4NQDA

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
260
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIEIDYGDILPSGDGTYQAWASIELYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 66
structure length 260
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqdA01
3CFBB 1PZ5A 3BHBB 2DIAA 4HAFA 2VC2H 1LILA 1QP1A 4DCQB 3F12B 5ALBH 4ZNEA 2EH8H 1KTDB 3ROOB 4UV7L 1GXEA 1XR9A 1B4JH 4S1QH 5MENB 1DL7H 1I7UB 1K8DA 3GSNH 1QPXA 4HKBB 4YGVA 5B3JE 3PL6C 1G0XA 5JNYB 4C59B 5DUPL 3MV11 3P4NA 2ZP0T 4TSAH 3ZKND 1UJ3B 3RWHB 5C0AA 3TJEH 4HXBL 3L3DA 1A21A 2AKRB 4WO4D 1JHTB 3MX0A 5ICZA 2AK1H 5DD3H 2P8LB 3ZE1E 1PKQE 3MV8D 2ZSVB 2ERJB 2IANB 2HWZL 4NN7C 3S34H 5JA8B 5DK0A 2Q8AH 4KRPC 1JGVL 1UQSA 1DQQA 3CSYB 4ESKA 4J3WA 5BRZD 1JPST 3FB8A 5GSVB 5ICYB 1YY8B 1JPGA 4U1HB 3BRFA 3ULVE 4JG0H 2EDKA 3BZFA 4CADB 5IK3B 4OZHF 3CZFB 3SOBH 1ZA3B 3O6FD 1MJ8H 2DM4A 1FPTL 3CK0H 5FIEA 2CSPA 1P9MC 4JKWA 4NPYB 4IMKC 1S7WA 4HX1A 3WDHA 5A2IH 1DSFL 5L2KD 4PGZA 3WO3B 1Q9OA 1T1WA 4JFXB 2X4SA 3KDMB 1U8QB 4FN0A 2K9UA 4C56B 1H8NA 5F9WC 3OQ3B 5DMIH 1S9VA 4H26B 1KTRL 2VITB 4D0DB 1KCLA 2NPLX 2ICWJ 4G6MH 4MNQD 3RNQB 4DJMA 2L4OA 1MCOH 3F7VB 4LOUC 3TZVC 3FT4B 4YWGH 3EZJB 5CP3A 3T2NH 2YK1L 4WEBL 2EDOA 4LLYA 4X6FA 3EYFA 4XCYA 1MLCA 1G84A 1ITBB 4U0QB 1SY6L 4QYOA 3DYMA 4OGXL 4LSQL 3HMXH 1IGIH 3L1OH 4YPGA 3C08L 1GCFA 1YUHB 1WCBB 4NUJA 1XF3B 4MB5A 2HN7B 1EZVX 4UT9H 5C0JB 3LEYH 4RMUA 5FDYA 1PSKL 2EH8L 4HWBH 2ZUTA 2ADFH 4P2QA 2EE6A 4P5TB 1QLFA 1BQHG 1A7RL 1MFDL 2BJML 3EO1A 1T1XB 3L3GB 4LEOB 2X5PA 1CTNA 2MTPA 3MODH 2A0LD 2VDPH 4MDJA 4NRZB 1T66C 5I1EH 5H35A 4M00A 1T7XA 3MGAA 3UTSD 1EFXB 2GW5A 3CMGA 4KH2A 4DN4H 5EZIL 4PRIB 4PJFF 2QQLL 4Y5YA 5E24E 1B0GA 3RDTA 4XVSL 4Y4HA 5D7IF 4ZUUA 1AHWB 1HSBA 5KW9L 2YXFA 2B1AL 4Q9BA 4ENED 1GC1C 4HKXB 3HMWL 4Y5XC 2WINA 5AYQA 5FUZH 5J4MA 1N6UA 4IRSA 3MMEB 1NCUA 2Z35B 3QDMD 3V0WH 3IYLW 5I0DA 1UH3A 1Q9WB 1RFDL 1MPAL 4B50A 4LCYB 4LKXB 1A47A 3WO4C 4ZPTA 3BSZH 3S36L 3ULSB 4LSRH 4CVUA 1F6FB 5E03A 2NXYC 2XQYK 5I73C 2FD6L 2VXUH 3L3IA 5IB2A 2PXYC 3WUWA 1JZ2A 4PJXE 3RPIA 1M05B 1T04B 4CBPA 1OAUL 4Q97A 4EXPX 4PJEE 3G5ZA 1G7LB 1OGTB 4UZGA 4Y4HB 2J5LB 3FO1A 4UOW1 1J12A 2WLYA 1GL4B 4WO4B 3MJ8B 1S7TA 3BVNA 4V1DA 1WBZB 3DO7B 1DE4A 5C08E 2I5YH 4LBEA 1EHXA 1K2DB 1RURL 1WWCA 4EI5C 3UJTH 4JFXA 3FQXB 1JGEB 2I26N 3B4NA 2VKXA 4WDIB 2C3WA 4M48H 4HUVB 1AI1L 3B9EA 4Z77B 1W8NA 5BRZB 4QRRD 1P2CA 1VFMA 1UG9A 2FEDC 1AR1C 3HC0A 4DVRL 4M93C 2YD2A 3OHXB 4EOWL 3EBAA 4M1CC 4H5SB 3STZB 1IAKB 3QWRD 2XPGB 3H7LA 1K4DB 3CFKA 3DV6A 1G6RB 5IB5A 4XP6H 2D0FA 2XACC 3D87B 4GAJL 3S9DB 2FHCA 5SX4I 4LARL 3C09B 1UWXK 2APXA 5C0AD 4JQVC 3HA0A 4PS4H 2MJWA 3NFPA 4QHKJ 2HFEB 4L4VE 5F93C 1E6JL 2DQHH 4OJFL 4BQ6A 3DV4A 4P57A 3C8HA 4Y8DC 3UCRA 5C0JA 4PJEB 3UZEA 4XNXL 5IMKB 2ATPA 2QL1A 1QYGH 3VFRB 3O4OC 4WW2A 4KROB 2IPKA 5A43C 4R26H 5FYJH 4Z5RB 1UXWA 1T7ZA 4P4RB 2NY1D 1KBGL 2WLZA 3T0VA 4DN3H 4HUUB 2MWCA 2Q87A 4NYLA 4KK8C 5ECJE 4JZJC 1NCCH 3HRZB 2D7PA 2QV2A 4D94A 2PO6B 5I30L 1MHHA 3NPSC 4ERSH 2NY0C 1ZWIB 2OTWB 3ARBD 1T83C 3V5HA 2YPKB 2ARJB 3CH1B 2NY2C 1UCTA 2DS4A 4Y5YB 2JJUA 5B39B 4S2SB 5DMYA 1JPFA 1PY4A 4NQEB 1NCNA 4NZUL 4HCRA 3BHBA 1BAFL 4Z7VE 5KZCD 2F8OA 1PX3A 4KK9D 3LN5B 3S3SA 3V6BR 4JN2B 1N0LA 2VQTA 2DL9A 4WUUB 5F7NC 5HDQH 1YEFH 3VW3L 4M6ML 2CRZA 5HHOD 1AJ7H 4XWOC 4O2CA 4NNPL 1T6WA 1EVTC 2BHZA 5CINH 4BZ1L 1AGBB 4CN6A 1JV5A 4LLDA 1ZGLA 4BFIB 2GJJA 3MFFB 4P4RA 4HIEA 4S0TD 5D7KE 2OM5A 5DUMH 3P4MA 3BP7A 4ERSL 3LKPA 4LIQH 5GRXG 5CJXC 2R23B 3E6FB 3HI5L 1KJVA 3HUJE 1EEYB 3VWKB 3QG7H 5E7FA 5J3HD 3AUVA 4X9FA 3H0TB 4E0RA 1F4WL 2W38A 5D1XA 2C26A 5IVXA 3QQ9D 1G7JA 3T0AA 5IFJB 3U9PH 1G7LA 3IETA 1G6RH 4P4KA 1L0YA 1DQLH 1JPFB 3N50A 3O4LA 3L3KB 1B90A 2VSDA 5HGHB 3EJZD 5CIPH 4P2OA 5K33A 1ZSDB 2R69H 1CQYA 5JQ6L 3G6AA 3UO1H 4DCQA 3Q6FA 2DI8A 3FB6A 1MJJA 2EIBA 2NZ9D 3QDHA 1W0VA 3G04A 3SBWA 3FRUA 3CDGB 4HIJA 4L4TA 4YDKH 4KRNA 4M5ZH 5T1LB 4PD4K 2G5BA 5KSUA 3FOMB 2VZVA 3ARXA 3DXAB 3RUGA 4NZRL 3TLRA 5IHUH 3QWOB 5IM7A 5BZWA 1FGNL 4XMKL 3I02B 3TNMB 5IB3B 4G6AC 4PJ5A 1I9RH 2PXYA 4P23B 5HHME 3F5WA 2DMBA 2P8LA 4Y4HD 4QOKA 5K93A 2H8PB 3LS5L 4AM0B 4AZ8A 1ZT1A 4JPIA 1NGYB 1YA5A 2JIXA 3UJIL 3FQNB 4LLQB 4M6AA 3BUTA 5J3HC 4R7NA 4GBXB 1BBDL 2DBLL 1ZSDA 5CKAA 3LHPL 3M8OH 4QTIL 1EXUB 4K9EC 1HXMA 4PJAE 2NY7H 1ZANL 4P2QD 4U4BA 2AXFA 3L5XL 2J8UB 2Y1VA 1AO7E 3L3JB 5IQ7H 4OM0H 4K8RC 2DQGL 1LO5B 1AGDB 2XTLA 5AWNH 2WBJD 4G7VH 3L3DB 5BZWB 4IRJD 3DJ9A 2ZUYA 1CL7H 1WFUA 2YK1H 5FYKD 4XMLL 1H5BA 1A3LH 1WISA 3CJJA 1P4BL 1S5HA 3D9AL 5HGAA 2WBJC 3FOLA 3PHOA 3NAAL 2Y23A 4F3FB 5B38A 1G7MA 4G6ML 4BSWA 4PP2B 4GRLB 3EIFA 2CKBA 3SDAC 4RFNB 1BZ7A 4KVNL 2VKWA 1XIWD 1EHLL 1AGEB 3I50H 4XBGB 3MR9B 3BKMH 1FFOA 2R2HB 5GGSY 1A5FL 1AXIB 1HKLL 2A6JB 1DLFL 1XGPA 3IDXL 5FUOL 1HHHB 2R0KL 3AS0A 3GFUA 5F6IB 4TPRH 2OZ4A 2AJVL 3ZT6A 1M7DB 4NT6A 4TTGA 1U8LB 3OR7B 1ZT4B 3TZVD 2XQBL 4JFED 1IM3B 3IKKA 1IEAB 2P24B 3ARFC 4NBZB 3R1GL 3O0RH 1VSCA 4JFOB 3JTTB 3MRCA 1QBMH 4JZJA 1B0WA 5E6ZA 1I7TB 3DX7B 2VR5A 2BCKA 2PO6D 3RGVA 3RTQC 5D7LA 1WT5A 2NX5A 3NCEB 3IKCA 4XP9H 1NC2B 2FX8H 5DHVB 2BY2A 1PSKH 2ADGA 3P73B 1MCQA 1HQRB 9CGTA 3ZKXC 1QOKA 1QBML 5HYSA 5MEOB 3IFPA 4IOFD 1K5NB 2O93L 2YWZA 2F5AL 5JPMB 3C5ZB 4I3GA 4OLXH 1CICA 2JK5B 3BP6B 3GEWB 5KVGH 5CS7A 4ONGL 3VXRB 15C8H 5AG8A 1QSEA 2XFXB 1R6VA 5DRXA 1U8LA 2D0GA 1C12A 3ESUF 3BRGC 1V3KA 1S7QA 1A1NB 4G9FB 4PYGA 2AJVH 4ZUTA 3WE6B 3CIQA 3DO7A 1AXSA 3L5WA 4DW2H 2KDGA 4UAOB 3O3DA 2PO6C 5CJXA 4XBPB 2O5XH 1OB1A 2AAVA 2VC2L 3MNWB 4GRLC 3ES6B 4JFEA 1JZ5A 2LVCA 4FFZH 3T0EA 1JE6A 4NGHL 4P2QB 4LKCB 3BT2L 2GI7A 4U6XB 4KTDL 1UXSB 2XKNB 2Z4QA 4YHYB 5DRZB 2JIXB 5E6ID 2NX5E 4GMTL 4Y8AA 1YMMD 5DS8B 3WIHL 3OHXA 4JGUA 5GGVY 2AK4B 1R5VB 2R4RH 2YD5A 4Y88A 3BDYH 1SJVA 4XPTH 5FGSA 2ILLA 4QHMB 1IARB 4U6HA 4HFUH 4MCYA 4NO5B 1FZMA 1QFHA 1OM3L 1KB5H 2IQ9H 2EDFA 3RWFB 1K6QL 2ZJSL 3MJ7A 4ZXBC 3KYAA 1S7TB 4DUVA 4Z18A 4FFZL 4CMHC 5A2KH 2BNRA 3BZEA 1OGAE 2VLRD 2H32B 5H37H 4PV9A 3OMZA 1CDCA 3MRGA 3HMXA 2VE6A 1Q0YH 2F58L 1TJHH 4GRWF 3HLAA 2A6KA 2BRQA 4OCLC 3GIZL 3DECA 3T0XA 5EO1B 5I1AB 1E4WL 5CGTA 1BZ7B 3MJGX 1JNLL 4N9GA 2CD0A 3C5SA 3V4VH 1AE6H 2EIEA 3VFPB 4P49A 4Q7DA 4JO4L 2GUOB 1G1CA 3TVMC 1UKTA 2IPUG 2W0FA 4PRDB 5AYUH 12E8H 1YEKL 2JJTA 4GAYA 3RWGB 5BXFA 1DVFD 4OZGE 1CD1A 5J1TC 3P40A 5HY9A 5F1NB 3GHEH 3HE7C 1JL8A 2P5WB 3QXVA 5AD0B 5I6XC 3HUJB 1U8OB 4YDKL 3U2SB 3QQNA 4QO1A 5MERB 5L8JB 2ZCKH 1J0ZA 5F9OL 2BRRL 4BM7A 1MELA 2H32A 4J12A 4R90L 4FQQA 4YFDB 4JAMB 4HHAB 3SDDB 5I1HH 4HUVA 4PJGE 4UBDD 4P5TA 4N8VB 4U1JB 3TBSA 1OGAA 1JZ3A 1NMBL 4RBPH 1QACA 1A6WH 5HD8C 3GMMB 4U1LA 1PFCA 4HWUA 5E00B 4BH7A 4EI5D 5B3NA 1EFXA 1U3HD 1K5NA 1X5KA 1NGZB 3GO1L 3U0WH 2NZ9C 4FA8A 3X3FL 2I07B 5EN2B 1LP9A 2DJUA 4XPAL 4BUHA 2BHUA 4ZO9A 4ZAKA 5D1XD 3L5XH 4GKSB 5DJ8A 4OFIA 3QNXA 1F4AA 4NSKB 1L9NA 4U3HA 1A7OL 1SJHA 1AKJD 3TBWA 1CFQA 5LBSL 1A3LL 1QQDB 1CR9H 4XBPA 1CXLA 1WZKA 4JGJA 4FFEX 4N9OB 3W82A 5I9QB 4U1SA 1DDHA 3EFDH 5E2WH 2KL6A 4L3AA 5AWNL 1PG7X 3OKYA 4HXAH 3ARPA 3RTQA 1CK0L 2WIIA 2A77H 3VRJA 1QFWH 1JHLH 1R3JB 4NKIL 4Y5VC 4HKJB 4L4VB 2ZKHH 2JCCE 1JRHL 3WNNA 2P5WD 3V5DB 5CCKH 3KS0H 43CAB 3MCKA 2ARJA 4CDGC 1TJGL 2ORBL 3MRBA 3QUKB 2EE9A 2EH7H 4NO3B 4ODXA 3UJIH 3H6JA 4G3YL 5DQJB 4NRXA 1FO0H 4NSKA 3AU1A 4DEPC 2LU7A 3B9VA 4IRZH 1MWAL 1FL5B 5I1DA 3CDCA 1VB9A 4X9IA 2CDGA 1FP5A 5F7UA 1IM9A 3DTXA 1EAJA 2O26U 3QQ3B 4UQ2A 4U1SB 4GJTB 4IMLA 5ANME 5ISZA 5EWIH 5E0QA 1D5XA 1N8ZB 1WWWX 4ZS6D 1D9KD 4L8BB 4LCCB 4DK6A 4CNIB 4P3DB 2HLAA 3FAXA 1R5IA 3RX7A 3VD3A 2AV1A 3HZYB 4H1LB 5D2LA 4PTTA 1H3VA 4KZEH 1IAKA 1II4E 1ZV5A 5IVNA 4PJBF 2YR3A 4KHTH 4Z7VA 4QOKB 3VFUB 3AGVA 5EOCL 5GGRA 3VFSB 1V5JA 3JTSA 1WFTA 4PP2A 3GI8L 1ZVSA 1CVRA 4OV5B 3U9PL 1HH6B 2P5WA 1NC4A 2MCPH 1N6QH 2LU4A 4M48L 3EO0B 4LARH 4ZFFB 2YUXA 5CJQL 5HDQL 5IESL 3RWJA 3IDYC 4CVWA 4CMMB 3NPSB 4LL9A 5IMMA 3PGCB 4WW1B 4FQQB 3SCMD 4EOWH 5GS0L 1T89A 1FSKB 4DK3A 2J8UA 4FXKA 2VTFA 5KSUB 4K7FB 2GTWB 3RWIB 1PLGL 5BV7B 4RSVA 1QLEH 5I30H 3VXMA 1MSPA 1EK3A 4NC2B 5HYFA 1YN6B 1WLHA 1FFNB 1T20B 1ZLVH 3QJFB 1A7NL 2VDRH 4UTAL 4DVBB 4OGYH 1G0DA 3L6FB 2EYRA 4Q9QL 1PKQB 1N64H 2EDEA 1YMMB 4H1LG 5DK0B 1YYMH 5C0IB 4G8IB 1QUNA 2H26A 4MX7A 2NY4B 3RHWF 4JQVA 5D7IB 2QLVB 1JZ6A 3QH3A 4JPKH 5F6HJ 5FYKH 3OL2A 4OJFH 2A74A 3MLXL 1OGAD 2VLRE 3DBXB 2CO6B 1CE1L 3MZTA 3NZ8B 4P5TD 4D3CL 4HJJH 3G08A 1PEZA 3BKJH 4JKMA 3QJHA 1I4FA 4JR9H 3E3QA 4U3CA 2HKHL 3L9RA 4MAYB 1KJMA 3DHJA 3H9HA 4YDVA 5D8JL 1T1YB 4O9HL 4Q0XH 2VZSA 4LEXL 3ZDZE 5DSCA 4M7ZB 3BKCL 3OAZH 3O4OB 3BESR 4EI5B 1A1MB 5C0FA 3FB5A 3MRPB 5I9QC 2NX5B 1NMAL 2O5ZL 3I6GA 1RULL 4HK3N 2OL3B 1PZ5B 2EZ0D 2JELH 1FNSH 1YEKH 4F58L 4MS8A 1RURH 5GRVK 1AIFB 2F15A 1R3HA 1G9ML 5C3TA 3KYOA 1T2QH 2ZKHL 3QEQA 3OR7A 1YNLH 1BZQK 4F7EB 3V4UH 3OG6B 2BJMH 4HXAL 2VLMD 1JWUA 4HKXA 4LDOB 1QFUL 4RFEB 1TJHL 1RZGA 2LVEA 4IDJH 4BKLA 4HGWB 3SKJL 1QVOA 8FABB 1I3UA 2NYYD 4Z76B 1BVZA 3W9DA 1B2WL 3T65A 5L9DH 1DLHA 4D0DA 3QEUB 1MIML 3IDJA 3ULVC 4OI8A 1S7VA 4HFUL 4JRYA 2ADGB 2IWGA 1U8HA 4R4ND 1N59B 3FT4A 3H8NA 3TJHA 5IP4A 5GSVA 4KDWA 2ZCLH 3VFNA 4DGVL 3OTTA 3OJDA 4RGOH 3ULUE 1R3HB 2AXGA 2X4OA 2C5DC 4HGMA 2DDQL 3N1PC 2CDFA 3BP4A 4XPHL 3SGDI 3LDBB 4Y16D 4YHNB 5E7BA 4YWGL 1OQXA 3L7FB 3NA9H 4F57H 5I19H 1B0RB 3SDYH 4PJFB 3MBXL 3IDYB 2OJEA 3UTZA 1BJ1H 3QCUH 3E2HB 3DMMB 3VWJB 2P48B 5EZJB 4XHJC 3I6LE 3KDMA 4PRPE 5T5FL 1TLKA 5J57B 3QJFA 3LEVH 1TVHA 1KEGH 5F9DC 1NGXA 3ARFA 4NFCA 4WW2F 1QSED 3E0GA 5GZND 1G7MB 3EO9L 4O4YH 2HVJA 3QHFH 1CICD 3BN9D 3KXFE 2HTKD 1BQLH 2VRAA 4PJIF 4YBQC 3RNKA 3ZDZF 3IDUA 5DRWB 4OLYL 2YHGA 5KVDL 3QUZB 5SWSD 4ZUVA 2DN7A 4I3RL 3L1OL 4HMDA 4ELMA 3KPPB 5JA9A 1H3WM 4ZFOB 5IMOA 3JV6B 2VB5A 1BFOB 1LP9B 5F7YC 4NP4L 4TSAL 3K7UA 3GHBH 1JHKH 1YQ2A 4GAYB 4LSPH 5F6HI 1YY9C 1WBYA 3MUGB 3QHTC 4W6XB 1B0RA 1B6DA 3TGXA 5TF0A 4WO4A 1IEAA 4EXKA 4WEUD 3NH7L 2FECL 3WS6A 4YHIA 3DV4B 1H9VA 3FQXA 3PV6A 3BPNC 1ETZA 3QI9B 4JREB 4PJCF 2H2PC 4NN6C 4RIRA 2FH6A 4D0BA 3OSKA 4WW2C 1G1YA 1KJ3H 1YZZA 2MKWA 1JZ8A 1OAQH 3HR5B 2R4SH 4KGLA 5KTEL 4NRZA 1RUAL 4U1LB 1P4IH 1BVKB 1LO0L 3NABL 4JFYB 5EU6A 5DVNA 4M1DH 5E8OB 35C8H 3VG9C 3MRMB 1TTGA 5B8CC 2C3VB 4ETQB 1A5FH 1DSFH 3Q3GB 5FYLH 2CLRB 3MXVL 1UM5L 3JUYA 3HZMB 4LQ1A 5I8EB 5JW4M 5T5FH 1MJ8L 3CK0L 3VFTA 5J8OA 4MHHG 3PWLA 1FNLA 4OFPA 2F74A 3B3IA 4OD2B 5HHMD 1NFIA 4QRQA 5A1AA 4UDUB 4WY7L 2VXSL 1FL6B 3QCUL 3D85B 5T3ZE 1RI8A 4P5MA 2Z35A 4JCMA 1RZ8B 1G9MC 4PP1D 4RIRB 3KYMB 3VD9A 1MCEA 4DW2L 5HGGS 4PRNB 3V6FA 3GNML 1M7XA 1MAKA 1AQDB 5IQ7L 2IQAB 1P9MA 3SJVD 3T8XA 1RHFA 3S88H 5DYOA 1YEEH 3BIKB 4OLVH 1AXTL 3HE6D 2XXCB 2XKUA 3EOAA 3MCLL 3CDYA 5DGRA 4OZIA 4TTDC 3DV6B 3BE1H 2D7TH 2HFGL 3MRDA 4N0CD 2AJ3A 3RZCB 1EO7A 4OKVA 4P4KC 4QOKD 1CICC 2VXTL 2X1QA 4NOFA 2D03H 2JF1A 3ZLQC 4Z9KB 4MCYB 3S98A 1FCGA 3TNNA 1B4JL 4K9EH 3AREB 4NN5B 4NRYA 2KKQA 3NFPB 2QR0B 1CDYA 1Y6KR 4KZDL 2ITCA 1ITCA 4WUUA 3C5ZC 5DD3L 1IC4L 1LO2H 4OM1L 3ZYOA 1FYTA 4HFWB 2FJHB 4WDIA 5GS1A 1RZ7L 4GG6F 2G9HB 3HNVL 3J8F7 4J7RA 5JORA 3KYMA 1UEMA 4G43B 3VMOA 3KLSA 3G5YA 3JV4B 1ZE3C 1FZJB 3MV7B 4I2XB 1QSFD 5C0EB 2EDQA 1VFUA 4HEME 1CFNA 3S37L 4JHAL 2FSEA 5HHNA 3S36X 1KIRA 3UTOA 3VWKA 4PJCE 4UT7L 4BQBA 3GSOA 1T0MB 4H0HB 4ELKA 3DX9A 2IBZX 4F33A 4QHLA 1W72L 4JY4B 5FYKU 4BK4A 5KSBB 3BGFB 4OZFH 3G6JB 4GG8B 3D0LB 1IL1B 5EU7C 1GAFH 2PYEA 5D7IE 1XGRB 3C5JB 1IEBA 4CJ1A 1OSPL 4ZOCA 4EEEA 2ZCHL 4G59A 3QUYD 1KLGB 3K8KA 4ODSL 1NCBH 1C08A 5IBTL 4D9QE 4PJEA 4L3EB 3RVTC 1TPXB 3KPSE 1NUGA 4ZFZA 5SV4A 3MLPA 1IT9H 2CGRH 1HYSC 5I75C 3MCG1 4HWZA 4M43L 1URLA 3QQ4B 4UMGA 5FYJD 4HV8B 1JN6B 5GGUB 1EGJL 2E9BA 2O61B 4EDXB 3RZCD 1FQ9C 4NYLB 5CINL 2C4FU 4NQDB 1PQZB 3TBTB 5FF6A 1FNGA 4P59L 1ZWIA 3PGFL 3TWCH 5A16A 5IJVA 4Y5VA 4XH2A 1F11A 5DK3A 5BZDA 1JUFA 3DIFA 1ZK9A 1FL3A 1GIGL 4OIIL 2J6EH 2YD8A 3U36A 1NQBA 3DGCR 3X11B 5GGTA 1KN2L 5I6XB 4FQ2L 3MRNA 1E28A 4GQPH 2CJUL 3KPLB 4GW1B 3GIVA 2AXJA 5GRZA 1HXMB 3BOVA 1DFBL 1MCDA 2H9GB 4D0CB 4NO0A 4XBEH 5D96C 2PR4H 1JBJA 4DZBB 4WNQB 1MJUH 1G7HA 4YHYC 4DN3L 4FXKB 3HG1E 2X7LA 1AP2A 1AQDA 5TQ0H 5KSBE 5CJQH 5IBLC 1P69B 3U0TB 4LASH 5T3ZH 4BKLB 1EGJA 2I24N 4PGEB 3O4LE 2XZAH 2V2XA 1NBZB 3NZHL 2C1OB 1HXYB 3LQAH 3C2SA 8FABA 4G6KL 2IADA 5DJXB 4LLVB 4U1IA 1TJIH 1KCSH 3MRRA 4LSVH 1WEJL 3K4ZA 1YPZB 2XIDA 3TM6A 1A4KA 1PYWB 3P77A 3X11A 4PJAF 2GT9A 1A6PA 5T3ZL 3IRZA 1UGNA 5DA0B 3LZFL 1CICB 1R5WA 2WWKT 5KVMC 2P8PB 1CDJA 3STLA 1NMCB 5IB1A 2DLFH 3IF1A 2E6PA 5K9KA 5DMGC 3FN3A 1CFVL 3W0WA 1OD7A 2OJEB 3L95A 4MJIA 4RFEA 2ZPKH 4XWOD 2DM2A 1PW3A 1T1YA 4JGMA 4PGEA 4OCXL 4U6YB 3S96B 5EUOE 1EBPA 4PJ5B 1RU9L 2VN7A 3F6LA 2NY6C 3PHOB 4AM0A 3B5TA 5JLZA 3BDXA 1HEZA 3QXTA 4ZO7A 1ADQA 1H0DA 2HP4A 4OZ4A 4E41E 4YDJB 4M9OA 4N0YH 1N5YH 1NC4B 1RZ7H 3FQRA 1X6LA 3VXQB 1AGEA 1J1PH 4BZ2L 3UTTE 3C5ZA 3RWJB 4O2EB 1IC4H 4PRHD 1C5DA 3EYFB 1LQVA 4X6CE 3OKMB 1YEGL 4QHMA 2FH8A 1Z3GL 1J1XL 5TH2A 2H3NB 3CC5A 5GPRA 3VXSD 4PJ9D 3F7YB 1IGFH 2FX7H 2XN9A 2HT3C 2HVKB 3IFNH 4X6DB 3BSZL 2R9HD 3VXSB 1HHJB 4ONHA 4LBEB 3DMMA 3HC4H 1BM3L 2F53A 1XGTB 4JZJB 1BEYH 1U6AL 3SN6N 1IC5H 3E3QC 4FQJL 2XWBA 3S4SG 2A1WH 4RAVB 2XWTB 3KYKH 3UAJD 2VITA 2AABH 4JQXA 5CLWA 3TFKD 4RCAA 5J6HB 4N0FB 4PBVC 4XVJL 2FIRT 4MX7B 4PJ7B 5D7JA 2YPLB 5JOEA 1ROWA 3F58H 1QNZL 1I8IA 5C70A 4RFNC 1Z0MA 5HTSA 2FGWH 4XCNB 4Y4KC 3ZHLA 4ZNEE 1UB6A 1FDLH 4N90E 4R4BB 1RIHH 1INEL 1I8LC 5D93C 5EFIA 4AIXA 1JNHA 1LE9A 1A1NA 4ZUTB 4NQXB 3WHE1 4X7FC 3HHRB 2L0DA 2IGFH 5CHNB 3U7WL 1LEKB 2W0KA 1A14L 4DFIA 1CFTB 4ZSOA 5IMKA 5INDB 2H2SC 5E2UL 3BH8B 3HMXL 1ZA6A 5C0GB 4KY1L 3KPSD 1UWGH 3GRWA 3CVHH 5EUOF 3T77B 1Y0LA 1L7TH 3S88L 4FFWC 4KHXL 4WHYH 2AEQL 1E4WH 1DQTA 4KK6D 3OF6A 1BOGA 3ZDYE 1U8KB 4P0DA 2VL4A 4M5YL 4I4WA 4MAYD 3NCFB 4V2BA 3IDNB 3RY6C 3QNXB 1CXIA 1C12B 4Z7QE 3A6CL 2X10A 1YQVH 4E41D 3NFNB 3C8KA 3V0VA 5IV2A 5A2JH 3ZE2F 4JKPH 1ZVYA 3U4EB 5CBAB 3WLBB 1WV7T 5FDWA 1K2DA 2BY1A 1QFWM 1QRNE 3H42L 4OQTH 1A0QH 4JFDA 4HS6A 1ND0B 4JO1L 4P23C 1RUQL 4MZ3A 2FLRT 5CUSH 1U93B 1DBJL 4N8VA 3LKSA 2XXMB 1P2CB 3HNSL 2DQEL 4RMVA 4EBQH 4L4VA 4JRYB 3PDOA 2V5MA 3D5OF 3RY4A 4DWHA 2AV7A 4M8QA 1NLBH 5EZIH 1IKFH 1EBAA 3H42H 3WN5A 3GMOB 4WUKL 1WZ1H 5ENWA 5JDJA 2ZOKB 4K2UH 1RAMA 4NQDD 1MY7A 4AQOA 3FFDA 4ZXBD 4UIMA 4CL7A 1PBYA 5C2BL 4GKSA 4M62L 1D5MB 5E5UB 1YEIL 2WANA 3MUJA 4JPWH 5F1NA 1FZMB 1H8SA 1QHOA 2VLLB 1MAML 2JJWA 2OS7A 1SJHB 2XZZA 4MLIA 2BZDA 3TO4A 3D1MC 5IGXL 3VG0H 3KGRA 2HFFB 2Q3AA 3MYJA 4JFPA 4JO1H 1U8MB 3GBML 2D7QA 5LGKA 3BIBX 1A22B 3SJVE 2YD4A 2RB8A 3QUYB 1ZVHA 2RR3A 5HHVH 2LE9A 5TDNB 4YBHA 3KJ6H 4U7MA 2WQ8A 2GTZA 5E6IC 1BVLB 5ADPL 4JKPL 2FO1A 3OJ2C 1D5XB 1N8ZA 3TCLA 4XI5D 1I1AB 2R0ZL 4U7SA 3LVEA 2YKLL 3HZYA 4BQCA 3D3VE 4X99A 3OR6B 3PE9A 3QIWD 5FKPA 1A9EB 2PXYB 3GMOA 2DF3A 1BQLL 5TDOA 3MCKB 2F9BT 3LEXA 2DI7A 3SDCC 3TO2A 1FL3B 1MRFH 1KELL 5FGCE 2XV6B 5HYIA 2CK0H 2OZ4H 3V2AR 2E8YA 4I18B 2VISA 5IVXE 1JGLL 4FQCH 2WNGA 5GZOD 1FIEA 1A14H 5A3IC 4KRLB 3KPTA 1RD6A 2E9JA 4DZBA 3MFGB 2IGFL 5I19L 2AQ2A 1CLYL 1WWBX 4RZCB 2DQJL 5C07D 4KI5C 3SKNB 4OZFA 1V3LA 1A7QL 2AV1B 4X4ZA 4K07A 2R23A 3E6FA 3SE8L 2BERA 3X14A 3MACL 2GJ6E 3NMEA 4XHJD 5D7JC 5E2TL 3MJ9H 1QSFE 1MIMH 5I8KH 4PJIA 1F11B 3AS3A 5BZDB 4KAQH 4J23A 4Y4KA 4GRLA 2BVUA 4YPJA 1IGFL 4FTVD 1CCZA 4YC2B 3RVVC 2OI9C 2VUYA 4S1DD 5IEHB 3WMSA 2VISB 3K74B 5ESVA 5EOTB 2DLGA 1FL6A 1VFBB 1WIPA 1X5FA 1QR1B 5C0CE 1Q94A 3QIUB 4X5XA 1X4XA 2QKIB 4BELD 1I3RB 3PGCA 4WW1A 2NW3B 2PNDA 1BQHB 1MH5A 4DQOH 4AMKH 3ZZ1A 4PPTA 2AJSL 3UTQB 1TXKA 4PRNA 4RA3A 4EDWH 1GOFA 4Q6IC 2YC1A 4P9MH 1BLNA 3LQZB 3PQYB 4O5LL 3RL1B 5EH1A 4Z95H 1EEZA 4HKJA 4KDTC 1AC6A 3W2DL 4HUUA 1A7PH 2BSTA 3PDOB 3ME0A 5ITBH 3AS1A 4I48A 4OF0A 4Z78A 2NXZB 3T04D 2V5RA 3X14B 2QADD 4GRWE 1ZHLB 1B6UA 4JZOB 3HZVB 1C16A 3MROA 5IFHH 1P5UA 2FWOA 3E2HC 3O6LL 4XGZA 4UAOC 4UDTA 1JNNL 5HYJD 3GGWB 3V4UL 5C0FB 2DMKA 5HHXL 5GJSL 4PR5A 1HN1A 3IAQA 3O4LB 4Z0BL 3VRLE 4OQ1A 4HD9A 3EKCA 3AU1B 3CXHJ 4NM4L 1FLRH 3RX8A 5L7XL 5L8LB 1H8OA 5H94A 2WQRA 2EDTA 2VZOA 1T5WA 1MHPL 5H8DA 4OCXH 5JW3H 2MCPL 4JCLA 5JORB 3ARSA 4M5ZL 3GI8H 2EDNA 2XN9B 1GYAA 3BGAA 5I73B 4FMKA 3KYKL 5SWQB 3E1F1 4X6DE 3W9EA 4L8DA 1KXQE 2R39A 1A3QA 3DHMA 1MRCL 4JFFD 4K7PH 2PTVA 3HC3H 1EVUA 1UC6A 3E6HB 5FGRA 2Q3ZA 1PY9A 5D1ZB 3ARED 3UPRB 1TNMA 5AZEH 1S9VB 3P9MB 2IADB 3BUYB 4CU6A 1AY1L 2C3HA 3EOBB 3DUUB 5DK2A 2VL5A 2C4FT 5EWIL 1OSZB 1A4KB 1J1XH 4PIRF 3IJSB 5I74C 3SE3A 1GGBH 3X13A 3AREC 2CIKB 2YPLE 4NN5C 5HGHA 5EBWA 3SO5A 4R7DB 1M05A 4AL8H 1PLGH 4MA1B 1C08B 1UH2A 4WU7A 2VDKL 5HVHB 4C58B 3VI4F 5FUCE 3LKNA 2V7HA 3L7FA 4HKBA 3G6DL 2X41A 5D1XC 1MLBA 3NACH 4IOIB 3D25A 5F97E 3CFJA 3QQ9C 1ED3B 4Z7OF 3MBEB 5HI3C 4GUPA 3CLEL 2P5EA 1INQB 4OB5L 5DD0L 3GMRA 2VDML 3UPRA 3FOLB 1ES0A 3T65B 1FZOB 1KB9K 1KN2H 4G8EB 2BY0A 3G6JF 5EU5A 4UTBH 4U1KB 3N85L 4PJ9C 1U58B 4N9GB 1FO0B 3FB8B 3QH3B 4GG6B 1JI2A 3CVHB 2AJXH 3LKRA 4I0PB 1KBGH 4WFHD 3SPVA 3GJFK 1IGJB 4MDIA 1MHEB 1LMKA 1UFUA 2EDHA 3CUPA 1FVEB 2AEPL 5EU3A 2J8UF 2OR7A 4JM2D 2DQCH 1UB5A 3T1WA 3ETBF 1Y18A 1SQ2N 2DQHL 4XB8A 1FJ1A 5TGBB 5E5RB 4DGYL 1S7UA 5EUOA 1RK0B 1GGCH 1T0PB 3I2CH 4P2RA 4QRTA 4N0RA 5F7EL 2BCKB 3BIAX 1MI5E 4OV6F 3KG5A 4H26A 5H2BA 4X7TA 1KIPA 1MREH 5D7SL 3B9KB 5HHOE 1QFPA 2JJVA 4OZIF 4X4YB 1F5WA 5J13C 4S11A 1V7NL 5J0BA 3PQYE 2FO4A 3IXTB 1I9EA 3O41B 5F9OH 4OLWH 2ZCKL 3ULUD 2A77L 2I07A 3FFDB 3OG4B 1OTUD 3VXNA 3V52L 2PTTB 3SDXB 4JFDE 3GBNH 2GJ6A 3RIAK 4JDZA 4HCRH 4PJXB 1I1CA 4DOHE 4EQ2A 5L8KB 4KVCH 1QFWI 4FTVE 2HA1A 1IBGH 4MNHA 1P7HL 1A1OA 1CFQB 3P30H 3D85A 3HI6L 4ZODA 3QIBD 5CEZH 4HW6A 1JGEA 1CDIA 1IGCL 3KPNA 1DUZA 3QO1A 1JHTA 1DDHB 4Z7UB 4M1CD 1JIBA 4LSUL 4M43H 4HDIA 2F19H 3D18B 5I2IA 3RTQB 1U8NA 3QDAA 2B8OT 4KI5E 5F71A 1RIVL 2VLME 4MHHI 5A3ID 3FQRB 5ETUA 5EU7E 3DLQR 4OBSA 3TT1H 2AXGB 2X4OB 3PWNB 4ZNCD 2VDNH 4GAFB 1YDPA 1ZA3A 5JTWA 1YEEL 3CFCH 1I7RA 3GSNB 3MA9H 3G6JE 5AG9A 2BMKB 4Q9RL 3GNMH 4MXWH 3O8XA 1RUMH 3BH9B 1BD2B 1TZGH 3QCTL 2H1PL 1CLYH 1QA9A 4PJDE 3BDYL 4YHIB 3QIBB 4HFWA 5EIIB 1TMCA 1I8LA 1NGQH 1EJOH 4JRXB 4AYFA 3B9KC 3F7QA 1V8HA 5DA4A 3KHOA 4QHUA 1ZLWH 2GTZB 5CJ8A 3FOMA 3AY4C 1JWMB 1U42A 3T4YB 3EYQD 1WC7B 4HZAA 4UILH 3MRLA 4UUJB 1S7XB 3Q48A 2BSRB 3UZVB 4P3WA 3CD4A 4L9DA 3QUZA 1CTOA 1TQBB 5GGQH 3RVTD 2AK4A 3QCVH 1LO2L 4EN3A 4X6FB 1KSRA 2C1PB 5CEXB 3CH1A 4DKDC 4RMWA 3PUCA 3VXTB 2Y4SA 4K94C 5HY9B 3KPQA 1MCIA 2UY6A 3FO1B 3QA3A 3HE6B 2X1XR 1J18A 2AJUH 5T33H 5C0RL 4G9DB 3ARDC 1EHNA 4LMQE 3QDME 1U8MA 4J3OC 1YUHA 4NUJB 5EIIA 3IDIB 4KKNA 3PWVB 1OM3H 3QEGH 2R8SL 5I1GH 3U6RB 1DEDA 1SM3H 5LGJA 3RL2B 2W92A 2ZZUT 1A2YB 1UYWL 3DUSB 4MYWB 5DO2C 1EEZB 1WC7A 1TENA 4ZTOH 2C7UA 1U8JA 2Q7NA 1F13A 3GM0A 3J7HA 1R3LB 1UZ8A 2ICCA 3TH2T 4X99B 3GB7A 5TE4H 3VDAA 1WGOA 3WIHH 5CEYA 3MBEC 5I1CL 2BVQB 5D93B 1NKOA 1BFVH 1WZ1L 5MP6L 2QQNH 4PRIA 3DIFB 2YD6A 4Z7WE 3HZKB 3AVEA 2CKBH 3IETB 4Y2DD 4EVNA 2PTTA 3KLHD 2N4IA 5DMKA 5FA3A 4TPRL 5HI4C 3TBWB 2NY3C 1U3JA 2A38A 5E8NB 5LQBH 1F4YL 1QBLH 2UUDK 4WEMB 1P4IL 3KPNB 3MLYH 4XAKD 3RDTC 2Z91A 3PF2A 1OHQA 3H9SA 3M1BB 4ACPA 1ZT4A 1OAQL 4HDIB 5E56A 1OF2B 5IWLC 1TQBC 1CG9A 3MRJB 4LFHD 3TPKA 2QTEA 2BDNH 5E1HB 3UDWC 1R0AL 3ULSA 3P3YA 3T8XB 2PYFA 2GK0A 5FK9B 3GMMA 1M7IA 4I48B 4NCDA 3S35L 2AV7B 4Z78B 5CZVL 2RQ8A 1KNOA 3EJYD 4X6DF 2DDQH 4NQCB 1UYWH 1SYVB 1MNUL 2AEQH 5EC1A 4LOUD 3FB5B 3OAZK 5F3HB 5BW7A 2BNQB 1D5MA 5E5MA 1SM3L 5BS0D 3BP5B 4D9LL 1L6XA 1NMCC 3GHBL 4ONGH 4WI8A 5KVGL 4DAGH 3HNTL 5ICYA 1EDQA 2X4UB 5HHQA 1OCWL 1EHAA 5A2FA 3DTXB 4PRHE 1TETL 4X7EC 2VLJB 4LSTH 1WIUA 4X5WA 4X8JA 4OLYH 2H9GA 1S9XA 2FX9L 1OT2A 4R0LC 2GEEA 2Z8RA 1J8KA 1I8MB 4LP5A 1CD0A 3HKFA 3QHFL 1IAMA 1YJDC 4YO0A 1AD0B 3A6BL 2NY0B 4GRMB 3S37X 4MD5B 4P48A 1RIHL 3QCVL 5LJYH 2GJZA 4F7PB 4PRPB 4WO4C 1C1EL 1NFDE 4JZNB 1QNZH 3Q1SL 4TNVF 4NKOA 4HSQA 3AMKA 4NZRH 1YN7A 2FJGA 3O9WA 3FB7B 3MRQB 4MXVF 3ZMRA 3D9AH 3SCMC 5J1SC 3HS0B 3QZWG 1LP9E 3STBA 3VD5A 4E5XB 3UJJL 1NGQL 4XPHH 3GSRB 3UPAA 4YNYA 1WFNA 4P9HH 4LLYB 3K0WA 2B5IC 1HH9A 5DUBA 4FQJH 4WRLA 2ZUUA 3HE7A 1EHLH 4BQ9A 5D72H 4WU7B 2XZCL 3BPCA 3PQYD 2GSIA 4K7PY 2P7TB 1QFOA 2ATPB 3TA3A 1CWVA 2AEPH 4OFYA 5L9DL 3TPUA 4JHZA 1A2YA 1MFCL 1OW0A 3UTZB 1OPGL 1MI5D 2BNQD 4Q74A 1CL7L 1FFNA 1T20A 3QIUC 4X4XB 3FQTB 5GRVL 2BC4A 1RIVH 2VWEC 3RKDC 1YECH 2DQGH 4OSUH 3G5XA 4N1EA 2MHAB 2FB4H 1H0DB 1I1AC 1FH5H 2HRPL 3QXUA 4EVNB 3HS0A 1RZJC 2VXVL 3PDGA 5KSAA 4N5EC 2NY3B 4PTUA 2NXZC 4QRPA 1NC2D 4I0PA 4YIQB 1JYVA 3CSGA 4ODTL 2P8PA 3RVUC 4RA0C 5KS9A 3FFCD 3QNYA 5AUMB 5F88B 4LLDB 5K9KB 1SMAA 5IIEB 1UB5B 4WUUE 1MCSA 1NEUA 4HJ0D 4KQ4H 3C9NA 4JLRB 4ISVB 4PJ8B 2R69L 3VXRD 1O0VA 2B4CH 4V2CB 3HAEA 4YAQB 3PWPB 3BD3A 1HXYA 2VDQH 1S7SA 2OI9B 1DQJB 1WAAF 1FGVH 2Q8BL 2R29H 4XX1G 3MRRB 1HHIB 5GS2D 3BKJL 3DI2B 4G8IA 3OKDA 5I8OH 3PABB 4GXVH 1GGCL 3OKNA 4L5FL 4GS7C 2VQUA 4NKDB 1EAPA 3OB0K 5D7JB 3CU1A 1TPXC 2R2EB 2HH0L 4LU5H 3MO1A 1T2XA 1E4XI 3IDMB 1XR9B 3UROR 4F8TA 4R0LB 2CIIA 4CVXA 5DC9B 5KAQG 1DBMH 4LNRA 1I75A 5CWSA 1YMME 4MXVE 1YMHB 5I18H 1NBQA 4FQXB 3PIQB 2DYPB 5FO9A 4GRMA 2ZOLB 3IXAB 1F3JA 1BREA 1WCBA 4LHUD 5EO9B 2VLKD 4JFOA 3QO1B 3MV01 3WBDA 4X6BA 1PZUB 4F2MA 5E99H 1LK2B 3R8QA 1HYSD 5EBGA 3L3OA 5HYSG 1MCHA 4FQ2H 1X5JA 4E42B 1YN7B 3UYOD 5HHXH 3QAZB 3FTGB 4KV5E 4H1LH 4R4FH 3JVGC 1GHFH 3GMQA 1KCRH 3RNKB 1LQSR 1NCCL 4YHLH 4IM8A 4YDLC 4M6MH 4WHTB 1TJGH 4IEFB 1NUDA 3SGEI 4HS8H 5LBSH 1F00I 2ZOKA 5CCKL 1Z9SA 1BAFH 3L7EB 1MFCH 5M94B 3SDXA 2Q7YB 2W1NA 2Q86B 3RWDB 5JHDD 2CIIB 5EPMA 5FCUL 4DTGL 1EH9A 3NFNA 2YN3A 5KG9B 2Y5TA 2OBGA 2ITCB 4FQXA 1HZHH 4CN4A 3X3FH 2X44D 3ILPA 3SCMB 5JMRA 3L5WB 3MYZA 2HJFB 2NY0D 4G7YL 3EFDL 3IDIA 2NW2B 3D39B 1ND0A 3EFFA 4K3HA 3PL6B 3HR6A 1MWAA 1MQKH 3I9GH 1T7WA 1FGVL 4LGRB 1AY1H 4ELME 5DQ9A 5E2VH 5E8PB 4U1JA 5I1LA 4FRWA 1U8IA 3ALWA 2CO7B 4LSSL 3L3HB 4XNXH 4JN1H 4MA8L 1VGEH 3CMOL 2EE2A 3QUML 3WYRA 1NAKH 2HT4C 4XPAH 3W11C 4WHTA 3NFSL 2OTWA 1M6OB 5HDOA 5IMLB 2F8VA 1RIUL 3VXUD 3IAGC 43C9A 3L5HA 2DQJH 4NM8L 2B1AH 4G3YH 1MHEA 3IDGA 1RZKH 2DQFB 2XG5A 5IKCA 2GSGB 1RMFL 1I85C 1EPFA 2NXZD 1QA9B 4WGVB 3ZYZA 1UM6H 2VDQL 5T1LD 1FG9C 1DANU 2WUBH 1H3PH 5L7XH 4HLZG 2HKFL 1C1EH 4JB9L 4KQ3H 3CFIC 4LLWA 2ZUSA 4YHZH 5FYJE 4ONFL 2GFBA 4NKIH 1BJ1J 3GDBA 1U93A 2DLHA 4OSUL 4PJCB 1F6LL 1I1AA 3VGAB 2UV3A 3GJFA 1GOHA 5DI8B 4WFGE 2H41A 5E8EB 4L3CA 5IF0B 3GB7B 3UP1A 2D31A 3CFKB 1U8KA 4WJ5B 3N1GC 2IPTL 1LDPH 1DQMH 5F44A 2AXHA 1G9EA 1BIIB 4K55A 4HT1L 4G9FA 3B3IB 3GIZH 3V0WL 5DDHB 3CNKA 4MXQA 1F02I 4KU1A 3OZ9H 2XTJD 5IEKA 4ZD3L 3G04B 2AJYH 4OD3L 1DUZB 1OP3H 3GSWA 4KRPD 5KAQF 4PRAB 5CZVH 3S35H 4P46A 3U6RA 4LSRL 2GFBB 2XTJB 4UOW0 4YHOH 3D18A 1YYLH 2NY5L 2P47B 4HULB 4L3ED 3G5YB 5CGYC 5E1AA 4F7CA 3TCLB 2A9NL 4UNTA 2EICA 3PP3H 4OZHA 1AD9A 1JK8A 3SGJA 3ET9F 2FBOJ 1NDGA 1NFDB 3WLWC 5D7KD 5HI3D 3PJSA 3KS0J 4WCYL 4JHWL 1XAUA 5EC1B 3K2UH 3MLSL 1SJXA 1FV1B 2YPVH 4J6RL 1G7JB 4TVPE 4Z6AT 1PG7H 5C07B 4YE4L 4M3KB 4P23D 1QZ1A 2UYLA 4KTDH 3B6SB 1TETH 2W9LA 3B8SA 5B4MD 2FATH 2R15A 4PRPD 1C7TA 1AE6L 2HJFA 3Q6FB 3TT3H 4P2CG 4FP8L 4PV9B 3STLB 1I8KA 2EIZB 4KJWC 3BQUC 4OLUL 2CK0L 1CDUA 4QY8A 4IS6A 1HI6B 4YK4B 3A6BH 1UZ6F 1QEWB 2EO1A 3DXAA 5FHBH 1HQ4B 5IB4A 5LCVL 2L7JA 4L8DB 1OAXL 4AEHH 3QZWA 1IC1A 3NGBC 3B2VL 3CXHK 5F7MC 4AENB 2D9CA 4Z7OE 3GMPB 4U0RB 4P3CL 1G6RA 5IB5B 4NQCA 4UILL 4HXBH 3TBVB 3HNTH 3N1MC 2QEJA 3TO2B 2X89D 3EYVB 3V6ZB 3NN8B 5JDSA 5FYLE 4PRBB 3T3PE 5TE6H 1DQQB 3EW3B 4RBPK 2AS5M 1KF9B 1QBLL 3U2SA 3OKKA 3D69A 4LLAA 1CDBA 4XNQB 1WIOA 3IB4A 2AVGA 1I8KB 4KTEH 4ZSOE 2V17H 1HSAA 1GH7A 1M7DA 4NT6B 1YEIH 2Z93A 4F15B 1EEUA 5C2BH 4WI2A 4NHUA 2P24A 3MBXH 4C83A 4BSVB 4YQXL 3F65A 5FKAA 5I1CH 2IG2H 4YHML 1P4BH 3GRWH 3ZTJG 4IRSC 1RZIA 5E00A 2WUCL 4BH7B 3ZO0A 4XVJH 4M61B 2CRIA 1XF5B 4NUGL 2DL2A 4K8RD 4JPIB 3I50L 5DJAB 5INCA 4L4VD 4WI9A 3S5LB 1VADA 3VMPA 2E5EA 5JPNA 3LPWA 5HPMA 4J3XA 3LRSB 5ITFA 1U92B 3A67L 1N26A 5DD5H 4XX1E 4MNGE 2E9WA 2VDNL 3FRPA 2CR3A 5CD5C 3B2VH 5MENE 1IMHC 3QDMB 4JEGB 3ARDA 4NNYA 1KPRA 1HCFX 4WGWB 1NAMA 4YGVB 4IDJL 3K8LA 3V5KB 1QFUH 2RFXA 4CUCA 1IM3A 4W4OC 1WBXA 4U2YA 4LF3A 1Y18B 4N5UA 2KQMA 5EU6E 4XNYH 4Y2DB 2BXZA 2YUZA 1MHCB 3BDBA 3D3VA 2XRAL 5F21B 4JM2B 4X4XA 1T2QL 4UOJA 3OGOE 3TJEL 4UDTB 2BVPB 2X4NA 4O58L 1D5IH 2DQDH 2R0WH 2X2YA 3B9KD 3QBTB 4P2YA 1OOAA 3QSKB 2RAMA 2EC8A 1FVDB 1RV6X 2XI9A 2B0SL 1BHGA 4WWKD 3PABA 2YPVL 4J6RH 3V79C 3D0VA 4NM8H 3QO0B 4MXQC 1YNTA 1OTTD 3MRNB 4OLWL 3LKRB 3ELAT 4G6FB 1G0YR 4XAWL 2C3VA 5D5MF 4ETQA 4M93B 1LEGA 1A6TA 3WNMA 1S9XB 1VGKB 3W81A 1INEH 4P46C 5EPMB 4MA8H 3BEWB 5IHUL 4C54A 4XP1H 5E6YA 1SYSB 2HKHH 5CBEB 3P4NB 3WXVL 3FQUA 1XCQA 3SDCA 2EIDA 4WFFE 3BZEB 3W9EB 3LZFH 4GH7B 4POZD 4OD1L 2OLDA 2D7MA 1QPPA 1CGXA 2M8XA 32C2B 2ADIA 5IFAH 4Y19B 2VE6B 4JZNA 3KPOA 3EZ8A 2UWEF 2BVPA 1SJEB 4NC1E 4XI5C 4LSVL 1U8NB 2HVJB 2FJGB 2DQCL 1UXSA 2XKNA 3KLDA 5DHVA 2ZUQC 1X5IA 1HHKA 2V2TB 3BWUC 4XC3H 2NY7L 4XNMA 5DD0H 2J4WL 4QXWA 1TCRA 4NDMB 1EO8H 1HDMA 2E27H 5IT2L 2DBLH 5HDBE 4CW1B 2F53D 4G80A 5JXAH 4CMMA 3BAEH 3HG1D 4CVXB 2BSSA 4L8SA 3VCLA 5AAWA 3SEPA 1S7QB 1RZJL 1W72A 4I77H 3O6KH 2F54A 3KLAB 5C9KA 1FFPA 3OAYH 3DXAE 2VDLH 2WK2A 2Y5EA 3W11D 1OWWA 2ENYA 2DKMA 1IAOB 5CJOH 1DTUA 5GGSA 4W6WB 3U7YH 1P5VA 4LDEB 3JV4A 1XF5A 1QRNA 4KVCL 3ZE0E 3BXNB 1D5BB 4LVOC 5CGMA 2CKBB 4XXDA 4P5KB 4PBXA 1U58A 3FFCE 2XA3A 3STZA 5H37G 2R1WA 4HUNB 3DX9B 2OL3H 5D96B 1ONQA 4AEEA 4Z7WF 4PRDA 2D4FA 3QRGH 1VGEL 3ARDB 3PXJA 1UB6B 4JPVL 5GRUH 3L5IA 4DOHB 3C60D 4NQVA 4MA7H 4L8CB 3QNYB 2DLFL 1J8HD 4L9LC 4F9LA 2PYEB 3V5KA 5JW3L 4Y4FC 2XT1B 4KRMB 1OP3K 3RWFA 3KAAA 5F1OB 1S9YB 4D8PB 5E08L 2BVOA 4HBCL 5FB8B 4Y4FD 1T3FB 1I7TA 3DWTA 2B4CL 3QDJA 3VE0A 4RAVA 2V5SA 3UBXG 1ZEAL 1XR8A 5FCUH 4DTGH 4Z0XB 5IOPA 1D5BA 5T3XL 1JP5A 4GKOA 4TQEL 1S7XA 2YWYA 4PJDA 2NQCA 2OJZH 4NO2A 5IW6A 3QXAA 2BFVL 4HZLB 1K8IB 2EXYD 4HS8L 4XVTL 4J4PC 2YPLA 1OQOA 2QADB 4XWGH 2YUVA 3PWNA 3JV6A 3X12B 5FHAL 4P9ML 3T0EE 4NZUH 4HH9B 1CU4L 2P44B 4EDWL 4NM4H 3GKWH 3HB3D 3FO0H 1Q1JL 2OCFD 4NRYB 3SO3B 3NCMA 2B5IB 1FNAA 3H9ZA 2DM7A 4GKNB 3TZVB 5J1AA 1AC0A 1J8HA 3MNZA 4S0SD 1OAUH 1U3HC 4IRSB 4WI3A 5E2WL 3C60A 4PREA 1P7KA 1QQDA 5IFHL 2G75B 2X4RA 1Q9LA 5C0DA 4MJ5B 4Z7UA 1KJ2A 3WFCH 1ADQH 3T0EB 2NY3D 4ZQKA 3OJMB 4JJHA 2I5YL 3BAEL 1WZMA 5HI4D 4G5ZL 1X5HA 2NY4D 4HWNA 3P0GB 3UAJC 3IDJB 4MCZA 5C09D 5J9PA 1EEYA 4RDQG 3NGBB 3MLWL 2RCSH 5E9DB 1A8JH 1AXTH 1MRCH 3WN5B 2LV4A 1T04A 3MV9B 3O3BB 5FOBB 1KCGC 4PLKC 5ILTH 2A6DB 1MAJA 3X12A 1GGUA 4X6CA 4AIOA 4XRCA 5I8OL 3QXWA 1L9MA 3KPRB 4XCFL 3ZKMD 2XG4A 1EUUA 4YGAB 3QIWB 1MHPH 2ERJC 1OAZH 5JXEC 2BMKA 2OTPA 4NQUA 2GK2A 3BVNB 4PP1C 3MJ7B 5EORH 4Y19D 5DD6A 5DC0A 5J89A 4LSDA 4DN4L 2ESVA 3ARGA 3VWJC 3BQUD 2JLLA 2BP3A 1C7SA 3DXAD 1F8TH 2A0LC 5I1EL 1CGVA 3PL6A 4KQ4L 4ODBD 2UWEA 4RMQA 4I3SL 5HPOA 3RKDD 3LV3B 5DQDH 2FZ3B 2HTLC 2VLJD 2CDEA 3DX8A 3MV9E 1N7MH 4PJAA 4YX2L 1NKRA 1ZLUH 4M8QB 3UJTL 4XAKE 3GJFH 5L6YH 1MHHB 4PUBH 3SKMA 3C08H 2XWJB 5ID0A 4X7DC 5I15H 4PJIB 5F96H 5J56B 3RVWC 4XNZC 2AJSH 3MGTB 4FQ1H 1RJLA 1QRND 4OV5A 3FAWA 4YUEH 4YXLL 3DX6A 1NGWB 1NGPH 4JRXD 3GBMH 2F5BL 25C8L 3ALPA 4BFEA 5IK3A 1XF1A 2A6IA 4OF8A 1VACA 4K9EL 2NW3A 1EJ6A 3NCCB 3V6OA 5FB8A 1FIGH 3JWDH 3PWJA 5DJ0A 5BRZE 4Z95L 5EOQH 1J0HA 4X0KB 2VUOA 3CXDH 4GW4A 3B5GA 1KIUA 3VFVB 4XPGL 1JPTL 2C3GA 1G7QA 2XZCH 4LPUA 3P11L 3O81A 2BVTA 1U8QA 3DVGA 4MXQD 3OR6A 1SVZA 5IBLD 3R06A 5E8OA 3SKMB 3LEXB 3O9WB 3F7RA 2DM3A 3FONA 5JOFA 3WJJA 4HH9A 1FVDA 3MGTA 5KOMC 3PGDB 1LO4L 1BPVA 3I75B 3OKEA 1GSMA 4TUOA 5DF0A 4WUKH 5DR5L 2VLJA 5FEBA 4FABL 4M7LL 5C6TH 2GAZA 2APTA 2O5XL 3EGSB 4NIKB 4OFVA 5HSFA 1I8MA 1QKZL 4LMQI 3C09C 3SDCD 3OAYK 3SDDD 5FGCB 3IU3B 2B39A 5ESQA 3S7GA 5HHPA 2FX9H 3IJYB 4RFOH 3QEGL 4Y19A 1RK0A 2YKLH 3P11H 1UZ6E 4MGXA 1LP9F 3DX7A 3CVHL 1MIEL 3MV9A 5FOBA 5EU6D 3KLHC 1IGTB 5H2BB 4AEIL 2Z0BA 5F7FA 4P99A 4MQ7A 4IOSD 3GMNA 4OCWL 2YS4A 1SVCP 1FIGL 2CUMA 2M1KA 5DJ6A 4U31A 4RNRA 4TULH 2CRYA 2HWZH 1NPUA 1TZHB 3IS0X 5ALBL 1JTPA 4Y4FB 3FB6B 5C09E 1DEEB 3GSUB 4C55A 2AI0L 5FV1L 5DO2D 5IHLB 1LDSA 4NO0B 2J5LC 1KPUB 1S5IL 4NKQB 1MCOL 5AUMA 5IJKC 2BDNL 2VZ1A 1OP5K 4KKBD 4FQ1L 1KTLA 2PW2A 3TT3L 4KY1H 5BJTA 5CSBA 2YUWA 3MBED 4C4KO 3RL1A 4P3DA 1VEMA 2FSEB 1D5ZA 4ODWA 3VI3E 2GJZB 3ARDD 3S3PA 3IJHA 4FQHB 1EJOL 5B4MC 2QADC 3MLYL 32C2A 2VZ3A 4B7LA 4O51A 3NIFF 1PG7L 3MSPA 3U48A 1E27B 4YX2H 4XZUB 5JW4Q 4LKXA 2B1HL 3BYTA 2IANA 3HNSH 5I1JH 1JTOA 4MD4B 3LKSB 3RU8H 1TZGL 3QCTH 1DBJH 3V9FA 5DK2B 5LXGH 4JHWH 3QB7C 1SBSH 4KVNH 3NIFE 5FGBA 1F8TL 4U1MB 2GT9B 3RY6A 3BISA 4YHPB 1NGWA 5DJDB 2GY7B 2QHLA 3S3JA 3C6LD 5CILH 1FRGL 3SE4C 4NCC1 4WV1C 1VGKA 4JR9L 1TVBB 2CUHA 2GITB 4MA3A 3RBGA 5I17A 4NWUL 3S34L 4UQ3A 1MFEL 2EDBA 4C56E 3LN9A 5IROC 3O8XB 4JQIH 3FJTA 1NAMH 4NHCL 5DFVD 5D4QA 4OQTL 4X6BB 2ED7A 3HC4L 3KPOB 1UWGL 3QDJB 5C1MB 4QWWC 1ZA6B 5C0GA 5J11C 4X7TB 5I15L 2ATKB 2Y36H 1HHIA 3NCJL 4XXDB 4S1QL 5JPNB 1QSEE 3PGDA 5C0CD 2A2QT 3V52H 1SEQH 4Y1AE 3EOTH 2RGSA 2OXHA 1KLUA 3C8DA 2E7LA 4NNYB 5BXFB 1N5YL 2GAZB 2X70B 4UU9B 4XMKH 1FDLL 1AHWA 3PP3K 4WNQA 4QKXB 4QYOB 3IU4H 5KG9A 1Q38A 3HUJA 4G9FD 3JV0A 4YPGB 3MLZL 4L1DA 5MEND 3T4AA 2BVOB 2IAMC 3RI5K 4Y1AB 3IJYA 3BN3B 4JFZH 1XGQB 3UEZA 1V7ML 4JAMA 2D7NA 4KV5F 4C56A 4N5ED 2WWMD 3CH8A 5JW5A 2IPKB 3EO1B 2UVEA 1U8IB 1C5BH 4MQ7B 1U6AH 5BVPH 4N0FA 5AEAA 5GJTH 3P0VL 4X8XA 1XIWB 5TQ2L 2R2EA 4JJ5A 2HT3D 1NGZA 1F4WH 2W0FB 3KYOB 2P1YA 2X4QA 3HZKA 1MQKL 3I9GL 3OAUL 5I74B 3GSVB 4OT1H 3DI3B 2DQTH 3IF1B 1YMHA 4HWBA 3FQUB 4IHOA 3SDCB 1LE5B 1NFIB 4QRQB 5D1ZC 5EO9A 1FN4B 4LCWE 4U6TA 5I75B 1IGCH 5L2JA 2PTUA 3RZWA 1DBAL 3VXUA 4X6EB 4LCYA 1NCTA 4GLRI 2SEBB 7FABH 3THML 3SKOB 4RISH 4OIIH 4HAGA 1IAIM 2X42A 4KPHL 2E6JA 5JIPA 4ORGB 4Z7UF 3WFHB 5DHXB 4OGYL 1A7NH 2V5TA 1UJTA 2PUQT 2B4CC 1H3UA 4X4YA 2OJZL 3Q0HA 4R4FL 5FM4A 4JJ5B 2VZTA 4UT6L 4H8WH 3LSOB 4F15C 2CGRL 4ZAKB 4F7TA 1KCVL 3SDXF 3U0PB 5CMAA 3D0LA 4OGZA 1J87A 3FZUC 3MLUL 2ARWA 4WTXA 1CU4H 5CD3B 1ZHBB 2YMXH 2BNRE 5F3BA 1KG0A 2JE8A 4JM2F 4Z8FH 1KGCE 4RISL 1QYGL 1N5AB 1R3KA 3THMH 2JB6A 5BMFL 3ZDXE 4X8JB 1QSZA 2A6IB 4BZYA 1YEDB 3CPLA 3V0AC 2NR6C 4P46B 4ZUSA 1HIML 1KJ2B 1VDGA 4XC3L 4K7PL 1MCBA 3LKOA 3PHQA 2HJKA 1CFSA 1P7QA 5I2IB 1E6JH 3HLAB 3RUGE 3GSXA 1O5DT 3EYOA 4U0RC 1KPVB 3T1FB 5DJ2B 1GZQA 2XZAL 3EOAB 3I02A 3K1DA 4WENB 3DSFL 5CIPB 4Q6IB 2X1OA 4N0UE 2AJXL 2XQYG 4XP6L 3O3BA 1FE8L 5KSVB 2GCYB 1BD2E 1JUFB 3H2WA 4PGDB 5GGRB 1YDPB 3RWGA 2AQ1A 2HJLB 4ALAL 5B39A 1IJ9A 4XBEL 1MRDH 1OLZA 3CX2A 2CMRL 3IGAA 4MJ6B 5AD0A 1C5BL 1U8PA 3RHWK 2CLZA 1D9KA 5EBWB 3TP4A 3TVMB 4YNYB 3ZDYF 4UT6H 5B38G 4D9RD 4P57B 3ARZA 4N0UA 3DURB 4NO0D 3HE7B 4PJGA 4EUPG 4LASL 4FNLL 4F37K 1NFKA 1ZTXH 2ZUXA 3RPKA 5F9WB 3TBSB 3U7YL 2Z8WC 1Z0NA 1WSST 3P4MB 4RWYL 4Q2ZA 1AKJB 3VXMB 4NO2B 3C6LC 1BVKA 1RJCA 4KJQD 4TUKH 5CEYB 2P8MB 2EKSA 2DOCA 3EDEA 2BOBB 3ZSTA 4NWTH 4LCUA 3MREB 3OBAA 2AEWA 3HZMA 4FXGA 1Q0YL 3L3KA 2EDJA 5IBTH 3IFOA 5IT2H 4IHOB 1BZ9B 1IGYA 4NQSB 5HDBF 3G6AB 3ORJA 5I8KL 4PTUB 4Y4FA 4GO6B 3U4EA 4GOSA 3PHSA 1MPAH 1JVKA 2IAMA 2G75A 2X4RB 3RJQB 1KJ2L 2J4WH 2EIZA 1KPUA 4RAUA 4IMLB 4QLRA 1BOYA 3VXPA 5JW4N 1KTLB 2YD9A 1UA6L 4HIEB 4R3SB 4PY8I 2WMPA 1I9JH 4DGIH 4CVZA 5JQHC 5LAXB 3JTTA 4H1LA 4LRNL 2R4RL 3C87A 1JCKA 3NABH 5EZLB 4UIKH 1OARL 1KFAL 4FQXC 3RUGF 1GC1L 3RGVC 1U2CA 4R2GD 2DQDL 2R0WL 4U49A 4EI5A 2EECA 2BNUB 1T1XA 2BNQA 4YXHH 4NZJA 3I6KA 5D6DC 2NY1B 4DZ8B 1PYWA 5T1DH 3OPZH 1QSFA 5BQ7A 5HYSB 3UC0H 4OFYD 3O6LH 1JGUH 5FAAA 5ELIA 1GZPB 1VESA 2ZG3A 3W2DH 1WTLA 1RVFH 1HSBB 4B0MM 2A9ML 12E8L 3PIQA 3O6FC 1S9WA 3BFOA 1KJMB 3H9HB 4XP5L 5GZOC 5I0ZA 1KJVB 1S5IH 4UI2A 4Y4KD 3D39E 2RIKA 5HHVL 4I0PD 5CIPA 1OAKH 5HDLA 4N1HB 5ANMA 5I1KH 1J0YA 3AAZA 3G6JA 1MF2L 4GG8A 3TV3H 1ZKAA 3MOBL 2PKDA 5TPWH 1TFHA 1JHKL 3GRWL 2VAJA 2X09A 5CILL 4FP8H 5T3XD 2VXQH 3D39D 4O2EA 2WP3O 1KLUB 3EHBD 3U1SL 3SKUD 5MENA 1RY7B 5ACMA 4RFOL 3RFZC 3ARGC 2VWEE 3SY0B 2IPUK 4NFDA 1NAMB 1HK6A 4R9HA 4K7FA 1BFTA 1XCQB 4X6DA 1PD6A 2C4XA 2R0KH 2J8HA 2G60H 2BNRB 1RUQH 4YDLB 3GK8H 2ZNXA 3OWEA 1MFAL 1FPTH 3ZSSA 1A0QL 5DEGB 3KVQA 1CS6A 4Y5YC 1JPTH 1S7SB 3Q5YA 4MD4A 5JLZB 4OZGB 2XN9E 1LO4H 1AGFB 2COQA 3P9WB 2ATKA 5C0IA 5CKGA 4YHOL 4X7SH 4Y5XA 3B5HA 4IIQA 4PJDF 1J5OH 4I0KA 5TE4L 1FVCA 1TCRB 1C8PA 5ESVB 4ZD3H 5DGQA 3BGMA 1AIFA 1XGPB 3O41A 1CIUA 1NGPL 5HGBB 3QHZH 4DGVH 43C9B 3WIFA 3OXRA 3P4LA 2N7AA 4KROD 1WBYB 3MUGA 3ULUF 2R8SH 3C8KB 3DGGA 5BOPA 5K9OB 3VWKC 3SHSA 3LRHA 4P2QE 3MC0A 2DYPA 5DUPH 2X7LB 3KJ6L 1CN4A 1A9BA 4Y2DA 1V05A 1BECA 3C6LA 5GHWH 3ES6A 4JFEB 2YRLA 2SEBA 5DEGA 4PGBB 4Z7WA 1B4RA 1ES0B 1NUFA 1RULH 3NH7H 2BC4B 1N7ML 4MJIE 4GKZB 4HWEH 3K2UL 3UC0L 4MAYC 3H3KA 3IVKB 1DLHB 1QKZH 3DRTA 5BVJB 4HIXH 3JBG7 2FBJH 4M7LH 5C6TL 3BZ4A 3MLTB 4NP4H 3WIHA 1JYNA 3FN0H 3LD8C 2NY2B 2NY5H 4S2SA 3E8UL 4UB0L 1RMFH 4N68A 3O6MH 3R0MA 1NMAH 4J8RA 3I3BA 3QXDA 4U1GC 1AXSB 3TZVA 5JUEL 4KXZH 1WAAE 2WAHA 1BEYL 4DEPB 2ZSWA 1WK0A 4D9RE 3ULVD 3BI9X 3H9SB 1ZGLB 5C2UB 4LKCA 1QLFB 1YQVL 1LDPL 3AAZB 4M8VA 3NAAH 3CFEA 3BP7B 5EOQL 3NA9L 4F57L 2DI9A 3JWDL 1ORSB 4JANA 3OKDB 5IW6B 1ADQL 3OX8A 3WFCL 5E95B 3U9UB 1NBVH 1A6ZA 1XMWA 4NDMA 1YY8A 3V5DA 3WXWH 5C0BB 1SYVA 3VFGL 1WFOA 1HZHL 4EKXA 3TF7C 2W60A 3WL9A 3IDMA 5C9JB 4PB9H 1I9IH 5E5MB 3IDGB 3GSVA 2H45A 1GPOL 3NOIA 5JXEA 4JB9H 1YYML 3AREA 3O8XD 2HKFH 4OD2A 4HPYL 3MRHB 3HI6H 4YLQT 1S9YA 1ZTXL 4BH8A 4H88H 3VWJA 2UZIL 3TIDA 5IESH 2VSCA 4LP4A 3TESA 1NSNH 3D39A 4KTYA 1UM4H 3E3QE 2XWBB 4YO0B 5DQDL 2QHRH 4L29B 5BS0E 1QRNB 1RIUH 5KVFL 1PX4A 2NY2D 1MRDL 3ULUH 4QRPD 1G9NH 2JIXD 4TRPH 2ZUVA 5F72S 1N4XH 3CMOH 4PJ7A 4X98A 5DVKA 2R9HC 3RAJH 4GG6A 4EN3D 4JFYA 4K8RL 2QSCL 4KK8D 2DWEB 5IMOB 3MRDB 4RGMC 4PLOB 3GMLA 1IGMH 3WL9B 4GS7B 2X70A 4UU9A 4UV4H 5HGDB 1D6EB 5K9JH 3TNNB 4N5EA 2VMFA 5BOZG 5E9DD 2Y25A 3QRGL 4I0PC 4G7YH 4W81A 5DD6B 5C09B 2HFFA 2W65B 4W70A 3O2WH 4F7MA 3QFJB 3PV6B 3DURA 1BM3H 2N56A 4TSBL 2MQCA 4YBLC 2GKIA 1AFVL 4XHQA 4JRXA 4PS4L 4LSSH 2I60L 3TA3D 1OF2A 5KVEL 4OI7A 3RA7H 4KRPB 3EAKA 3T3PF 1BLNB 3LQZA 3N9GL 3PQYA 4L1HA 4Z0XA 5IOPB 4HWZB 3U0PA 2VZUA 4PJAB 1J11A 1IVLA 1LNUB 1CE1H 1TZIB 5I1IL 1GHFL 1AO7B 4HUWB 2VR9A 5DZLA 5FA4A 5C0CA 4TRPL 3L6FA 2C1PA 4KI5F 1AR1D 4QCIA 3O6KL 4N0YL 3TN0D 4S10A 4R97C 2W9DH 1LVEA 1U8PB 4NQCE 4OCYL 5FHAH 1CGTA 4Q9QH 1EUTA 3TA3C 5CAYB 4HH8A 1UCBL 4ZFOL 5CBAA 2P43B 1YC7A 3PNWB 5DFTA 3UBXB 5FECA 4XP4H 1DZBA 2IAMD 1KENH 1DBML 2ZSWB 4QTHA 3G6DH 5HHMB 5EBMA 1JF1A 5T3XH 3WKML 4XPFL 1H15A 5GIRB 3P0YL 3ARUA 3VGDA 1EO5A 1JFQL 5DJCB 3VFGH 4MQXC 3FO2A 2AKRA 3P9LB 4XMPL 4AT6A 1E4XH 5IVOA 4F9PA 4GXVL 3MROB 4HMCA 1ZGLP 3VH8B 3U4AA 4JFEE 5HI5C 3FB7A 3MRQA 3WXVH 4XCCL 1ZHKB 1J9CT 1UQSB 3CSYA 3EYSH 3VH8G 3IFOB 4MB3A 5D72L 4LGPB 1W72H 1N5AA 4FFVD 3OKLA 3VD4A 4OZHE 1MWAH 4FHBD 4P9HL 1KTDA 4OGAC 5FFLA 1T0NB 5JO5B 5IW1A 3P2TA 5F1IA 2F53E 5KBNC 4WTZA 3MLZH 4PJ5E 4QHUB 4KUZL 4F7EA 3CCHA 5EIQA 5D1QC 1NEZG 5AYUL 1D5IL 5HYEA 4C83B 1CXKA 1G7PB 4O58H 4LVOB 3VFVA 1FLTX 4LLMB 4TNVK 4Q6YA 2O61A 3ZTNH 5JIKA 2QQKH 1ZHLA 3GMPA 1GGIL 3ULUL 2YPLD 4Z0BH 4Z7VB 2BRRH 4G8FB 1FH5L 3SO3C 3L3OB 5DJXA 1SJEA 1A7RH 2DQIL 1FO0L 2AERT 2X89A 2HJLA 2Y06H 3F7VA 5CLTA 2VL5B 5DD1H 2ICES 4Y5XB 4NQCD 5IHZA 1N59A 5JXAL 5GHWL 4YEFA 1P7QD 5D9SB 3TWCL 3V7AE 3UTPE 3VJ6B 5GRJL 5DJDA 4YR6A 5BCAA 5SX5K 2BXYA 2VLKA 1K6QH 3QQ3A 4UQ2B 3NZ8A 5CJ5A 5DJ0B 1T22A 3BD5A 3MUZ1 4ZFZB 4GMSL 2FB4L 4DKEH 1XFPA 3QJHB 5MI0C 3CCHB 4JFDD 3C9NB 2APBA 2CPCA 2ID5A 4JLRA 5ADOL 3RBSA 2IBBA 3Q6GL 2I9TA 4C4KT 2DYPD 3G5VA 1AR2A 5EUOB 4PRPA 4XXCC 3WFZA 4LK4A 1UWXH 3L5JA 5GGSB 2C1OA 3QR2A 4KK6C 3P4OB 3TBVA 4FTVB 1KYOK 4TVSa 3VWKD 2Y72A 1VKXA 4PRBA 1FYHB 4QF1B 1PDKA 3UTSB 3QYCA 3UXFA 1M71B 4OZIE 4YHPA 4XPTL 2V9QA 5IMLA 35C8L 5HGBA 5IMMB 2DIJA 4MDIB 4TVPD 1DUYA 4JO3L 5HHOB 1VPOL 1NMBH 2BOCB 1AGBA 1L4IA 5EC2B 4WUUD 4V3DB 3L3JA 5KANG 2LABA 1SYSA 15C8L 3VRIB 4B41A 2XY1A 1OD9A 1EMTL 1RZFL 1E6OL 4Y1AD 2A83B 2NZIA 1X5YA 3HNVH 1QHPA 3HE6C 5CEZE 3LH2H 1WCQA 3QNZA 1JNLH 1FC2D 2HFTA 2YZ8A 4LLUA 2PYFB 5FK9A 5C6WH 4U6YA 3S96A 5DSCB 2V2XB 1IAIL 2H6PA 4PG2C 4P2RB 4FQLL 3VE0B 1KELH 5KJRH 1KEML 1MF2H 4LLVA 4U1IB 1T21B 3WFBL 1JF6A 3INUL 4G6JL 4M3JA 5E8EA 5JOPD 1FVCB 2XKSA 1SMOA 1LO3L 1Q9KA 2AGJH 4XTRC 4LAJH 1H3GA 4WHDA 1KB5L 2IQ9L 1CXHA 4S1RH 4XTRD 1N0XH 1LWRA 5DLMH 2D9QB 2VLRA 5EBLA 2XQBH 4A6YH 1XF2A 5EC2A 4O2FA 4TVPL 2QSTA 3O2VL 5DHYA 1MNUH 1KC5H 5SWQA 1J8HB 2Y9RT 1IZJA 2APFA 3BQUA 1GRWA 5BV7H 5IGXH 3QIBA 1D5ZB 3N06B 4ODWB 4Y1AA 1S3KL 3CVIH 3UTPD 4XNUL 1J5OL 4MQTB 3VXUB 2XTJC 1E27A 4Q9CA 4Z77A 4WY7H 4K3JH 1YY9D 3KPMA 4ZPTB 1QBAA 4Y16B 4WWKA 1ZT1B 4A2LA 1T4KB 1RUPH 3VXME 3V6OC 4GRLD 5I1AA 3B9KA 4XNMB 1IKFL 1VPOH 5DYOB 3P73A 4LPWA 5JZ7C 2NY6D 5ETUB 3C5SB 4EBQL 2I9LB 3UYRL 5IR1B 4RGMB 1KC5L 4MNGA 3C6SB 4NC0B 3GSQA 3EDFA 2E7BA 4I4WB 2IH1A 3VXNB 2ZCLL 1Y6NR 2B2XL 4ODUB 4MXWL 4NJAH 3B9AA 4OKVB 4XCNA 3G9VA 5FM8A 4HT1H 5DJZA 4J3TA 3QEQB 5C07A 1EZVY 4JFQA 3PP4H 3U1SH 4G42A 2E7HA 1LE9B 1L0XA 1BFVL 1FORH 2IPTH 2ESVB 5K59E 2ZOLA 3IXAA 3SKJH 4HF5H 4MJID 2CXKA 4XMLH 5L2JB 4FQXD 1BBDH 3INUH 1OAXH 4K3GA 5LCVH 5L2KE 4DKAA 1AQKL 1CFTA 3PHQB 3VFRA 3OZ9L 4Z76A 3BXNA 3D6GA 4YUEL 5F89A 4KMTL 4JVWA 5I1KL 1OTSD 3LS5H 1RK1B 4A6YL 4NZTL 1S7VB 1KUMA 1N0XL 1LNUA 2KUTA 4GRWB 1ZAGA 1FG2B 1DQML 2IAND 5SX4H 4R8WL 1H3PL 2FATL 5BS0B 1SHMA 2R0LH 4HK0B 3IRPX 1IBGL 3PWUB 3SQBA 1CXEA 4PFEA 4F7TB 1IGJA 3ROLB 1RJLB 4L8CA 3LB6C 4WU5B 2NYYC 3S4SA 1UACH 1T7YA 4H0IA 5EFIB 3Q5OA 4O4YL 3AROA 3DVNB 1D9KC 1CE6B 2MQ3A 5FUOH 4WCYH 5T3XE 5E8NA 5C09A 1FFPB 1IAIH 2VLKE 4HS3B 4OF6A 1FJ1B 3BKCH 1XF3A 1GGIH 1RQ5A 1XGQA 1P1ZB 4ZUSB 2HG5A 3FKUS 1I7ZA 3AS2A 3KWWB 3QUXB 5EBMB 2RJMA 5GS3A 2HT2D 3G9AB 3KHQA 2Z8VC 3GUTB 3IFLL 4AY0A 1IILE 3NVQA 4HUXB 3VRJB 3OGCA 4OZHB 2F8XC 4JRYE 4HJJL 2VLJE 3MV9D 3DUHA 4Y89A 4J4PD 5FF6B 5MEOA 1CLZL 4PJ8C 4EQ3A 3UDWA 2BVQA 2H1PH 3PWUA 4JPKL 2AABL 4GMSH 4DKEL 4WV1B 3KPQB 5CP7B 2GSGA 3VFTB 1PG7W 4FXGB 4LVHB 2GIYA 2CLZB 1U3ZA 3HPLA 2NY4C 1B2WH 3V4PL 1H5BC 5E2VL 1MCFA 3T2OA 3ILQC 3M8OL 1QLRA 1OT1A 1MJJB 4IRJB 1JJUA 3ARGB 5D2NB 2WBJB 1E4XL 3PWVA 1BX2A 1P1ZA 4M1GH 3S6CA 4XMPH 4QY8B 2D2OA 3LPFA 4D0BB 1TTUA 1CFSB 3MUHL 3UZQA 1YEGH 1JFQH 3QFJE 5MEQB 1N6VA 4HKZB 4OFDA 3HB3C 4A6YB 2HLAB 4MMXC 4G6AD 4K94H 4MCZB 4MAYA 1ZANH 1JPSL 2DJ4A 3U0TA 4WI4A 5LAXA 1MUJA 2FYYA 1V3JA 2PCPA 3D3VB 1TZIA 5HBBA 1XF4B 1FNHA 3K46A 3GSOB 4R6UA 4OTXL 4XWGL 1I1FB 1T1ZB 1VA9A 3VA2C 2FWOB 1MQ8A 4FQIL 3CX5K 4XRCB 5DJYB 1UT9A 2ICEB 3S35X 4PR5B 2D3VA 5D6DA 2O5ZH 3O3AB 1IL1A 1INDH 3FHQA 1E4KC 1BZ9A 3EDDA 1BWMA 1TZHA 5L88H 1QLRB 3WO4B 1I9RL 4ZOAA 5IEKB 4PREB 5GS0D 1HILB 2IH3A 1NCAH 2IJ0C 3CDGA 4HIJB 4L4TB 3O2DH 3LKOB 4ALAH 1R24B 1MREL 1TQCC 4ZQKB 1H15B 5JNYA 2PW2B 5ACZA 3RA7L 4FZEL 2IQAA 2QSCH 4EDXA 2ENSA 4Z7NE 3IJHB 3MQIA 4FQHA 2F54D 1ZLSL 2ADJA 5IQ9B 4NJ9L 1PGRB 4PJHE 5E9DA 4HQQL 4TTDD 1FNGB 1I1FA 3F5WB 1JYWA 4ZS7H 1X6NA 3QI9C 3WNOA 5C0BE 3DSNA 3MA7A 1IQDA 5DHVH 4G6KH 4Y4KB 4P4KB 2Z9TA 1I1AD 1CGSH 2FJFA 4XCCH 3F6IA 4J3UA 4E5XA 3LPGA 3EYUH 4LPVA 5IBUB 1IGML 5EB9A 3VXSE 5BMFH 4CKVX 3ZKQD 4CGTA 4OUOA 5KS9F 4PJFE 4G9DA 1HDMB 3VRLF 3RAJL 2ESVD 2HG5B 2GSIB 4BA8A 3GBLA 4X9BA 2J2ZA 3UX9B 2VDLL 3P0YH 5IBUG 4MD0A 1MEXH 4XPFH 1WF5A 1LO5A 2QHRL 3VXSA 1JZ4A 1HQ4A 1DQDH 3BEVB 1T1WB 4RMTA 1WITA 1KENL 1A02N 4APQD 3CU7A 3R4DA 5M7QA 5ERWA 2BOBA 5C6PB 2AEIT 3EYUL 3CX5J 4OCYH 1N6QL 3REWA 2VXVH 5AZEL 4KGJA 4KWUA 4J4PA 4U1KA 1VCAA 5EOCH 5TF1L 1IZKA 5T1KD 2HAZA 1CL7I 3HC3L 4U1HA 5DDHA 4TUOB 3VFWA 3OKKB 3KPLA 4GW1A 3RZCC 4K3DH 1KLGA 2J3SA 1DEEA 4FMFA 4O2CB 2WBKA 3AFLA 4QTHB 4IBLT 3CUPB 1MLBB 3VI3F 5KW9H 4O2FB 4OD1H 3AXLA 1S7WB 2R29L 4HX1B 1LEIA 2G5RA 3E8UH 4UB0H 2YC1B 5BJTB 5JHDE 4FG6D 3L95B 5TQ2H 4I18C 5HHPB 4JKKA 4OUUB 3Q1SH 3TIEA 2FEDD 4Y2OA 4R90H 2X05A 1DN2A 1REIA 3LY6A 4ZSOB 5INDA 3ARWA 1SBSL 1YNKL 3O3EA 4XC1L 5D7LB 2DICA 3IVKA 1INDL 3UJJH 4QF1A 3GHEL 3BN9C 4YDJA 3SGJC 3T2PA 1PJ9A 3TC9A 3WUZA 3LEYL 1K8IA 1TNNA 4JHAH 1J1OH 1RUKH 5ABDE 4XVUC 4I8DA 3MJ9A 4XNYL 3G08B 1I9IL 3VCLB 3WJJC 4CN1A 1YECL 4M02A 3HAEH 3TH3T 1G7PA 2WINB 3WXWL 2VQ1B 4K23L 1WAAA 1J86A 3T0WA 1SEQL 4TULL 4HPOL 3NCJH 4P23A 3WD5H 5HYQB 3JWOH 1XCTB 4OCWH 3BUYA 1T21A 2D7TL 1IQWH 4U6XA 1NGYA 4OZGA 3EYVA 3L3HA 3TYFB 5EZOH 5ADPH 3GMNB 4KKBC 3VXUE 2V7NB 3QO0A 4K71B 3V8CA 4M4RA 4ELMB 1A7QH 4JRYD 5MEPA 1NBYA 4F8QA 5F1SA 3IS1X 5JIHA 1VFOA 4I13B 3T2NL 5IWLA 1DVFC 1FYTD 5CMAB 4WU5A 3WV0A 5GSRA 4ZUUB 3S36H 3Q5TA 5DRXB 3ZHDA 1YJDH 3D25B 2C9AA 5DHYB 2AJZB 4MVBC 5K9OA 3HG1A 3PDDA 2X1PA 1UVQA 4FQCL 3UYPA 2OMNA 5B8CA 3VFMB 4QHNA 3BWAA 3QUYA 5GGVH 4PJIE 4O51B 1O7VA 3MNVA 5JUEH 3FQTA 1P7QB 3GUTA 4IJ3B 1MFDH 5EO0B 1FZOA 1JWMA 1NJ9B 4M6NL 1DN0B 1UACL 1N3NB 5CUSL 4M1DL 3ALXA 5I8CB 4KJYB 4OGAD 3VDCA 3DOSA 2CKBL 2AK1L 3GZKA 4JDVA 5HYJA 5D7JD 4GBXC 2X9WA 2R0LL 5KTEH 1IE5A 1ZT7B 3GJEA 3OJDB 4H0GA 2UZXB 4JG0L