 3TV3H 5IB2B 2V9RA 3EYFA 3MRGA 1UWEL 5D6DC 1MCOH 1TPXC 5KSUB 2RFXB 4P2YA 4PJDB 3LS5L 2VZUA 4QRQB 1BD2A 4U3HA 4NKDB 4UIKH 3WIHL 1BF2A 1K8IB 2P42B 3EYSL 1DL7L 4NZTH 1TJIL 5D7IB 2BMKB 2CLZA 5I6XB 2JJTC 4HS8L 1FL5A 4U1NB 3SE8H 1V7NL 3QSKB 1IQWL 1YPZE 5F1IA 3MRJB 3EYOB 1J1OH 5FV1L 4ZODA 5EC2B 4DOHE 5DQ9B 3PWNB 1FLTX 4YQXL 4OB5L 1FG9C 1NCCL 1QHPA 3ARSA 2G60H 4JFFB 3OAUH 2CK0H 2H3NB 4OLYH 2RCSH 1S8DB 3VW3H 4PJGA 4J4PD 3MUGA 3A6CH 3W2DH 3S3SA 3O41A 1KPRA 4N90D 4I9WE 1T5WA 4XCNB 4WFEE 4JREB 2UV3A 3FONB 4QRPB 1G7HB 1KG0B 2P48B 4TVPH 5D2LE 5I1HL 5BZWA 3ULSA 2O5XL 1FFQA 4LSDA 4QRSB 5C07B 3U9PH 2ZSWA 5ITBL 4N5EA 3LQZB 3RA7H 5C0GB 3P11H 4KXZH 4PJCB 1T7VA 3T0ED 4EIGB 3LCYA 3GK8H 4RX4D 4ZNCD 3MGTB 2MQCA 4Z78A 4ONGH 2VZSA 1N5YL 1KC5H 2CRMA 3C9NA 4EI6B 2ORBH 1U91A 4KDWA 1RUPH 2OK0L 1YJDH 4OJFH 4D9RD 4WUUB 5KVDL 5D70H 1KCUL 3IDUA 3U0WL 2OR9H 2Z4QB 3H7BA 4FOMA 5EUOF 2O93L 1T1ZA 1O7VA 2QHRL 3U6RB 3RWHB 5CSBA 3OJDB 4MNHB 2XN9E 4P4KC 3ARGC 4PJHA 4NKOA 1S9KC 4LAQL 3NCYS 5CZVL 4WW1B 3GSVA 4TNVF 4PS4H 1UVQB 2O5ZH 1XCTB 4JY4A 2OTUA 3GM8A 2D7MA 4RNRB 3QNXA 3KLHC 2EKSA 4LL9A 5JDSA 3LKSB 1QFWL 4LRIC 3ZE0E 1BFOB 1TJGH 1WCBB 2V17L 3KVQA 5CFHA 5L8KB 5HYQB 5JHDE 3PWPE 4N0UE 4M93B 4OGXH 4Y19A 1F3DH 1NCNA 4FXKA 1A7QL 3DNKA 3REWB 3IXAA 1YNKH 3FCTB 1LD9A 4JB9H 1MJJB 2ZG3A 4S0TD 3T1WA 1HI6B 3JV6B 1N6UA 2ADFL 1ZHKB 3MCKB 3VXMD 1X7QA 4LKXB 1ZT7B 3QZWA 1BBDL 5I0ZA 3HA0A 2F74B 4PLJD 5DLMH 3DO7A 5D9SB 2AK4E 3O6FD 4K7FA 3L95B 4CVZA 4E42B 1LO3H 4M9PA 1FL3A 5D1ZC 3F7YA 5TE7L 1RIUH 4PJ9A 4NNXB 2KH2B 1NFDA 3H0TB 3PP3K 4F15C 3SO5A 2LTQB 3B3IB 3SBWC 1OSZA 1G7PB 4P5MA 2HLFC 1YNLH 3SDYH 1UWXK 5FO9B 2DMKA 3WDIA 1IKNA 5L0QB 4KTEL 4QLRA 5FKPA 3OL2A 5DZOA 2VAJA 3SE4C 4CADA 3EJYC 4IM8A 2BVPB 4UQ3A 4JGUA 3Q6GH 3FZUD 3DO3A 4U7SA 3O3BB 3VFTB 5MENE 2ED9A 1GGCH 3S96A 3IDMA 3T0BA 3MLVH 3MSPA 4JPIB 1CE6A 4WRLA 3VFTA 4K8RL 3STZB 3G04B 4FXLA 5JOEA 4NP4L 1K6QL 3B2VH 4KDTA 3FB7B 2XA8H 2VITA 2BNUA 5EO1B 5IEKA 4MMZC 3HI6H 1ZEAH 5E2UL 1LO0H 5C0EB 4Q58C 3ZYOA 3IF1A 4NZDA 1CIUA 3HE6D 3WE6A 1W0WA 1YN7B 1U41A 2JB6B 2XZQL 5C0NC 2F53A 4JM4H 2XXCB 3WKMH 3OKLB 4RGNE 4L9LA 1FFOB 3CPLA 5JLZA 3OMZA 4YDVA 1CDIA 2RGSA 5DMKA 3VRJA 4WI6A 1C7TA 4D9LL 5HHVL 1CE1H 1JMZA 4XPTL 3S4SG 4F7EA 3LS4H 3B5GA 3LKQB 2YPLB 2QQKH 3PE9A 1FAKT 1ZHKA 3UAJD 4U6HA 5KAQF 4QRUA 4AM0A 3D85D 5HI3C 4X4XB 3QA3A 1FV1B 4BZ1L 3RKPA 4U6YA 1ZT1B 1DQTA 3PUCA 4Z8FL 5GGVY 4NSKA 1F8TL 4N8CL 5EU7E 4LU5H 4PJDE 3GGWA 4L3CA 5E9DD 4G9FE 1AIFA 4JO1H 3DLQR 1CICC 5FM5M 5DUPH 2XYCA 5E8OA 5TPWL 3AGVA 5IW6B 4KU1A 4F3FA 4LSRH 2VLMD 2FWOB 4PJ5E 4GUPB 1JFMA 4KKAD 4H88H 1TQBB 2YPKB 4ZS6D 1CF8H 3JWOL 3W9EA 1CVSC 1MJJA 4F58L 1K2DB 2FX8H 1ZV5A 2E7HA 5DMJB 5HHQA 3EYVA 1F11B 4APQA 4LLDA 5E2WL 1TETL 2ICWB 2NZIA 4HFWB 2EECA 4OV6F 4UUJB 3QNXB 2H6PB 4NO3B 1HIML 2EC9T 3LKPA 4EDXB 1ZLWK 2P7TA 3RZWA 1ETZA 1KJMA 12E8L 3MGTA 2HLAB 2BSRA 2NNAB 1NAKH 3BKYL 3IS0X 1NMAH 1CZ8L 4ODTH 3T0XA 9CGTA 3TN0B 2QADC 5L8JB 4ETQB 5IB4B 4MDJA 4C56B 2HRLA 1NBVH 5EOQH 4MDIB 2R1WA 5CJQL 2WQ8A 1FO0A 5BRZE 2OSLA 2DLGA 3B6SB 1T0MB 3RIAF 2OM5A 1FIEA 1YECL 1ZMYA 3LN4B 4HKJA 4NM8L 4NO0D 1WBXA 5E99L 3T65A 2DTML 3QG6A 1NGQH 4IMLB 1WEJH 1NEZG 3IU3A 1QSFB 4IJ3B 2FD6L 2ZUXA 1GYAA 2UVFA 3P3YA 5DHVB 4XT1C 5GGQL 3V6FB 1MCSA 4FXGB 3QUYA 1G7LA 1KJMB 5FYJD 2WP3T 3OZ9L 4Z6AT 3C2SA 4HIXL 1N6QH 2NY2B 3FMGL 1TFHA 2KZWA 3E8UH 1YQVH 4NKDA 4KRNA 1F00I 1JZ7A 1F02I 4HUWA 4GG6F 4OF3A 1FIGH 4MXVF 4AEFA 4DGVH 1SQ2N 2VLLB 1HHIB 4XRCA 3UBXA 5CSGA 3NAAL 2YA1A 4HGMA 4P9ML 4Y16B 1P7HL 3Q2CA 4MQSB 5HYQA 3HS0A 2JF1A 1JYXA 5CJOH 1MHCA 3QFJD 2EDFA 4X8JA 1NL0H 3MGAA 5CCKH 4QHNB 4XI5C 3H3BC 1TTFA 5C0CD 1BJMA 4FQCL 4N8PA 4KJWD 2PO6C 4RIRA 5EUOE 3P73B 1OT1A 3G08A 1OGTA 4G8GB 3JWDC 1V7ML 1AO7A 4M7LT 4Z7VE 5JHLH 4GBXD 3ZHKA 2AV7B 4HS8H 3UJTL 1S7TB 2FHCA 5B21A 5C7XH 2DQFA 4NCC2 3WFEL 3LKQA 4Y2OA 1IEBA 1BECA 1DUYA 2CKBB 4FZEL 1QSEE 5LXGL 3RTQB 5E8PA 1KT2A 2FGWL 2FJHB 1BF8A 1NCCH 2CDEA 1IILE 4GQ9L 1JYNA 4RZCB 2EE2A 3QO1B 3T0EA 1FE8L 4GAJH 4D8PB 5HGBA 3ARGA 3WDJA 2HT3D 1KT2B 1MH5B 2DBLH 1VESA 1UZ8B 1BFOA 1AIFB 5FYKE 1KELL 2EZ0D 3ARBA 1P1ZA 3QQ4B 1PAMA 4WWKD 1B0RB 2X9XA 3QXAB 2PYFB 4NNYA 5FK9A 2WBWB 1QR4A 1KCRH 3QNYB 3OG6B 1H3PH 2PTTA 3GB7A 3K4AA 4Y16D 1XGPA 3KR3L 5HHMD 1NFDE 3NACH 1KCGC 1CFQB 3D9AL 4QRPA 3MACL 2L0DA 1U8NA 2EIEA 2JCCB 2C3HA 3VFWB 4TSBH 3RWEB 2XN9A 2X1QA 1CN4A 1IGMH 1XT5A 5KSVA 3QUZB 4OJFL 4K07A 5TE6L 4OD2A 3U7YL 4X6CB 1SYSB 1X5IA 4ODVL 1KCLA 3PWNA 4X6CF 4X9GA 2Y07H 2NY3C 3CFEB 4GXVL 1HKLH 5HHOD 1RUMH 2I5YH 4OAWA 3V4PL 1T89A 1TNNA 4POZD 5EBLA 1ZANL 1ACYL 1RURL 4X6CA 5E6ID 4KK5D 4JG0H 5TDOB 1FG2A 2NCMA 2WWKO 3MFFB 5FM4A 4CMMB 2PW2B 4Z0XA 3HMXH 4HIEA 1QRNB 5ICZB 2ZSWB 1Z9OA 3F7YB 8FABA 4FQXD 3V6ZA 5IFJB 2RIKA 1FNAA 5DJXA 3T8XB 4GJTB 5GGSB 1QFWH 1JYWA 1YEFH 3D69B 1SBBA 4MA3A 2V17H 2WV3A 3CX5J 2ATKB 2G2RB 4AH2A 3VGGA 5JXED 2AERT 4KXZI 2FR4B 3FFCB 5IEHA 3FOLA 3FCTA 5HY9A 3TH3T 2ADFH 4U1GB 4QXTA 2WW8A 5SWSE 4DEPC 3U4BH 1NBZA 4NDMB 3UX9B 1J0ZA 4KJPD 1N5AB 3TBVA 4XWGL 1JUFB 2QL1A 4Z7WF 2GIYA 1A64A 2A2QT 3BDYH 3G5ZB 4PV8B 5TE7H 1U8IA 1B2WH 4HWUA 2JJVA 1S9YB 4Y2DB 2Z0BA 3L5WA 2NNAA 4JFEE 3CDYA 4G43B 4U49A 1CLZH 1CICD 4JDVA 3BAEL 3FO9A 1AGDB 4PY7A 2YN5A 4RAVA 1FJ1B 4P2OC 5IMKA 3GMPB 3HG1A 1AKJA 3SE4A 1X9QA 3MBED 1YEKH 5C07D 4ODUA 4LRIA 4JFDB 3BN9D 5J6HA 2R9HD 1GPOH 1I1AC 1MFBH 2NMSA 4MCZB 3EJYD 3VFRA 4M43L 1VEPA 3H2WA 5ECJE 4HWEH 4PLOB 3MRMA 5F7MC 2LTQC 4PRHA 1LP9B 3SHSA 5IMOA 2W60B 2A74A 1T89C 3DV4A 2P24B 2F5BH 4UILL 1IM3A 2QKIB 5HHOB 3IFPA 4LSVL 4U4BA 4ZAKA 4WFGD 3HZMA 4XZUB 3P0VH 3U36A 1F58H 1XGTB 4ZD3L 1I9JL 2AXFA 3P4LA 2Z8WC 4I0CC 4NKOB 1PKOA 3MRFB 4QRSA 4QGTA 1C5DA 5I1KH 2DYPA 3QI9B 2GAZA 3TBVB 3FO2A 3GGWB 3RY5A 5HGHB 4JCLA 1KPRB 4WI8A 5ETUA 3UJIH 4LARH 4NGHL 1CFBA 1SJHA 3TFKD 2FGZA 2VDMH 3FRPG 4PJGF 2PYEE 3QYCA 3QEQB 3TBTB 4G6FD 4LP5A 1OW0C 1R0AL 3NABH 5IMMB 3ARZA 2YD7A 1F6AA 3TVMB 2HJKB 1RZFL 1LO2H 4KK8D 2ERJB 1ZGLA 3ZO0A 4KGJA 3MV9A 4NJAH 2FX7H 2XV6B 3PWLB 2VRAA 1JHKH 4XNQA 4PP8C 3UTSD 1JFQH 1A1OA 4Y1AE 5FHAH 4F7CA 1QRNA 1BIIB 2IAND 3NH7H 1KCSL 2PETA 4MAYD 2PW2A 3U9UA 3QWOB 4QHUA 4NHUE 2HLFD 3X11A 1M7DB 1T5WB 1BQLL 2NTFB 3MRCB 5AZEL 2D9QB 4MQ7A 5DO2C 3X17A 3ARGD 4P4KD 1RULL 4OLZH 1ZT4B 2BNUB 5EO1A 2DL2A 1FNLA 4EUPB 5IQ9A 4LEOB 3SBWA 4H0HB 4LBEB 1JRHI 4WHTB 1BM3L 1CBVL 1T4KA 4R2GC 4MJ4A 4TULL 3MJ9L 1RJYB 3OV6A 5CKGA 3NIDE 3VWKB 3DVNA 1I3GL 3S96B 4LEXL 4BQCA 3IFOB 2VDKH 1T7XA 3AC0A 3F7VA 1BZQK 2DTSA 1CD9B 4L29A 3NCCB 2V5TA 5IWLC 1G6RH 2B20A 2UZIH 5I6XC 3MRDA 3KPRB 1NLDH 4N9GB 5DMYA 5DRXA 1IAIH 4LKCB 3KPSB 2C7UA 4HIHA 4YGAB 4R8WL 2IF7A 2P7TB 3TZVA 1B0GB 3H9YA 5I1DA 1KUMA 1E27A 4GW1B 4W81A 1I1CA 2P49B 3UYOD 2J6EH 2AJZB 1HINL 4NQDA 1TTUA 3P0YL 1UA6H 1NUFA 1BQSA 3V5KA 5HHPA 1MRDH 5SWSD 2DRUA 4KK5C 4JREC 4YNYA 4GOSA 5CAYB 3HI5H 1Z2KA 3FAXA 2Y9RT 5IQ7L 5GZOD 4BYHA 2SEBB 2DLFH 4OZFB 4Y1AD 1A2YB 1FGNL 1NUGA 3SDDB 5JXAL 1U8PA 4P2RA 2XZAL 1MHPL 4IOFC 1I9RL 5FOJA 4O2EB 5K9KA 3REVB 4M6MH 4WTZG 1LEKA 1WLHA 3O2VL 1BQHA 2NLJA 5JLZB 5AWNL 4MVBD 5FF6A 1LDSA 4D0CB 6FABL 5HDOA 1PFCA 1U58A 3WNNA 4IRZL 4OSUH 1T22A 3MROA 4TVPD 4K7PX 1JGDA 2CLVB 2ESVD 3ULVE 4UV7L 5DI8B 4YBQC 1JPTL 2VL5B 1DVFD 1WV7T 1N8ZA 2XA3A 4LGRB 4IJ3C 3ZE0F 4AEHL 2P4AB 4MXQA 1XF4B 4PRAB 1MCLA 1YMHA 1P7QD 5AG9A 4LNRA 1HXMB 5JW3H 3O8XD 1SJEB 4P9MH 3VCLA 5I2IA 5GHWL 4KKBC 1CICA 3DX8A 2DI7A 4JPKL 1UXWB 2R23B 2A9NL 4HGWB 43CAA 1JI2A 3B5TA 5GJSL 2CD0A 3HPLB 3P9MB 4HZLA 4KI5F 4XNUH 4JJHA 5I19H 3PWUA 5I71B 3SGJA 1U3ZA 1S3KH 2BY0A 4U6TA 4ZS7H 3DV6B 4K94H 3IETB 4Y5VC 4V1DD 4YZFE 5EIIB 5ID0A 1XGQB 1ITCA 4CDHA 1PQZB 3QIUA 2HVJA 1MIML 5D5ME 1NDGA 3KPSA 1FL6A 1CXHA 2W1NA 4I1NB 3DJ9A 4U05A 5C09B 2RQ8A 5IB1B 4OI7A 5ISZB 3OPZH 3B3IA 1O5DT 3QFJA 2C1PA 4Y19E 2A77L 1AXIB 2W07A 3BKML 4KZEH 4R4FH 3CMOH 3ARBD 2BNRD 1IAKA 3MNZA 2MPAL 4UINL 4P46D 1JIBA 4NPYA 5C0FB 3BYYA 5KZCD 3VXTB 3V6OC 3MNZB 2FX9H 5F9JA 5IIEA 3WV0A 2NTSP 2J8UA 2R1WB 5A16A 3C08L 3KAAA 4LVHB 1HQRB 4MYWB 2BC4A 3EHBC 3OAYH 4HH9B 4DKFH 3S5LB 4M6OL 3ULUE 3BKCH 4WY7H 1EEQA 5DFVC 3CLEH 4QHKI 1R5IA 4U1HA 3C6LC 4WEBL 2P46B 3V9FA 1FL5B 4U1NA 2HVJB 4HK0A 4KHXH 4E41B 5HVFB 2A0LD 1U8MA 5CEYA 1IQWH 3C5SA 2GTWA 4EKXA 3LKNA 5IW1A 1MVFA 5F71A 4DOHB 3VRIB