4EN3C

Crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
270
structure length
257
Chain Sequence
b'FPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPLLLVCHVSGFYPKPVWVKWMRQQGTQPGDILPNADETWYLRATLDVVAAGLSCRVKHSSLEGQDIVLYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The Molecular Basis for Recognition of CD1d/alpha-Galactosylceramide by a Human Non-Valpha24 T Cell Receptor Struct. Title
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 257
sequence length 270
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4en3C02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4en3C01
3SN6N 4RGOL 1XEDA 3SDAD 5FYJD 3CFCH 2IGFL 3T3PE 3VFGL 3NAAH 4O58L 1H15A 2UZIL 3W0WB 4XVJH 3U6RA 3RX8A 1RUAH 1TVDA 2VOTA 5DEGA 4F9PC 1CGUA 4UB0L 5GGSA 3ROOA 4UT9L 2GTWA 4N5ED 4WFHD 1ZS8A 5DLMH 3FT4B 2NX5D 3MJ9H 3ETBF 4FQ2H 2E8YA 5CEYB 4HUMB 4L9LB 3PWVB 4NO2B 1I8IB 3WDIA 4L5FL 3BQUC 1NDMA 1AGEA 4MA3B 4A6YB 1U42A 5E6IC 4OZFA 4XWGL 4HV8B 1ZLSH 1OTTC 3HNSL 3TCLA 4F58H 1BJMA 2XZAH 4KK8D 2VQ1A 2JB5L 4DEPC 1FNEA 3OAYH 5JHLL 2BNUA 4GG8A 2XTLA 4NZRH 4Z7UA 1LO0H 1RJZB 2UWEE 4WGVB 2XWTB 4G5ZL 3B5GA 4MDJA 3UROR 2VDNH 5CUSL 1T7ZA 2DF3A 3OR7B 4JFEE 3KYNA 1H5BA 3RA7L 4GBXB 1F6AA 4U4BA 2ZOLB 5E6YA 1MJUH 4CVXB 5E8EA 3X17A 4J6RH 2Y5TB 1QVOB 4KPHL 4ZFOA 4XMPH 1BLNA 1N8ZA 4U1JB 3BD3A 4M8VA 3MRQB 2KKQA 3IFLL 3B9EA 1I8LC 5DDHB 4PJBB 4JLRB 3MOBH 1TNNA 4XI5D 3P0YH 5GGVL 5I1HH 2AGJH 2ZOKB 4NNYB 3IKCB 4KI5E 2Y07H 4W4OA 2XICA 2YA2A 3WKMH 5GS0C 4HUKB 1S8DB 3ESUF 5KG9A 5D5ME 3HAEB 1PDKA 4PLOB 4S11A 5DK0A 4EZMA 1DBAH 3PJSB 4KK6C 3SE3A 4LEXH 1NUDA 2OCFD 5ISZD 2JE8A 4GS7C 5A2LH 1FORL 3TWCH 3VFOA 4YE4H 1KCSH 2HRLA 4MNQA 5T3ZL 2EDWA 1UCBL 4L3EB 1ZGLP 4LPVA 2FO1A 4J12A 1NCTA 3MV11 4Z7WA 2X70B 2QTEA 1TQCB 3O0RH 5AWNL 2ZUSA 3ZE2F 1I4FB 2FATL 4JE4B 3JWOH 3LS4H 3RI5K 2ZSWB 4M1DH 1JUFB 4PJ5A 4Q6IA 3ARBA 4JN1H 1QP1A 1QSVA 3I85A 4Q7DA 3VFSB 4KUCF 3X3GL 4LSPL 4OD1H 2CD0A 3HI1B 3MTRA 1KYOK 3GSRA 3K4DA 3LIZH 4K23L 2Q87A 4XCCH 3VXUA 1MUJA 5INDB 1RZIB 2QHLA 1JPTL 1YYMH 4LAJH 4GRLA 5EOCH 4JREB 1M7IB 3I75A 2W9DL 4QXWA 1JN6B 4U6XB 3LKRB 1KIQA 3KLAA 3KPSB 2R29L 1HINL 5C6TH 4EQ3A 3I3DA 3LSOB 2Z93A 1BP3B 3UXFA 1E4XH 1FO0H 3HB3D 1G7JB 1RURL 5D7JA 3EOTL 3S7GA 4AG4L 4P5MA 2FD6L 1IM9D 1J0JA 4XPAL 5DZNA 5DQ9A 2C1OB 4R7DA 1D5IH 3UTTE 5JA8B 1X44A 4P5TA 5DT1L 4MB5A 1VCAA 5AZEL 2UY6A 1QBBA 2UWEB 3C9NB 1YEIL 3NCYS 1DEEA 1CYGA 4FMFA 4CADA 1MI5E 4PGZA 3EO0B 3ZL4L 4JFEB 3PABA 4LRNL 2R2EA 2AABL 1C8PA 2L7UA 3ISWA 2B1AL 1KF9B 4L4VA 3U46B 1YN7B 3THML 1R5WB 4Z7WF 4NDMA 1H8NA 4HC1H 3T2NH 3P4OA 3U4BL 3V6ZB 3EYSL 3VGEA 4C83A 4LGSB 1F8TH 3B9KA 1FZKB 4YC2C 3C5ZB 1T21B 1RUMH 3LEXB 4L8SC 3P4NB 4XX1E 3V4VH 4PJFE 2I60H 4DEPB 4Q9QL 2NY6C 4OLZL 3WSQH 4NO5A 3WXVL 4FFWD 5ERWA 4Z0BH 3RWIB 4RBPH 1JZ8A 1BAFL 4NJAH 1G7IA 2Y25A 4OCRH 1BOGA 2YUVA 3O9WC 4UTAH 4IOIB 3KPTA 5MENE 3NCBB 3IT8D 4NUGL 5TF0A 3MRHA 3ILQD 5D5MB 4X5XA 3DUUA 3C5JA 3ZKXC 4EKXA 3VFRA 4KDTC 4UBDC 4GSDL 4V1DA 1IQDB 2NY1C 4QRRD 3T0EC 4MDIA 2X89D 3KPOA 3X14A 3P11L 1EEYA 4JM2D 2E27L 5EBWB 5CGYC 5LAXB 2FH6A 3O8XD 2OS7A 2CSPA 3BKCH 4G6KH 1BVLA 4IJ3B 2YPKA 3FQWA 1UZ6E 2HA1A 3A6BH 2CLVA 5FGRA 5CEXB 1NLBL 5IBUB 3C2SA 1U8HA 2FSEB 43C9A 2AK4D 4OT1H 5C0CA 3O2WH 1V7NH 1NAMB 4UIMB 3ULUL 2HAZA 3GSWA 1MAJA 1QBLL 3FB6B 2VYRE 5B3JE 5I9QC 2JCCE 3QIUD 5AG9A 3SDCA 1FCCA 3VXTB 3D39D 1HH6B 2PXYB 1YY8A 4X4ZA 4YXKL 4AY0A 4NZTL 3OJVC 2Q6WB 4X6BA 2UZXB 5MEOA 1BQHB 1A6VL 4GS7B 1SVZA 3W5MA 2I9TA 4L9DA 3PGCA 4GQ9H 1QQDA 2Y06L 3KPRD 4FQXD 1MHPH 3KJ6L 4ZYKB 3CK0L 1JFQL 1WVZA 4GKZA 3KYAA 4JGUA 2OMBA 2A73A 3VXSD 3AB0C 3JV6A 3EKCA 1WLHA 5IHZB 2VDPL 3S5LG 2F9BT 3X12B 1LO3H 1GC1L 4QOKD 1X5GA 4XP1H 4CU8A 3T0AA 1FLTX 3BT2L 5C2BL 3MRIB 1J5OL 4PRAA 5FKAA 1LDSA 1HXYA 3N50A 5KVDL 1TVHA 4A6YH 5FHBH 2F53D 2MQ0A 4J1UB 3LN4A 3UTTB 4XBEL 4R4NC 3IGAA 4ZNEA 4XNXH 3V5DB 5DSCB 2HMIC 1KT2A 4Y5XA 3S3JA 3WLWD 4OUUB 4KVNH 3TJHA 1MI5B 4PRBB 1QHPA 5LGHL 5I74C 2KQMA 2Q7NA 3L3GA 5IQ7L 3FN3A 4XNMB 3FONA 1CK0H 5JDJA 4Y5VC 4OSUL 3RX7A 2NY0C 3CXHK 3TCXA 3FT3A 1WZMA 4KKLC 5E99H 3UYPA 4K9EL 5FYJL 5FOJA 3NA4A 4OFKA 5EFIA 2IAMD 1JNHB 5GGSY 1FPTL 3E1F1 4QRPA 4PJFB 4D3CH 4JZOB 3ILPA 1KGCD 1I1AC 3GHEH 2VH5L 3VXNA 5ADPL 2XQYK 4L8CA 4NO3B 1X5IA 5FUCE 2B8OT 2YS4A 2V5MA 5MENB 1CLOL 4M8QA 3RWEA 3VXMD 3ZKSD 3EO9L 4MSWB 2VLJA 3MCLL 1CG9B 1A3RL 1CFTA 1HZHL 1IRAY 4H8WH 2NY7H 4RAVA 5HPMB 1KEGH 1RHFA 1JF1B 1TZIB 2GK0B 1GH7A 1KN2H 3L3IA 3FFDB 4MXQD 4YC2B 1XIWD 4L8SB 2DWDA 1UENA 3QI9A 1N6QL 3OZ9L 1BMGA 4GRMA 2LAAA 1AKJB 4OLEA 4I3GA 2HJKA 3MRLB 1IKFL 1IAIM 2D7QA 3VCLB 3FMGL 2NYYD 3GMPB 4FXLA 3REWA 3NVQA 4HS8H 3O9WB 4QXUH 3GSXA 3RY5A 4JB9L 5JOEA 2WUBL 2X7LB 5A43C 2VZSA 1YEDA 5C0AE 5C92A 1MIMH 3D2UD 4PJCE 1JE6A 3TM6A 5TE7L 1AQDA 2X6MA 3V0WL 3ZKXB 2JCCB 5TFSH 1NBYA 4LSVL 2NY1B 5JW5A 1KYOJ 3I6GB 4M9OA 3BJ91 1T20A 4LDOB 2BC4B 4FZEH 2ICEB 4B41A 3KWWB 2Z9TA 3FOMA 4XVSL 1KJ3L 4HIJB 3L3KB 2YK1L 5T1MA 1AXSB 4F7PA 1CD1A 5E5MB 1ZLVK 1A7QH 3PGFH 4LVEA 25C8H 3PWNA 2Z0BA 3MRGB 1E4KA 4LASL 2E9IA 4IDJL 1YC7A 4PLNC 1T7VA 5HPOA 2LU3A 5ANME 2HLAB 4ORGB 4KTDH 3QG6A 4IRSA 3N85L 1FZJB 4B5EA 4WI7A 4NP4H 3O6LL 5I9QB 4F3FA 2ICWA 4WI3A 3J7HA 5F7YC 4DKEL 2PETA 3QCTL 4JFHE 5C8JA 1K5NA 3OKMB 2CXKA 4P46C 4ZXBB 4P2RE 4H0HB 4Y4FA 5TQ2H 1PYWA 1KFAH 5HGDA 3UTQB 4R0LA 3T4YA 4LSUH 1CZ8L 2HFTA 5E7FA 5EBGA 1C1EL 5CWSB 4JRXD 4XGZA 3INUH 1KB9K 4UNUA 3UTPD 4NN6C 5C2UB 3CX5J 1F11B 2F54A 2VDRL 1S9VB 5EWIH 4D0CA 3GMRB 2ED7A 3QDMA 4WWKA 3QHZL 1ZHBA 4HW6A 4AJ0A 4LARH 4O2CA 2Z91B 5E94B 3GJFH 5HGAB 4WFFD 3L7FA 1Q9OA 4KDVA 4HWBL 1RFDL 3MPCA 3QEHA 2H2PD 3TZVD 3TT3H 2GJ6D 3GK8H 5I16A 5I18L 3EYQC 4I48B 5EA0L 3BJLA 5C3LD 1UT9A 3EOBA 1F4WH 3DXAE 5E00B 3E2HC 2VLKA 1WCBB 2KBGA 1C7TA 5GGRA 1Q1JL 4FNLL 1BFSA 2CGRL 1QBML 3GMMA 4WUKH 3WEXA 4D0DB 1NDGA 5EO0B 4Y5VB 4YHLL 3ARGD 4CN6A 3HZMA 5SWSA 1NGQH 5J4MA 1DN0A 1RUPH 3MREB 4OGYH 1HEZA 4PD4K 4WENB 3TBYA 3E6FA 2XWBB 1RJLA 1XCTA 1XGPA 4MJ6A 1JZ5A 1T5WA 5E95B 3WL9A 1WZ1L 3QDJA 5FM5M 2EDLA 1Q9KA 2ARWA 1MRDH 2H1PL 1NGXA 5AD0A 4MXWH 3S35L 4U1MB 4FQJL 3SKOA 4PRDB 1DSFL 4UT7L 2XKUA 1J1XH 3TO4C 1N59A 4PG9B 3DVNA 3DRTA 3D25B 3K74B 3MNWA 4X6EB 4IRJB 1ES0B 2EIDA 1OARH 1OGAA 1MCCA 1ED3B 3Q5TA 2IBGA 3GUTA 1KV3A 2I5YH 4G8FA 2XQBH 5C0AB 3AM8A 3AC0A 4U6HA 6FABH 2DM3A 1TJIL 4PJCB 2QQLL 5GS0H 3MUJA 1ZXQA 1V5JA 1A21A 3DHMA 5DMKB 1N2RA 4Y19E 5BOPA 1VFAA 3P9WB 4K3JH 4HSQA 1FJ1A 4K94L 3IFNL 2PYEA 1ZMYA 5KSBE 4Y1AB 2A1WH 5ALBH 5C0JB 3PWLB 4EDXB 2IJ0C 5JLZA 3QFJE 1OP9A 5I1CL 3I50L 3KYOB 2BY2A 1OAUH 5D7IA 4M61A 4FABL 3BSZL 1NL0L 1KCVH 2YD8A 4EJ1C 5BV7C 3REVA 3BYTA 4NQED 5JOFA 1RAMA 5ANMB 2HJLB 4RQQB 3HI6L 3MLPA 1VPOL 3X3FH 1MHCA 4LBEA 4PV9A 5D2NC 5DRXB 1DLFL 5F1NA 2NXZC 3C8KB 2JLLA 5C0RH 4ZUWA 4OQTH 1EO8L 4NQDE 3MBXL 3QIWA 1P9MC 1T1XA 4N90D 4P2RB 2RFXA 5JIKA 2IALA 2NLJA 4LLMB 5C0NC 3QIBC 3WO3B 3PWPD 4LLUB 5IG7A 1UWGL 2ZCKL 2O5YL 5LBSL 1MAKA 5IBLC 4EXKA 4XXCA 4PTUB 5IB5A 1EHLH 3HMWL 1MVFA 1CD9B 5HVGB 1FL3B 5HHME 1BQSA 2EKSA 1JWSB 3DRQA 2BVQA 2VDML 2AXGA 3DX9B 5SWZE 5FYLE 4HXBL 3B4NA 4ZUSB 2D9QB 4D9QE 2MQCA 2WBJA 5D2NE 4K55A 4MGXA 2CPCA 1LP9A 4LDEB 2D0HA 2E7LC 3OPZL 2VXUH 2OL3B 1U91B 1IBGL 4GXVH 4P46B 2AXFA 2AJVL 1QKZL 3U4EA 4AK1A 5H35A 3JV4B 3QUZA 2VLRE 4KK9D 4CMMB 4M62H 8FABB 3TFKC 5IB4A 4NZUL 3DXAB 3DVGA 4QXTB 1IILE 5MI0C 3MODH 4I3RL 4NCC2 5D4QA 1QFUH 5F9OL 1QSEE 1BZ9A 1RU9H 2VJXA 2QADB 4NN6B 3ZHKA 2RJMA 3ME0A 4LPCA 5D7IF 3ZSTA 4CVUA 4XB8A 1PX3A 5FGSA 1ADQH 1UC6A 4WO4A 1J1OH 2EH7H 1ZGLA 1P7QD 2H3NB 4OZHA 4U6YB 5EB9A 1INQB 5FCSH 1U3HC 4DZ8B 2VXTH 5E0QA 1I1FA 1YEFH 3CVHB 4RIRB 5EN2A 3S37H 4KI1A 4KROD 1D9KB 4TYUA 1Q9WA 3OSKA 3RZCA 5LJYH 3VWKB 1IC7L 1J1PL 4NQXA 4JFPA 5C07A 5HD8C 1ZT4A 1IC5L 5BVJA 1S9WA 5KJRL 5FDYA 2DI9A 5ETUA 3L5WB 4OF0A 3BGFC 2WUCH 3SOBL 5IMKB 5LQBL 4NQCA 5D1ZC 4UINL 2JIXB 3MGAA 3NIDE 1WBZA 1JHTA 3WJLC 5K33A 1CGVA 3NZ8B 4BUHA 4XZUB 4M7KL 4TUOA 4AENA 1JNLH 5E2UL 1RPQA 3GSNL 4HDIB 4OI8A 2ZKHL 2XZZA 1JZ4A 4JHAL 1S5HB 4Y19B 2XXCB 1UM6H 1CL7I 3BZ4A 2ITCA 3FZUC 5KSBB 2X1QA 4P59L 5J8OA 4WDIB 5DK2A 3QFJB 3KNBB 1XF3B 1LP9F 1FL5B 4MJ2A 4DVRL 4JFQA 2IQAA 1Y0LB 1DQQB 1CXEA 3TO4B 4O2FA 3ZYIA 4YPJA 2I9LB 3WXWH 4G3YH 5IFJA 1OF2A 1L9NA 4S2SB 5I0ZA 5JHDE 4UUJB 5TE6H 3WIIH 3S4SB 2IADB 4XNYL 2FGWL 1EFXA 2EYSA 2UVEA 5E8PB 4J4PA 2EIEA 3C09B 3VMPA 4DVBB 3MYJB 2CJUH 4PRHA 1F4YH 4J3SA 1KELH 1ZEAH 4NQDB 3MA7B 1UFUA 5DJDA 3O3BB 1ZT7A 3D87B 1BZ7B 4R26H 4ISVA 5L2KA 3EHBC 5J0BA 4P23B 1MRFH 4FXGA 3P3YA 5SX4I 1KJMA 3I6LD 1A64A 1KB9J 4LKXB 2QQKL 3MR9A 4S1RL 5BV7B 1DBKH 3TPUE 2YBRA 5HHMB 3SO3C 1S7WB 5HYQA 5FA3B 5SWZB 5GGUA 1FN4B 4KAQL 2GTZB 5KN5A 5AYUL 3BP7B 5DJAA 2UYLB 5D7LE 5I0DA 1B4JL 5EU6A 5D2NB 4NN5C 4NHUA 1I3RA 1A6ZA 3KS0H 2B1HL 4HKXA 4L4TE 1CFVH 5BMFH 4MWFB 2V2WA 2VLRB 3MJ6A 1IC4L 3T09A 4Z0XB 2EKJA 1AQKH 3R8BB 3FHQA 4DAGL 3I02B 1JGEB 1JGVH 1F2QA 4V2BA 3QULB 4JCLA 1QSEB 5DHVB 1IGIH 1NCBH 4PRPA 1FLRL 4G8IB 3DBXA 3SGDI 1GOHA 3SQOL 3L95A 3TH3T 1DEDA 1T1WA 3GBML 3BMWA 4KTYA 3H9SD 3SQBA 3UTZA 2B4CL 5J1AA 3SDAA 3EDFA 1CFQA 4N5UA 2HT2C 2IANE 4LSSL 5DRWB 2RGSA 4YDIL 4MJID 3BFOA 5GZNC 1NBZA 5IVOA 3FN0L 3STLB 4N5EA 5F7EH 3SHSA 1HH9A 4MQ7B 2NX5A 1SVCP 3OKLB 1R3LB 1KIRA 3OAUL 1YEGL 2W07A 4H88L 2VL4A 3W9EA 5MI0B 3WHE1 3F7PC 3QO1A 1XR9B 5J6HA 1IT9H 5CD5C 3LRSB 1SJHB 4P5KA 4QHNB 1EGJH 3DI3B 1KN4H 4N1CA 3DMMA 3QUKB 4V3DB 1P7KB 1FYTA 5E9DA 3IJYB 2X4SA 4QWWC 5JDSA 1U3HB 1A7NL 3OG6B 3LKOA 4CVZA 1YUHA 1KTKE 1XH3A 5DMIL 1A1MA 4YIQA 2ZUTA 1NCAL 5EU4B 1MJ7H 3QPQD 4OB5L 3ARRA 3RJDA 5GGRY 3NFSH 4X9BA 1UA6H 3EJJX 1BFVH 4JKWA 1JRHI 2G9HB 3BGFB 5MEQB 3AAZA 4M5ZH 1PLGH 5C0DA 5D1ZB 3UC0H 2CDEA 1HIMH 3BP6A 1HSAB 2V5YA 5JHDB 3S36H 1HI6A 4JKPL 4PJIA 4GRWE 5I15L 4E42B 3G6AB 2YEZA 4OLUH 1JPGB 1JNJA 4MLIA 3UPRA 1UZ8A 5BO1H 5GGVY 3MJ8A 1JWMA 4XWOD 5DO2C 1UB6A 3LAFA 1FE8L 1NMAH 3Q6GL 4WW2A 2UUDH 5J1TC 1XGYH 4MCZA 5D7SL 2NPLX 4MD5B 5BZWB 2J8UA 4EUPH 4ONOA 3FAXA 4HGKC 3O6KL 4APQB 2PTTA 3SE8H 2SEBB 4XVUD 4JY6B 3TPUB 4IOSD 3WFCL 4ODTL 4ZOEA 5EDXA 3GSOB 4KFZC 4JR9H 5ENWB 1KPVB 2OQJB 1A1OA 1EAJA 3TVMC 2CIKB 1G1CA 3FB5A 4BH8B 5D7LB 2X40A 3EYUL 1VKXB 2R56H 1MH5B 4OCYH 2VABB 1H8OA 1K2DB 1OAXL 1YMME 3UJIL 4ELMA 1A7OH 1C7SA 2FX9L 1G9NL 2ADFH 4Z7VF 2P5WA 4I5BB 4BZ1H 4MQXC 4FTVD 4WUUA 1MWAH 4L4TB 3C60B 3R8QA 3SJVD 2QBWA 5E08H 1G7LA 1FH5H 4ZPVA 5ESVB 4XBGA 2OL3H 4FQHA 3GM8A 3PWUB 4DW2H 2P49B 5HGHB 3TGXA 3SO3B 1F42A 3A6CH 5DUMH 4OM1H 4FP8H 3RIFF 3WN5C 2OX5A 1T7YA 4NN5B 4E0RB 1LEIA 1QSFD 4UZGA 4WNQB 4DUXA 1BGXH 1LGVA 2GAZA 4HWBA 4LSTH 4PJIF 4TSBL 1CICC 2V9QA 5HHPA 1MAML 5ID0B 5JTWA 4Q97A 4GKOA 3U9PH 1CF8H 3W0WD 2Q8BH 3SGKA 3VGDA 5D1XA 4KMTL 4Y2DB 4X5WA 4WW2F 5AEAA 3NZHH 3X13A 4E41E 1IAIH 3RU8H 2NZIA 4TNWF 1ITBB 3UTSA 4L8DB 4Z77A 4Y4KB 4PRIE 4Y16B 1TZHA 3LKQB 3QNYB 3VMNA 5C7XL 3C6LC 2V2TA 1IM9A 3HC3H 5FUZH 4WI9A 2GIYA 3IDIB 4ENEC 4KQ3H 1A4KB 1MHHA 3BWUC 4Q9RL 4ZFGL 2VWEE 3F7YA 4HXAH 3MRFB 5L88H 4HIIA 3MOQA 1P5VA 1E0OB 4DKAA 1MCRA 1FCGA 3C8HA 2C1PB 2HYMA 2WY3A 3BAEH 1C12B 1ZAGA 3MGTB 1NEZA 5C08D 1QNZH 4R2GD 5BJTB 1G7HB 3RPIA 3MLZH 3CFCL 1EEZA 1RJCA 1T1YA 1U0QA 4KV5F 3RRQA 5HHQA 1R5VA 2CLZA 2G60H 4U33A 3TO2A 2OR9H 1IAII 3SKNB 4JZNB 4G9DA 5DLML 1SBSH 5EBMB 4NRZA 4PRNB 4WFGE 3OX8B 3NBNA 2VDQH 1L4IA 4LRIA 4NFCA 2PTVA 2XT1B 2X4QB 3BD4A 1YEEH 3KXFA 4Y4HC 3EO1B 3OJMB 1QFWI 4G6ML 5I30H 2APXA 1TMCB 1I9RH 4UILH 2V2XA 3L3JB 4X6CA 5HTSA 1IFHH 2HWZH 3BH9B 4K3EH 3U9UB 2P24B 2XZAL 1T0NB 5BV7H 1F3RB 3HUJA 4XH2A 3RWCA 1IL1B 4QRRA 4BSVA 5CMAB 1FFNB 2X89A 4JPIB 3SE4C 3BIKA 4JM2A 1YMMB 3O3EB 1NCCL 2FL5A 2CDFA 2VDNL 3UTOA 1IGYA 4FQIH 4JFFE 4LEOB 1EHXA 4DUVA 1U8QA 4GLRH 3MA9L 1NC2A 4ZO6A 4L3ED 5I17B 3F62A 3GJEB 5IM7A 3F12B 4J6RL 4P2QE 5HDQL 2AK4A 2XG5A 1AIFA 3U2SB 3IXTB 3Q6FB 2VZ1A 2FJFB 1KIPA 3LN5A 1CQYA 3OR6A 3O6FB 3NA9H 1JGLH 3GSUB 4PP1C 3QIUA 1OSZA 2VKWA 3TVMB 4LSRL 2AGJL 2AXJA 4C4KO 5DHVH 1FSKC 4OGAC 5JR1H 5IF0B 4ZUTA 1P4LB 4NN7C 1D5MA 2DLIA 1NGWA 1JI1A 5GHWL 4KQ4L 5I75C 3CMOH 5M95B 4JFDA 1M71A 5IEHA 1GGYA 3BZFA 3OB0H 1PKQE 2V5SA 4HJGB 1NUGA 1D6VL 1KJ2H 5EC1B 3VXSA 1JPSH 4HX1B 3EFFB 3RVTC 4E41B 1DBAL 1CE1H 4QT5B 4R8WH 3KPSD 3QDHA 3ALWA 1KCGC 2BY3A 3IDGB 3HFMH 2A2QT 3TWCL 3HRPA 4YE4L 1UB5A 1VGKB 3HA0A 3RDTC 3T2OA 2UVFA 4PRIB 3WN5B 1RIUL 1X4ZA 3PP4H 1E27B 4XNQB 2FYYB 3EYOB 1R5IA 3W9DB 1I9IH 3CLFL 4X6CF 5EOTA 1X5AA 1CICB 1RUQL 2EE2A 3BUYA 3DGGB 3I84A 3HUJF 5F88B 3O0RL 1UXWB 1T4KB 3NCEB 3DROA 3HC0A 2P5EE 3K2UH 4DFHA 3JWOL 1HHHB 3AXLB 3LS4L 5FAAA 1DBJH 3CSPA 5KW9H 2FBOJ 4BKLA 1VFBB 3FOLB 4O02L 2CDGB 4NGHH 3LPFA 3PDGA 2ENSA 5DJ8A 1H3TA 4JFED 5L8JB 3F65A 4GJTB 2X4OA 4EQ2A 1LE9B 3O3DA 3H7LA 3GSNA 3V5HA 2QJDA 3SCMA 4EN3C 5E6ID 4I0PC 2CO6B 4HWNA 5ADOL 3V6FA 5CBAB 5K9JH 5F96H 4L29A 5EOCL 1PSKL 3C5ZD 5FM4A 2NY4B 1WIUA 5T1KB 1OTTD 5BZDA 3CH1B 3QWOB 4NKDA 5C6TL 3GEWB 4OI9A 2R0ZH 4JO1H 1CGWA 4H1LG 3FB7B 2EXYC 1Q0YH 4TTGA 1ZANH 4ODXA 5BQ7B 2CKBA 1ZHLA 4LCYB 4BA8A 1CBVH 3HG1A 4F9LC 4LLDA 2AQ1A 1P2CB 4I9WE 1NGZA 4DKDC 5CSZA 5DD0L 3RY6A 4BQ6A 5IW6A 5DMJB 1PG7H 5JO5B 2FJGB 4O51B 3GO1H 2VXSL 1CDIA 2P8PB 4UOW1 4X9HA 1MEXL 3W2DH 5CP3A 4MXQA 5JXEC 3H3PH 1LO2H 1QRKA 3RWHB 1KTLA 3MV01 1JZ7A 3QCUL 4JFFB 3KPMA 1I85A 4BZYA 3WIHA 1KB5L 2DOCA 1UGNA 4JANA 1TITA 2FJHA 3VW3H 4RA3A 1A2YB 4JGMA 4P2QB 4R90H 2PKDA 3FO1A 4Y4HB 3VH8A 5GS0D 4OM0L 5DJXB 1IAKB 4NBXB 1RJYB 1PZUB 4TQEH 2EDDA 5EZJB 5KOVC 1CFNA 1X4YA 1G9ML 5GS3A 5EBLA 3TV3L 3HE7C 4O2EA 4TRPH 5DD1H 3WSQL 3MNVB 5IGXL 3OXRA 4DFIA 1GXEA 3KPNA 4KK6D 4YGVB 4PJ8C 2PXYD 1QFPA 1OOAA 1JGDB 1OAKL 4FRWA 4PJAA 3JWDC 4GW4B 3Q0HA 5DXWA 5EOCJ 1KJVB 5JPNA 4IDLA 2CRYA 5BVPH 4ELKB 2YKLL 3P4MA 4IEFB 3ZDZE 1PKQB 1WBYA 4NUJA 2V6HA 2Q86A 4IIQC 5GIRB 2YN3A 3HRZB 3OKKB 5D6CA 3MXVH 5J6GB 2O93L 3V4PL 3MV7B 1AP2A 4LCCA 4H5SA 4LOUC 4NNXB 5IMMA 1SJVA 1PVHA 4HD9A 3OJ2C 4YAQA 5JPMB 1FSKB 1ZWIA 5DR5H 5E2WH 3BKCL 3L3OB 4RWYH 4IBLT 3D0VB 3FL7A 3O41A 3MO1A 1S7UA 3A6BL 2QV2A 4N9GA 2HRPL 1HNFA 4N0YL 5D8JH 4OT1L 4X7TA 5I75B 1F13A 3UTTD 4JO2H 4PB9H 2P5EB 5HHNB 1GZQB 1TENA 3S96B 4Z7OE 1X7QB 3H7BA 2ENYA 4HPYH 1WWWX 2XNAB 3MRBB 1MI5D 2RHEA 5DFWH 2AJXH 4KJYB 1Z0NA 3DWTA 1SYSA 2IPTH 3UYRL 1EDQA 1TVBB 3L5JA 2ORBL 4ZOBA 2X4TA 1WZKA 3GJFK 5EUKA 4K7PH 3VGAC 4DTGH 5K59F 4LVHC 4FHBD 2GSIB 1CVSC 4FXKB 2GJ6A 1BIIB 1LK2A 2I07A 2FHFA 4RNRB 3DPBA 3DX8A 1T7WA 4ZMAT 4YHPB 4X6DA 3QZWG 2OSLB 3L5XH 4PJAF 2ZCHL 3BP4A 4OLYL 4ETQB 3L3HA 4XNUL 5KAQF 4HF5H 2DQIL 5MERA 5MEND 3NOIA 2L7JA 3ARGA 1UKQA 1X4XA 4A6YL 3N1PC 3MRCB 2ADIB 2BOCB 3UMTA 2APBA 1JHKL 2DDQL 3L5IA 1S5IL 4EN3B 2NY2C 1LEKB 1NFKA 1HCVA 3RHWF 4S10A 4ODWA 4JHZA 1DANT 1KLGA 4QRQA 4KVNL 2YC1A 2ITDA 1YECL 5JIPA 5FGCE 5DC9B 5DI8A 2NY6D 4PUBL 3UBXB 5D96C 4FQ1H 1AKJD 4HAFA 3ES6B 4RGNC 3DYPA 43CAA 4JPWH 4Z76B 2YHGA 4W6XB 3O9WD 4U7MA 3MMEA 5TDOB 5I2IA 5I1EH 1IEAB 5HI5C 4XVTH 4NNPL 2OJZL 2R1XA 3VRJB 3PNWB 2XPGA 3TNMB 1OTSC 3MLSH 5C6PB 1CE6B 3NCYP 1QA9A 2GUOB 4D3CL 4TSCH 4RFEB 4DZBA 3SDXE 1EJ6A 3VG9C 4FMKA 1NMBH 4UBDD 2ATPB 3H42L 2NY1D 1T5XB 3T0ED 3DOSA 5ESAB 1B0RB 3LQMA 4L3CB 5CGYD 4PJEA 3RGVB 1F90H 4HPOL 2NR6C 7FABH 1HSBA 1NLDH 3L9RB 4YHZH 3VD4A 4NQEA 1TJHL 1YPZA 2W60A 1M6OA 5IW1A 4X9FA 4H8WL 4U1KA 5K9OA 2NY7L 3NABH 5DHXB 4I2XA 4RFOH 1C5CL 1S7RA 1KN2L 4X6DF 2CK2A 4ZUUB 3NCJH 4QRTB 5J9PA 4FS0A 4ZO7A 2HH0L 3HE7B 4HFWA 5EIQA 3D18B 3GBLA 2EDRA 4U49A 1FG2B 5DTFA 1CT8A 4P4RA 4KKAC 3RTQC 4PJ8B 4WFHE 5IEKB 4ZXBD 4QXUL 1X5ZA 4WI4A 4ODSL 4ODUB 5LWYL 2R39A 3DVIA 3RGHA 1FZMB 4IMLA 2FIKA 1G0YR 4TVPE 2VQUA 4I18C 2C4FT 1N0LA 4IIQB 4K8RC 2HG5A 4PTTB 3O2DL 5BCAA 3H9HB 4QRUB 1T89A 3GI8H 1XR8B 5IWLA 1S78C 3ZHLA 5IR1A 2RR3A 1AC6A 3IDXH 1FV1B 1A7QL 4OZ4A 3SE9L 2DQFA 4J3TA 3F7VB 4IOFC 5JMRA 1OPGH 4W6YB 4QKXB 1NPUA 3NH7L 3M07A 3HTLX 4NCC1 3U7WL 2DLGA 1XGQA 1TDQA 4PP2A 1ZHKA 2XTJC 3TBTB 1MNUL 3ARFB 5JORA 4XPTH 5F6HJ 3AY4C 4UMGA 4NP4L 1WT5A 2EC9T 4S1SH 2BVPB 2HMID 5EC2B 1K6QH 4DKFL 5B8CA 4QTHA 3ROLB 4PJEF 4GMTH 1XGUA 2PUQT 3I6KA 4KY1L 4RZCB 2A77L 2GT9B 2LTQC 2X1OA 3D85D 2CLRA 2MNUA 3VFNB 4LVHB 5FO8A 5CIPH 4MA7H 4KKLD 1KC5H 4AL8L 1IGJB 3VFWA 4MQTB 4YR6B 4Q9CA 3NFPB 1NAKH 2DIBA 3FN9A 1CIDA 2XTJE 5FGCB 5LCVL 1NANI 5I1DA 5IESL 1NCWL 3QAZB 3WJJA 2D03H 5TDNA 1YN6B 2D7TL 1MIEL 1BD2A 1I1AD 4F2MA 4LARL 4IRJD 3X11A 5C0BA 4K3GA 1U58A 3IYLW 4ZAKB 1UWEL 1EH9A 1MJJB 4NCDA 3QQ4A 4NYLA 1J0KA 5ISZE 1TTUA 3TT3L 4PV8A 2APTA 5C0AD 1SY6A 5CLTA 2D31B 4OF5A 4JDVB 3MCKB 1F4WL 3KPPB 3SDXB 1AGCA 2NY2B 3MV8E 2LQRA 1FGVH 4Y1AD 5DJ0A 3LEYH 3BN3B 4M7JH 4EOWH 3E3QA 4P2OA 2KPNA 5IBTH 4RGMC 4WEBL 1VEOA 1A5FH 5D96B 2Q3AA 4UDUA 1GCFA 5EOQH 3WFEL 4XPBL 1KACB 1NGQL 3IAPA 2P4AB 3IFOB 4R97C 5BRZA 4AIZA 2G5RA 4K71C 1H3WM 4DN4H 1G7PA 4QCIA 4DQOL 3EDDA 4YLQT 2GCYB 1JV5B 4GMSH 3F6IA 5EULV 4ONGH 3MOAL 2AKRB 1TJGL 4MXWL 1YYLH 4KJPC 2E9WA 3VG9B 1G7MA 5DZLA 2BCKB 2MHAB 4MX7B 2YSSB 1F3JA 4MD4A 4XPFH 3TA3A 2JJVA 2V5RA 4JFHD 1MREL 1Z3GL 2DWEA 3QUYA 5EU3B 2C7UB 3HPLB 3F8UB 3GSVB 1Q72H 4KJWC 4FFYL 4QHMA 1ITCA 1LO5A 2XQBL 4OF8A 3V95A 6FABL 5M7QA 1YEJH 4X7FC 5IT2H 5GS0L 2BMKB 3HC4H 3P0VL 4ONHA 4K3JL 3ZYOA 1D5ZB 1NAML 3T0WA 3F5WA 4G6FB 2PW2A 1W72B 2P46B 1T6WA 4K7FB 1FNSL 3MV9A 5ITBH 4NWUL 1OAUL 5GJSL 1AFVL 1T83A 3UPCA 3RTQB 2YWYA 2VZ3A 4YO0A 1WFNA 1T2XA 4P46D 4J3VA 1WBXB 1H5BC 4Z8FL 1MCLA 4XRCA 4D9LL 3MRPB 4KVCH 3QHFL 2FZ3B 2XZCH 2V17H 1W2KT 3OF6D 3DXAD 3MUY1 3BDYL 4I18B 3D1MC 3T4AA 1AGFA 4JQXA 1LQSR 4MCYA 3BE1H 1DBMH 2R0WH 4OZGF 1P6AB 4N1EA 3QO0B 3CFEA 5T5NG 2AI0H 1DTUA 3H9SA 4QHLA 2X4RB 1P6FA 2H32H 4HUWB 3LEVL 3ZE2E 3TBVB 5HBBA 3B3IB 3LRHA 1R3JB 2R0LL 4CN4A 2DQJL 5HVFB 1DR9A 4NC1C 3HI5H 1D9KD 4YQXH 2PYFB 5B38A 2XTJB 5C6WH 2EDKA 2A6KB 3EYQD 4HGWB 1OTUC 4PJ7A 4JPVL 4QRSB 4I3SH 5E1AA 5E2TH 3UJJH 4IM8A 3CDGA 4NZJA 3MLYH 2JIXD 5F7HA 3SE3C 3V5KB 1U92A 1YY9C 4N0UA 5I19L 3KLHC 4GXVL 5ISZB 3CFBB 1KCUH 2LTQB 4U1NB 4HIEB 1A6AB 5IROA 4JO3H 2LFGA 3V0VA 4N0CA 2Q8AH 4Y19D 3CVIL 1RK1B 3G5YA 5B39A 4KHXH 3MV8B 4CW1B 4WCYL 1BEYH 4R96B 2ZPKH 1T04B 4ZFFA 4NC1E 1K4CA 1EAPB 1A7PH 1F58H 3KPLB 3QFJD 4OD3H 1CL7L 3F6LA 4ZQKB 1KB5A 1MY5A 1DLHB 1JPFB 4P4KA 3V8CA 3ARDA 1DP0A 3TO4D 1ADQL 1A4JB 1AJ7L 2EH7L 4JZJB 1FVCA 1UG9A 2XOTA 3HPJA 3HCVB 4CRPA 3C5SB 4LLVA 4MNQE 2ZUUA 5HYSG 3QNXA 3GMNA 4OF7A 3KPRE 1TCRA 2WIMA 4NQDD 1D6EB 4GRLC 5E8OB 3D5OF 1OAYL 3ECBA 3R0NA 3R1GL 2VSDA 4LCUB 3LV3B 3QNZA 1AD9A 5E8NB 1L9MA 4U1LB 5MEPB 3Q3GA 4QY8B 4YFLI 1JNLL 5GRUL 2L4OA 3RNQA 2YUXA 4DGYH 1T03H 3SPVB 3OKNA 1VADB 1UACH 5JUEH 1U8LB 1F6FB 5D7JC 3EOAB 2YD5A 4L1HA 4CBPA 3GGWA 2YPVL 5DVMA 4K71B 4N8VA 4PJ7F 2CR3A 5SWZD 5IMOB 1LK3H 5DURB 3QG7L 5FYLD 5T33H 1F97A 2F53E 1H15B 4D9QD 4ODBD 2DJUA 2DLTA 4RMTA 5DEGB 1AHWA 2EEBA 3D3VA 3ROOB 3RWJA 2IQ9L 3NPSC 1ZA6A 4HS3A 4FTVA 1U8PB 4GXUN 5F3BB 5IOPB 3WXWL 4MA8H 5H8DA 4G3YL 1U8JA 4PJ9A 4PJGE 4UOJA 2AJUH 4MB3A 3QWRD 4CMHC 2VLRD 3QIBD 4WHYH 1RQ5A 1CQKA 3K46A 4RISL 4M7LL 5I71C 4OTXH 2A83B 1NDMB 1AGEB 1HOCA 2CJUL 3G9VA 5IBLD 3FQUA 1KELL 1KIUA 2ATKB 3MRNA 5LKNA 1EVTC 5LXGH 4KXZH 1V8HA 5C71A 5EIVA 4BFGA 2C26A 1QSFA 1MRFL 4IRZL 5IV2B 5K9KB 1XF5B 3B6SA 2HTLC 3PG2A 1XGRA 3ARUA 3QUXC 3GMQB 1N7MH 5A2FA 4PBWD 3WIFB 2K3TA 1YJDL 3KYNB 5TPWH 4GFTB 2VAAB 2AEQH 1G6RH 3C87A 3TFKD 3O45B 4WHTA 5E8EB 3BUTA 4JHWL 3E8UH 4BK4A 3EW3B 5D1QB 5CEYA 3S88L 1N8ZB 2D7OA 3PWVA 3VGGA 4NM4H 3QA3B 1I8IA 3HNVH 1MCWM 2HJFB 12E8H 1FAIH 2EIZB 2DQUH 3NPZB 2ADGB 2IF7A 3RVXC 3QRGH 2AERT 4HV8A 4OGXL 1AQKL 1EIBA 3ARSA 1DQMH 2UZYB 1U3HD 2D7NA 1JGVL 4AEIH 3H9ZA 2P8LB 3TT1H 1RJZA 3LRGA 2XWTA 5HD8D 4RAUA 3QSKB 3OR7A 5D1ZD 1QRND 4V1DE 4KUZL 3S34H 5DK0B 1UXSB 3CZFB 1VFUA 4GBXA 1JTOA 1JRHL 2ZOLA 4FN0A 4CVXA 4F33A 1QVOA 4HG4K 2M26A 5I66B 1FDLL 4U1JA 1CDBA 5HHVH 3MRQA 4MB4A 4U1IB 1JZ2A 4MNQB 5DDHA 4EBQH 5GGTH 4ZODA 2RCSL 3TYFA 3FZUD 1P4BH 1IT9L 2ZOKA 5T5FL 4NNYA 3IKCA 3EYFA 3FQXB 4HLZH 5I8OL 2R2BB 2GFBA 5F7KC 3H8NA 2FCBA 5EZIL 4P9HC 1CGSH 1Q0XH 3SGEH 5F7LB 4G42A 3HAEA 3A67L 3OBAA 1RULL 4TVPH 1DCLA 3GSRB 3KS0J 3WS3B 2R8SL 2F53B 3NFSL 4WHCA 4Y5XC 4M5ZL 4JRXE 3UC0L 4OCWL 2W65B 5GRVL 5IFHH 3TJHC 3UTPE 3EHBD 4HUXB 4L4TD 5KVFH 1UKSA 3VU2A 3BKJH 4FA8A 4JDZB 1FIEA 2Z93B 4YDVB 1X9QA 3BISA 1IAOA 3MFFB 4AH2A 2X70A 2JJWA 5A16A 4M48L 5ABDE 2AS5M 3O2DA 5D7JB 2VAJA 5ID1B 4YHML 4M5YL 1NMAL 4PG2A 3VD5A 2IAMB 1VA9A 4R7DB 1XGYL 1JUFA 2DQGH 4K8RH 5EPMB 2XZQL 4XCFL 4QF1B 5M94B 2DQHL 4X4YB 3BRDA 2FDBP 1B9ZA 3NPSB 1U3ZA 3BPLB 1DJSA 3SE8L 5CHNA 5INDA 3IETB 4XAKE 1RZIA 3IAGC 3CU1A 1I7ZA 5DQDL 4JR9L 3GNML 4W4NA 5I71B 2RQ8A 2R69L 3AREC 2OM5A 3RAJH 1M7IA 1JN6A 2VDLH 3LKRA 1OAZL 4NDMB 1MFCL 2OK0H 3LSOA 4G6JL 3U1SL 2ADFL 4F7MB 1G7JA 3GHBL 3QI9C 4MS8A 2NZ9C 1HXMB 2H26B 3DUSB 4MHHG 5HGBA 5AYQA 1NEUA 3QUXB 5ERWB 1SJEB 2OL3L 4H1LB 5F7WC 1L7TH 3QH3B 2HT2D 3MX0A 3R06A 1BOGB 1RMFH 4F9PA 5GZND 3ZMRA 1JF5A 3MRHB 2VLJE 4W70A 3RL2B 2UWEA 3C9NA 4OM1L 4OFYD 4R7NA 4FP8L 1AO7E 3T3ME 5GRJL 2ESVE 1MLBB 3EO0A 4GAGL 3QUMH 4JFEA 2CQVA 5D6DA 1CLZL 2X05A 4V1DB 3PHSA 5CD5D 1S7SB 1KTDA 4MDIB 3MXWH 3QEQE 3U46A 3LDBB 4WTZA 2M1KA 2NW2B 3AS2A 3U9PL 4A2MA 3PIQB 4HKBA 3V6ZA 1VFMA 5FCUH 1GGCH 5CJOL 4QWWD 3C5ZA 1T21A 1E4KC 3CVHL 3V4UL 3WDHA 2EH8H 4WI2A 5FO7B 1IAIL 3RU8L 4NRXB 1D5BB 2VNCA 4M43H 4IRSC 4RMUA 2ID5A 3GSWB 4IOIA 4ALAL 5L0QC 4NM8H 1VB9A 3N0PB 2A0LC 5IBUG 2VLLB 4GW1B 3HC3L 4AEHL 1I1YA 5D5MA 2AJZB 5AZ2H 4KQ3L 1QFWL 2NY3C 4Y4FC 2Z31A 1RIVL 2R2CA 1Q38A 3H9YA 1I8LA 3PWPE 1ZTXL 5L88L 3T1WA 3EJYD 1JMZA 4LAQH 3RIAF 2GITB 1V3MA 5EBWA 2JJTA 4U6VL 5DO2D 3G5ZB 5I1IH 4JRXB 4MVBC 5LAXA 1QNZL 1VERA 1NH6A 3AMKA 5DVNA 4F7CB 5CEXA 2WIIA 2F58H 3DJ9A 3F58H 5HDBF 3BD5A 4MJ4A 3CSGA 2OR9L 1NAMA 3ULVF 4UIMA 5FKAB 3L1OH 1I7RB 1B2WL 5DJ2B 3TVMD 3LN4B 4NWTL 4OZFH 4NO0D 3VXTA 1HH6A 1AE6H 2PXYA 3NCCB 1U8NA 4ZO9A 5D72H 3L7EA 2Q6WA 1FFPB 1YEEL 3W5NA 5HHOD 1NGYA 4Y0GA 4MQXD 2DIJA 2J7LA 3WFDH 4ZYKA 4K3EL 4LLWB 2A9NH 4RMQA 1KNOA 5BV7L 4U0QB 3CSYB 3FT3B 5HI3D 4P48A 5DMGC 1TLKA 5IHZA 4KI5F 5CJ5A 5FYLL 4G6AC 3CLEH 1HKLL 1KCRL 4H26B 4FQIL 2VXVH 5CGMA 3U0TA 5BW7C 2FB4H 2CMRL 4PRID 3MRIA 4YNYB 3ILPB 3U0PB 3C2AL 5CINH 3UO1L 4G7VH 3FCTA 5D5MF 4OLXL 4L3AA 4GXUM 4L8CB 3K8KA 4J1UA 3P40A 1CICD 3UTTA 2WNGA 5FDWB 1ZV5A 1U95B 2X44D 4G43A 5IUSA 5IB1B 2VLJB 3BRGC 4PLKC 1JGLL 4NJ9L 3AM8C 3LOWA 1IM3A 1AO7B 4OUUA 3AREB 2ESVB 4JO4H 1MI5A 4ZNCD 1XF2A 4U7KA 2R23B 1MPAH 2I24N 4MNHA 4XNMA 3L3IB 4F8QA 3E6HB 4P3CH 3QEQB 5TE4H 4OZIE 4IMKA 3O4OC 3QI9B 1T22A 1IGTB 1SEBA 3FKUS 2CRMA 1TCMA 1P53A 5HXMA 3C6LD 1JNHA 3HZKB 3O2VH 4P3DB 1OGAE 3ZKNC 4PJFA 1MLCA 4ENED 3MLVH 4ZOCA 1ETZB 5T1KD 4JZOA 1CE1L 4CU6A 2R2HB 5DC4B 5HJ3A 4R8WL 1J7VR 3HFML 5EORL 4NO3A 2P47B 1AQDB 2FWOB 1IKNA 4NOBA 3BKMH 5ILTL 2W0FB 2COQA 4MSWA 1J86A 5DUPH 3KLDA 1CG9A 1F6LL 3N9GH 4GAJH 4EIGB 5IHUL 2ZNWA 4NQSA 3QFDB 1IC1A 2FX8L 3T0BA 2OP4L 4BQ8A 3FOMB 2X41A 2QHRH 5HPMA 1A6TB 1JF1A 1TZIA 4F7PB 3FFDA 3K2UL 3PWPB 2P42B 3I6LE 1K8IB 2F5AH 3IDMB 3BW9B 1MFAL 4XXCC 2WM0A 3UAJC 1MHEB 5KW9L 5TQ0L 4NGHL 1J0IA 4U1GB 4O00A 4Z7QE 4JFFD 4RDQF 5SWQB 1IGCL 2A6JA 3DV6B 2OTUB 4ZFZB 3GMPA 1C5BL 3O9WA 1QYGL 4HWEH 2VSCA 2L0DA 3OKDB 3BVNA 1MFBL 4P2QD 4F3FB 4Y4HD 1A3LH 4WTXA 2ARJB 1MCHA 1DQDL 4ZS6C 2X4PB 5K9JL 4LGPB 3HNTH 4Y4FB 2JCCA 3QUZC 4JCMA 4R4FH 1KEML 3I6GA 5IMLA 4Z18A 4OJFH 2BC4A 4LSQL 1Q0YL 3KWWA 1Z9OA 1N4XL 4QGTA 5GRZA 4U05A 5KAQG 4HIJA 4XP6L 3L3KA 4WU7A 1MFEH 5DD6B 2XN9A 4NKIL 3MRGA 4PGCB 4D0CB 1QLFA 4ZD3H 3RQ3A 1DE4A 5HHXH 3S8WA 4PJFF 3MLUH 4N1HB 4O2CB 2VIRA 1LP9E 4HGMA 1U6AH 1FNLA 2HLAA 4ORGA 1WUNT 1Z9SA 1P7QB 1FZJA 1Q9OB 2JJUA 4HUVB 2O61A 1LO2L 4N8CH 1T2QH 3KYKL 3MV7D 4PP1D 1A8JH 3S3SA 3RZCC 1F5WA 2AAVA 3QQ9C 1LE5A 3FO2B 2E7CA 2DS4A 4OGAD 2JELL 3MNZA 4ZXBA 3OKMA 1RVFL 3VW3L 1A47A 5DJZB 5F71A 2OZ4L 4HWZB 3QISA 5CWSA 3VFTA 1RZFL 2P5ED 3W39B 3N1MC 5F7FA 1NDGB 3WEXB 4PGJA 4O4YL 1DN0B 4XC1H 3SDDB 5DD1L 3K4ZA 1HEZB 3RVTD 2XI9A 3VRLF 1WAAF 3GMRA 4MAUH 1RJLB 4G7YH 1XCTB 4MJ6B 3G6JA 5B22A 2FX7L 3JVGA 3WFBL 3RDTD 1B88A 3I9GL 5AD0B 3DYOA 2J88H 3ZE1F 2PTUA 4BM7A 1C5DA 1N59B 3DVNB 5I1AB 3OGCB 1OGAB 4I48A 2JCCF 4YZFE 4JQIH 4G9FA 5E00A 4RRPG 3ULUC 4J4PC 3TYGL 1WCBA 4BZ2H 1MCBA 1UM5H 4HBCH 1DBBH 2IEPA 2C3VB 1PZ5B 5DR5L 5E2WL 2PW1B 4HMCA 4RWYL 5KVMC 1OB1B 4D0DA 5EO0A 2BP3A 4Y5VA 4C54A 3BX7C 1ZK9A 1HQ4B 3WO4C 3MREA 3O4OB 2H8PB 3KDMB 3FRPG 5CP7A 3T2PA 2XWBA 3T04D 3G6DL 5JW3L 4FZ8L 1PY4A 4K3DL 4PB9L 4X7SH 4EN3D 4M61B 1FFQA 4RMRA 3K8MA 1NC4A 4U1MA 4AM0B 5I1LA 2Q20A 4O9HL 4PRDA 2LABA 3WV0A 3D25A 4X6EA 4UU9B 4IRJA 1ES0A 4CAGA 1ED3A 2EXYD 4F37K 4X0KB 1X5XA 4DTGL 4FQPA 4ZUWB 1N5AB 5GSVB 1SMOA 5C0AA 1T1XB 4AMKH 1YQVL 5KVEH 4WEMB 2F74B 2RFXB 2OXGA 2A6IA 2NLJB 3SJVE 4HQQL 5IG7B 2X09A 1INDH 5C0JA 1MRCH 3PWLA 4EDXA 3G6JF 5JXED 2WBWB 3PL6B 1KXQE 4EUPG 2GSGA 4M4RA 1K85A 2H9GA 3KYOA 4HF5L 1ZSDB 1AXTL 5FOBB 3T0DA 2BVQB 4HS6A 3LPWA 5ECJE 1S9YB 2VZOA 3U0WH 5F9AC 1JHLL 4XBPB 4WRLA 5D7KE 1QLEH 2R9HC 1DFBL 1LP9B 1BJ1H 1NUFA 5ANMA 4RQQA 2HFGL 2IMMA 4PJDA 4KHTH 4JKLA 4AIOA 3CXDH 5EG6C 2AXFB 3NGBC 5DRXA 3C8KA 3QUZB 3FRUA 4B0MM 3HE7D 4WTWA 2OJEB 1FNGB 2C3HA 1UJ3C 4PJ8D 4P2RA 2PN5A 4JPWL 1A0QH 1I7TB 2ZSVB 1FO0B 4LLUA 3NACL 4LLYB 4H20L 2F5BH 4NQVA 2AJSL 3ZYZA 4PTUA 1F45A 3DMMC 4RMSA 1FL3A 1JWSA 4JQVA 2BOBB 3P4LA 3DX9A 1NMBL 2XWJA 3AU1B 4BYHA 4ZUSA 2NXYB 4KK8C 1BQLH 1ND0B 4ESKA 5EN2B 3QP3A 4ZTOH 3RZCB 1SM3H 2DQDH 4MLSA 7FABL 1NLDL 1IQWH 1ZT4B 3MLWL 5GISH 3LHPH 1DDHB 2KQNA 4OBRA 1U91A 2FBJL 5ETUB 4YHZL 4Z6AT 5BXFB 4LHQB 1S7XB 3JV4A 3NABL 4CMMA 1WBZB 5C08E 3TIDA 8FABA 3OB8A 4M3JA 3VI4F 3DXAA 3MUGB 5EZLB 5FEBA 4Z7VE 4M6NL 2AEPH 3BPNB 5BOZG 1FYTE 1Z2KA 1RY7B 2AXHA 1PEZA 3AMLA 3V6OA 2FH8A 4K2UL 3BZ4B 4G8EA 2ITCB 5E4EB 1MFNA 2HFFB 4WW2C 5JW4Q 5FUOH 1RZ7H 1KOAA 2H3NA 1CDCA 1INQA 1FIGH 3LS5H 4DZ8A 4XC3L 4PJDF 3CVHA 4RIRA 1D9KA 4YJZL 4KGLA 3VWKA 5C0EA 5J3HC 3H3KA 5I1GL 1I9JH 4M00A 4PJIE 5FA4B 2PO6A 3L5WA 3KVQA 4HK0B 1EFXB 2EDBA 1F4XH 1KXTB 5IMKA 3RWDB 2JIXA 5IHBA 1MCKA 3UPAA 4CDGC 5GXBB 1R3IH 4JY4B 2R1YA 5HYSB 3NZ8A 1C08A 1OPGL 4M6MH 2QSCH 4YHIB 5DJDB 3AS1A 1R0AL 3OHXA 4HIXH 4ISVB 3FFCD 1S5HA 5DFTA 4Y19A 2VN4A 4NIKB 3EOYG 3JTSB 1P69B 4ZDHB 1HE7A 4RGOH 5KSBA 2NY2D 4C57C 2IGFH 4WDIA 1K3ZA 3QFJA 3RZWA 4O58H 3KNBA 1K6QL 1XF3A 1FG9C 1FL5A 2LE9A 2QQNL 4X9IA 3B9DA 4OCNC 4UT9H 2BNQE 3TO4A 5T1DL 5KN5B 2I9LA 1X6NA 4RGND 1DQJB 4UUJA 2MCPL 4MA7L 3S4SA 2IADA 4LNRB 5HI5D 5K93A 2Z8SA 4DVBA 1NAKL 1O7SA 2ZG1A 4WUUE 5FFLA 1OTSD 1KLUB 4JRYE 2CIIB 4XWGH 2V2WB 4M7LT 3SGKC 1RZJL 4NQDA 2D03L 3MA7A 3BZDA 4TPRL 5GSRB 3WUWA 5D1XC 3ZKMC 4LCIL 1RZGB 2VISA 5F70A 4P23A 3OJDA 2KDGA 1CDGA 3TIEB 1M05B 4KDWA 3KPSE 2NR6D 1PKOA 3DBXB 3QR2A 4G5ZH 3JUZA 5DD3H 2W1NA 1HKFA 3L95B 1JGUL 4TVPD 1T1WB 3OTTA 5CUSH 5HHMA 3UTZB 4POYA 5FA3A 5SWZA 2GTZA 4H25B 3TLRA 2ZUXA 3ZYJA 4G6FD 1EHAA 3QPXL 3BP7A 2YMXH 3LEYL 2UYLA 1G0XA 2PF6A 4KPHH 3NGBB 4QTIL 5D2NA 4AT6B 2E7HA 2F8XC 2ZZUT 1KG0A 1P9MA 3MLRL 5CLWA 5EOQL 4F57L 1UJ3B 3VFUB 4KKAD 3RTQD 4C4KT 5D93C 1A7RL 3O3AB 5IVNA 2JB6B 4YH6A 5C08B 3FQRB 4P5KB 4R2GB 4YHYC 5KSBF 3EYVA 3E0GA 3I02A 4Z7VB 1JGEA 4ONGL 4KRNA 1QSEA 3MC0A 1FYTB 3ARVA 4K8RD 2HKFL 2X4SB 1VEPA 5JDSB 4OKVB 4OLWL 3T08A 4TUJB 4G8IA 4HIHB 4XNZC 4YK4B 1YUHB 3T65B 1F00I 1H3PL 5CJXC 3BKYL 1S78D 4YIQB 3CU7A 4A2LA 1QBAA 4LRIC 2BRRL 1Q94A 4PR5B 4XP4H 1E4JA 4JFXB 1RIHH 4IOFD 1BHGA 5DRWA 1YEJL 5LG1A 2BSSB 3MYZA 3VXPB 5JZ7C 2CDEB 4M1CD 1AR1C 2PNDA 3BP6B 1KPRA 4HHAA 3STLA 5A1AA 4MQ7A 5B38G 3PE9A 5T3ZH 5F89B 2XTJD 1UCBH 1R3LA 1JVKA 4PJIB 2EXWD 2ZUYA 3MJ7A 1NMCC 2YEZB 1XR9A 4S0UC 1G7QB 3CNKA 2XA3A 2XKNA 3LRSA 4LQFL 3BESR 5GS2D 5AWNH 3GIVA 1FL6B 3RX5A 1SJHA 3IJHB 2MPAH 2FATH 4JPKL 4R3SA 4JEGB 1I9EA 3QUKA 2KZWA 2D0GA 5J89A 1P7KA 3IJYA 1Z0MA 5EO1A 5DS8A 4KVCL 2BDNH 2XZCL 3HZVA 2V17L 2WLYA 3KXFE 3MV8D 3WS6C 4OCSL 4QHKJ 4K23H 4P2YA 2VMFA 4Y5YB 2BJML 1JPTH 4X6CE 1LEGB 1LDPL 2M8XA 3SO5A 2BNQB 2G9HA 5MEQA 4LPXA 4Z7UF 2WK2A 5D1ZA 3HUJE 4MYWB 2W9DH 4NHCL 1HSAA 3QEUB 1HINH 5JHDA 5AG8A 1OWRM 3G6AA 4Z95L 1EBPA 4JDTH 4AZ8A 3VXRD 4WUUB 3HI5L 4YQXL 3EOTH 4JRYB 4AG4H 2P43B 1GPOH 4I3SL 2IH3A 4XPAH 5E2TL 3UJJL 4Y89A 3AGVA 3T77A 4G8GD 5DT1H 3HLAB 5BZWA 1HWHB 3N1FC 3BH8B 4NT6A 5AZEH 4OV5A 3OKOB 3LKSB 4APQA 2BXZA 5MHSE 2SEBA 2QQQA 1KCUL 4LHUG 3VGHA 4JY6A 3TPUA 3BIBX 3WYRA 4Q0XL 4JO3L 2VR9A 3LZFL 4LRNH 2AABH 2EDEA 2DTML 3GSOA 1KPVA 2OQJA 1W0VB 1QR1B 3IKKA 2B1AH 2CIKA 4J3UA 5DURD 5HHPB 4JM4L 5FM8A 5D7LA 4F7EB 4OKDA 1VKXA 3S97C 1MH5A 2VABA 3BZEB 1K2DA 3EYSH 4N0FB 4GKSB 4KJPD 1CU4L 2D4DA 5IJVA 4NOFA 9CGTA 4I5BA 5K9QG 4L4TA 3C60A 1ORQA 4Q9QH 4OAWB 1WISA 1EHNA 2OZ4A 4OLZH 2Y7QA 2AV1A 3WXVH 5ESVA 4DGVH 1Y6KR 3PWUA 3VDCA 3FQTA 3GJFB 1BAFH 4KJWD 4EVNB 4PJXE 3NCFB 4Z77B 3CX5K 2N7BA 5HGHA 2Y5EA 1TZHB 1T2JA 3BQUB 4NUGH 3SCMC 5HY9B 5E6IB 2ILLA 3ZT5A 5DA4A 4YWGH 3K4AA 2VXQH 2GQHA 3KPQB 1E4XI 4WNQA 5DUBA 3T2QA 3F7YB 5HYJA 5GS1A 4HIIB 3QRFM 3P11H 2IANA 3DSFL 3JWDL 2E27H 3LH2L 5ID0A 3IFPA 3JWNC 5INCB 2W9EL 3EDEA 3MACL 5SV3A 4KUCD 4X80H 5FYJU 3LKNB 4YHYB 3TNNB 2YPLA 4UV7H 5JOPE 4UTBL 4Y2DA 4POZC 1NLBH 2CLZB 5D1QD 2H6PA 4LHJB 1MOEA 1OCWL 4MXQC 1OP3H 4HAGA 4L8DA 3P77B 4G9DB 1UEYA 3ULUH 4Y4KA 4MA8L 5HDLA 1I8KB 4Y16A 2DYPB 3QJHB 1I85C 2IPUK 1Z5LA 5FYKE 4YXKH 4HZLB 4NZTH 3IDIA 1J0HA 4Y88A 3KXFB 1H3VA 1K8DB 2D9CA 4Y8AA 1R3KB 4HH9B 1LVEA 2HKHL 3HG1E 2Y06H 3MRFA 3NIFE 2JK5B 4J7RA 4X6CB 2V2XB 1OTUD 1U93B 3CK0H 1QOKA 1NMCB 1JFQH 2C1PA 4KC3B 4YXLL 4NFBA 2VRAA 3HUJB 2IH1A 5BJTA 1G7HA 1N7ML 4TUKL 1YY9D 2VDPH 3S3PA 4I77L 3T0EE 3KLHD 1X5LA 2CDFB 1IGYB 4M93C 3BT2H 2WINA 3SKNA 1J5OH 5JW4R 4PDCE 4MNQD 1FC1A 3MLTB 3Q2CA 5KVDH 3E8UL 2P45B 2VN7A 4I1NB 4PRNA 3OX8A 5K59E 4XBEH 5DRNB 5FECB 5IW3A 5FF6A 1KIPB 3LN5B 3HNVL 1N0XL 1OSZB 12E8L 4LCCC 1FAIL 2DQUL 4XP5L 2Z35A 5CJQL 3QRGL 2B4CC 1TMCA 1J8HA 5LGKA 5I1JL 5IQ7H 1IZJA 3FT2B 3U9UA 3ZTNL 2P24A 2E3VA 3T1FA 4OSUH 4LF3A 2AVGA 5CMAA 1FFNA 3VD3A 1FVDB 4JPIA 5JIHA 1I3VA 4JFDB 4K9EH 5FYJH 2YD1A 1YMMA 3O3EA 3QEGH 1ACYL 3CH8A 2J6EL 2VE6B 1AI1L 1FPTH 4LEOA 1UWXK 3T0VA 3QYCA 1JBJA 4PS4L 4U1HB 3S5LA 2VH5H 3GJEA 3F12A 4PJXB 4LVNC 3U2SA 1S7TB 1UB5B 1V3KA 1RI8A 3IXTA 3Q6FA 5KS9E 2P1YA 3JUYA 4LSDA 1R5IB 3O6FA 5D7JD 4G80A 3EGSB 3GSUA 3U4AA 3GKWL 1A3RH 2Z8RA 3BUYB 2R1WB 5IK3B 1BJ8A 3CIQA 4HFUL 3RVVC 4MZ2A 4YDJB 2EC8A 3DROB 1FNAA 3HC0B 1P4LA 5B3NA 4GRWF 1JZ3A 3QDGE 1N6QH 3OZ9H 1IEBB 5A2IH 5KSAC 4FFVC 1IGFL 1V3JA 2VZUA 3ARGC 3FMGH 4TVPL 3B9VA 5EC1A 1UH3A 5F3HB 4EDWL 1QLRA 5ALCL 3QJFB 3EFFA 4HX1A 4L4VD 1N64L 4AEEA 4E41A 1M7DB 4MNGE 3R4DA 4QT5A 3FQNB 3SCMB 2WUBH 1W72L 1CDUA 4XHJC 1CXKA 4KK5D 4Q9BA 1VGKA 4L29B 5TE7H 4PRIA 1EA9C 4PYHA 4Z7NE 1E27A 5KVFL 3B5TA 3KYMB 2FYYA 3EYOA 4LSVH 2HTLD 2NY6B 1UJTA 4CN1A 3QUXD 1WEJL 1DVFA 4KRMB 4JFZL 5F88A 4XVSH 1KJ3H 1QPXA 4LMQE 2CKBB 1I3GL 3HG1B 1CDJA 1HHHA 3P30L 5DEZA 3AXLA 4IDJH 4PYGA 1NGZB 4EI5C 3MRJB 5CSZB 5IW6B 2H41A 2CDGA 2ZJSH 1JK8B 5H2BB 5B21A 4X7EC 3I3EA 1DUYA 1YNKL 3N85H 4V1DD 4XPHL 1TFHA 5F6HI 3O6LH 3EAKA 1MCPL 4WTZG 4Y1AE 3T0EB 3DX7B 4HH8A 1ZT1B 1YZZA 2VC2H 5F7DB 4DKEH 5CBAA 4LKCB 3RVXD 2FJHB 3QCTH 1CI5A 2G2RB 5T1KA 3HMXL 3QWOA 4BFBD 2BNRE 2DM2A 1CZ8H 4JY5L 4BELD 3FB7A 4U2ZA 2ZUQC 1C1EH 5D9SA 2EE3A 2XFXB 1PX4A 5L9DL 5EBLB 3IDYC 1X5FA 2EYTB 4J3XA 1LMKA 2G5BB 4KJQD 3KPNB 2IPKB 4XCNA 3SKMB 1HNGA 4X8JA 3QHZH 5JO5A 2FJGA 3V2AR 1RMFL 4HUNB 1HILA 5J7CC 2ICES 4PGEB 4PJEE 2P8PA 1KCKA 1DANU 1H3UA 5KANG 4HWBH 4O5LH 1RFDH 1S9KC 1ZHNA 1OAQL 3K1DA 2OTWA 1TETL 2EDTA 5TDPB 3VXOA 2E6QA 5GPRA 3QT2A 5I18H 4JFFA 1MCOL 2EDHA 2LU7A 2X1PA 3GB7B 3NFNA 1T89C 1WIPA 3AB0B 5T1LB 3PQYE 4TNVF 4TULH 4H5SB 3O6ML 1UCTA 1Q1JH 5DJXA 5KS9B 3U7YL 1RJYA 3LQAL 1ZWIB 1YEKL 1QEWB 5MP6L 4GG6A 2CGRH 1QBMH 2OYPA 4QO1A 3MO1B 3STZB 1S7UB 2EH8L 4YHLH 5CSGA 4PY7B 3MNVA 1WWBX 3H0TA 4X7TB 4KGJA 5DJ6B 4YGVA 1BVZA 1JGDA 1KLFA 5C70A 4GW4A 5DD5H 5DJYB 1WT5C 5IIEB 4ONFH 3QDGB 1F02I 1WZ1H 3H7BB 3MLXH 2H1PH 4MD0B 1EMTH 1QZ1A 4FQJH 2PR4L 3GMOB 4XMLL 3TJHD 3DO3A 1DSFH 4UT7H 4XAKD 1PKQA 5IKCB 3L3DB 5I74B 2X4TB 3HRZA 3OKKA 3D85B 5CBEB 1NGPL 4MNGB 4UQ2B 5I76B 1I8MB 2NY0B 5IJKA 5J6GA 1ZKAA 1TJIH 1LK2B 2AK1L 4NNXA 5FIEA 3GMLA 2R4SH 5JPMA 4QRPD 3VI3E 2A74A 4X6DB 4YGAB 3IFNH 2FR4B 3HE6C 1URLA 1PQZB 3HZYA 3NTCL 2H2SC 2YD7A 4UIKH 3CCHB 4ZUVB 3L3HB 1I1AB 3VWJA 5I1CH 1GAFL 5KSAB 3I50H 4MHHI 4JJ5A 2C4FU 4OD2A 4HCRL 3M8OL 2P5EA 3OXSB 5HHNA 1GZQA 1JMXA 2VQTA 4BQ9A 4FABH 2VLJD 3DECA 1NL0H 3V52L 1AO7D 3ARED 2ESVD 2XNAA 4N9OB 1F2XK 3WE6B 3MRBA 4EI6A 1AE6L 1FGNL 3JZ7A 4YDKH 1OHQA 1TVBA 4QHUB 3TJEH 4JG0L 3QEQD 4P2OC 4QRQB 3HN3A 2ITDB 5JNYB 3QI9D 5DHYB 2GSIA 1DUZB 2NZ9D 3LKPB 1EO8H 1CIUA 3VA6A 3MBXH 4FXKA 1BD2E 3DHJA 2DAVA 4GG6F 1J12A 2A9NL 1A6UL 3BGMA 3N1QC 4RNRA 5EUOA 4YHPA 3ELAT 3MMEB 1E6OH 4UDTB 2EC9U 2GY7B 2BNRB 1UWGH 2OSLA 2O5YH 2ZCKH 5KOMC 5LBSH 1HDMA 2V7HA 2DQCH 3IRZA 1WZLA 3NIGF 3UBXG 4FG6C 4ETQA 3UDWA 4EI5B 4DZBB 2VDMH 1NBVL 5FYKU 2YRZA 4HXBH 3PXJA 5CZVH 2BOCA 4YFDB 3TA3C 2J12B 4EUPB 3WD5H 1OQXA 3QUYC 4X5LA 4PJEB 5CJ8A 4OZGE 1ORSB 1LEKA 1HSBB 2V9RA 3OPZH 5H94A 1ZLVH 1IBGH 2WP3T 1OLLA 3VGFA 2AJVH 4I0CC 2MCG1 3ZSSA 4AQOA 4U1KB 4WW1B 1MQKL 1S7RB 3ES6A 1ZLUH 1UVQA 4IRSD 4P3CL 2ZUQB 4LP5A 4I3RH 3SY0B 2YD6A 2R4RL 3PQYB 5JW4N 2EECA 4HFWB 5TDOA 1IEAA 4LVOC 4Q2ZB 4CNIB 2MSPA 1MWAB 1T83C 2A0LD 4CJ0A 3UJTL 3VRJA 3PNWA 1UQSB 3ZKQD 1CE6A 1TZGH 2GUOA 4RFEA 5CCKL 2NY3D 4X7DC 4Y4FD 5HYEA 2DQEL 2ATPA 1WCQA 1T5XA 1B0RA 2C3WA 4L3CA 2V7NB 4JQXC 1J1PH 5IVZB 1ZLWK 3RGVA 4MVBD 1X5KA 1IC5H 5DUPL 3L9RA 4GAJL 5FXCH 1M7XA 2Y36L 3SOBH 5HGGS 5LQBH 3MV9E 4UINH 1K4DB 5EUOF 1UH4A 4WU5B 4ZO8A 1DQLH 4OZ4B 1BBDL 3MRKA 4QRTA 4M7KH 5J57B 1MF2H 5E2UH 5E4IA 2E7LE 3GSNH 3ARWA 2ZKHH 1Z6JT 3HE7A 4JHAH 2VITB 2FECI 1T0MB 1ZHKB 4XMKH 5L7XH 1FG2A 4QXGH 4F7TB 5JORB 4PJ8A 3B5HA 5E2JA 2C3GA 4LNVA 4WHYG 1J11A 3E2HB 1A3LL 5ACMA 3IVKB 3EFDL 4DVRH 2HN7B 5FYKH 3CUPA 4X7CC 3I6KB 3RNKA 3HNTL 5SX5H 5F1IB 4DUWA 4PTTA 3WLBB 3RFZC 2CKBH 5IROC 5SWSD 3H9HA 4QRUA 2F19L 3SDDD 4N0CC 4R4FL 1FFRA 3O4LE 4OJFL 5DMGD 3IS0X 2FGWH 3VFWB 5LGJA 4G6AD 1PD6A 4GW5B 1OSPH 1MFEL 1FV1A 5CP3H 3F7VA 1GSMA 4P4KC 3ZDXE 3HE6B 2AQ3A 1BD2B 1KCLA 3ARDC 2ZCLH 4OIIH 5HHXL 1I7UA 3MLUL 2A38A 3TBTA 3TP4A 1OGAD 1FNHA 1QRNE 3ARFA 3WIHH 5C0IB 1J10A 3KG5A 3QQ4B 4NYLB 4YBQD 3L6FB 4PLKD 1T0PB 1T2QL 2BVPA 5EC2A 5ICZB 3ROLA 4RZCA 5T3XH 4H0IA 2Q7YB 2GT9A 4EIZC 1CLYH 3P2TA 4GQPH 5AYUH 2PYED 2W0KA 3FO9B 3VFNA 1B4JH 4X99B 5EU5B 1HHIB 1OM3L 3OQ3B 1IGJA 3FO0L 4OZGB 4YR6A 4OZHF 3NFPA 1FRGL 1S7VA 2B1HH 3BP5B 4FQLH 4XC1L 2CK0H 5IVXE 1TPXC 1IC4H 2J5LC 1YN6A 4G7YL 1JCKA 4DAGH 1JFMA 4LPTA 1QO3B 4U1SB 4ZTPL 1HCFX 3CMGA 4LCWA 4XTRC 4S1QL 2J88L 4ZAKA 1U8MB 4G59A 2NXZB 5C09E 5CD3A 3LQZA 1JYVA 3SQOH 3RJQB 3TA3B 4PJ9C 4Z7OF 2E8ZA 3GBMH 1GGBH 2D31A 3DO7A 4JDVA 3MCKA 3KPPA 2B4CH 4JQIL 4GAYB 3STBA 4HUUB 1LO5B 3QIBB 4LSSH 1FC2D 2J6EA 4Y7MA 4YDIH 2VLME 3PUCA 4HBCL 3PL6D 3UAJD 3FN0H 4QYOB 4PP8C 4XAWL 1UM4H 4HLZG 3MZGB 2VO5A 5JQHC 3EZ8A 3OAUH 1YEGH 5KBNC 2D7MA 3CFDB 3IJSB 3GRWL 4YHOL 3MV9B 1GGIH 3IFOA 5I6XC 1CFSA 3D3VE 2DI7A 1W0WB 1GIGH 2GCYA 5I8CA 3C08L 4ZS6D 1JV5A 4JGJA 3VRIB 4M1GL 2AKRA 2J1KA 3ULUF 1KJ2B 4PGDA 3QUZD 2BCKA 2MHAA 2KH2B 4MX7A 5FHAH 4OCXL 2YSSA 1NQBA 2ADJB 1A7NH 2YN5A 5DFVC 5EU3A 3T4AB 2C7UA 3BHBB 3U48A 3HPLA 2UV3A 3GSVA 1RZ8B 1JTTA 3QXDB 3BN9C 5GJTL 2AQ2A 2ICCA 4ZPTB 3CFEB 4BSWB 5KVEL 1MCNA 1WC7A 2BMKA 3MROB 4P9HL 1D5ZA 3H2WA 1W72A 4S0SD 4JKPH 3O4LB 1MRCL 2NXYD 1OGTA 2ERJC 1PW3A 3IDNB 2ARJQ 3OAYK 5B38B 2ZUVA 3RZCD 4WJ5B 3QQ9D 4PJ7B 5C07D 4Z5RA 5HVHC 4XHQA 2DM4A 3U0WL 4JVPA 3WFZA 2IBBA 3CDGB 1J05B 2X4UB 3Q6GH 3ULSA 3P9MA 1WBXA 4XP9H 3G08B 1QRNB 3MRPA 1U92B 4GBXC 4KZDL 4S1DC 3O6KH 1AY1H 4I18A 3G5VB 1A9EB 2F15A 3QHTC 4KZEL 1E6JL 1KENL 3WFCH 2BK8A 4ODTH 5FGBA 3GI9L 2JJSA 1U3JA 2JKXA 3QO0A 3G5YB 5B39B 3RI5F 4LL9A 2HVKB 5KSVA 1A0QL 2IPUG 4ZFFB 1P1ZA 4TSAH 3EYUH 5GRWA 1R6VA 2YXFA 4LMQI 3B3IA 1OAXH 1V7ML 1A9BB 3ERYA 2F5BL 3ARDB 2P7TB 2FX9H 3HMXA 2OXHA 3DETC 1ROWA 2A6KA 5IVXB 4CL7A 1YNLH 4LFHD 2W0LA 1WSST 4QRSA 4XXDB 2K9UA 5ESQB 3CZJA 1EFXD 3HPJB 4J4PD 3FTGB 4LLVB 2G75B 3V5KA 1JJUA 4PRHD 2YA0A 1IQWL 5I73C 1JNNH 3Q5OA 4S0TD 3NCMA 5L6YL 4CGTA 5ISZA 5C09B 3ECBB 2HFEB 2EO1A 5IHLB 3QNZB 4X4XB 1AD9B 1GGTA 4CW1A 5DK3A 3Q3GB 4TSBH 3GSQB 1MAMH 1EAPA 2P8MB 4LHUB 1TQCC 1CD8A 1E28B 3KPLA 5EZOL 4ZQKA 1TPXB 1DLHA 1PGRB 1BJ1J 4KMTH 4WFEE 4PG2C 3RP1A 1A4JA 3DV4B 3WNMA 1RZ7L 5JXAL 3BPOC 4JZJA 2BSED 3D3VB 3LS5L 5D7KD 4FFZL 4L8BB 3P9LA 4HS3B 3I2CL 3HCVA 5HHOE 2QKIB 1M4KA 1I9JL 5C7XH 1EXUB 1D6EA 5E8OA 3PDOB 3DSNA 4LCUA 4F80A 2X2YA 4P9ML 1MCSA 4Q9RH 4ZFGH 4U1LA 3B9AA 4QY8A 2QSCL 2NW3A 4KKCC 3BEWB 5CSBA 2D0FA 2XY1A 2J8UF 3CAFA 1PBYA 4DGIH 3N1GC 4MS8C 5JW4M 1U8LA 2Z4QA 3B6SB 5I6XB 5JA9A 1B6UA 1A6PA 1XGRB 2R9HD 2VDOL 4PBVC 4PB0L 4OZFG 5IMOA 1T1ZB 1MVUA 3WNPA 1CR9L 1ERNA 1L6ZA 5I1KL 4DK6A 5DA0B 3ULVC 1GL4B 2A9ML 3RUGE 1U8PA 3PHOB 5E1HB 5F3BA 5IOPA 4NRYB 4FQCL 4WHTB 5TF1L 4ELMF 1Y6MR 4LDLB 4X83A 5D6DC 4HMEA 4X9GA 1P4IL 2R0KH 2ZWLT 1K3IA 4HCRA 5DJCB 3DI2B 3PV6B 2OR7A 3B2UC 4YEEA 1JI2A 2A83A 4D8PA 1XMWA 4NFDA 2EE6A 4LPUA 2HLFD 4NKMB 3DMMD 3ARYA 2ATKA 3NAAL 4G6MH 1FYTD 4XVJL 5E9DD 1RUAL 3C5ZC 4NKOB 1CGTA 2VL5B 3U36A 5HDBE 5IV2A 5K9KA 4BFIB 1XF5A 1SY6H 2ERJB 3MJ9L 1P5UA 4FQ2L 3GMQA 4KI5C 3ULVE 3WIFA 5DD3L 5HVHB 4RBPK 4X4ME 1NCCH 2IG2H 2B0SH 4RAUB 4J3WA 3K1KC 3VGBA 1R24B 4XCYB 2VAAA 1PY9A 3MRMA 3O45A 3MA9H 3DURA 2YMXL 4Z9KB 5D1QA 4F33B 5HDQH 1ZLSL 2Z31C 1Y18A 4F58L 4NQTA 3IU3A 1OP3K 3WHXB 3QA3A 3T8XB 2CO7B 2ICWJ 3P73B 4NZRL 2QR0A 3TYFB 2HJFA 1LO0L 2E6JA 2JJTC 5F8RC 2EIZA 4LSRH 1VHPA 3HHRB 1QG3A 1C16B 2ADGA 3EYFB 2X4NB 3G04B 3O8XA 15C8H 4IJ3C 5CEZE 4PFEA 1XGTB 3TBSA 2GJJA 1MJUL 2GFBB 5CILH 2P8LA 4KQ4H 5GHWH 1U2HA 5J3HD 4XMPL 3DX6B 4M7ZC 4G42B 3M45A 1YMHB 1D6VH 3C8DA 2BNQD 3BWAA 3MOBL 3P0YL 3ET9F 1UXSA 5IB3A 3CZFA 5I1HL 3H6JA 2HT4D 2PXYC 1VDGA 1RV6X 3D39A 4NO0B 4XPGH 5I73B 1AH1A 2MMXA 4XP4L 5KZCB 1H0DA 1D3CA 1GZPB 1RIHL 5DZOA 3WNLA 3VJ6A 2Y07L 1OW0A 5I66A 3PDDA 1L6XA 2FLBT 1RIUH 5HHOB 2P5WD 4U1IA 3WKML 4WUUD 5ITFB 1BF2A 4FQXA 3KPRA 4JRYD 3CLFH 5AUMB 1IAOB 4V2CB 1RUQH 2Y6SC 4AH2B 4QNPE 5E5RB 1NUNB 3TBWB 5A16B 3MRDA 1QFOA 2MPAL 3FQXA 2IBZX 4KKBC 2RIKA 4LEXL 1A14H 2R2BA 4C56E 3D9AH 2B2XH 4GLRI 3MV7E 4QOKA 4J23A 4O02H 1KCSL 3BPOB 5DC0A 3PGDA 4KRLB 5FB8B 2BDNL 3U30C 3V6BR 1GOGA 1W8OA 4WVRA 2AV7A 3WS3A 5DQJB 2F53A 5CHNB 2F8OA 2DJ4A 3SGJA 1I7ZB 5ADOH 3TH2T 1ZOXA 3RUGB 4OGZA 1PSKH 5D1XD 2W65A 3ZKMD 4JM2F 4JN2B 2BY1A 1YNTA 4HUXA 4PJGA 5FKPB 4M1DL 2EIBA 4JDZA 1VEMA 4JN1L 4YDVA 2FEEI 4JDTL 3MFFA 4OQ1A 3UTSD 3CDYA 3WMSA 4OD1L 4IMKC 1VFOA 3GZKA 1A1NB 4GUPB 5HGBB 3LIZL 5ID1A 3BQUD 4XCCL 4E5XB 1GPOL 3C6LB 2IAMA 1YYML 1T66C 1BVKB 2BVOB 3R06B 5DD0H 3ZT7A 5EPMA 2IBZY 2VXSH 3IF1A 4QF1A 4X4YA 1MEXH 4IHOB 1B0GB 4R7NB 2GHWB 4PY8I 3EUUA 1S9XB 1E4XL 1RHHB 1J87A 1FO0L 1IKNC 3IETA 3QCUH 3D69B 1KB5H 3VXMA 1KTDB 1TTFA 3RIFK 5CIPB 2PCPA 1LNUA 4FQQB 1D5IL 4OM0H 2MWCA 1NFDA 4HKBB 5DEFB 3CFKB 5E7BA 4GT7A 4YX2H 3RWFB 4F7MA 4QGYA 1G9MH 1XIWA 1HXMA 2FO4B 1HHKB 2H26A 3TV3H 3DUSA 3FB8B 3NN8B 5IGXH 2DYPD 3QUXA 4DGVL 1SJEA 2HTKC 3VFMA 4H1LA 3QH3A 1OAKH 1MQ8A 4TNWK 1WF5A 1QD0A 3KXFD 5A3IC 4PREB 3BO8A 5JZ7D 1AR1D 3RL2A 2OBGA 4W81A 1EO7A 2YKLH 1WV7T 1I1YB 4HC1L 2OTPA 3T2NL 2EYRB 4J8RB 3D2UA 1MLBA 1F8TL 3MGOA 4YWGL 2VXQL 1RUML 2Z31B 4LLQB 3VE0B 4ZSOE 5TGBB 3V4VL 4PJGF 1WFTA 2I60L 3D0LB 5F97E 1S7SA 1RK0A 3QB7C 2Y72A 3M1BB 1RZKC 5ICXB 3V4PH 1YQ2A 2NW2A 4Z0BL 3HR5B 4DCQB 4CKVX 4NJAL 1AXIB 5L2JB 3PIQA 4OCRL 4UTAL 3VRLE 1WAAE 4U3CA 4X80L 3CGTA 2X9YA 4UV7L 1NC2D 2WIIB 5FO7A 5ACZB 1R3HA 1II4E 2HRPH 2BHUA 4N0YH 4NRXA 1D5BA 3QXAA 1S3KH 3ZE1E 4XCEB 4M7ZB 3EDKA 1GRWA 1V05A 5GRYA 3GRWA 1T3FB 4C56B 5MHSD 2VLLA 4GW1A 1U8NB 3RL1A 1EEQA 4I4WB 3L7EB 3UYRH 2AJZA 4ZXBC 2ORBH 4HJ0C 4ODHH 4G6KL 1NGYB 2WQ8A 4NN7B 5C0FA 5KSUB 3VDBA 1YJDC 2XN9E 1NFDF 2VZVA 3O2WL 1H8SA 2GITA 4JFDD 1V7NL 1FBIH 3K81A 3RBSA 4LIQE 3G5ZA 4DK3A 4JRXA 4HEPG 1KNOB 3RKPA 1HHJB 3VFVB 1F3DH 1FYHB 3S35X 4F7CA 1UYWH 3CC5B 2O5XH 1WWAX 1QFHA 2ZCHH 1UH2A 4OLYH 1RUKH 3JVGC 1HQRB 3TH4T 4XNUH 5K9QI 4MZ3A 3U0TB 2DQIH 1OL0A 3RDTB 3HS0A 3O11A 3U30B 3FCTB 4GQ9L 2WANA 1U9KA 3TZVA 1I7RA 1U8OB 1MHPL 1XAUA 5DJ2A 1JHKH 2DDQH 1KPUB 5CAYB 1MCJA 1J88A 1S5IH 3BPCB 2BSTA 4G43B 1G6VK 5DRZA 1E4WH 1FFPA 5C0GA 3IXAB 2DMCA 1IM3B 2GK2A 1YECH 5FUCC 5TH2A 1LO3L 1XF2B 1AGBA 4PUBH 4XP1L 4D0BB 4MNHB 5HI4C 2H32B 4LLWA 3G6JE 1NJ9A 1T7XA 2E5EA 5KVGH 5JOPD 5ICYB 3CSYA 1T22B 1EX0A 4X6FB 5FHBL 1SEBB 4ACPA 3QEGL 3SCMD 3QQNA 5F9JB 2DQTH 4NNPH 2OJZH 4I0PB 4XNXL 4H26A 1MLCB 4RAHA 4AYFA 2DBLH 4YNYA 2OLDA 3QZWA 5HJ3B 3U0PA 4G9FE 3IDUA 3H42H 4L4JA 4UQ3B 1X6LA 5FYKD 1N26A 3ARZA 2YRPA 4IRJC 5FDWA 1CK0L 1BREA 4MAYC 3K2MC 1U95A 4HPOH 4U6TA 5IB1A 2X1WL 5E99L 3HG1D 4ERSH 3LMJH 1AO7A 2YD2A 4NQSB 3AREA 2ESVA 1TJHH 1XZ0A 1UEMA 5GRXG 4HKJB 4POZD 1OWWA 3FFCE 3UEZA 3QBTB 2R23A 4OFIA 3R0MA 4ZSOB 5L8LB 1C5CH 3HAEH 5IFAH 3E6HA 3QEQA 3GHEL 2HH0H 1IGTA 4MJ5B 2WLZA 3MUZ1 2CUIA 3ZLQC 3WFHB 1U3YA 3DTXB 4YPGB 2A6JB 3HZKA 3EJZC 4P3DA 4GKNB 4RGNE 1ETZA 3BVNB 4ODSH 1MCWW 5LWYH 2R2HA 2NTFA 1SYVB 3T0XA 3L5HA 2DB8A 1KEGL 2D3VA 5T3XD 2FWOA 4HKZB 1MFDH 2EE9A 5TJWK 2W0FA 2Q76A 3O2DH 3VI4E 1QFWM 3OWEA 5IMLB 2N1KA 3QFDA