4NQDA

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
260
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIEIDYGDILPSGDGTYQAWASIELYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 66
structure length 260
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqdA01
2VQ1A 1HHHA 1KJ2B 2FBJH 2X9WA 5FM5O 5HTSA 3QXTA 1VFAB 3DMMA 2PW1B 3V6FB 1J8HA 2C9AA 5C71A 1ZT7A 4XRCA 1TIUA 1JI1A 3NA9H 1PKOA 1K2DB 1S9VA 4GXUN 4TUJB 2NW2B 6FABL 4HXBL 2H6PB 5E9DA 3GSXB 3SDCA 4XAWL 4JLRB 3GSRA 4KTDL 5IVXE 5ITFA 1VGKB 5I75B 5I74C 1WTGT 3MJ6A 2A6IB 2J8HA 3V5KB 1RZ7H 2J4WL 4LCWE 1CK0H 3SE9H 5C0JB 1IZKA 4QT5B 1FYTA 3QRGH 4HWEL 2BDNH 4PG9A 5HHQB 1ZT4B 4IOFD 5L9DL 1DBBH 3DXAE 1DEEA 3DYOA 4GKZA 2L7UA 5KAQF 2SEBA 3QDMB 3S37X 2YRZA 4N0RA 3TH4T 3PWNA 1SJHA 1XGYL 4UAOB 3IFPA 1CR9H 1V7NH 2VDKH 5EORL 3GI9H 4D0DB 3GSOA 5DQDH 5FM8A 5J1AB 1D5MB 4WUUD 2EDNA 5FKAB 4G80A 1UENA 2BY1A 4HQQL 4OSUH 4Z5RA 4NC2B 4QGYA 5BOPA 3BX7C 3SQBA 2PO6A 4R90H 4AENB 5AAWA 4O9HL 4CVWA 5FHAL 2KDGA 3VXUA 1Q9OB 3GKWH 4N5EC 4Y5VC 1FRGH 4L5FL 4UNVA 4DZ8A 4WEMB 4M61A 5ADPL 4JZJB 4PJ9B 4CKVX 1DQML 3F62A 1U36A 3V2AR 1XIWB 1KXVC 5KANI 5KJRL 4LAQH 1DFBH 1QBMH 4XCFL 3GHBH 1CCZA 3C5ZC 3E0GA 4Z18A 2VLMD 1EZVX 3QHZL 4LCYA 4ZO7A 5JZ7C 1A6AA 3UTOA 3RVXD 3EFFA 3S8WA 2XQBL 1NGXA 3PABB 5DVNA 4BUGA 4LPVA 3VWJC 2AEQH 4YXKH 1FLRL 1L4IA 2M26A 4RWHA 5DHVA 5IT2L 4KXZH 5JOPD 4NT6B 5F9OH 2MQCA 1JHTB 4NFBA 1M7XA 4I0PB 4NNYA 1AD0A 5GRWA 1I75A 4PJDF 1VADA 3OAUH 1Z6JT 4Y16C 3QHFL 4FS0A 3GFUA 3C2AH 1OW0A 2AK4B 3IRPX 3MXVH 4DUWA 2HVKA 3LDBC 1X44A 3B9AA 1DSFL 1CVRA 1N3NB 5IHUH 3WFDH 5AD0A 3FT2A 1LP9A 2A0LD 1UJ3B 2AS5M 1OSPH 4HKJB 3OXRA 2J2ZA 4OLWH 3U30B 1LK2B 2GTWB 4Y4HB 4QHNA 5LAXA 2APVA 3WFZA 4LU5H 1FG9C 1J8KA 1MCJA 1VPOH 2XPGA 1JGVL 3PV6B 1XAUA 2Y06L 3ZZ1A 2X4QA 3CVHH 2H45A 4WI2A 1U2CA 4C83B 2FJHA 3EAKA 4O9HH 1A64A 2V7NB 4NZUL 5B4MD 4PJ8C 4PJ5B 4PUBL 4XHJD 3MRGB 2EDRA 2GITA 1BZ9A 3WSQH 3T4YB 1NEZG 3TYGL 3RKDC 1D5IH 3TF7A 3VGAC 5GSVB 3MLTA 2P44B 2WIMA 1UB6A 3MZGB 1MQKH 1WBYA 5I8EB 4PREB 2OTWB 1OAYL 5EWIH 1A4KA 3ZDYE 1XF5B 4NQEB 3NZ8B 4LFHD 4A6YA 5D93C 2XG4A 4CJ1A 1INQB 3FO2B 2VXVL 1T0NB 1V3JA 2OJZH 3LRGA 3SE4A 3NCFB 4XP5L 4XC3H 3MTRA 5HPMB 5E8OB 1KCUH 1ROWA 5TDPA 1ORQB 3HRZA 4M5YL 2R2HA 1FQ9C 5I2IA 3FT4A 2V5TA 2R2BA 3IGAA 1IAKB 1O7SA 4MA3B 3ZMRA 3D39D 5T1LD 3WFHA 2AJUL 4YHOH 3WO4C 4YDIH 1KPUB 5MP6H 5C0BD 2W59A 5GGSA 5EPMA 1B9ZA 3EW3B 1KC5H 4LCCA 4XP9H 4XNUH 4M4PA 3FFCD 1BVKB 4YPGB 5DF0A 4YWGL 4RA0C 4JFFA 4NQDA 2CK0L 2AGJL 4RGNB 4BA8A 2DM2A 3FB8B 3ALPA 2JJTC 4K94H 4N5UA 3PXJA 2BJMH 2VYRE 2YPKA 2GJZA 4M03A 4CW1B 4JPVH 1UM5L 5CGYD 2AJYH 3UBXB 2W0LA 4PTTA 4Z8FL 1XR8B 5BQ7B 1L9NA 4PGEB 1SJVA 3L5WB 3BQUB 2RFXA 1G6RA 3VXMA 4HGMA 2QSQA 3DRQB 1FN4B 1JGLH 4JFHE 3MUZ1 4TNWK 1N64H 3QDAA 1JPFA 2GK0B 5ALCL 1VGEH 1QNZH 4BFEA 4HUUA 1YC7A 3D0VA 4JKPH 3SBWA 2CIKB 1A6TB 1E4WL 1JHKH 4K2UH 3RWIA 5IFJB 3GIVB 5GGUB 1PG7L 1F5WA 2EEBA 1S78D 1IAMA 1A1NA 2HH0L 3SGDI 4HC1L 5BRZD 4K3DL 4KTYA 4FFZH 2R1WA 1GGCH 1ETZB 3TFKC 4FQXD 3ETBF 1T04B 3MCLL 3VWKB 2YPLE 2MKLC 1DDHA 4NKOB 2OZ4A 2BMKB 3V95A 2DQEH 4LNRA 2F54A 1ZXQA 4NFDA 3S4SB 5I15L 5IIEB 3QAZC 5JXED 1KBGH 2B20A 2DQHL 3TBVB 2BSRB 3WFDL 2AJXL 2GEEA 1BVLA 5EOQL 4EVNA 4EQ3A 2GYSA 3U0TB 4K7FB 1A8JH 3EFFB 3V6OC 1I7RA 3QUZC 5A2KH 1JVKA 2X70B 5BJTA 4XP5H 2BCKA 3G5YA 3OAZK 4ZTOH 4XB7A 1U8NB 4C56A 2E27L 1YMHA 1I8LC 4K07A 4MX7B 4ZG1A 1MJUH 3O2DL 3LV3A 3QIUD 2QR0B 3DI2B 2HT3C 2L4OA 2DM3A 3SDXB 3OX8A 1PY4A 4PTUA 1MWAL 2ZUQB 3SO3C 4TTDD 5IOPA 4Y88A 3WNPA 4I3RL 3X3GL 2LTQB 2DWEA 5DLMH 4Y2DC 1JFMA 4XXDA 3WSQL 4GXVL 1N3NA 3JVGC 1S5IL 2YC1B 1ACYH 3WCYA 5JHDA 2KZ1B 5C9JA 1IRAY 5F97E 4PJEE 4LSVH 3MV8D 2YPLA 4BH7B 3I6LD 3U4EB 3RAJH 4PJDB 4NRYA 4YWGH 3TPUE 1EVUA 4OFPA 3BAEL 3O8XD 5EBLB 5B8CC 1AJ7H 1KV3A 1AP2B 5DRWB 2XY1A 1G0YR 4JZOA 3DVNB 2NY1C 3G6AA 3HUJB 4HKZB 3H7BA 3I02A 2FGWH 3ARDD 1PLGL 2BSSB 4XPTL 3Q1SL 4CN6A 4HIJA 3ZSSA 2ZSVB 2A77L 3E8UL 4NQSA 4M62L 5HI4C 1ND0B 3S7GA 5GQBA 3K80A 1WBYB 3JUZA 5I8EA 5CJBA 2XTLA 2Z93A 4WO4D 4F7MA 4F57H 1A6UL 4RFEB 3WD5L 5I9QB 5J0BA 1C5DA 2WP3O 3VRJB 4UTAH 3O4LE 5C0FB 1Z3GL 4ZO6A 3ZDZE 4ZOCA 5JA8B 2G5BB 2DTML 3P4MB 4KK6D 4Z0BH 5EN2A 3L5XH 4ONFL 2C3WA 1CN4A 4NO0D 4ZUWB 4BSVB 1MRDL 4PRHE 3KWWA 4E5XB 3FO9B 1BJ1J 2J7LA 3L5IA 1I1AC 5C09D 2IGFL 2EE6A 4HWBL 4MXVF 4E0RA 3PQYA 2JIXB 1M05B 2IMMA 1UWXH 3LS4H 3QBTB 4JE4B 4RMRA 2YD5A 3TCLA 2ORBL 2EO9A 5T1DL 5MERA 1UKQA 3BGMB 2FX8L 1YEEL 2R56L 3IJYB 5EC1A 1LNUA 4BSJA 3CGTA 4PJFE 5DHYB 3NCEB 3I9GH 2N56A 1CICA 1T83A 1UT9A 3VGHA 5D1QB 1QKZL 2JB6A 2LE9A 5GZND 4JANB 3FQRB 2NY0D 2Z31D 4NQXA 3O41A 3FB8A 4AL8H 1DVFB 1XCTB 2V2WA 4XCYA 1VFBA 3AY4C 3V4UL 1YNKL 1S3KH 3VFTB 2FGWL 4BFIB 1JRHL 4JPKH 3BQUA 43CAA 4HWUA 3BZFA 4JHBA 1S9YA 4Z78A 2VLJD 3BT2L 4JB9H 3QCUL 3L9RB 3TBWA 1F90H 1ZHNB 4QRSB 1JP5A 2AXGA 3NGBB 4ESKA 3GMQA 5T3XD 1KFAL 3WD5H 4PJIA 3L5HA 4PJBA 5KG9B 2VR5A 1IVLA 1I4FB 3W0WA 4GRLC 4PJ9C 3PGCA 4JFED 1CDHA 3HNTH 5BO1L 4LPTA 4Y2DD 1VA9A 5TE7H 1DQDH 4Y4KD 4QHUB 1IZJA 4OF5A 1ADQA 1BQHG 4P2RA 3WNOA 3KLHD 2NY6C 4QHLA 4FQQA 1JTTA 4FQPA 1F2QA 5DEGA 1AY1H 5DD1H 1T04A 4PV9B 2IC2A 1RZFL 5H94A 1EH9A 3VWJD 5B22A 1KCLA 1NFDB 2ADGB 2VDQH 3NFPB 2GCYB 2O93L 4O5LL 1X6NA 2X4UB 3BVNB 4R26H 3RHWF 4HJJH 4YHPA 3WLWC 3P0YH 1S5IH 2BSRA 1RJZB 2APFA 3NTCH 3TBVA 4HUVA 5I1GL 2ICEB 5F1NA 5HYJE 4I8DA 4IRJC 4DVRL 4B0MM 3ARZA 4OCLC 1I7RB 5EC2A 4AT6B 3QB7C 4U6VH 3S5LA 2FWOA 1BOGB 2Q8BL 4ZAKA 1A7OH 4JN1L 5KSUA 3JTSA 2FBJL 2P42B 5I30L 1KEGL 4KRPD 2X42A 4JQVA 4I48A 1CFSB 3BWAB 3U4BH 3OPZH 3BP4A 5E9DE 1OGTB 3ARED 3N50A 1G9NH 4G8GD 3F7QA 4DZBA 2EYRA 5JXAH 5K9OA 4KUZH 3BN9D 4OGAD 1C5BL 4F9PC 4PP2B 4FQ2L 3KPOA 1GJIA 3O4OB 4L4JA 5AAMA 1T3FA 4TNWF 2I07A 4HIIA 3JWOH 1J5OL 1QHPA 3FN3A 2XN9B 5IB1A 1D5ZA 3MJGX 4JO3L 2I9LB 1KB5B 4R7NA 2J88L 1Y6NR 4PBWD 2RIKA 5DHXB 1C12A 2DI8A 5D93B 4Z6AT 3BIKB 5FF6B 4MS8C 5FO9B 2DKMA 3FAXA 5JXEC 4UINL 5EU5A 4X6DF 3QIWC 4P5KA 3FFDB 5DFWH 1CE6A 5JW5B 5J1SC 3MRDA 1U3YA 3DROA 4J3WA 1V8HA 2ADJA 2YK1L 4BZYA 4NO3B 4X0KA 2Z93B 5EIVA 3C6SB 2R9HC 1P53A 4HWBA 1FPTL 4FQJH 3NAAH 5CZKA 3DBXA 2P48B 1YY8A 1BMGA 5F7NC 3LMJH 4BH8B 4X8XA 4RIRA 2DQGH 5IMMB 5JQ6L 3RUGF 1HHIA 3GBML 3QG6B 1FNAA 3O3EA 1QSEA 3BSZH 1UM4H 2N4IA 3H9SB 3ALXA 3PHOA 5DQ9A 1TJIH 5D71H 1BJ1H 4ZNEE 1PD6A 4WUUE 3MFFA 2GSGA 5C0GB 5J9PA 4I18A 4PGCA 3BDYH 5KANG 4LLAA 1DVFD 4KJQD 2YZ1A 2IAND 4FZEL 1F3DJ 3O3DB 5BXFB 3TESA 4NM4L 5DHYA 2LV4A 3KS0H 3KYMB 5ANMB 3S36H 1K85A 3WFBL 3V7MA 3W0WD 1FZOB 4EXPX 3UJTL 3IJSA 4JZJA 4BZ2L 4HK3N 2J6EH 1YDPB 2UWEB 1I8IA 3VFUB 2X2YA 4NQXB 4HQQH 1SY6L 3G5XA 5MENB 4G8IA 5C0IB 3EHBC 4MDIA 3QXAA 1DEDA 2H1PL 15C8H 1BQUA 1Z2KA 3OPZL 3OZ9H 1BIIB 4D9RE 3BZFB 3LQAH 3MV7B 3IFNH 1FL6A 3EJJX 2Z35B 3C2SA 1OP5H 3RTQC 4EI5D 4M6AA 2GTZB 1XF1A 5KN5B 5FO7A 4FFEX 1FBIH 1J1PL 4P0DA 1A14L 1A9BA 3LHPL 3SCMD 3QNXA 2FR4B 2WAHA 1UZ8B 4JDVB 2Q3ZA 3QPQD 4GMSL 3MYZA 1BWWA 2Z0BA 4PJIB 5K9KA 1AHWA 3TBTA 5D70L 5AG9A 3WXVH 1A47A 1JCKA 1WFTA 1S7SA 4OD3H 5GRUL 4U1KA 3QXDB 5D7JC 3RDTB 3S5LG 3VW3L 1NANI 4R90L 1WT5C 3GSNB 4HIEB 1Y6MR 1MIEH 1AO7E 4OIIL 4NBYB 1ZKAA 2XZCL 1LK2A 4PGJA 5DD3L 1RZKC 2Y36H 3O6LL 3HA0A 1NKRA 3PV6A 1KN2H 3HNSL 2I5YL 3RA7L 1TETH 3TPUA 3DV4B 5E8DH 3Q3GB 2H26A 2VDNH 2GCYA 1LO4L 4GG8B 5A16B 5ESVA 1F00I 3MMEB 4DN3H 4NP4L 2XQBH 3GSWA 1IKNC 2CLRB 3EYUL 5C07A 1LGVA 2F53E 4PDCE 4YR6B 4QCIA 4LK4A 3G5ZB 5FAAA 2CLVA 1IM9B 2ZUYA 2WBKA 3REVB 4NQVB 4CBPA 1UWGH 1ZLSL 1G7LB 4DK6A 4DQOH 3ARDA 5J7CC 3RWGB 3PWPA 4MJ5A 3VD3A 3GUTB 4LDOB 5BV7H 5E4EC 2FHCA 1W8NA 1IL1B 3SDAD 2ZSWB 4M62H 2NXZB 3QCVH 3O8XA 4PRAA 3DVGB 4R0LB 2R2HB 3S36L 4X4YA 2VOTA 3ORJA 3LEXB 1KJMA 3RGVB 4R96B 1I9JL 3TIEB 3OHXB 2XWTB 2DDQL 4V1DE 1L6ZA 5DSCB 3O2DA 5ERWA 2XTJC 4OLVL 5GGSB 4BK5A 3WS6C 4QRQA 2I9LA 4K9EH 5GRZA 3GBMH 4XBGA 1FFOA 1S7RB 4DVBB 1C12B 4C55A 5HPOA 5K9JL 2A9MH 4PRHA 5FO9A 2VLRB 3EJZC 4BKLA 3SHSA 1B3JA 5EU5B 1RIVL 1C16B 3IFNL 2DL9A 3MRQA 1UEYA 3NACH 4MD5B 4EI6B 1EAPA 3DROB 5FYJL 1J87A 3BUYA 3CZJA 2JELL 4FXGB 5CJ8A 1EFQA 4EN3A 3MRFA 3L3GA 2YPKB 3C6SA 2LAAA 3MUHL 4U2ZA 5I6XC 2VQUA 4XP6H 1I1AB 3FB5A 2WLYA 3ULVF 2OX5A 3MLRL 4BH8A 1K4DB 5IK3B 4Z7NE 2ATKA 1U8OB 4XVTH 4QHKI 3UTQA 3QG6A 4XTRD 1AKJA 2G9HB 4J2XA 1FH5L 3MJ7A 3W11D 4Q0XH 3H9ZA 2OR9H 1VB9A 5E1HB 4PJXA 2PNDA 1YNLL 2IAMA 4HKBB 5KVEL 3A67H 1WWWX 1HXYA 2VDLL 1A0QH 4JRXB 3ZHLA 1JPTH 3VJ6B 1QA9B 5B38G 2PYEE 2CR6A 3HKFA 4WFFD 1RVFH 1H3PL 2D0HA 3NIGE 4X6FA 4KDTA 4AJ0A 1CXHA 3U4AA 4HJGA 5C7XL 1OWWA 1A6VL 5ICYB 1FFPA 2YZ8A 3KLAB 4MNQB 4WWKA 3KYMA 5ANMA 5GJTL 2YEZA 4S1RH 3OGCA 3F5WB 3O6FA 5HGAA 1RZ7L 4ZNEA 2IPUK 5EO9B 1NCWL 5HDQH 4NBXB 1IEBA 4PLNC 2FIRT 3VXSA 1ZHKA 4B7IA 4KI5D 4JFDD 3H9HB 1V3LA 3IDGA 5GIRA 5I8KL 3SDAB 4K7FA 5SWQA 2AJSH 4GRLB 2EYSA 5TGBB 4X6BB 1XGPB 4U1LA 4P23A 3G5YB 3GJEA 5E8NB 5TDOB 3FKUS 2OL3B 5L88L 4XMPH 3CC5A 3DI3B 4CN4A 1MCQA 3S37H 1TVHB 2LAGB 2EZ0D 4NJAL 5AZEL 2O61B 2FL5B 4P2CG 4W6WB 4LASH 3ZE2E 5IOPB 2JCCA 2DWEB 3A6OA 4S1SH 1IC4H 2P1YA 3NABL 2CDFB 4Q6IC 3FO0L 3IDIA 3QDME 3WLWD 3DO7A 4TNVK 3KLDA 4X9BA 5T33L 3DGGA 2Y72A 3PWPD 1LWRA 4PJDA 4GKNA 1PZUB 3DSFH 3RKPA 3DTXB 4PJAE 5CJQL 1JPGA 2VDLH 3FFCB 5D72L 3O6KL 1MCOH 1A5FL 2BNRD 4PJIF 5CZVL 3I02B 4NCC1 3RVVC 4IMKA 3D85A 2BZDA 2WWMD 3HPJA 1BZ7A 1KELL 4JJ5B 2HJKB 3VXTA 1ND0A 1FVCB 1JGUH 1MCCA 3FRUA 3TWCL 1MLCA 3HCVB 4PJEF 3FZUD 4RFNC 3MRIB 4YXHH 3OAUL 4MA7L 1OAKH 4KDVA 1I8MA 5LGHL 4M1CC 4NRXB 1C5DB 5EO1B 2JB5H 2KPNA 4N1HB 4QXGH 5LWYL 1AGFB 3GMLA 2QQLL 3BP7A 2X4SB 4PRAB 5CMAA 4NJ9H 1K3ZA 2DTSA 4TRPL 2W07A 1JF1A 2WWKT 3RGVA 1GC1C 4OCWH 1G1CA 3HZYB 2DLTA 2ESVE 3E3QC 4ZUVB 1F4YL 3MLYH 3C5JA 3B2UC 3NPZB 4NFCA 3MUGA 4P2RE 3IDJA 3L5XL 1NH6A 2VE6B 4ONFH 4LGRB 4NRZA 1MFBL 3QQ9C 2OTUA 1LHZA 2CGRH 2MHAA 5J13C 4HHAA 3VRIA 2AXFB 1F58L 1J05B 3HG1B 4IRSC 3ROOB 4JRYB 3GBLA 3VFRA 1UH4A 4NGHH 2XA8H 4ZNCD 5EFIA 3ARFC 1JPTL 3ZYJA 1CZ8H 4FXGA 4JFDE 4JM2B 1CDUA 5D72H 2FO4A 2VL5A 2PTVA 3NCYP 3HE6B 1XCTA 5C0DA 3L3GB 5B38B 4X5XA 4WWKD 2D31A 4FFWD 2IMNA 4TPRL 1YY9D 2IPKB 3BJ91 3UPCA 1SVZA 4MSWA 4PLJC 4U0RC 4RAHA 2AW2A 1NCCH 5D9SA 1KELH 4PGBA 4NKDB 4G9FB 4JO4L 3ILPB 4X9GA 3EO0B 2XKNA 1YQ2A 3RKDD 4QOKE 3ARWA 2IGFH 1S7XA 4Y5VA 4N5EA 4WI4A 4G6FD 4OFIA 5IB4B 3BP6B 5CILL 1K5NB 5DA0B 2X09A 4QHUA 4M9OA 3WN5B 2NYYD 5CSGA 2J1KA 5ANME 2V2TB 4XAWH 1QR4A 2B4CC 4OCRL 3WMSA 1ADQL 1RZ8B 3CXDL 4S0UC 1R5IA 3UTTA 1AGDA 3NBNA 4J12A 4L9DA 4CRPA 1MJ8H 1NGPL 1RY7B 2XZAH 2HN7A 5JHLH 1QEWB 1FNGA 5I18H 1D6EA 3ULSA 5LGHH 3GRWA 3QDJD 5C0BE 2HG5A 5FIEA 4TTGA 3C5ZD 1Q0XH 4Y16A 1OAQH 4HDIB 4U49A 4CVZB 4JPWL 4RMSA 2PCPB 1B2WL 2A1WH 1CXLA 5IVZA 1N0LA 1G7HA 4WW1B 4QTHB 1KB9J 3BE1H 4LVNC 5M95B 2AJVH 1HIML 1A1MB 4L8BA 4FTVE 1C5BH 4LPUA 2VXUH 4UZGA 2MQ3A 4GOSA 3QO1A 1JJUA 3LD8C 3RZCD 1MVUB 3OKOA 4TVPE 3RWCA 5DJXB 3D2UA 3QZWG 5L8JB 3T77A 1VKXA 4U1NA 3QUZD 4FXKA 2VDMH 2JCCB 4JO3H 2XNAB 5HGDA 4MAUL 4GAJH 1U8HB 1NAML 1XR9B 2DL2A 3UPRA 3IDIB 4L3EA 3MUJA 1U95B 2BOBA 3DGGB 5HGHA 4PJ8A 4HIHB 1M71A 3KPOB 3VFPA 1BQSA 1NFIB 3SKOB 2F53D 4U1JB 4L4TB 2MFNA 3B6SA 5C07D 1EPFA 4HXAH 3Q6FA 2VLKE 5HSFA 3PHQB 1OTTD 4YHZH 4P3DB 1X5KA 3BIKA 4TSCL 1T2XA 4MMXC 4DN4H 4M8QB 5I0ZA 2WBJD 4IM8A 1MAMH 2Q20A 3FQTA 5CJXC 4PJCA 4I77L 2Q8BH 5D2LF 1OY3B 5HDOA 1J88A 5HHPB 2I25N 2B1AL 1PG7H 5CBAB 2BK8A 2ADIA 5FGSA 1OQXA 2HFEB 5GS3A 4Z0XA 3TYFB 1KYOJ 3UJIH 4G8GB 1H9VA 4OZFG 1GOFA 5LGKA 3RX8A 3O45A 5FKPA 3ROLB 4U1MA 1TZHA 3DURB 4JFZL 5CEYB 3TNNB 2ILLA 3L7EB 3GM0A 4XVJH 2O5YL 1G9NL 3BH9B 3RY5A 3KPMA 1M1SA 3ARRA 4WGWB 4Z77A 5CMAB 2OP4H 1B0GB 2DYPB 4YXLH 1U58A 4OF8A 1J0HA 2AEIT 3EYQD 4QNPE 2GSGB 2VLJB 3QPQC 4GSDH 4OJFL 2HFFB 3I6KB 4R7DA 3RJQB 5A3IC 2FJGB 2Z31A 2J8UE 3O2VH 2B2XH 3KXFB 4LARH 3EKCA 1EEUA 1M7IB 2P7TA 4MAUH 5JIIA 5AWNH 4NHUE 1OVZA 3HNVH 5H35B 2AJZB 1N2RA 2R0WL 1LDSA 1G6RL 4WHTA 4P2QA 1H5BB 5F1IB 1NAMA 4UDTB 1MWAA 3O2WH 2ED8A 3BEVB 3F12A 5IHUL 4V3DB 1VSCA 1OARL 3KNBB 4MNGA 2FO4B 2VL5B 2AABH 2HJFA 1QLRB 3VH8A 3SBWC 2BVPB 2FSEA 4N1CA 3FB7B 1MCPL 5EA0L 5T3XH 2D31B 5IB3A 5H8DA 5GGRY 3SY0B 1MCWM 4KVNL 3KPQB 5ALBL 5F1KC 4PGBB 3MV7A 3D39B 5T1LB 3FQXA 1FL6B 1XF4A 3ILPA 3H9SE 1OGAA 2R1YB 4L8SA 3F7RA 3HPLB 5IW3A 3MLWL 1KCSL 3GZKA 4OM0H 1A4JB 5KSAC 3MRMA 4ZFZB 3ZTJG 2DN7A 5E99H 1IGYA 3VI4F 3I3BA 2B1HH 2DS4A 4QRUB 3T8XB 1Q1JL 1DBKH 4L3EE 1FV1B 3O4LD 3QXDA 3O3BB 1JZ4A 2PKDA 3S9DB 1X7QA 2OZ4L 1XIWC 2UWEF 4NOFA 4OKDA 4ZPVB 2X4RA 5FA4A 2BVUA 5I71B 1N6QL 1ZVHA 1MFCH 4HF5H 1YYMH 1FIGH 1MIMH 5EO0B 3VXSD 4GRWE 3OKLB 1DBMH 3LB6D 2RHEA 3QUZA 1RZ8A 4KMTH 3FQUA 4UB0L 2HLFD 2C1PB 4MQTB 3IXTB 2DQTH 3VWJB 4G6ML 3QISA 1WZKA 2NXYD 1R3JB 3TC9A 1I8LA 4CADA 1UQSA 1IC1A 2EDWA 1D6EB 3ULSB 3AM8A 4GG8A 1HHKA 2Y1VA 3MXWH 5ELIA 4ENED 2VMFA 3N9GL 5FV1L 4BYHA 1CGSH 1EERB 2ICWJ 1IGMH 2VO5A 3I6LE 2RBLA 5SWSA 4Y2DA 1WBZA 1GGTA 3DMMB 3V6FA 3HZVA 3JVGA 4XNYL 1S8DB 3BGFC 2ORBH 4XMLH 3GIZL 4XRCB 5T1DH 4C4KT 2R39A 4W68A 4IDLA 4KI5C 4N8PA 5DEZA 2R29H 3U30C 1FNSH 4GKSB 1U8KA 4OFYD 3LKOB 5F7EL 3OKEB 1Z9SA 3U9PL 3GUTA 4KHXH 3UO1H 5B8CA 1FFQA 3P0VH 1SYSA 4K71C 4N9OB 2A6IA 1CGTA 3AROA 4YEFA 2QQQA 4QT5A 4PJAF 2DKSA 4N8CL 4PP1D 2VXTL 2XZZA 4JKWA 3ISWA 3HAEA 4AIXA 3U36B 3PWLA 4WEBH 3WUZA 4HIHA 4LLQB 1RUPH 5E00A 3NVQA 4UBDD 1QFWM 1YEHL 1AC6A 4PRBB 4JFZH 1QQDA 4KY1H 1R0AL 4M00A 1KYOK 2QQLH 4CNIB 1A7NH 4DVBA 1N6QH 4ZD3H 4QRPD 5EULV 1T2QH 5C0CB 1XGUB 4OGXH 4OAWA 3RVTC 4C57C 4KMTL 3MBEA 4UB0H 4E41B 1IM3B 1H0DB 1U91B 5AZ2H 4YBLC 3QRGL 2PO6B 4HWEH 1AE6L 4XVSH 5DEFA 3UBXI 5IFHL 2QQNL 5IEKB 1CI5A 4KZDL 4AENA 1I9IH 5F7LB 3ES6B 3EUUA 1I7TA 3BW9A 1NFDE 3TYFA 4HH9B 2NY5C 1I1AA 4YDKH 4KQ4L 3DX7B 1TXKA 5INCB 4XPHL 2M2DA 1TZHB 4N0CD 5EOCH 2FIKB 4Z95H 3OKMA 4X4MA 3RP1A 1U8OA 2WUBL 1FYTD 1E4XH 1HHGA 4JZNB 4ZXBC 2A9NL 5TQ0H 1OARH 3F7VB 3SDXF 1DEEB 2DYPA 2SEBB 3V5DB 2VZSA 5GGVL 1IQDA 1NJ9B 1SBBA 4PRIB 4KTDH 2VLRD 1HI6B 1N5AB 1TZGL 2VLME 3BDBA 1JHTA 3BH8B 3SDYH 1P4LA 5F7DA 2NY2D 2I26N 2CO7B 3O4LA 3FQNA 3BQUC 3F5WA 1TMCB 1E4KA 4C59B 4LSPL 2OJEA 3A0OA 4K3EL 2E6PA 1BPVA 3SDDD 5DWUH 3ARBD 1QFWI 5KVMC 1G7IA 2Q7NA 5IB2A 2BOCB 4ODTH 1RFDH 5FYJU 2E9BA 3FB7A 4KKCD 5EUOB 4PJ9A 1QSFD 4LPYA 3DYMA 1XGPA 1LILA 1HQ4A 3ZLQC 1Q9KA 4J6RH 3ARPA 2UV3A 3B9KD 3ZYOA 1XF2B 3LPFA 1A4JA 4WTZA 3MRBB 3BWUC 4KK9C 4ZUSA 3CFIC 1I7ZA 3NPSB 4PY7A 3VDAA 2GJJA 5SX5K 4G8EB 3QH3A 1AR1C 3LSOB 3STLA 2A77H 5GSVA 4PJCF 3STZA 3QAZB 4AEEA 1T22A 7FABH 1YEDB 4TYUA 1YEJH 4IRJA 5DFTA 3QDGD 1CLCA 1LD9A 4NJAH 3PWPE 3D2UD 2Y4SA 4MJ4A 3S35H 4G7YH 3HMWH 5EU7C 3I75A 1ZT7B 1K3IA 1CQYA 4CADB 2X10A 5BZDB 3DX9B 4GKOA 2ATPB 5KZCD 4J8RA 4AY0A 3D9AH 4N90D 3RZCC 5D5MA 1CLOH 1B4RA 4MA3A 4MB3A 2D4DA 1H15A 4XMKL 5E56A 2IFFH 4S2SB 5HDLA 2LTQC 1EJOH 3MR9A 4J4PD 3QO0A 2X4QB 2X89A 1E4XL 1OAXH 5MP6L 4R2GB 1S8DA 3V0AC 4EBQH 4LCCB 3QWRD 5GGQL 1MUJB 1ZT4A 5GRVK 3UC0L 2EDQA 4F9PA 4OD1L 5ILTL 2DQUH 3QQ4B 1BZ9B 3MLYL 1SJHB 1T7XA 4PV8A 4KC3B 2F58H 1OOAA 1GGBH 4HGWA 3WDIA 1MFBH 3ARGD 4OT1H 5E6ID 3QI9D 4ONHA 4LL9A 1JF1B 5F3HA 3IYLW 5DUBA 4NKMA 4ZFFB 1EJ6A 3AREA 3TN0B 4O2CA 1RZJL 3QIWA 2X05A 5TPWL 1TQCC 4ZUVA 1J1XL 1RJCA 1ORQA 3DX6B 3STBA 4EKXA 1ZK9A 1TLKA 3KPPB 5C6TH 4FZ8H 4NRZB 2GK0A 3VXUB 2D2OA 3THML 4CNIA 3TIDB 1W72L 3FT4B 4G6AC 3PV7A 1WICA 1MEXH 2X4OB 3U1SL 3GB7A 4GW1A 2VAJA 2AGJH 4R3SB 1JGUL 1QLEH 3L3IB 4P5MA 5DJAB 4AIOA 5EFIB 1E27A 4DWHA 4FFWC 1NANH 5DEFB 1U8PA 2JK5A 3O3UN 3QUYB 1BGXL 4PJHA 5ESAB 4P5TA 2V9TA 1ETZA 4EUPA 3C6LD 3TFKD 1FO0H 4HH9A 2CKBA 3MOBL 2LU3A 3ECBB 3TEUA 2OMNA 4NQCD 4MJ6A 3I85A 1BECA 5T3ZL 1HEZA 1NBZA 2DJUA 4I18C 5DHVB 3CUPB 2EO1A 4PJFA 4D0BA 4GRMB 5E8DL 4WIQA 4LVEA 2LQRA 3OKKA 3ZKMC 5FUOH 3NA9L 3HI6H 3LPGA 1DBML 3ZE1E 2NY2B 2ARJQ 5CBEA 4PGEA 4LEXL 3IU4H 4PYGA 4G6MH 2AK4A 1LEGB 1WIOA 2MKWA 4EQ2A 1FN4A 4ELME 5AD0B 2OXGA 4C56B 3L1OL 2DKUA 5HHMB 1ACZA 4JPWH 4NWTH 4BQ6A 2BNQE 4H8WL 4Y4HA 3RIFK 2X4NA 4FHBD 3GSNL 4LRNH 5IFAH 1GYAA 3T65B 1NGWA 4NGHL 3ARQA 1QP1A 2BNRB 4HMDA 1AGCA 5H2BB 1EMTH 1SBSL 1JYXA 5A3ID 2V2XB 1ZGLP 3PF2A 4JR9H 3LIZH 4LVOB 3UJJL 3DVIA 1SJEB 4S0SD 5J6GA 3MYJA 2CDGA 5DK3A 1XH3A 1G7IB 3BKML 2OK0H 1YQVL 4LHQB 2B4CL 4QF1A 3FZUC 2NCMA 1AHWC 1AI1L 2AEQL 1FIGL 1W0YT 2A73B 1U93B 4MNGE 1OSZA 4XX1G 2MQ0A 5ESQB 4PJ7B 5IM7A 1FGNH 1ZT1B 4K2UL 4QTHA 5D6DC 4LMQE 3DO3A 2E9JA 1JYVA 2W65B 1LO2L 2PXYB 4WCYH 4OZHF 5D71L 2NY6B 1VFMA 4LOUC 5GSRB 5C08A 5BVJA 2EDLA 3EZ8A 3RWCB 1T0NA 4JM4H 3P9WB 4UINH 3PWVA 1A22B 4WHYG 5IESL 3TT3H 1A6WH 3OWEA 4J1UA 1FFRA 3WUWB 3U6RB 4IOFC 4KJPC 4OZGF 2IG2L 2GIYA 5EBWA 3CLFL 2E7MA 1F4WH 2V17L 2E6QA 3KXFE 2R2BB 3IGAB 1IKNA 2WLZA 4RRPA 3VRJA 3C5SA 4IRJB 1Q94B 5B39B 1M71B 1U3ZA 4QHMB 5GHWL 1QRNA 4OF3A 4GW4A 3RU8H 2GY5A 5J8OA 1U3JA 3EGSA 3TZVB 3VFOA 1WK0A 5I8KH 1YEFL 3DX9A 4QXUH 3TJHD 5IW6A 4WJ5B 3MOBH 2GFBA 4OZ4B 5IHLB 4Y1AD 1H15B 3ULVD 1V3KA 5EB9A 5D7KD 2IALB 2AEPL 2FJFA 1AXSB 4MA1B 2QSCH 5MERB 3WHE1 2J12B 3VXQA 3O8XC 1IQWL 1T1ZB 1A02N 3H7BB 1GC1L 2FH8A 2C3XA 3MJ8B 1KENH 4Y5YA 5JR1L 3CMOL 3BKMH 4U7KA 2OK0L 2P4AB 4YE4H 4RAUB 4TSCH 4G8FA 1U8MB 2G60H 3QIBB 4XC3L 4LHUA 4I13B 4U3HA 4XPBL 2PYFB 4M5YH 2EIEA 1HDMA 3WS6A 3BPLC 4JY4A 5GGSY 3SQOL 2AK4D 3SGDH 4RFEA 3CXHJ 3MV7E 1P6AB 4M1DH 3LRSA 5C0FA 1E6OH 1U58B 5E8EA 4LCIH 3CFBB 4Z76A 4Z78B 2OCFD 4GXUM 2EXWD 4YBLB 1HWHB 2FEEI 2K9UA 2Z31B 3MRJA 4Z95L 5C70A 3R4DA 3QDJE 4HIXH 3KWWB 2AXGB 3HAEG 1RFDL 1AI1H 2E9IA 1N59A 3CFDA 4XMPL 1PYWB 5L2KB 3K1DA 3FCTA 4XWOC 1E4JA 2APXA 3GSQB 1RK0A 3NH7H 5BS0B 4NN7B 2F54B 3T0BA 2P5WB 5DJDA 2ZUSA 2D7PA 4P2RB 2QADD 1JWSB 4F3FA 2AV1B 4JM4L 5I66A 1RHHB 4N5ED 5CEXB 2UVFA 2YA1A 2VDPL 2BNUB 3I84A 3FONB 5F89B 1D5XB 5CZXC 5KSAD 1S78C 2W0PA 2Z4QB 7FABL 1XF4B 2J6EA 2OS7A 1I85A 2VDQL 3N1GC 3NIGF 4YFLF 1F13A 1ZEAH 1RJZA 4HUVB 1F02I 3SDXA 2XXMB 1YNTA 3A6CH 4QXWA 1ZLWH 5TDNA 5BVPH 1D9KD 3S98A 1UB5B 2ZG3A 3L95A 1FNEA 4GAFB 5HYFA 3TNMB 4K7PL 4PGZA 4Z7UF 3V4PL 3IT8D 4IRSD 2A9ML 1BM3H 5HHMA 4JAMB 5KSUB 5C08D 1LO2H 4WCYL 1NLBH 4NRYB 4JJHA 4NO2A 3WKMH 1NGWB 2XTJD 3NACL 3NCMA 4HPOL 3WIFB 4UOJA 4DGVL 1DANU 4DEPB 3GIZH 4RDQF 2VITA 5FYJD 2W0KA 4XCFH 4UTBH 4RMTA 1DQQB 3DLQR 5CLTA 3T0AA 4MWFB 2ITCB 5ILTH 5DA4A 5ITBH 1W2KT 4TPRH 3IDUA 5DEGB 3G6JB 1CD0A 4OD2A 1I9JH 1DANT 5GS0L 2FX9L 3GGWA 5JIHA 1QRND 1IAOB 2ADGA 4Q6IA 3ZL4H 3KYOB 1H3UA 4Z7WB 4YQXL 5E5UB 3TJEL 4RISL 3AB0B 3ZTNH 3JV6A 1IJ9A 2P8PA 3OXSB 1S7QB 2EDJA 4MXQC 1DLHA 4PFEA 4AT6A 3HLAB 2B8OT 5KS9A 2HFGL 1YN6A 1XZ0A 3ZDYF 1WV7T 4FQXA 4KJPD 3HC4L 4KI5E 3E3QE 5TH2B 3JTTA 3K74B 1ZHBB 3DYPA 3JTSB 3HAEB 5EZIL 3V6ZB 4X7EC 3R0NA 4YBHA 3UC0H 1Z0NA 1DN0A 3WEXB 2BNQB 3L3JB 2NLJA 1BX2A 5KSBA 5SV4A 2K7PA 2YD2A 2HT2D 3VXMD 4F9LA 3F8UB 4X7DC 1CXIA 2PYEB 3UAJD 1C1EL 1B90A 5JW4Q 2YSSB 5GGVY 3ARXA 4GMTL 4QRRB 4UT7H 1KJVA 2JJWA 2GJ6D 5DT1H 2HRPL 5EBGA 3FRPA 3O41B 5KS9E 1D5ZB 3QUXC 3BJLA 1WQVT 3KJ4B 3VCLB 1Z5LB 2DQFA 4O4YH 3RZWA 5I1LB 3ES6A 5I17B 1Q72L 1OB1B 3N1QC 3SKJL 4WDIA 4Y5XC 3LKRA 2W60B 3RGVC 4W70A 1CE6B 1MEXL 3EHBD 5MI0C 2YPLD 5CP3A 2JJSC 2A2QT 1RZIB 3E3QA 5IT2H 1JWMA 3EOYG 3LEYL 3OKMB 5HYJB 1HDMB 4N8CH 4UQ2B 3QIWD 5HHNB 1PSKH 5TF1L 4PS4H 3IVKB 4WEBL 1LO3L 1JGEB 4LLUA 1WEJL 4IRSA 3GSUB 1T66D 4NQCA 1CL7I 2YD6A 2F19L 3E2HB 1C08B 1HHIB 3ARFA 3D3VA 1KTLA 4XWGL 5CZVH 5FGCE 3Q0HA 4K23H 3ARGC 5MEND 2ZG1A 4UIKL 5KN5A 3DUSA 3R06B 4LCWD 3TP4A 4L1HA 4FQQB 4YC2B 3C6LC 3LHPH 1TVBA 1T1WA 1FLTX 2XYCA 5L2KA 5EZIH 3NIDF 3PP4H 3FQNB 1WCBA 4DAGH 4ODXA 5T1KB 4FA8A 2H9GA 3DETD 5DO2D 5GXBB 5D7JD 5GRJL 1JWUB 2X4UA 1KLUB 3AAZB 1OCWL 1VCAA 4YHIA 5GGTA 3IAGC 1NPUA 4D0CA 4PJHF 2DD8L 5E2TL 3BSZL 4P2YA 2VQTA 3G6DL 5L6YH 3LN9A 3A6BH 1IARB 3WIIL 3PWUB 5HI5C 2W9DH 3O3AB 3MODL 5JUEH 3LVEA 1T5WA 4DKFL 3BPNB 3LS4L 3CDGB 1UVQA 1ZV5A 4X4XA 4NHCH 1SEQH 1PG7W 3PWJA 1UH2A 3OKDB 3PGFH 4HLZG 1ZE3C 2XV6B 3EOTH 4UI2A 1BQHB 5TDNB 4QCIB 5JIPA 1DQDL 4UUJB 5JIKA 1MAML 2FCBA 3UXFA 1FNEB 3IAQA 2NPLX 4G42B 5DUML 5I16B 1MREH 5DD5H 1IMHC 2B1AH 1UYWH 2IANA 3L3HA 5L0QC 3HRPA 1R3HB 1CTOA 1UZ8A 4JDVA 1WZ1H 1NCNA 4NKQB 4MNQD 1UM5H 4PJXE 4OUUA 5C3TA 3G9AB 4E42A 2VISB 1W0VA 3MROB 2BP3A 4QGTA 3MGOA 4F37F 4F7TB 2NQCA 4P59L 5ACLA 1IILE 2AABL 1WAAF 3UTTD 1S7WB 4RMVA 4YE4L 1OP5K 1KXQE 2QTEA 3L3OB 4U1SA 4UIMA 2DMCA 3G6JA 1R24A 1NCAH 3ARBC 3FFDA 5C0EA 5C0ND 3Q3GA 4K94L 5ID0A 2OSLB 2BJML 2E3VA 4ZFGL 5CWSB 4KGLA 3W2DH 5HHOB 3U2SB 2ICES 2V5RA 4GT7A 5ESVB 4PRDA 2YS4A 1S7RA 4GBXC 5HYSB 2YPVH 2Y9RT 4WU5B 3U4BL 1YY8B 4O58L 3IFOA 4AIZA 2N7BA 1RIHH 3GRWL 4OFKA 3ARVA 2UYLB 4M3JA 5A43C 3MRHB 4DFHA 1C7SA 4PV8B 5D7IF 5EH1A 5D2NC 4TNVF 4YUEL 2JELH 1N4XL 1CLZL 3R1GH 4KJYB 1FORH 5IF0B 4PR5B 1J0JA 3BXNA 3PWPB 5DJ8B 4NKMB 4LSUH 4ZFFA 5J6HB 4KKNA 4G7YL 5CJXA 4I0CC 4HUWA 4LSQH 4JY6B 3RNKA 1DL7L 5F72S 3CFEA 1D3CA 5C0BA 4WFED 4K9EL 4NZRH 3WHXA 1YN7B 2G9HA 3KPPA 3AMKA 5FECA 1IGFH 1IGJA 2YSSA 3TIEA 4KKAD 1FZOA 1OHQA 4Y0GA 3QIBC 1QSFE 5E7BA 5KVEH 3BE1L 3FRPG 1LO0L 1BFOA 2XA3A 1LO3H 1VFAA 5ERWB 3U46B 5I15H 2H2SD 2VIRA 4F57L 1J1XH 3VCLA 12E8L 1Z5LA 2DQFB 4JG0L 4P59H 3KS0J 3QXUA 4HK0A 2FLBT 4HJGB 3AGVA 2Q6WA 4JFEE 4R6UA 5ESAA 1U92B 4P5TB 3U9PH 4HJ0C 3BZEA 3QYCA 4QYOB 2KL6A 4HAFA 5JMOC 1KACB 3DUUB 1ADQH 2Q3AA 3SE8L 3VFGL 4MD5A 1RZIA 4EI6A 5J4MA 3H3PL 1NCBH 3WIHH 2Z31C 1UYWL 5BZWA 2XZAL 5JHLL 5K9KB 3O0RH 5J13B 3EYVB 3VXNB 3CXHK 3P9MB 3WFCL 5EOCJ 3FFCE 1P9MA 3SPVB 3RDTA 3HE7B 3JV4B 3IFPB 2NY0B 4OI9A 5E8NA 5TDOA 4JFQB 5J06A 2ED9A 4H0IA 1ZLWK 3D25B 1MCLA 1KPRB 3CC5B 4WHYH 1F8TL 5ICZA 3QCTH 5GS0H 5J1AA 4YDVB 3N85H 4TUKH 4A2MA 4XNMB 1KCGC 1QA9A 2JTDA 1HILB 1WCBB 5J12C 2W9EH 3EZJB 4OV5A 1E28A 3QUMA 2VABB 2CDFA 3HI1B 3JBG7 1AIFA 4L8SC 4NZRL 1QR1A 4NQDD 5HJ3A 3L1OH 1RULH 3UJIL 3QDHA 4L4TE 5KSAA 3SCMC 5ABDE 3KLAA 4MNQA 4NUGH 4MJ2A 3NZHH 1OWRM 2X40A 3T3MF 2A73A 5FFLA 4MHHI 4LBEA 3R8BB 5JLZB 5ESQA 1MCIA 5I1CH 1XIWA 4KHTH 3T2PA 5F21B 4IHOA 3ZT5A 1UVQB 4G6JH 4N9GB 1ZLVH 4IS6A 3VXPA 1P7QA 3MRNB 3NCYS 3MV9D 3I2CL 4N0YL 2DBJA 3WXVL 4G5ZL 1LO5A 1MCSA 4M93C 1NGXB 4OLZL 4WW2F 4P48A 1U8QB 4KMQA 1D7FA 1PQZA 3K2UL 2F8OA 3EOBA 4DEPC 4ELMB 1IL1A 3UTTE 4JQIL 1WFOA 5DD6A 2FRGP 1ZGLM 3AM8C 1AD0B 2D7QA 3IDNB 1R5VA 4HWNA 5DMKB 1VADB 1FVDA 1KJMB 3ZDXF 4P2OB 4JG1H 3ZTNL 5DJ2B 3U7WH 2H1PH 4YIQA 1J7VR 4QHMA 4M6OH 4LKXB 2VDNL 2ZOKA 4HKXA 3IAPA 4F7TA 1D5IL 4QRQB 1G9MH 4CDGC 1LP9B 1R3LA 4S1QH 1NCTA 4OLUL 4P9ML 4HXBH 4MXWH 3OSKA 3GMOA 1OD9A 1S5HA 4AQOA 5E9DD 3SDCD 4HS6B 3DTXA 4XNQB 5KSBF 2XPGB 1KOAA 4GS7B 1B0WA 1BF8A 5DC9B 5LXGH 3QG7H 5ID0B 1YUHB 5C0CE 4OTXL 2H3NA 5E99L 2DLGA 3E6HA 4XCNA 2RQ8A 3IF1A 2EEDA 2ICCA 5E5RB 3V8OA 5I73C 4PJ5A 3P11H 4UT6H 2DAVA 3MRGA 1M6OB 1JZ2A 1BZ7B 1TITA 2D7MA 3VFRB 4Y19B 1P2CB 1YPZF 3UTQB 2BVOA 3P4OB 1AKJB 4JM2A 2I9TA 1MRFH 1I8MB 4R8WH 3T4AB 5T5NG 2BFVH 2YWZA 5EO1A 2Y5TA 1J18A 3FO2A 2DQTL 4C58B 1YY9C 5HBBA 2XG5A 3MBEC 1X4ZA 5KW9L 3RNKB 4DW2H 5IW1A 5HPMA 3KJ4C 4MCZB 3RWEB 4G7VL 5ICYA 4YZFF 1TJHH 4ODBD 2D7TH 5I1HL 5DUPL 1W8OA 3GEWB 4Y4FB 1DBKL 1RUQH 2WINA 2EYTB 3WXWL 3O11A 4QY8A 3D3VD 3OMZA 1ZHKB 4Z9KB 2OZ4H 3CFJB 2X9YA 4ZXBA 5DC0A 2MMXA 2ESVD 5FHBH 4JPIA 2QSTA 1EAJA 1NGQH 5SV3A 3WYRA 3HG1A 4X6BA 2UZYB 1RUKL 4U1LB 4JFFB 3RUGA 4U7SA 4CUCA 1IEAB 1AGEB 5BMFL 2DLIA 1K9TA 1WBXA 2BVQB 2WBWB 4NDMB 1KJ2H 1WWCA 3J7HA 1O7VA 4HFUH 5IUSA 3X13A 2HLAA 4M1DL 4X5XB 1IBGL 2QKIA 4K3DH 3UBXA 4NO0A 2NXZD 2FL5A 5LCVL 3KYKH 5CILH 1DBJL 1E4KC 5BS0D 2P47B 3RDTD 4YEEA 2VLKB 3IKCB 2W9DL 4JFQA 3B9DA 1WAAE 4Y1AA 1PX4A 2FLRT 3NMEA 4HK3J 2GKIA 4JHWL 4MQ7B 5JOEA 2CPCA 1MCNA 3CK0L 4HV8A 4CU7A 2JF1A 4A2LA 3RWIB 1K8IA 1MJ8L 3QJHA 1K5NA 1O5DT 1XGRA 4K8RL 3VXME 1JBJA 4XBEL 3FFCA 3RPIB 3QHTC 2H32B 3L6FA 1GGIL 4FQIL 5JQ6H 4D2NA 1BD2B 2ZOLA 3UPRB 4HLZH 4LSSL 1AIFB 2AK4E 1QR1B 5I76B 1PLGH 4Z7VE 4OI8A 2ITCA 2R1WB 5KSAB 1MHHA 3NIFE 2YN3A 1P84J 4PJ8B 5D1ZD 3WS3B 3NCCB 5IBUG 35C8H 1XMWA 2J8OA 4FNLL 4X4ME 4N0FB 4ALAL 2YD7A 4DUXA 1NUDA 2EDEA 2DQDL 1X5XA 2NXYB 2BNRE 1MLCB 5IHZB 5FV2A 5IMLA 4R4FH 4P4RA 4KY1L 2Q87A 3HMXL 3BKCH 3C8KB 1A7NL 1J8HE 1PBYA 1S7QA 1LO5B 1YMMB 2FX7H 4OZIE 4MXWL 1A6ZB 2PCPA 1YC8A 5IVZB 3UP1A 3JWOC 5IGXH 4IEFB 1E6JH 2EZ0C 3EYOB 1RZKL 3L3KB 2OXHA 2BC4A 4KMLB 5DJYB 3J8F7 5JO5A 1TPXB 3TV3L 1UACL 4HWBH 3RZCA 3Q5TA 4KRLB 3SDDB 5F93C 5ADOL 1BAFH 4U1NB 3BKYL 3HZYA 1T6WA 3WO4B 1EVTC 1U8HA 1XR9A 4G9DB 4XP9L 3SKNB 4ZYKA 1Q72H 2ZCLH 3NIFF 4WY7H 4B41A 2XWJB 4EEEA 5CJOL 3S37L 5GGRB 1T20B 3P3YA 4U33A 4UAOC 5TQ2H 1HYRC 1MFDH 2D3VA 4L4TA 4OLYL 5HYQA 2C3GA 3R0MA 1LE5A 2LABA 2P7TB 4NUJA 4NNXA 1D9KA 5I1LA 1DUZA 4PJ5E 1OB1A 2B0SH 3AREC 3TA3B 2IPKA 4GRWH 1YEIL 5HHMD 3MLXL 4MQSB 1EUTA 5HHPA 4PY8I 1H5BA 4DCQB 2IH1B 2DQJL 3JTCA 1JGDB 2I9TB 1OLLA 4OCXL 5JW3H 5LQBL 3N85L 2HKHL 5I1KH 3FOLA 1FCCA 4DN3L 3CSYB 3EDKA 5F96L 2F5BH 5FKPB 4ETYA 1T4KB 3GSUA 3FN0H 1KJ3L 3BP6A 2ZCKL 3BH9A 5F8RC 3D3VB 4OGYH 5EN2B 1RZKH 5HD8C 3V79C 1T03H 3H3PH 3WIHL 5E2VH 5MENE 2IQ9H 5ECJE 1B0GA 4ZDHB 1OAKL 3HFMH 1QLFB 2R0KL 1PSKL 4NPYA 4P5TC 35C8L 1KCRH 5TF1H 4L1DA 3S34L 3GO1H 3B8YA 4PJEB 2DLHA 2W0FB 5ADOH 1MHCA 2XOTA 5I1CL 1OAXL 3C60D 5T1KA 3E1F1 2EDTA 1CZ8L 4Y2OA 1XGTA 1X7QB 1JIBA 3W81A 2LVCA 1M7IA 1CR9L 2APTA 4XP1H 2LU7A 4OB5H 2Y25A 5BRZE 5IEHB 3QEQA 1HNFA 5HVGB 3EYUH 1QPPA 5CHNB 4CVZA 4LDEB 1YYML 5F3BB 1N2RB 3FQUB 3PQYE 4K55A 4PJHE 1J0KA 4D9LH 4JN2A 5JPMA 1Q9LA 1QSEE 3BYYA 4XX1E 1R3JA 3SQOH 5C07E 3BEVA 1IAII 1HZHL 2IEPA 1CS6A 4LDLB 4RQQA 2YD1A 4Y4HC 1CD1A 3C09C 5D1ZA 1YZZA 2FSEB 4YJZL 3D2UB 3MACH 1MCWW 1HH9A 2DOCA 5TPWH 4FXKB 4GXVH 4XMKH 1F58H 4FABH 4Y2DB 5CZXD 2GI7A 1PY9A 3GI9L 3K46A 2ERJB 8FABA 1OGAB 4Y1AB 5C0RL 4AEIH 3GMQB 3T1FB 4EXKA 2FEEL 4QRUA 3PP4L 5TE6H 1AXIB 1XT5A 5FO8B 4D8PA 1DR9A 2DIAA 3CVHA 3NH7L 5GPRA 1W0VB 3H9YA 2PN5A 1NFIA 3MROA 4DGIL 4E42B 3UTSB 5D6DA 2A6JA 1RI8A 1FZKB 2NY1B 5K9QG 2ZOLB 1X5AA 2O5ZL 1N5YH 1HN1A 5IQ9B 2MPAH 1XIWD 2EE2A 1QVOB 2VDPH 4F15C 3WS3A 4M93B 3PWLB 4Y7MA 3FQWA 4MD0B 3FQTB 4MAYD 4WHCA 5H94B 5CUSH 2NTSP 3V4VL 5IBUB 3MGTB 1JN6A 4PRBA 2K1MA 3F7YA 4PB9L 4JFFE 4XB8A 4YHPB 3VE0B 5AZEH 2BXZA 4NSKA 5FYLL 2DBLH 5I9QC 5JOFA 1I1RA 4DJMA 4K7PX 2EDXA 3KLSA 2OLDA 3JV5A 2UYLA 4FQ2H 1YEGH 3L7EA 2FWOB 3CLEL 3JUYA 5DD5L 3MV11 1R3KA 1NC2D 4U2YA 3HE6D 1NGPH 4KROC 5IEKA 4Z77B 4JFXB 4DFIA 4P4KB 4KJYA 5HHVH 1XCQB 5K59F 3CSPA 3BW9B 5KVFH 1A0QL 2BVYA 2DMBA 5KVGH 3D18A 1Q0YL 4CU6A 1Q9WB 4GG6F 3CCHA 5T5FL 4GS7C 1V5JA 2VLJA 1RVFL 2BNQD 3MOQA 4G9FD 5E24E 1OGTA 3QUXD 1RURH 3F58L 5E6IB 4YHZL 5D96C 3SKNA 1KUMA 5J56B 3QDGB 2BRRH 1UA6L 1HIMH 4LAJH 4YHNB 2VZOA 4TQEL 4HCRH 4Y5YC 4NQEE 1N6UA 5C2BH 1BD2E 5SWZB 4L4VA 1FPTH 5ETUB 2X1XR 1W72A 2P46B 1DQLL 1ZTXH 3QDJB 2YN5A 3X14B 1T3FB 3PIQB 1NL0L 2F5BL 1OF2B 2DLFH 1B6UA 3RL1B 4UDTA 3WNKA 4X83A 4N1EA 1IC4L 1PFCA 1DVFC 4W4OC 3MREB 3PE9A 4NNXB 1UWXK 2EKSA 1P4LB 3NFSH 1UG9A 2Q6WB 1CBVH 2H8PB 5E6YA 4JY5L 5JW4R 4NWTL 3RWDA 3LH2L 1BD2D 3TA3A 5C6WH 3FN9A 4OAWB 5I0DA 1FDLH 5I1HH 5T1KD 2BY3A 2AI0H 2HT3D 2OJEB 4KH2A 1YEHH 2ADJB 4X6CF 4YPJA 4HH8A 3NGBC 1KFAH 4FQHB 5D70H 4LSRH 3HB3C 3BRFA 2YA2A 3X3FH 3KPNA 1NMBH 3PL6C 4I2XE 4KQ3L 4Z7WE 5EUOA 3VMNA 4ETQA 2FIKA 3IJHA 4PRNA 3KPRE 1VPOL 3RVUC 1BFSA 4HC1A 1YMMD 2VR9A 5DMGD 4J6RL 1RSFA 1QSEB 2R0ZL 3CVHL 5JDSA 3QUYC 3F7VA 3TH2T 2Y36L 3HG1E 3O6LH 5EZJB 1M7DA 2AJUH 4YDVA 5F6IB 3RX7A 4O51B 1IQDB 4LSPH 1Y18B 1JRHH 1HILA 4M7JL 3TBYA 2JJVA 3QJFB 5C0GA 3C60A 3P77A 3TO4D 1ZLVK 4U6YB 4I18B 1CXEA 2MCPL 1R6VA 3TT3L 3STZB 2X1PA 1I85C 2H2PC 5BRZA 5C0AE 4J3XA 5DMJB 3EJYC 3Q48A 3QEQB 1SVCP 2QADC 1BLNA 3VH8G 5MHSD 5CEZD 4CVXA 4I3SL 4U1GB 5IGXL 4KRMB 1PX3A 1GSMA 4JVUA 1FJ1B 5GGVH 2G75A 4AH2B 2D4FA 2W9EL 5MENA 3BDXA 5GRVL 5KOVC 5BZDA 5E2JA 4JVWA 3U0PB 3Q5YA 4IS6B 2Q86B 3V9FA 4GKSA 2FYYB 4QTIH 5D6CB 4HFWB 5D5MB 3U7YH 1C1EH 1II4E 1ITCA 1U8QA 5D7KE 1BIIA 4RZCA 3CNKA 4ODHL 1BEYL 3MCKB 5FA3A 3EYFA 3QO0B 3B2VH 3TA3D 4YDIL 8FABB 4KHTL 4I5BB 2CXKA 2HVJA 5FM5M 3SKMB 5KZCB 1FG2B 1A1OA 4OI7A 2FBOJ 4G8EA 3X3FL 1MCKA 1MCPH 4YIQB 1WCQA 2HAZA 1JZ8A 3BP5A 4LKXA 2BHYA 3FMGH 5IKCB 1PEWA 5ALBH 1T22B 3TT1H 1CYGA 4MQXD 1R3LB 4FQLL 5IVNA 3BPOB 4XBPB 1CLOL 5EU6D 2PW2B 4MXQA 5DMYA 3CH8A 5EIIB 1FZJA 1XGUA 4KZEL 3FQWB 3SJVD 5DI8A 5IJVB 3QIWB 1Q1JH 5CEZH 5E08H 1L0QA 1H0DA 4FQXC 4X99B 1U9KA 3TBSA 4NIKB 2ICWA 1JN6B 3LS5H 1CL7H 5ICXA 4CMMA 1UCTA 3DX6A 5GJSL 4AK1A 2MCPH 1DQJB 2H3NB 4MS8D 4QLRA 1UFUA 3TIDA 3ZTJH 3LMJL 5CIPB 4M7KL 1YEKL 1E4XI 1X5YA 3PNWA 3DHJA 3MNWA 3DX7A 2ZUVA 2YXFA 1VFOA 4NKIH 4YR6A 1GGBL 3QQ3A 1P4IH 4KUCF 1TTFA 5DJAA 4Y19A 1CG9B 2CLVB 3O2DH 3S35L 1F2XK 3BO8B 1MFDL 4OLYH 1R3KB 4HZAA 2EC9T 3RBGA 4DKAA 1NUFA 3ZYZA 4F9LC 1IAIM 1AR1D 4M02A 4ZOBA 4JQXA 1P6FA 3WKML 1D6VH 1MCHA 2FEDC 1X5HA 1A7RL 3BDYL 4P2QD 5ISZE 4MZ2A 4LOUD 5IW1B 3HR5A 2ZSWA 3QUXA 1Q38A 4XVUC 4MCZA 4GRMA 1FAIL 3DIFB 3BEWB 4XNYH 1W72H 5F9JB 1NKOA 1S7VA 3QEGH 4Y5XA 3W82A 2J6EL 5SWZA 3QDMA 3O4LB 4JFPA 5FYKU 3NAAL 3PWNB 4R97C 2NY3B 5C6PB 4ELKB 3QNYB 1S9WB 2JJSA 1OF2A 5DK0B 4LEOB 3GMMA 2X4TA 4RISH 4WW2C 4RDQG 3OF6A 1NC4A 4F33A 4XP4L 2AJSL 4XNXL 1INDL 3RGHA 4Q0XL 1OQOA 1TJHL 1ITBB 1RK1B 3GB7B 4PRPD 4HMEA 3W0WE 1G6VK 4N0UE 1NEZA 4DGVH 5IG7B 4L3CA 4LHJB 4QXTA 3ARGA 4J7RA 3S35X 1XF2A 1H3PH 1UGNA 1KLGB 5IBTH 3MRRA 3W9EA 2CDGB 1A6PA 2CRZA 2NY4D 4YX2L 3X11A 3C6LA 4EUPB 4PB0L 4ZUSB 4NO0B 4NBZB 1I7ZB 4LSQL 1MAKA 2EDKA 4PY7B 4GSDL 4Z7VF 2IPTH 4FFVC 4Q9QH 4NC0B 1U93A 4MJ6B 4FQIH 4OGAC 3UJTH 5FDWB 3STLB 2B5IC 5MEOA 3EO9L 4NN7C 1S7UA 1PAMA 5BOZG 2GT9B 43C9A 3M07A 1V7ML 3LKSA 1KN4L 1T1XA 2GY7B 1C7TA 3MRPB 2D7OA 5BVJB 1LD9B 1WWAX 5JHDE 4CMHB 2B39A 1JK8A 3DOSA 4XTRC 3TBYB 4HXAL 4ZPTA 3LRHA 3TO4A 4JREC 4X6FB 2H32A 3L6FB 1A6WL 1MF2H 4PJ5D 4O2EA 4WU7B 1IC5L 5BRZB 1BFVL 2C3VA 5I76A 3HZKA 1I1YB 5B4MC 3I6GB 4XNZB 1MHHB 4ISVB 3MV9A 3T65A 1FORL 3C5SB 1T5XA 4ODUA 4S2SA 4HX1A 4I77H 4Q9BA 1OM3H 3OGCB 1INEH 3FO1B 4PYHA 5D7SL 2VXVH 5H2BA 3HNTL 2ERJC 2V2XA 1AXTH 4PS4L 2E8ZA 1Z9MA 1G9EA 1UJ3A 3GNMH 2B2XL 4HKJA 3C9NB 3C8DA 3RI5F 2Q86A 4FRWA 3C8KA 3DVFA 5D6CA 3O4OC 4HG4K 4KV5E 1OSZB 5KTEL 5CD3A 5CLWA 1I3VA 4YHOL 4QNPF 4Q2ZB 5FA3B 5DT1L 2OL3A 1MJJB 1EEQA 1GGYA 4R0LC 1K6QH 2BVEA 3KPRB 3QIUB 5GSRA 3DWTA 4NO5A 5F3HB 2BXYA 1DZBA 1JYNA 1MI5D 4PGDB 4POZD 3ARBA 4HWZB 5INDA 2AJ3B 3T4YA 5DD0H 1GOHA 5HYSG 3T0DA 3QFDA 2J8UB 1HCVA 3QUKA 1J8HD 3IDMA 3KDMB 5D7IA 1YEFH 1UB6B 3I3EA 4BZ1L 4Y89A 4JY4B 4IDJH 5F9WC 4AL8L 4D9RD 4GBXA 4JDZB 4KRPC 3KPSE 2X4OA 4P57B 1NLDL 4EDWH 1T20A 5FEBA 1LE9B 2JJUA 3OF6D 3B83A 1D6VL 5D2LE 2ITDA 4GW4B 5D2NA 5BV7L 5HYJD 1ZWIB 1PGRB 2R29L 3G04B 4CMMB 3ULUE 1I9EA 4KROB 2V9QA 5IVOA 5IW6B 1S9VB 2VZUA 1ZA6B 5DMIL 3VXRD 2NW2A 2DIJA 1NC2A 1PYWA 2IH3B 4AYFA 1T6VN 1DN2A 3PNWB 2IF7A 4JLRA 3ECBA 4JM2F 1GZPA 4BQBA 5IR1B 3GSQA 1RK0B 1GIGL 2IANE 4O00A 3ARSA 5GHWH 1FL5A 4PJFB 4DCQA 1JFQL 2IH1A 1BHGA 3MRIA 4JFHD 3ZDZF 1UACH 3QHFH 3OKKB 3JZ7A 3CU1A 1UWEH 5K93A 4X7TB 4OBSA 5D7LB 4RAUA 3QIBA 4PJGE 4NUGL 5GGTL 1LEGA 4JVPA 2P43B 1FDLL 1CDCA 2ZCLL 4YGVA 2F54D 2XA8L 3CH1B 2X4SA 1OP9A 3DIFA 1ERNA 3KYNA 5IV2B 2YBRB 1GZQB 4CW1A 4ZXBD 5F9JA 3ULUL 1CGYA 1K6QL 2X4NB 4NCC2 3NN8B 4YFLI 4XCCL 3B9KA 4X4ZA 4Y5XB 1WVZA 4S10A 3S36X 4PJ9D 2P5EB 3L5WA 4G5ZH 2BNRA 4LLWA 1LEKA 4BSWA 3L95B 3MV01 5DK0A 3QRFM 2CJUH 3MUGB 3WLBB 3IDJB 5F44A 3MYJB 5B3JE 2B0SL 4P23D 2HYMA 5KBNC 2OYPA 5CJ5A 5CHNA 4DZ8B 3LPWA 3HFML 2R0KH 3PL6B 5KTEH 2CUMA 4R2GD 3MLXH 5IJKA 5IFJA 1P9MC 4U1IB 4DKEL 5D7JB 4XPFH 3RDTC 2R69H 3WIHA 5BS0A 4OBRA 4JRWA 5C09E 2YK1H 2CIIA 5IG7A 4OZFH 1DQQA 2JIXD 4JFYA 3OR6B 4JO1H 4TVSa 4G43B 5DDHB 4CDHA 3HC0B 1HOCA 4IOIA 4MLIA 3VI4E 1URLA 5I66B 4LASL 4KK8C 4HBQA 3TGXA 5CEXA 5F6IC 3HR6A 2BNUA 4U1HB 1DL7H 3RAJL 2BMKA 4KKBC 1IKFL 4K7PH 4PD4K 1EV2E 4APQB 4RAVB 1AJ7L 1QRKA 2VLKD 4NT6A 4IDJL 3O6ML 4Q6YA 2ESVA 3SCMA 3T1FA 2DI7A 4KJWD 4OQ1A 4HPOH 3QEHA 1U3HD 1U8IA 4D8PB 4FQCL 1OP3H 2X4PB 2G2RB 1RIHL 3VD5A 4ZPTB 3TNMA 4AM0A 4WUKH 3JTTB 5E6ZA 1ZHBA 1WFUA 2A6KB 2GFBB 3GHEL 4OZ4A 3TCXA 3WFBH 3KJ6H 3MRLB 3RVXC 4GMSH 1KNOA 3PDOA 4XCCH 1AGBA 5DFVD 3OV6A 4MJIA 4DGIH 3VXRA 3WKNA 4L8DA 4HSQA 1QFUH 5KW9H 2V6HA 1UH3A 2H2PD 1GH7A 4C83A 2NTFB 4GAJL 3KPLB 1NSNL 1IBGH 4HCRA 3X12A 4G8FB 1U8MA 3VI3E 2XWBB 1I1FA 3SJVA 1NBYA 1FE8L 3MCG1 4WW1A 3V4VH 1SM3L 4JZOB 1VGEL 2Q7YB 3HUJA 3WXWH 4M7ZB 5IROC 5DYOA 2L0DA 4AG4L 4JKLA 4OZGE 3DUHA 4NNPL 2BSSA 1NL0H 4H25B 5DJ6A 1KIQB 3UTSE 4HWZA 2O5XL 3MLZH 2COQA 2F53B 4NQSB 4FQXB 3QFDB 3TLRA 3IETA 4RGOL 3VFVB 5K33A 5C0JA 2O5ZH 1HSBA 4QXUL 4UQ2A 1HK6A 3TWCH 2E7LC 5HHNA 4YHNA 5I2IB 1AQKH 5D7IE 4NZTH 5A2IH 3CFDB 5L9DH 3WFHB 4PJBE 1R5WA 1F3RB 1WEJH 1WISA 1Z9LA 2RGSA 1CFTB 3ARFB 4U6TA 2P5WA 3MNZB 1LEIB 2E7BA 4XVJL 1DUYB 3CPLB 4XWGH 4JM2C 3DXAA 1A7PL 5TFSH 2EKSB 5CP7B 1BVKA 4RRPG 5ALCH 2H8PA 1SMOA 3T2NL 1NC2B 1KJVB 4ZTOL 3S3JA 3EO9H 2R0LH 2JIXA 3K8MA 4PJCB 5H37G 4YXLL 1JHKL 5A40E 5F89A 1D5XA 2HP4A 2H9GB 4U0RB 3U9UB 2ADIB 4NQDE 5F1SA 4EN3D 2GJZB 1IGIL 4LF3B 4D0CB 3WE6A 4M6NH 5LJYH 2W38A 1INDH 3BOVA 4P3CL 3ZO0A 3VXRE 3BYTA 3OB0K 1RZFH 3IJHB 2ZWLT 4PRNB 4PRHD 3V5HB 2GUOB 2EH8H 5SWZD 4XPFL 3V8CA 3CH1A 3CJJA 2I27N 4LQFH 4HG4J 4O5LH 5IV2A 5I1JH 1BBDH 5C8JA 1PZ5B 4AG4H 2CIKA 1OTUC 1M7DB 4NWUH 3HZMB 2IFGA 3GIVA 4NQED 5DVOA 4O51A 1AO7A 4PP8C 3WNMA 1J10A 3C60B 3P77B 5JA9A 1X5IA 4OTXH 4U6YA 2YXMA 2GQHA 3IB4A 1IKFH 3TBWB 1Q0XL 2XKUA 4QRSA 4S11A 2WQ8A 3P11L 5F9DC 2C4FU 1BEYH 2VZVA 3ZKSD 3CZFB 3K1KC 3W39B 5HYIA 3QFJB 3BMWA 2AAVA 3HE7C 5EOTA 3BKYH 1F3JB 2YKLL 4Q6IB 3MGOB 2NY0C 4LVNB 1NAMB 2AV7A 3FT2B 1LK3H 4OCXH 3HI6L 3F12B 1HE7A 4LKCA 4JFYB 5F7EH 2FYYA 3DGCR 1BP3B 3FMGL 5IB5A 2R15A 3LQZA 1YN6B 3MV8E 4HS8L 2A6DA 1DLFL 3D39A 5T1LA 5FYKH 2FO1A 4L8SB 1QYGH 3PWJB 4OF0A 4PRDB 5E8PB 3WO3B 1SQ2N 3V6ZA 1IGYB 3C2AL 4PTUB 1NDMA 2X1OA 4UUJA 2NLJB 4XP1L 3O3BA 3IDXH 1T7WA 4X6DB 4ZAKB 5C9JB 1KPVB 2XQYG 1KIPA 3TZVD 2HMIC 4TUOB 2B4CH 1MLBA 4YUEH 2A6KA 1DFBL 1QBML 3O81A 4QRRA 4BZ2H 5EIIA 2P5WD 1FNSL 3T3ME 1KJ2A 2WBJA 2VDRH 1CFSA 3BWAA 5AZ2L 4H88H 4LP4A 4YNYA 2X89D 2Z92A 4YAQA 1K8DA 5DRWA 1G7QA 2VDOH 3CFCL 3RY4A 3LKPB 4GH7B 4LLYA 3MLVH 1PJ9A 3V4UH 4LFHG 3WHXB 2DICA 15C8L 1HHKB 3QIUC 4WO4A 5FECB 4XC1L 5E2VL 4UIMB 3X12B 5T33H 4PIRF 2W60A 4C56D 4HIJB 2ZSVA 1L7IL 2C7UA 1EO7A 1MOEA 1TJIL 1CFNA 3VI3F 1MI5E 1NLDH 1NBYB 1YA5A 3V5KA 3U46A 4RBPH 5HYJA 5EPMB 1MHEB 5IBLD 5JMRA 1SEBA 3MA7A 3O6KH 3VFWA 2NY5H 5F7KC 5C0NC 3IVKA 1KG0A 3OGOE 4P2OD 3VXUE 4QYOA 4GUPB 4AIZB 5DR5L 3H42L 5I19H 4IRSB 1SYSB 4FQ1L 4GLRH 4ZUWA 5T3XE 1EA9C 3VG0L 1D5BB 2D9QB 4LMQI 2P5EE 4TULL 1D9KC 1AO7D 4MA7H 4PR5A 1OLZA 5HHOE 1IAIH 1QYGL 3P73A 1ZA3B 4EIZC 4ZFOL 1TVBB 4ALAH 1T1YB 5FKAA 1XR8A 1XGQB 4KI5F 2NZIA 2QQKL 4HUWB 4LPWA 3RA7H 3D6GA 1NFDF 5DO2C 2YKLH 3EO1A 4D9QE 2ZUUA 1H5BC 1CFTA 4KTEL 2C1OA 3DARA 3UZEA 2O5YH 1JGLL 2F8VA 3LQAL 3PJSA 2RCSL 1LNUB 5EC1B 2EDYA 4GJTB 3UMTA 4P2QE 1JPFB 2VLJE 5DZLA 1QNZL 1DCLA 1CICB 1A6TA 1RK1A 1BFOB 3CK0H 3DHMA 4LLVB 4LSUL 1T66C 3MUY1 2ZUWA 4LQ1A 4E41A 3FQRA 3GBNL 1IM3A 5JW4N 3QUMB 1E28B 1RMFL 2VIRB 3MLWH 4PGCB 4IRJD 1KULA 3V6OE 4JKKA 3G5VB 2V2WB 4XCYB 4K3GA 3BI9X 3DPBA 4HPYL 4LF3A 2R9HD 3BZEB 3LQMA 4BQ8A 5AYQA 1CDIA 4NKOA 1BQHA 1MJ7H 3IJSB 1H8OA 3UYPA 2VDKL 1I8IB 4LNRB 2APBA 5FM4A 5IIEA 1S7UB 1ULVA 3RJDA 1MFCL 4HF5L 2XY2A 4S1DC 2RB8A 4MDIB 4P2RD 3AUVA 1FP5A 1T1XB 5E70A 1JHLL 4WUUA 2ADFL 3T0EA 1KENL 3BD3A 5JR1H 4MVBD 4DVRH 2DLFL 1KGCE 4ORZC 1BJMA 4KVNH 5KOMC 3TO4B 1QHOA 1YMHB 4MX7A 1HI6A 4DOHB 4J3TA 3FTGA 2DD8H 3QIBD 5E0QA 5E2TH 3OXRB 1H3VA 1KPRA 1U41A 3BH8A 4YHKL 1FVEA 3IDNA 2WQRA 5ID1A 1KN4H 5DVLA 5D1ZC 1TCRA 4ZQKB 4F7EB 1QSVA 4JPVL 2IWGA 1BBJB 5LAXB 2ICWI 3TBTB 3S97C 1JNLL 5A2LH 2Z8RA 3IU3B 4TVPL 2VABA 4ZS7H 3HI1A 1F3DH 3SOBH 4OZHE 3VXOB 3EOAB 2NX5D 5TF0A 5I1KL 4YX2H 3MNVB 4KU1A 1UCBL 3RWHA 5GZOD 4BH7A 1VESA 1NCDL 2N7AA 3U4EA 4K3JL 3GHEH 4XZUA 2V5YA 5IB5B 2X7LA 1KB9K 1T7ZA 5JLZA 3S5LB 4DK3A 1G1YA 3QUMH 5F9OL 3VG0H 1AP2A 5CD3B 1UM4L 4PJGB 2H26B 4H88L 1YUHA 1RMFH 4NZTL 4HKZA 1KCRL 2AKRA 3OB8A 1P7QB 5E8PA 3MMEA 1CFVL 5TE4L 3SKUD 3KR3H 4XCNB 4HPYH 1INQA 3GSWB 3MRBA 1KCKA 3TPKA 4UT6L 3LEVH 4JO2H 3T2OA 1P7KA 5HXMA 1B2WH 2UZIL 4Y4HD 2J8UA 5ACZB 1A7QH 2FHFA 1CICD 2YD3A 4UOW1 4X6DA 3HRZB 3P4OA 4Q7DA 4KK9D 2Y07L 1KPVA 3CX5K 5F6HI 4H1LA 3RNQB 5EUOF 4FTVB 4XMLL 1JPSL 1UEMA 2Z9TA 4F7MB 1NCAL 2X5PA 3ARDB 1OAZL 4POZC 3CSGA 4NNPH 3GBNH 3QQ9D 4K8RD 5F96H 2PF6A 3VXSE 5DR5H 2VDML 4HKXB 3DJ9A 4M1GH 1R3IH 5GISL 4G6KL 4DW2L 1KB5A 4R7NB 1I1AD 3N1FC 1DJSA 4TTDC 4D9QD 4JRXE 5CKAA 1QSFA 1NMAH 3RWEA 4E41E 5FF6A 3MACL 1FH5H 4B7LA 1TZIB 5I1DB 3GJFA 4YK4C 2IQ9L 3SDDC 4R96A 5CCKH 4HS6A 4X5WB 4L3ED 1YNLH 2EIZA 4JG1L 4GRWF 4ZUUB 1M05A 4PRID 3ZKXB 5D2LA 2QQKH 1JRHI 2EYTA 2WUCH 3M1BB 4M6MH 1FBIL 1J1PH 4O02H 1FL5B 4QY8B 3GJFK 4NO3A 4X0KB 3IJYA 3CFJA 4OQTH 2OQJA 4KTEH 4M48L 4NQTA 1H3WM 4URTB 2NY1D 5J57B 4Q9RH 4OLWL 4ACPA 3P9MA 4C4KO 2VLRA 4BKLB 2VLLB 3LN5B 1F6LL 2QJDA 2RFXB 4I0PD 1GHFL 4Z0BL 5HHXH 4L3AA 5BV7B 3QXVA 5C08E 1AGEA 1TVDA 4JM2D 7CGTA 3O3EB 4YHKH 1DVFA 1SY6H 4W4OA 3X13B 4ZS6D 5DQ9B 3BHBB 3NN8A 3B9KB 3AREB 4NZUH 3TA3C 3TVMB 1TNNA 1TETL 5GGUA 2Z8VC 4XXCA 5GS0D 4KQ4H 1EMTL 1SBSH 5IK3A 5J9PB 4BSWB 1LK3L 4PY8J 1P5VA 3D5OF 5GJSH 4LGSB 1T0MB 5CKGA 4OIAA 1QACA 5HJ3B 3WLBA 2IADA 5ITBL 5IMOA 5BXFA 3OG4B 3FOMA 2EIBA 3I3DA 1CU4H 5EZOL 3PL6A 3LKNB 4XCEA 1EEZB 2OI9B 1NCBL 3PGCB 1K8IB 4LLVA 3VJ6A 2WINB 5E95B 5IHBA 2HT4D 3G5XB 4IHOB 1HQRB 4G43A 5DDHA 4J4PC 3QUYA 4J3UA 1G7PB 4F8QA 5CIPH 3M8OH 1HOCB 4IOIB 1VHPA 4WWKB 3P0GB 2VSDA 1PQZB 3BESR 3HUJF 3GSNH 4LRNL 1VDGA 1RURL 3EOBB 4OCMC 4FMKA 4WI8A 3C60C 5CD5D 1RJLB 2NY7H 1U8NA 4M43L 5SX4H 2Z35A 3NCJH 4B50A 3BVNA 1QBAA 2P5ED 4HULB 4JRYD 1WUNT 5T3ZE 2QR0A 1ES0B 3FL7A 3BKCL 1DQLH 3S3SA 5CBEB 4UV7H 2J5LC 2VN7A 1YMMA 1UCBH 2ED7A 5EA0H 1A6ZA 3MA9H 1JMXA 1S7SB 3QI9C 4M8VA 3P9LB 4U1KB 2VDOL 2X4PA 4F7PA 4P23B 3GJEB 2Z8SA 2F9BT 4BFGA 1AFVL 2HRLA 2YRPA 4AM0B 1A7BA 1CGVA 1PKQA 4ZOEA 5DRZB 2FEDD 2NR6D 1PG7X 5FGRA 1MFEL 5ID1B 3BFOA 3RZCB 3MRLA 3GMOB 2F74B 2VR4A 4V1DD 1BBJA 3QR2A 3V0VA 2B1HL 4MXVE 5EBLA 5BCAA 4K71B 1AGBB 4IJ3C 3O2WL 1XGYH 3QXWA 2UUDH 3DVNA 3G6AB 4KVCH 2GK2A 2X1QA 5DJCB 1GC1H 2CMRL 3GMRB 4P46A 5LWYH 5DTFB 5J6GB 5FYLD 6FABH 2CLRA 1CGXA 3T08A 4RWYH 3HUJE 5F7FA 1LMKA 1EEYB 1I1FB 3GK8L 3WFEH 4LCWB 1P2CA 4AMKH 5IM7B 5F71A 4KAQH 2EDDA 2BVOB 4JN1H 1LE5B 1WC7B 5TE7L 4NQVA 2P24A 1KEGH 2EC9U 4N0UB 4EDXB 4HGKC 4P5KB 3S96A 5GS1A 1XEDA 2GSIA 3UTSD 2H32H 4JJ5A 4HEME 3P4MA 4M5ZL 1FVCA 4HIXL 3LZFL 2DQEL 3THMH 4X4YB 2UUDK 3CD4A 4NRXA 1J86A 2UWEE 3CSYA 3ZE2F 2DMKA 1R5WB 4I0KA 2EH7H 4OZIB 3B4NA 4QOKB 3DETC 2V5SA 1HINH 1E0OB 1RV6X 3MNZA 1LEIA 4RGOH 3PL6D 1NUGA 4FN0A 4WNQB 5DUMH 5E1AB 1JZ3A 5J11B 3G08A 4JQXC 5L7XL 1GPOH 3A6BL 1T21B 2C26A 1GCFA 1CFQB 4LCUA 4K7PY 5D1XA 1MNUH 1I3GL 1FE8H 3FAWA 1V05A 1EXUA 3RUGB 1E6OL 4U3XA 5I75C 2IALA 2FJFB 5JQHC 1EX0A 1N6VA 4KV5F 1SEQL 4S0TD 2I24N 2HTLD 3MRFB 1T1ZA 2OQJB 1K4CB 3OKNA 2C4XA 4UT9L 2OTUB 1BFVH 3VFTA 5JZ7D 4OLUH 4P9MH 2OJZL 2VSCA 3VRLF 1A6VH 1CTNA 3VFSA 4HS3A 1J05A 3NABH 3EJYD 3GK8H 3EYSH 5F7MC 1MRDH 3V5HA 2GUOA 1Q9LB 4OZIF 3EDJA 3JWOL 4WW2A 1J5OH 4U6HA 3UX9B 3QG7L 2QSVA 5C0DB 5DXWA 2FD6H 4MQ7A 1P1ZB 3AC0A 4HUMB 4H1LG 4MLSA 4I9WE 4PJBB 3HS0A 5KG9A 1HHJB 3PQYD 3HZMA 4PUBH 1RUQL 1EDQA 1ZLUK 1KC5L 4V3EB 1ED3B 3MRJB 3SEPA 2AQ2A 2CKBH 2IADB 4JFDA 4RCAA 4RWYL 3QQNA 3QNXB 2FR4A 1JPST 1FFPB 1N59B 4Y5VB 1V3MA 1XF3A 2UY6A 2CKNA 3BIBX 3WHE0 5JORB 4XI5C 2W0FA 2MWCA 3EDFA 1CDJA 4N0FA 3KPSD 4KAQL 2RJMA 4UNTA 2DYPD 1XGTB 1IEBB 4ZFGH 1I9IL 1KJ3H 5DJDB 4CL7A 3RVVD 1HQRA 1T7VA 2PXYC 3GSVA 5SWQB 5IVXF 2R4SL 3FONA 3P4LA 1BOGA 1MQKL 1JZ6A 3TO4C 2V17H 3ESVF 2E7HA 2BC4B 5DJYA 4OLEA 3UDWC 3BKJL 1N7MH 1RIUH 2HG5B 4KVCL 1L9MA 4RQQB 2WMPA 1DQTA 1N8ZA 4OD3L 3VDBA 4I48B 4M7KH 4HT1H 3CFCH 5DFVC 5FDYA 1EGJL 4G6AD 5CP3H 1QKZH 4YFEA 3HI5H 4DZBB 1UJ3C 2W91A 4WENB 4UBDC 1IGFL 3LKQA 3O6FD 3REVA 3ZHKA 1MH5A 3HMXA 3T0XA 4UU9B 1XCQA 3HAEH 1NDGB 4DQOL 1S3KL 1X3DA 2I5YH 1VKXB 4CJ0A 1MPAL 3WFCH 2I07B 2DQHH 1G7QB 4JO1L 3BT2H 4JB9L 5E6IA 4HMCA 3ULUF 3GMRA 2VN4A 4R0LA 5BS0E 3VMOA 4OLZH 8CGTA 2BHZA 1CE1H 2BOBB 2EEAA 4U05A 5C09B 3RL2B 1F8TH 3OAZH 4ODWB 3CMGA 3BZ4B 5TJWK 1EEYA 3K2MC 3GGWB 1TQCB 1RJYB 4U1JA 4LCWA 5FCUH 4ZAKD 4BFBD 3ZKNC 3KYOA 4XPGH 2HH0H 2BSTA 1SEBB 3BPLB 5IVXA 3Q6FB 3MLSH 3PHQA 2E6JA 1OL0A 3QWRA 3JV6B 4QWWC 2JB5L 3NFSL 3DBXB 1CBVL 4EDXA 2XZCH 4M8QA 1J1OL 4PJGF 1J9CT 3PGDA 1N64L 4MA8H 1HSAA 1UA6H 5TH2A 3P40A 5F88B 4J3OC 1EBPA 1CDGA 5A1AA 2HFEA 4G6JL 4L4VE 4R4FL 1MCDA 4EBQL 1QLFA 4NPYB 5HGBA 3S4SG 3K8LA 2BY2A 5EOQH 4OCWL 1TQBC 2DQUL 4I9WD 1WTLA 4U1MB 2BNQA 5CEYA 3TNNA 5I74B 3ZKXC 5F8QC 2NMSA 1B4JH 4TSAH 1AXTL 1ZAGA 5FK9B 1T89C 3PP3K 3KPMB 4QO1A 4WI9A 3QDGA 4OM1L 2EDFA 3D9AL 3MJ7B 3CFKA 3O3DA 4WNQA 2CGRL 5E1AA 1A9EB 3MCLH 3SGKC 3N0PB 4PRIE 2NY2C 5C2UB 3NZHL 3AFLA 5J1TC 4X98A 4ZO8A 1HYSD 2CLZB 2CR3A 1IM9D 4H5SB 4JRXA 2IBZY 1EXUB 4RBPK 4M7LL 4I2XA 3SGEI