4NQDA

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
260
Chain Sequence
b'RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIEIDYGDILPSGDGTYQAWASIELYSCHVEHSGVHMVLQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
molecule tags Immune system
source organism Homo sapiens
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
total genus 66
structure length 260
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqdA01
1NGZA 5F1KC 3B83A 5SWZD 4Y4FA 3ES6B 2XY1A 5ALCH 2VXVL 3VCLB 5K9OB 4M7LH 1CIUA 2VO5A 1IQDB 4I4WA 1FVCB 5F1NB 1KCVH 1VKXB 6FABH 4PV9A 3VXSE 3FN0H 2GT9A 5F7NC 4TOYH 1CDCA 4JGMA 3UCRA 2HFFB 4G8GB 1FG9C 5J89A 2BRRH 4Z0XB 3QJHB 4JFQA 2X4SB 4MXWH 3LEYH 1OAYL 1UZ6F 4JFXB 1F4HA 4GW1A 1LO0H 3W9EB 5L9DH 3N1PC 5DI8A 1V7NH 5HYIA 1MREH 3ESVF 5ETUB 4XP4L 2ID5A 3DYPA 2IFFL 4V3DB 1F3DJ 3G5ZA 4PJ8D 1GC1H 2FSEA 1DEEA 2XN9A 3V52L 1U58B 2GSGB 4WFFE 2BOCA 1UZ8B 4XNYH 4X6DF 4I3RH 5BCAA 4GOSA 1NCAL 4N8VB 3CFEA 4DZ8A 1HINL 1YC7A 3MRKA 3L3GA 4U6TA 4FABH 2VL4A 1JHKH 2ORBH 4YAQB 4XNMA 5CILL 4S0UC 1MRFH 1MHPL 2HMIC 4ZOAA 4FFWD 3OXRB 4P46B 2F74A 3NZHL 1IEAB 4HC1H 1QEWB 4LPYA 4PP1D 2EZ0C 3QA3B 2WUBL 4QY8A 5CJBA 1I8KB 2XA3A 2A77L 4J23A 2R1XB 1T1WB 3QFJE 3SCMA 4MNGE 2VKXA 3DSFL 4O51A 4Z0BH 1DBMH 2XN9E 3L3JA 5C6WH 1NSNH 2V7NA 5HI4C 3SE8H 1VFMA 5T33H 5IBLD 4WUUD 4HDIB 1TTUA 5TH2B 5EO9A 2H32H 5DQ9B 4P23A 2IPUG 2X7LA 3FO1A 2X4NB 2GK2A 3G08B 1PZUB 3LH2H 5I66A 3KYAA 4YPJA 2EDHA 1J5OL 2R0ZL 4AM0B 4E41D 2EXYD 1S7UB 2DYPA 3OGCB 3D2UD 4JRXA 1D3CA 4W6WB 5CILH 5TF1L 1NMBL 4PJCF 5F7YC 3GBLA 3PWPD 4HPOH 2GJ6E 5DJ2B 4HHAB 4Q9RH 5HY9B 4TNVK 4G6FD 3L3OA 5MENB 3Q6FB 1D6EA 2PNDA 3GBML 5GSVB 3VXME 3VG0L 3BP6A 2ARJA 5C6PB 5IMMB 3VXUD 4YUEH 3QNZA 1F4WH 1MJ7H 4V3EB 3ISWA 4HWBL 4PGCB 4ZO7A 4P2OB 1UH2A 3QDAA 4WI4A 1QBBA 3GMQA 3CSPA 1W72A 2FWOB 4OCSL 1AKJD 4KY1L 2ZUSA 3GMPB 4NQSA 1BQUA 4JFEA 4D9RD 1HIML 5TQ0H 1CK0L 2IANB 1JYXA 1R3KA 3RWHA 4TSBL 5LXGL 2P5WB 3T8XB 4XNQA 3DRTA 3IS0X 3RIFK 5IB1B 4L4TB 2AEQL 1EK3A 1T1XA 1UM4H 4P99A 1FL3B 5FB8A 5C9KA 1ZV5A 5F70A 4OAWA 1JRHI 5IBLC 1AI1L 4OGYH 5DQJB 5F9JA 3PL6C 1YN6A 3QI9B 5DD5H 3WJJA 1S7VB 3IS1X 3L3IB 3TO4B 3QXDB 1CGTA 5IMKA 2HH0H 3SDXF 2KQNA 4JG0L 4BKLB 2BSED 3MCG1 3K46A 4JZJB 2V5YA 3AMLA 5EWIH 5DEZA 3STZA 2BVOB 1G1YA 4XPTH 2P7TA 4KHTL 2Q8AL 1VHPA 1NCWH 3PL6A 1JZ8A 4GQPH 2XACC 4MD4B 4LLUB 4TSBH 4XHQA 3OKOB 3PHOA 3R8QA 2Z8WC 2D03L 4FQXB 4JJ5B 2N4IA 1P5VA 1JE6A 3ULUF 4HUXA 1N4XL 2BMKB 1SHMA 3NZHH 1T22A 5BXFB 5DMKA 4QTIH 1URLA 4CL7A 5TDNB 2DBLL 3BW9B 4CUCA 2ORBL 3B9EA 3T0ED 2FEDC 3BUTA 5EIIB 6FABL 1MWAB 5GGTA 2Y36L 4OD2A 5BS0E 4ZFGH 5JUEH 1I7UA 5FXCH 1VGKA 4YQXH 4K94H 1QD0A 5DD0L 5ID1B 3EFFA 5ISZA 4K7FB 4PYHA 1TIUA 2Y07H 2DQCH 2HTLD 5DD1H 2J7LA 5CP3H 3U9UA 1MI5B 1F3RB 3S3PA 1G7IA 1YYML 4DWHA 2DM4A 1NMBH 4XP4H 3TESA 3FOMB 4N8VA 2YN3A 2F54B 2HMID 4KJWC 3UTOA 3JWDC 3HRZB 4OGAD 1HYRC 1DQLH 1JWSA 3MACL 5FO9B 1X5ZA 1W72L 2BZDA 3SDXA 3DOSA 4MXWL 2YRZA 5F1NA 3D3VE 4WUUB 1UA6L 5JQ6L 4M6ML 3T2QA 1GZPB 1MJJB 5JW5B 1P2CB 3K1DA 1WZ1H 2NY4C 1AGFB 3H9YA 1JCKA 5T1KD 1JGUH 4KGLA 4QY8B 4NJ9H 5D5MF 1RVFL 3QHTC 3W9EA 4P2QA 1ZHNB 3AXLB 5T3XD 5JXAL 1ROWA 2BVQA 4AY0A 3PWVB 1LK2A 1HOCB 3SJVD 4PD4J 2D7OA 2A6KB 5TDPA 4WW1B 4PRHD 2YPLB 1NUNB 4K94L 4IRSA 4XP5L 3HNTL 4PRNA 4NJAH 4GAYB 4WY7L 4NUJA 1EDQA 3U4BL 4HIEB 1XR9A 4HF5L 1JFMA 4FQCL 3VH8B 1UVQB 4FABL 2CKBH 4LQFL 5JTWA 1TMCA 1PJ9A 4OZFB 3QUZB 4JFYA 1N2RB 3TPUA 4AM0A 4XAKE 1I1AD 1XGQB 1H3VA 1HSAA 3A6CH 3O3DA 5I74C 4M7KH 4B41A 4PV8B 2R4RL 2ICES 3H7BB 4X7SL 3UBXI 5CGMA 5D71L 4JANA 1GJIA 2D7TL 3QRGL 2ADFL 1JTOA 3EZ8A 3MLWH 4KVNL 5J1AA 2IFGA 5F8RC 3H9ZA 3F7VB 1MREL 2ARJB 1J0KA 1QR4A 4GW4B 4R4FL 4EQ3A 2VDPH 4QRRA 2P5WD 4PJ7B 2BCKA 4EEEA 3CFJB 5FGCB 5GISH 3DX9A 3L3JB 5HDBF 1HILB 5DJXA 3TNNA 4DGVL 4X5WA 2XWBB 3ZDYF 1KCVL 5AAMA 4ODVH 4BUGA 5IT2H 4KJPD 3L9RB 1KLGB 2E8ZA 4NQSB 5TE6H 3VFMB 4LLAA 4QRTA 2ZZUT 5FM8A 1DJSA 2XWJA 2Z0BA 3G6JF 4XP9H 3CK0L 1Q9KA 5HGDB 3MREA 4PLOB 1AKJA 4XCNA 5BZWA 3KPSA 4JZNA 1AXIB 4EI5C 4NKMB 3I6GB 4N68A 2VABA 3MRBB 2AEPH 4ODVL 1FG2A 1Z5LB 4NPYB 4YXLH 5MHSE 3BDYH 4MA8H 4R7NA 4TPRH 2NY7L 3RAJL 3I3DA 3MV8D 1XIWA 1FAIH 1D5IH 2E6JA 4MD5A 5KSAC 1TQBC 2PR4H 3QI9A 4R4FH 2YKLH 4N0RA 4N1EA 4XBEL 2E9BA 4R96A 5LGJA 1A4KB 4HT1L 5IMKB 5ICXA 3TJHC 1NAKH 3GJFB 3HZKA 5EU3B 3BEWB 1J0YA 4D0BB 4OCWL 4JVUA 1S78C 4DTGH 4YNYA 1EHAA 3TBVB 4D8PA 3C5SB 5D1XC 2EDNA 2ADIB 2X4UB 3I84A 1LP9A 1QFUL 5F88B 1ZS8B 1ZWIB 3FB8A 4X6DE 1HZHL 4F7EA 1FO0B 4OD3H 1W0WA 4S1DD 1L6XA 4XWOD 1BQHB 1HHHA 4UIMA 5IB1A 5AG9A 2WP3T 3QXAB 4YE4H 3X17A 5DC0A 1FE8L 4HBCH 4XMPH 4UMGA 5EZJA 1T22B 3HNTH 1E4KC 4JFPB 3MGTA 5C86A 4OAWB 4E41E 1UZ6E 5DJDA 4J3TA 5I18L 5I2IA 2AI0L 1X5HA 3C60C 4JREC 1H8NA 4ZTOL 1PLGH 4GXVH 1TQCB 4XB7A 4TULH 2PTTB 4Z5RA 1MPAH 5EOQL 2WIIA 3MNZA 3TP4A 5LCVH 3GMOA 1DZBA 1S9YA 3H2WA 4P0DA 1AFVL 1IQWL 3GMMA 4G7VL 5BRZA 1MJ8H 4OGAC 4CNIB 1NGXA 2K7QA 3VH8G 2N7BA 3S37H 5MP6H 4X6BA 4XRCA 4R97C 1BWMA 3QIBD 1BJ1H 4PJHF 4NO0A 1SYSA 3U79A 3GUTA 2H8PA 5SV3A 4NN7C 2EKJA 2FD6L 1MHPH 5IOPA 5CD5D 3VI4E 2JIXB 4N0CD 2J8HA 3IU3B 1NLDL 3LD8C 3C60D 1MJ7L 1F4WL 4HJ0C 4OUUB 2IPKA 2AKRA 3GIVA 3TO2A 3WDHA 2HJLA 3QJFA 4LLQB 2DTSA 4PRIE 1FNLA 3EOYG 4Y4KB 1KTRL 4HPOL 4G42A 4Q9RL 4M61B 4LLVB 3DMMA 4PP1C 1MCOL 5DEFB 5TDPB 2J8OA 4R8WL 4NQEB 5FUZL 1FYTD 3SDDB 3U2SB 4JO3H 3GZKA 5D7LA 2G5RA 3B3IA 4ISVB 4HJGB 35C8H 4LSVH 3VU2A 1CGWA 1Q94B 4G6JL 5DMGC 5ICZB 4LBEA 4QT5B 5IEKB 5DVKA 4ZXBC 4NQCA 3A6BL 4OV6F 4IOFD 4M7LL 4Y5YA 2D7MA 4EIGB 2VDOH 2BFVH 4M1DL 1AGFA 3GI8L 1UWGH 3BEVB 3D0VB 3AU1A 3UYRH 4K8RH 5INDA 1J1XH 3H42H 1QLRB 3LRHA 5FYLD 5AYQA 1NH6A 1MFEL 2NR6D 3CLEL 2VZ3A 1MCOH 4QYOB 3H9HB 5D4QA 1HQ4B 4PRNB 5MEQA 1BVKB 5A2KH 4PGDB 2WZPD 4HXBH 4FN0A 3AS1A 4ONHA 1ZVHA 3FB6B 1NL0L 4PG9A 2A9NH 3VWKD 3RVVD 3S4SA 4PJGF 3QIUB 1OM3L 3HRPA 5TFSH 4ONGH 4QWWD 5DSCA 5LXGH 2EXWD 4EZMA 4K71B 2V9QA 1AJ7L 5JW4N 4FP8H 1BQHG 3EBAA 1K4CB 1XCQB 5LAXA 5HVWA 1MY7A 5L9DL 4OLVL 4L5FL 3D1MC 2ERJC 3DXAE 1Z5LA 5J1AB 3MR9A 3E6HB 4XAWH 4MCYA 2IALB 3QUYD 3TF7A 4R7NB 2IEPA 4GW4A 4CDHA 1OB1A 3T2NH 1NANI 4HIJA 5I1LB 2QSCH 2QADB 3QI9C 4I77H 3ZKXC 4I0CC 3HC3H 2JJUA 1MFBL 4MAYA 1T21A 1WJ3A 1NC2D 2C9AA 3KS0H 3MRMA 4RISL 5E9DD 2HP4A 3VFMA 3A6OA 4YC2B 4NQDE 1MAMH 3MBXL 2P8MA 3AC0A 1RZFL 4N0YL 4JHAH 2VMFA 1CE6A 1QBLH 1TLKA 1J5OH 4PTTB 3F7PC 2ZSWB 2AJZB 3TVMD 3DXAA 3GM0A 3UTTE 4XXDB 1ZT4A 3OJDB 1LE5B 3BI9X 4BQ6A 5C09B 1VESA 1PYWB 2GAZB 4JFPA 3FT3B 1XIWB 3AY4A 3NA9L 5T5NG 3LHPL 2Z31C 3QIUC 1F00I 5E95B 3U30B 4GO6B 5FKAB 3BZEA 1IGTA 4K3EH 3WFZA 4NC2B 5BS0A 1WCQA 2XKNB 2VLJE 4J3UA 1W2KT 1UJ3C 4RMQA 3V6FA 1IKFL 4KRLB 4DVRH 2L0DA 4L9LB 2DOCA 4UI2A 5B38A 1DUZA 1JN6B 4P2CG 4PJFA 1YEJL 4PJ9C 4FQ2L 1JHKL 3WLBB 3CUPA 1I7ZA 4AL8L 3HMXL 5CWSB 2BC4B 1EHLH 2OMBA 5DRWA 4NO0B 5C07B 5D7KD 3AM8A 3QCVH 4ZNCD 4BZ1L 5CZVH 2HLFD 5IHUH 3QIBA 3UTZB 1X9QA 2XRAL 4NQDA 4FZ8H 4O58L 3U6RB 4M7ZC 3ARWA 3QUKA 4E41A 2EDWA 4Y5VB 2VZUA 1MH5B 2DQGH 4ZTPL 3ZMRA 2BY1A 5DVOA 1CE1H 1E4WL 4Z7UF 3C60A 4EOWH 3QEQB 1QYGL 4Y2OA 1NCDH 3HB3C 5EC2B 3O4OB 1KIRB 1ZLWH 3DPBA 5E6IC 1P7KA 3LKPA 3S88L 1PKQB 2CIKB 1A7OH 4JY6A 4FXGA 2CKNA 4N9GB 2BOCB 4OT1L 5FYKH 1MRCH 3DSFH 4FFVD 5JW3L 3BOVA 1LE9B 4Q9QH 3CMOL 3QEUB 1P5UA 2HAZA 1Q9WA 1MCWM 1AIFA 3VWKB 2BJML 2Q20A 3L5WB 1NCUA 2ADFH 4HX1A 1SJXA 4P9ML 2JCCA 3U4EB 5HDOA 3LRSA 2DLGA 1CLZL 1VSCA 4DJMA 1NAML 2YC1A 5J6HA 4ZQKB 5BW7C 3IAPA 3T0XA 1OD9A 3EDFA 2MKLC 3QFJD 2X4PA 4P4KD 3MJ7A 5L2KE 2W0KA 3QO0A 4WY7H 4P4RA 4PRIA 2XV6B 2DMKA 2LU7A 3WEXB 1OP5H 3WLWC 4KHXL 4FFVC 5IQ9B 4NYLB 3BP5A 5GGQH 4HPYL 4OCNC 3UJTH 4HS3A 2CRMA 1ZA3A 1WBXB 2X4OA 4NZTH 5HVGB 4OQTL 4RFOL 3FB6A 1Z6JT 4RRPA 3KNBA 3ARFC 4U0QB 2G60H 1JPST 2NY6B 1X4ZA 4XVJL 4Q6IB 3VFOA 3MMEA 3B5GA 4OFDA 1NCCL 1NJ9A 3WNMA 4UDTB 4V2BA 3EJZC 5F7UA 2RFXA 1BZ7B 1QFHA 1K8DB 3DVGB 2EDQA 1CBVH 3PABA 2ZOKA 4TOYL 3LKRB 4YXLL 4HW6A 3GHBL 3BEVA 4EUPH 5GSVA 1J1OL 4L4TD 2YZ8A 2B2XH 1YY8A 2HFGL 2UV3A 5E2UH 1MLBB 3NPSB 4KQ4L 1K4DB 5IVNA 3GMNB 5ALCL 4X6DA 2HKFH 5JPNB 1LD9B 1F3JB 2E9WA 3S3SA 3MA9H 1EO7A 3MCLH 5DR5H 4HBQA 5EO0B 2V2TA 1FFNA 2B1AL 1DE4A 1E6OL 4RX4D 5CEZH 4OZIA 3LEVL 5JA8B 1RK0B 2R2HA 3SE3C 4KZDL 5DWUH 4J1UA 4MLSA 4TSAH 5EO1B 3EFDH 3T09A 4WUKL 3T65B 1WFTA 2B5IC 4ZMAT 3UO1L 4DQOL 4YDJA 5I1KH 4UUJA 3FB7A 2AQ1A 5IR1A 4L8SA 4HH8A 2V2XA 3K4ZA 4KDTC 4JKPL 2L4OA 1EHNA 4FFYH 3WIIL 1IT9L 3BISA 5F3BB 3PWLB 1DBAH 1WLHA 1RULH 5IFJB 1AGCA 5C9JA 1TCRB 2OTUA 1EPFA 1Q0XL 2FECL 1OCWH 3GJEB 4PRDB 1NGPH 3BP7B 5I0DA 3PXJA 5B39B 3I3BA 3OKDB 4X98A 5FYJL 2GITB 3EJYD 3NIDF 4FFEX 5I19H 5EBMA 1B0GA 3KYKH 4D3CL 3DIFA 3G5XA 4BSJA 4UINL 1ZOXA 3GO1L 1NPUA 4MLIA 3VFVA 4YC2C 3NPSC 1JZ7A 4LEOA 5HI4D 5KANG 2FX7L 2XZCH 2BC4A 1KJ2L 1U95A 3BGAA 1A7PL 1QLEL 1L0YA 4R7DA 1BOYA 5F9OL 5C07A 5C0DA 4G8GD 4XXDA 5ESQB 3T0EE 3HG1D 2AVGA 4PY7B 3MJ8A 4TTDD 4YLQT 3CGTA 3GSOA 5TQ0L 2WWMC 1FL6A 4XPAH 1HH6A 4LSUL 4PGZA 3I2CL 3VXQA 4NN6C 5E8DL 1A5FH 1W72H 1NC4B 5C7XH 2P49B 5DGRA 2OTWA 3M1BA 4X6FB 3EFFB 3MRRA 5JPMB 3PDGA 3TCXA 4F15B 2FCBA 4LASL 1E6JL 2ZKHH 1JPGA 4QRRD 1QQDB 1A6UH 1F45A 3RBSA 3EHBC 1J05A 1EZVY 5EOCH 5BV7C 3I50L 4Y1AD 1TJIH 1HDMA 4DGIL 2IC2A 1BZ9A 3LS5L 4FZEH 5DZNA 4Y0GA 2VDRH 4PDCE 4M93C 2BNQE 1CXFA 5TF0A 4PBWD 5KG9A 4ZQKA 4HEME 5C0JB 5LQBL 2R4SL 2AXFA 1UFUA 4PJBA 4YHNA 5FA3A 4BJLA 1MJUH 4PJBF 4A2MA 2ZUYA 3OKNB 4NZJA 3IJSA 4IOIA 4Y19E 3MUY1 3IDIB 5B22A 5C07E 3QCUH 1CU4H 2D9QB 3N06B 1NBVH 3NAAH 3M17A 1U8QA 2H41A 1PKQA 2CIKA 2I60L 1GXEA 2EH7L 2VXSL 3OZ9H 5KVGL 8FABB 4FQQA 5EWIL 1OAKL 1GGIL 3INUH 1I8MA 3K81A 1NFIB 2EO1A 1XCTA 3K8MA 5L7XH 5EUKB 4U6HB 1F4XL 3GJFH 4I2XE 4P9HL 1LWRA 3L7FB 2DI8A 4HX1B 3D85A 4LCWB 1RU9H 1OT2A 1YEFL 3U7YL 4F58H 2FR4A 5BJTB 1FNFA 4RGNC 4JG1H 1BJ8A 2VR5A 2VB5A 1RZIB 5HHQB 2QHLA 2YMXL 1DDHA 4IMLB 4NO5B 2HYMA 3TT1H 3L3KB 3SKUD 4H20L 4FTVB 3ULUE 2OMNA 3OKEB 3MJ7B 1HHJB 4LPTA 3DX8A 3VXOB 3ARDB 3IXAB 4PRIB 2F58L 4QF1B 2PTUA 3S36X 4PJ7A 1U3HC 1P7QA 4TVPD 3RZCB 4PS4L 5HYJB 1NUFA 4ELKA 2BY0A 4F57L 3BGFB 4LCIL 1ZEAL 1A7NL 3D3VB 3MYZA 4XC1L 4ODWB 2F53B 4QGTA 4OUOA 5DJXB 1FFNB 5DRXB 4G9DB 4X5WB 2NX5A 2XWBA 3OKYA 3SDXE 1EFXA 4Q0XL 5C3LD 1IC7H 3B9VA 4AIZB 5MEPA 2H2SC 1LQVA 1A22B 5BO1L 2J5LB 4L3CA 4IIQB 1IBGL 3O3AB 4EBQL 1F6AA 5HI5C 4Z7OF 2RFXB 3DUUA 4YUEL 4JZNB 1PY9A 2G9HB 4UV4H 2CK2A 2VZOA 4ERSH 2ZOKB 4U4BA 4JQIH 3N85L 1RZJH 1G6RL 3L1OH 3BT2L 3TZVA 4PB9H 3SDDC 3RPIA 4JO2H 5KS9B 1UJ3B 4NCC2 3DX7B 3LQZB 3S34L 2AEIT 1OF2A 1DQMH 3RJQB 2IGFL 3V0AC 2PYED 4I9WD 3SGJA 4ALAH 1S9XA 5IROA 3VGAB 5AD0A 1JIBA 3TBSA 2NW2B 1KIPA 4M7LT 1RMFH 2W1NA 4LSPH 1S7WA 1JRHL 5DRNB 3NVQA 3W2DH 2OX5A 4M5YH 1PG7X 4M9OA 5I8KH 2WW8A 4ESKA 2X4UA 5CINH 1XGPA 5INCA 1QO3A 4R0LC 4HUUB 4XZUB 3M8OH 3CDFA 1T89C 3ZTJG 5D72H 1H3GA 1CXIA 4I13B 2A77H 4RGND 4WU5A 2VLRB 1N8ZB 1U8HB 3MRJA 3TV3L 4R7DB 5I6XB 5SWQB 3TYGH 1CFQA 5J9PA 3MLVL 5ILTH 5HGHB 5GRWA 4LSTL 5EZJB 1K8IB 2GCYA 5A1AA 1ZHKB 3D69B 4BFGA 1N0XH 5HHVL 4JHZA 4EXKA 1HHGA 5KTEL 1IC1A 1LHZA 2HT2C 2LTQC 1XF5A 5KVDL 2FL5B 1UH4A 2DD8H 8CGTA 2O5YL 4L8DB 3NA4A 5EUOB 2IADB 1UEYA 1QRNB 3SO3C 1RK1A 1SJHB 1BBDH 3RNKA 4CVWA 5IHLB 3CFDB 4JN2B 4YHOL 4BYHA 5JZ7C 4V2CB 3WN5B 3UC0L 1QQDA 2ESVE 2IANE 5SX5H 4NQXB 3QWRA 1CICC 1CGYA 1RUQH 4XPBL 4QHKI 2ZP0T 5ID0A 5BQ7A 1MIEL 1RJLB 4ENED 1AGDB 1FRGL 1OP3K 4PJHA 1XF1A 3MRNB 4GMTH 5C0RL 1T5XB 3I75A 4OZHA 1JNNH 3HAEH 5JXEC 4M6AA 5A16B 3VXUA 2GK0A 5DS8A 1I1FA 4NKOB 4X4ZA 4JG1L 3GSOB 3WD5H 2HFEB 3W5NA 4MA7H 3ZKMD 4X4XA 2NY2D 5GGTH 3B5TA 3S96B 2X4SA 3MRCA 4BFIA 4I3SH 1NC4A 2IQ9L 4ODSH 3OG4B 4JAMA 4XBPA 3IJSB 4IOIB 5C0CE 2MCPH 1FFOB 5B8CA 2YUXA 3QCTL 4L8BB 1EUUA 2ITDB 5HYQA 3OMZA 4N5UA 5FHBH 1OPGL 3VDBA 4OTXL 1I8LA 3DVFA 4JM2C 5GRXG 4TUOB 4J2XA 3MGOA 1QSFA 5ICYB 3VI3E 2Y5TB 3VXNB 1JZ3A 4JFEE 3QCUL 2NXZB 1QTYT 5HPMA 4QRPA 1UXSA 4WW2B 1FIGH 5JIHA 5FO7A 1KPUB 1TDQA 2FIKB 4ZS7H 4YFEA 1PG7H 3FMGH 3KLAA 4FRWA 4HWEL 4YAQA 5LQBH 4M5ZH 1OL0A 2YBRA 3C87A 2BNQA 2JB6B 2C4FT 2AABH 1SEQL 4G5ZH 1E4XI 3TC9A 5IJKC 5AZ2L 1R3LB 1YDPB 3X11A 1VA9A 2VLJB 2R69H 5KSVB 4I4WB 2OR8A 3RVXC 1QLRA 5E56A 2R0LH 1YN7B 1DQTA 1MCLA 4LSRH 1G0YR 4HUKB 5GGRA 1ZMYA 4OZHF 4MA3A 3S6CA 5GZND 1NBYA 1FJ1B 5CKAA 3P2TA 4TN9A 5DLML 4M3JA 1CR9L 1PZ5A 4PGDA 4LSQL 2WAHA 1PFCA 1QRND 3U7YH 4EVNB 5I8OL 2ZUXA 1HHIA 2B4CH 2X4NA 3QQ9C 1L7IH 4XP6H 4J4PD 5ITFA 4MXQC 4S11A 1NGQL 2XTJD 3WNLA 1ZA6B 4RFEB 3ZYIA 1HEZA 1WEJL 2VITB 4IIQA 4U1IA 1JGLH 4M00A 3TV3H 4CN1A 2PXYC 4MB4A 2ZUUA 1SVZA 5HHQA 5DJ2A 3DURA 4POYA 1LDSA 1RSFA 5E8EB 3G9AB 2CDGB 1F5WA 5BVJB 3ZTJH 4Q58C 5DD6B 3QFDA 3FB5B 5BOZG 1GIGH 1BAFH 2C26A 4WFHD 4PJAE 2FX7H 5IP4A 4O2FB 4ZUTB 1MCDA 4MNQA 4PJIF 4PUBH 1S7QA 1PSKL 1NDGA 2F74B 1C5DB 3BUYA 3C6LA 5CLTA 4CN4A 3QEGH 4XVSL 1IARB 1MVUB 4U31A 1HNFA 3MJ9A 2GJJA 4R4NC 4X7TA 3TIDA 4KK6D 4HKJA 3HE6B 3LKOB 3OR7B 3ULVD 3LS5H 1AE6H 1T5WB 3L6FA 3HAEB 2E27H 4D2NA 3CXDL 4L3CB 3ARUA 3BZDA 4XX1E 4ERSL 4MB5A 3MRJB 3DRTB 1OOAA 3DXAB 2VLKB 1ZLSL 2P8PA 3LKQB 4L29A 4HKBB 5DK0A 1ZT4B 3ARGC 3BQUB 2Y7QA 3HUJB 4NRYA 1RIUL 1OT1A 1PYWA 1G9NH 2UZYB 2XZZA 1Q38A 1EGJA 4XCCH 3BPOB 5KVFH 3LKNA 3QPXL 4GRLC 2SEBB 5DMIL 1TTFA 3GIZH 5F9AC 1ZVSB 4CBPA 3LV3A 3ZHDA 3HI6L 4HKXB 3C5JA 2F58H 5C09D 5J57B 5FECA 1BFVH 1KELH 5F9OH 2X09A 3IRZA 3MLUH 3WKNA 2PXYD 3QDJE 4P9HC 4JE4B 1ZT1B 3WFDH 4D0CA 4ZFFB 2ESVB 3KVQA 3KXFA 3GMQB 5E2JA 4KK5D 1QSEB 4WU5B 4M62H 3KYKL 4GQ9H 2H2PD 4BQCA 4YXHL 4KK9D 3QUMB 3HR6A 2G5BB 1T0NB 2EDXA 4RBPK 1A1MB 3IDNB 3EYOB 1TNNA 1BJ1J 3MUGA 3HC0B 1DLFH 3VD3A 1LO4H 4OLZL 4R2GD 2P5WA 1D5ZB 5TQ2L 1FVCA 4YHML 4V1DB 1N6UA 1RZKC 4Y5VA 3NCCB 3O11A 4U1NA 5ANMB 2IAMB 5DVLA 1T2QH 2F5AH 1NBVL 4IS6A 4GKNA 3GIZL 3EOAA 4F7CA 4X0KA 4L4VD 5AG8A 3BGMB 3NTCH 2Q8BL 2GFBB 1PX4A 1UT9A 2Y23A 4ZNEA 1N6QL 2R4SH 4LMQE 5DFVD 4IRJC 5CJOH 4Z18A 2Q7NA 3UYOD 1YNTB 4QRPB 5ID0B 1S5HB 4GKSB 1AIFB 4LARL 5FDWB 4WWID 5KSAA 1NQBA 4K3GA 1U8MA 3MV8A 1SY6L 1FVEA 4X6CA 1BBJA 1JGLL 3GSUA 4FQXA 5KSVA 1RJZB 4U1GC 2NY5C 1LO4L 4OLZH 2DRUA 4P46A 5AUMA 4ZPTA 4LCWE 1FFOA 5B8CB 3MFGB 3WKMH 2PYFA 4LLMA 3DO7A 4HS6B 4RFNB 3RY6C 2AV7A 1JVKA 5DVNA 5ALBL 3RVUD 1QSFE 5E2WH 4WFGD 4UTAH 5GJTL 3V4PL 4GKOA 4EVNA 3BN3B 3C8KB 1WFOA 3HAEG 2HN7A 1CE1L 5F1OB 1P4LA 5I1AA 4OI9A 4ZTPH 1OAXL 4Y19B 3V5KA 4Y16C 5IGXH 4EDXA 4G6AD 3TPUB 4PJ7F 4EXPX 2E5EA 2QEJA 3QPXH 3U0PB 1JWUA 3TBWA 5KVFL 5CZVL 4TNWK 5FYKU 1BEYL 1BBDL 5GS0H 1JHLL 3MC0A 4JRXB 2E7MA 3KAAA 2P24A 5TPWH 3PWUB 4O4YL 1PG7L 3FMGL 1RIUH 1I9RH 4WI3A 4IBLT 5KVDH 4LSQH 1Y6NR 2NY5L 3WDIA 1KC5H 5FGRA 1OCWL 3ULVL 1S7QB 1DEDA 2H3NB 1BVZA 4R90L 1N3NB 5DUPL 3GBNH 3NFSH 2OM5A 3TNNB 3ZKNC 1A47A 2DQJL 2CLVB 5J13C 4PP2A 2I24N 2VDLL 3OF6A 1IT9H 3TIDB 3UROR 1YECH 3GSNB 4YXKL 1IGML 5CZXD 5C8JB 3QBTB 1GOFA 4HGWB 5L2KB 4APQC 1ZLUK 1S5IH 2WBJB 3M8OL 3EO9H 4DN4L 2AGJH 1KACB 3PWPA 3BYTA 3IF1B 3QHZH 3NIDE 4KUCD 5C1MB 3CPLB 1E4XL 4GMSH 1J0IA 3FB7B 4F7MA 4Y1AA 1OLLA 2APFA 2W0LA 3QFDB 3T8XA 3MYJB 1KJVB 4KZDH 2OP4L 3IVKB 4I2XA 1Z3GH 4OV5B 1WQVT 2LTQB 3ULSA 2D31A 1QBLL 2YUZA 2AV1B 3FT4A 5JHDA 1FLTX 2BP3A 2RCSL 3VFUA 1NGWB 1JPSL 4JR9L 3CFCH 5ICXB 1TETL 3F7VA 1MEXL 4Z7UB 3DUSA 3QUYC 4BZ1H 4DOHE 1L7TL 1KB5B 1L7IL 2XICA 3BMWA 5E2UL 3EAKA 1WT5A 5IM7B 3DETC 1P6AB 5D7LE 4NHUE 1Q0YH 3PIQA 4UQ3A 3BPNC 1FNSH 2C3HA 4NT6B 2VRAA 4LIQE 4BM7A 1JWMA 2PCPA 3ARSA 1V8HA 2MQCA 5E00A 4UIMB 4QXUH 3V0VA 1UB5A 3IKCB 2E7LA 5T3ZH 4X5XA 2NLJA 3UPRA 5EZLB 3HNSH 1OGAB 5JW4R 3IDXL 4FP8L 2R69L 5AEAA 1AHWB 1WCBA 4RZCA 4EQ2A 1BOGB 2A9ML 5E4IA 1N5YL 4DW2H 3RFZC 3V95A 2NTSP 1LP9F 1W0VB 4ONOA 2ITCA 5MEOA 4R3SA 2NCMA 3BE1L 1LK3H 4Q6YA 4KK8C 4YFDB 3MRQA 5GJTH 3C08L 3V4PH 3ZSTA 1Z2KA 4LAQH 4JM2B 4S0SD 1MUJA 3T4YB 3T3PF 3B9DA 1IFHL 1KJ2B 1S7RA 3KPNB 3S36L 4BA8A 5ID1A 1BX2B 3PL6D 2EEAA 1AXSB 5SWSA 1F58L 1V3MA 1FSKC 4U1LB 1J12A 4U6VL 5ERWA 2WK2A 3P11L 3E0GA 4R4ND 2ZCHH 1FV1A 4W4OC 5CEXB 1XH3B 5FDWA 3VI4F 3GKWL 3JWNC 3DI2B 5GQBA 1N7MH 1KGCE 3S4SG 1OAKH 3INUL 4NCC1 2GYSA 5DEGA 1CL7H 1RIHL 3VXSD 4J8RA 4LKCB 3MV01 1X3DA 5J12B 5GRVL 2EDLA 3DV4A 3IRPX 1QLFB 1U92A 4O2EB 1LMKA 5L6YL 3GSUB 3W2DL 1M1SA 2R0KL 4U1NB 4OZ4A 1A7OL 5F7KC 2A83A 2APTA 5AUMB 1X5GA 3J8F7 2RHEA 1UWEH 1KTDB 2Z91A 1KLUA 1Q9LB 3HFML 3B9KB 2FJHB 3OKLB 4LLVA 1F90L 3G6DH 4M1CD 1DR9A 2NY0D 3MLSL 3FAWA 3VXPA 1R5VB 1QVOA 1P84K 2AGJL 3X12A 1L4IA 1NCNA 5GGUB 4M43L 4F57H 5HYSA 2AJVH 4B0MM 4PJAA 1EXUA 4ZG1A 3IDXH 2AEWA 4QHUB 3RNQB 4X6CF 1Q94A 3BT2H 3LSOA 5F7HA 3OAZH 1YY9D 1LEKA 3D0LA 4Q6IC 5CUSL 4QXUL 2XQBH 1BM3H 3ALPA 1RAMA 5FGCE 2ZKHL 2QADC 3MJ9L 1SBBA 3TPUE 4ZAKD 1BBJB 2HT2D 1YEFH 4KFZC 3RWJB 1CLYH 1NMAH 4PJDE 4GQ9L 4J12A 3SJVA 3TYGL 3MRPB 5B3JF 3RZCA 2Z4QB 3AROA 5EORL 2JIXD 3HMWL 2FBJH 3T3PE 4H0GA 2VDOL 3ECBB 3LPFA 4J3WA 4NN7B 2F53E 4QCIA 4P5KA 4P3WA 1TJGH 1MFDH 2OZ4L 5FGSA 2MSPA 2VNCA 3PWJB 4IRSC 3FRUA 1JRHH 3UTTA 3KPOA 4H20H 4EDXB 4JDVA 4MS8A 1Q72H 2YZ1A 3EYSH 5E1HB 2NY2B 2P48B 3GO1H 4NQEA 1M05B 2ZG1A 1YQVH 4P59L 3B9KC 43CAB 3BIBX 5HGBB 3WNPA 3BRDA 3KYMA 1S5IL 4YPGB 4YE4L 3SKNA 1RZFH 2ED8A 1KEMH 3MYJA 2M1KA 4ETQA 5F72S 3RKDC 3U48A 1FGVL 3IJHA 3LMJH 1RZJL 1U6AH 4NC1E 2BSRB 2NR6C 3K2UH 3H9SB 5DT1H 3V6OE 4CKVX 4X4YB 4CGTA 1DVFC 2BSSB 4ODTH 5C08B 1TQBB 4F7TB 4WUUE 1SMOA 3ZYJA 2D0GA 3LN5B 3DETD 3GSXA 1WWCA 2F8VA 3MROB 5CHNA 3P9WB 4POZD 1KGCD 1KJMA 1AQDA 1G7PB 1S7SB 1AGEB 2NYYD 4U6XB 1WITA 5EFIB 5M94B 3S3JA 2AS5M 5IBUB 3X3GL 3ESUF 5D6CB 3KPSD 5CJQL 4YHLH 3PWPE 4HKZA 5DWUL 5E99H 3RAJH 4XC1H 4FFWC 1LVEA 2VDQH 5C0AD 4HUNB 5D7IA 3QFJA 1KXTB 1B2WL 1Z9MA 3S4SB 4NUGL 3EGSB 4KGJA 4ZFOA 5HYSG 1V7MH 1UQSA 1F13A 4QHMA 1YEGH 2EC9U 1GRWA 1NANH 1HXMB 3QULB 3Q5YA 1LNUA 3QI9D 4KDVA 1F11B 1IGJA 3ZTNL 2R15A 2OI9B 2AXGB 2B4CL 1J0HA 2L7UA 3ARGA 3FQUB 1YPZA 4P9HH 1T04A 4U3HA 3EJZD 5IMOA 1TTGA 3MNZB 4MDIB 1BGXL 4PJFB 3UTPE 1X5JA 5E1AB 4PJEB 5MI0B 3WLBA 2NY6C 4LVHC 4NNYA 3WIIH 1SM3L 4WFEE 4XRCB 1CU4L 2OS7A 2Y9RT 1RHHA 2VC2H 2P8MB 5AZ2H 1A7PH 1R3KB 5KJRL 1WZLA 1ONQB 3OHXB 4PJXB 3AS2A 3QUMH 1UCBH 2R4RH 4PJBE 2A6JA 2F54D 3CX5K 3IJYA 5DXWA 4M48L 4JDZA 5ACZA 4KAQL 3K4AA 4JGJA 3OJDA 4POZC 1LE5A 1KIUA 4Z0XA 4MA8L 1Z9LA 1SMAA 5EC2A 1BREA 5D7JC 4L8BA 2B1HH 4BK5A 3UPCA 3WO3B 5IROC 3V6ZA 2F5BL 1YJDL 2E9IA 5ESVA 5DURD 3DWTA 3O6MH 3TIEA 2X70B 5FGBA 3SKJL 4JKPH 5HGAA 4PJAB 4HCRL 2CIIA 1T1YA 4HMEA 4NGHH 3BESR 1XIWC 2RIKA 4Q74A 3SDDA 1SEBB 4LL9A 1B6DA 3EDEA 5C0NC 2DQHH 1VEOA 4I1NB 4FTVD 5ENWB 5TE7L 4U0RB 1A1NA 1JZ6A 5FYJE 2WNGA 1DUZB 1S9VB 1HK6A 4LCUA 4JQVA 4YDVA 1MCEA 3VGFA 3RGVD 5IHZA 3OB0H 5JQ6H 2IH1A 2QJDA 5SWZE 5J13B 3P0VH 1EO5A 4F9PC 4B5EA 1SJEB 4WGWB 2QHRL 1NCDL 1AFVH 3VDCA 3HI5L 3O9WD 4AT6B 4KMTH 2NPLX 3SQBA 1NCBL 2HVKA 2CXGA 3RL2B 1G7JB 3B9KA 3DV6B 4JB9L 4WO4C 3U6RA 4HFUL 4C4KT 3DARA 7CGTA 4ZDHA 3MLWL 4IRJD 2HKHH 3BW9A 5C0BE 2XRAH 2ZSVA 3X12B 4YHOH 5IB4A 3SGEI 1NGQH 3K8LA 1CF8H 5CSGA 3VRJA 3TJHA 3NCJH 4P5MB 4QTHA 5F7MC 3O81A 1RIVL 4HIIA 3BO8A 1LEKB 1FE8H 3VFWB 1CR9H 3U9UB 1T3FA 2PO6D 1F02I 7FABL 3QIWC 1NFDF 3BVNA 3O9WB 2EC8A 4OLEA 1OARH 5HGBA 4RMVA 3L3DA 4XH2B 1IM3A 2YUWA 5E6IB 2HG5A 1J7VR 3IAGC 3SKNB 3ROLB 2EDEA 1U8JA 4LPVA 4YGAB 2J8UE 4X6DB 2N1KA 1I9EA 5B3NA 4LLWA 3W0WE 3LHPH 3R8BB 1D6VL 2BSSA 4GAGL 5C08A 2X4QB 3WNNA 2VOTA 5H94B 5FCUH 3GSXB 1P7HL 1OAUL 5IFAL 1UWXK 2BVQB 2I9TB 1GGCH 4YGVB 4UU9B 5KS9E 5EN2B 5I8EB 1AHWC 2IQAB 3FFCA 5CEZL 1TCMA 5ESAA 5IVXF 1EJ6A 1DVFB 3SDAA 5A2IH 1CDGA 1CXLA 4N1CA 3O2DL 3WNOA 4HMCA 3B43A 1CE6B 2ZUQB 3JV0A 1I3GH 1MFBH 3QUYA 4WGVB 2FJFB 3QRFM 3CVHB 3F65A 4HLZG 2B2XL 3HUJF 1XF2B 3MLTA 2E8YA 1QACA 2D7QA 5KSAD 2YA1A 4ZFZA 4DCQB 4U1GB 4LVOC 4K3DH 2IWGA 1M7IA 2YPLE 4YBLB 1KULA 3FT3A 3U82B 4GBXB 3QDJD 4MAYD 4U7SA 1MCFA 2HLFC 5FF6B 2Y5EA 1QYGH 4Z76A 3HA0A 4Y5XC 3HE7B 5FKAA 2W59A 15C8L 3WFHB 5IWLC 4K3EL 5L2JA 1EBAA 5BS0B 2EH8H 1A7NH 4FNLL 1DSFL 1HE7A 3D85D 4D0CB 2VH5L 3MO1B 1DBKL 1FVDA 3VFTA 4HCRA 4FXKA 3QAZC 1CGSH 4NNYB 3X14B 4R2GC 3QFJB 4U1HB 2C1PA 3OSKA 5MHSD 1M6OA 4ZS6D 3BJLA 2YD9A 1RUKH 5B38G 1EVTC 5I73B 1HH6B 32C2A 4JRYA 4HC1A 2DMCA 4JPVH 3O8XD 4UBDC 4OCRH 3V0WL 3BPOC 1B0WA 2AXGA 5FUOL 3QUKB 5CJ5A 5KAQG 4BQBA 1LEIB 1FNEB 5L7XL 5JPMA 2ZUQC 1HCVA 1WC7B 3E6FA 1A9EA 2A6IA 4F37F 1T20B 2OTUB 1CFNA 3NFPB 4KVCL 3W9DB 1FFQA 2UWEE 3GJEA 3NMEA 4PRDA 1TZHB 3LZFH 1OW0A 2ZPKH 4FXGB 4FHBD 1WK0A 3N1MC 4D0BA 1CICA 2J5LC 4FMFA 4J6RL 5FIEA 3U36A 2ZG2A 3BZFB 2PF6A 3LAFA 4DN3L 1RZGB 1G7MB 5JR1H 4EI5A 3U9PL 3TA3D 1N64H 1BVLB 2DQUL 2VSCA 2YSSB 1FPTH 3L3HA 1HHHB 1IAKA 3W39A 5D1ZA 2XTJE 3OKNA 4RISH 5IHUL 2VE6A 1AD0A 3P4MA 1R3IH 3F6LA 2BDNL 2PYFB 4JQIL 4IMKC 4DZBB 3MUHL 5IF0A 5C0FA 4O5LL 5FFLA 1HOCA 3EHBD 4YDIL 4EUPG 5BO1H 1A21A 1NEZG 1UGNA 4O2CA 1INEH 4HEPG 1IC4L 2EXWC 3V4UL 1ORQB 4X7CC 2Q76B 1N0XL 4ZUSB 3K0WA 4LCYA 4NKDB 4Y88A 5HHVH 5JHDD 4N9OB 3WIHA 4P5MA 4QTHB 2AK4A 2EIDA 1LO0L 4YK4C 1A5FL 3QT2A 4IMKA 1T83C 4WO4B 5IB3A 3GDBA 5H35A 3U7WH 4XPHL 1H0DA 5HGGS 4X6BB 4LPWA 1N2RA 1EAJA 3QDGB 2ATPA 5CINL 5K9OA 1QR1B 1SVCP 3VFRA 4PJXE 5GRVK 3PWUA 4HZAA 4PRID 2DAVA 4AT6A 3PABB 4JFDB 2GTZA 1G7JA 2WUBH 3CH1A 1A14L 2KZWA 4LSPL 4ZPVB 5DRZB 4LF3A 1YYLL 2V7HA 1CLOH 4QRQA 4OCRL 1JPTL 2I25N 3SQOL 2PW2B 4MWFA 3STLB 4OGYL 3N1QC 2C3WA 2M2DA 5L8JB 4IRZH 1RD6A 1EFXB 3FONB 4HUMB 3MBXH 3I6LD 3T0DA 1WFNA 3OR6A 3MRGA 5GSRB 2XFXA 3N85H 1QFUH 1VERA 2DLHA 4U2YA 4EDWL 3SDAB 4Y8DC 4WVRA 1IM9D 2CSPA 5D6DC 1LO3H 3QG7H 3ZE1F 1H3TA 5SWSD 3T2NL 4GG8A 5BZWB 5I1KL 4LSVL 5KS9A 4QT5A 1AO7B 3LN4B 1S3KL 4JQVC 1I8LC 1KPVA 4PBXA 4DQOH 1MCSA 1K2DA 1WIOA 1JJUA 2KQMA 1EUTA 4FQIH 4KDWA 2CUHA 4LLWB 1QBML 3WUWA 1FAIL 2ICWA 1NDMA 3RY4A 2X4QA 1IC4H 2DLIA 2DLTA 2K3TA 2OI9C 4TPRL 3VFUB 1IZJA 4M8VA 3KPMA 1T6VN 4RQQA 1NAMA 4Z76B 3D18A 5C0EB 2VIRB 3BKMH 3HZYB 3JVGA 1H3XA 3PE9A 2Q86A 2IQAA 1QO3B 1XF4A 3H9HA 2QADD 4DFHA 4HDIA 5CIPH 2WQ8A 1FPTL 3FTGA 3RZCC 2Z35B 4TUKH 3CLEH 3OXSA 4DEPB 5CSZA 3RDTB 1F8TL 4J7RA 3G08A 4WCYL 3D9AH 1GAFL 3VXMD 3CZFB 3V7MA 1K8IA 2GCYB 3VCLA 5EZLA 3H6JA 4J3SA 3WL9A 2QSQA 4UNTA 2VDKH 1IQWH 2IPTL 1I3RB 4NQEE 4PJGA 2I07B 3O6FB 1B88A 5MENA 2H9GA 2F8OA 2J8UF 4R2GB 3E2HB 2YOCA 4ZAKA 3MXVL 3DUHA 4JFQB 1QRNA 4TULL 3LQZA 4F8TA 4AQ1B 1KJ2H 5I9QB 2XZCL 3RY5A 3F5WA 2HTKC 1PW3A 2CDFB 3IGAB 4J4PA 4Z95L 4AIOA 4EUPB 1ZSDA 3LY6A 4UILH 1R24A 2Z9TA 4M7KL 4PPTA 1C8PA 3HS0A 1KIPB 3QP3A 1U42A 5SWSB 4YHZL 3NFPA 4P2OD 3W9DA 2X9WA 3OJVC 1HSBA 5ERWB 1YNLH 5C07D 1OVZA 1ZTXL 1BD2D 1KG0A 3HG1A 2DI9A 5JMOC 2NY2C 4PG2C 3U4BH 2C5DC 4WJ5A 5DEGB 4S1RL 5DJAB 2BNUB 2DQTH 1Z9SA 1BVLA 2BVUA 4E42A 4X9HA 5KOVC 2VR9A 2X6MA 3LN9A 3V52H 2FLBT 4DTGL 1BPVA 4LFHG 3BKCH 3I6LE 5D8JH 5EU7E 4HWZB 2BVPB 5DJ8B 4HT1H 5IT2L 1CFTB 4AZ8A 1R5IA 4TSCL 4D9LH 2X2YA 5BVPH 4HS8L 3E6FB 5H2BA 2YRLA 3MGOB 2R1XA 2FECI 5DQDL 5DEFA 3QXDA 2H26B 1MJ8L 8FABA 4TVPE 1EFQA 1SYVA 3LEVH 3DMMD 5BVPL 1NFKA 4M6NH 4ISVA 2ZCKH 1ZK9A 3FO1B 1JN6A 3KR3L 1YYMH 4LP5A 5FOJA 5FYLL 4ZTOH 4YHIA 3DHJA 2XT1B 3FQTA 1BJMA 2O26U 3CUPB 4PJ8C 5I30H 3BQUC 1G7LB 3Q0HA 3VFRB 1GHFL 1RZIA 4QNPF 4IMLA 2E7HA 3MRNA 4GLRH 2F53D 1XGUB 4AL8H 1YN7A 3QIBB 3MRPA 5ANME 2AK4E 3D0VA 3FO0H 3PJSB 3CLFL 1K9TA 1U8IB 1YNLL 4KRMB 4XX1G 5E6ZA 1ORSA 3Q3GA 1FFRA 3CCHB 3KPRD 1IKFH 4U6YA 1FGNH 4ELKB 2NZIA 3AFLA 2FBOJ 3PWJA 1KT2B 4QYOA 2HJKB 1ORQA 4ZUSA 5IIEA 2JELH 5I1CH 4TTGA 3PNWB 2AK4B 2XTJB 3P77A 2FATH 2UWEF 4OQTH 4RFOH 3CSYA 3TBYB 5EO9B 3QUXB 1UENA 1A02N 5I17B 4KMQA 4WI2A 1N59A 4OBSA 2ZOLA 5D71H 1H0DB 5FEBA 3DJ9A 3N1FC 4KHXH 1M71B 2IPTH 5GJSH 3X13B 3RWHB 4RGOL 1JWSB 2HVJA 3SOBH 3MNVB 3BGFC 5BVJA 3VWKA 1U8OB 3BXNB 1K4CA 1XCQA 2D9CA 5AYUL 2JCCB 3WO4B 5D96B 1T4KB 3SY0B 4F33B 4K7PX 3BHBA 4HZLB 2AAVA 3SGEH 2XWTB 1CF8L 2DM7A 2WWKT 1U91A 3ULUD 2DLFL 2A2QT 5CD5C 1MVUA 1BHGA 4MNHA 1Y6KR 2YS4A 5I1LA 2FO4B 1AXTH 3GMLA 4NRZB 5E8NA 3O6KH 2DWDA 4JLRB 3PWVA 5M95B 4K7PL 1YMHA 2RQ8A 3VE0A 3CSGA 1JF6A 4QEGA 2EDTA 4NYLA 4OT1H 4LDLB 2NY1B 1S7WB 3EKCA 3BPNB 2J4WL 4OF6A 5BZDA 3QDMD 5C71A 2C3XA 3CNKA 1JFQH 5I16A 4PJ5A 3NIFF 4S10A 2CJUH 2VN4A 2KUTA 1UVQA 3TZVD 5GJSL 2FJGB 3MV11 1JTPA 3O3EB 4L4TE 1BD2B 3KYNB 3BWUC 4F80A 1HEZB 4PTUA 2AJZA 2DQHL 2B4CC 5EA0L 1RPQA 3B2UC 3O3UN 1KEGL 3FQRB 3BKCL 1FZMA 1KB9K 3V79C 4XVTH 4PJGB 2FRGP 3VXSB 1OM3H 2D4FA 3TN0D 2LQRA 3KPTA 5IQ7L 1ZVSA 5DD0H 5C0EA 3GMNA 3MFFA 5HDLA 4P2OC 1UB6B 5E70A 1KCSH 2X1XR 5BOPA 4OFPA 3FO2A 1FBIH 4HQQH 1TENA 5J6GA 5L88H 2HJFB 5T1MB 2PO6C 4Q2ZB 4FG6C 4H5SB 3BH8A 1GGYA 1I7TB 4R26H 3FQWB 1JK8A 2Q1EA 1CZ8L 4RDQG 3TCLA 2P7TB 4UILL 2NXYB 4WW2F 2X05A 3ULUL 4IHOA 2P4AB 2BFVL 2XI9A 3MV7E 1RVFH 3EYVB 2XKUA 2GQHA 3FKUS 5DJAA 4OCYH 1IC5H 5FYKL 4BSVA 2AK1L 1JMXA 2XNAB 4JM4H 1KCKA 4JCLA 4AG4L 1I1AA 3ARZA 5CKGA 4X9FA 1BLNA 3RWCA 25C8L 1HI6A 2R23B 3QWOB 1OQOA 1T7ZA 4HC1L 5HDQH 3E2HC 4QLRA 2DQFB 4LLYB 3SCMC 5CCKL 4D9QE 2VZTA 4EUPA 1WTLA 4NO2B 1I85C 3EO1A 1G9NC 1K3ZA 1INEL 2QL1A 3SGKC 3OKMB 1P1ZB 1WZKA 1C7SA 2H26A 1EEZB 3GRWA 2HT3D 3GK8L 4DGYH 2Y5TA 4PJ7E 3BZ4A 4QHLB 1P4IH 1DN2A 3E8UL 3MPCA 3PHSA 5IW1B 3VMNA 4NKIH 1A2YB 3QDGD 4ONFL 5KSAB 2W9DL 5CP3A 2C3VA 1U8MB 2MTPA 3ET9F 4H8WH 1W0WB 1U3ZA 3S5LA 3IDGB 3ARBA 3QUMA 2LAGB 4AEIH 3QNYA 4NRXA 5CJQH 2OCFD 1QBMH 4PJDA 5B3JE 2PO6B 5H37H 5JDSB 4U7MA 2FH8A 4Z7VA 2PUQT 2EE2A 3K3QA 1H9VA 1CFSB 2NTFB 3LZFL 3T3MF 4H8WL 1KBGH 2YD2A 1I3VA 1LO3L 3UJJH 3BJ91 2QQLL 1P4BH 4EN3A 4P4KA 3BX7C 5GGRB 1J1PH 1S78D 3DX9B 4ODHL 1YMMA 1JTTA 3VG0H 5FOBB 5I73C 1XIWD 4QO1A 1JL8A 2G2RA 4N0FB 2VSDA 4PY8I 2W65B 3GK8H 4DGYL 3NFNB 2VISA 5I18H 1ACYL 2XA8L 4U05A 4CADA 4JG0H 5FM5M 4H0HB 4IRJB 3C5ZB 2BNQD 2OSLA 5AZEH 4WDIA 3QAZB 5DDHA 3WFCL 3WIHL 2B8OT 1S8DA 5SX5K 1AC0A 1WAAA 4HBCL 5JO5A 1AKJB 1VEPA 3ULVE 1IFHH 2DKMA 1OTUC 4C55A 3GI8H 1ACYH 2XA8H 2ERJB 1F2XK 2JJTC 4MCZB 4TUJA 2WIMA 4Z7NE 1NCAH 2UWEA 4WI6A 4XTRC 2APBA 2Q7YA 4AEFA 2JJTA 5JOPD 2P5EB 3A6BH 3I6KB 4U6YB 3RRQA 1NUDA 1X6LA 4L8CA 3DVIA 1DFBH 2VLLB 4MD5B 3HNVL 4RWYH 5JDJA 3QDJB 5DI8B 5I1GH 2FATL 4NRZA 1NAKL 5E8NB 2EIEA 4JREB 3U7WL 5E2VH 1K5NB 1HILA 1OQXA 3FZUC 3I85A 4B53A 1T0MA 15C8H 5KS9F 2R29L 5T3ZL 1U8QB 4UU9A 4WFFD 2OQJB 4HK3N 3VA6A 3RPKA 3B6SB 4P3CL 4KKLC 3DO3A 4KI1A 4NWUL 2NYYC 4RX4A 4XHJD 2HN7B 1J18A 1ED3B 1Q0YL 4C56B 2FJFA 3GHEH 1YPZF 3HUJE 3MTRA 2J1KA 1W0YT 5I76B 1YEDA 4OCLC 3V2AR 3N0PB 5HHOB 2RCSH 3MUZ1 1MCHA 2BK8A 5K9QI 1FSKB 3HCVA 5EA0H 1MFEH 1XEDA 1X5FA 4Z7UA 3CDYA 3ARDA 2EDYA 2XN9D 1Z3GL 3LKNB 3DX6B 2KKQA 1MF2L 2GSIA 1AO7E 4HIHA 5C70A 3P0VL 1UWEL 4IDLA 3BEWA 4K9EC 5J6GB 2V7NB 4NZRH 4G6AC 4JQXA 5HDBE 3DGGA 2VDNL 4Z7WF 3MV9E 5E00B 5BRZB 5TE7H 5F7DB 1DBML 1YEHH 2ESVA 2YWZA 4URTB 3D48R 3ARDC 5C8JA 4X7EC 4LEOB 1U3HB 4PYGA 12E8L 4G80A 3L5XL 3QNXA 3SGKA 4XPHH 5KSBA 1QUNA 2JB5H 1DQJA 5I1CL 2ZCHL 3IAQA 3PWPB 2PYEE 3O6ML 5EOTB 2EEDA 1ZANL 2JIXA 3CFKA 3CFBB 2VQUA 5FUZH 2ADGB 5BW7A 1V05A 3RIAF 3IU3A 1QZ1A 3KPRB 4R90H 4G8GA 2NY0B 1KC5L 2XG5A 5I0ZA 1OAZH 3G04A 3QQ4A 5CEZE 3SOBL 4CU8A 1IAII 2PXYA 3O2WH 5HXMA 1HZHH 1GHFH 2OTWB 4P23D 4X6FA 4ZNEE 1CN4A 3JV5A 2VDML 5AD0B 3GJFK 3ULUC 4LEXH 4DKEH 1JGEB 2FWOA 4I0PB 4LGPB 5E24E 4J3XA 2X9XA 3ARFA 4JB9H 4JRXD 1NGZB 1OAXH 4WHYG 4HSQA 4UQ3B 1A2YA 2R8SL 3NABH 5HYFA 4KKNA 4XNXL 3T77A 4AIXA 3KWWB 4NC0B 4U1KA 3BWAB 2GT9B 2NY3B 3BFOA 4G7VH 4G8EB 2J4WH 2VLRD 3MV8B 1GZQB 2IH3A 5E6YA 3RP1A 3T08A 3UPRB 1A6PA 5EU6D 4LRIA 4UNUA 4K8RD 1XGRA 2AI0H 4JR9H 5DD1L 2Y07L 1OSZA 4O9HH 3OKMA 1W8NA 4AEEA 3KR3H 5MEOB 1AH1A 5DVMA 4JFED 2AP2A 2XN9B 5JORB 1MRDL 3THMH 1JHTB 1TZGL 3VFNB 2VN7A 3C9NA 1CI5A 5ACLA 3PWNB 4DGVH 4QRRE 3V4VH 1YMMD 2DS4A 2OSLB 4WDIB 1E4XH 4YH6A 3H0TA 3NIFE 5E7BA 4FQIL 4U1SB 5E8PB 3O2VL 2FR4B 3HPLA 2R2EB 3ZKSD 4AEHL 3ARTA 4QHNB 5GGSA 1EMTL 3WHE0 3AREA 4XCEB 5D96C 5HY9A 2W0PA 2DQDH 5IJVA 1A6AA 1AO7D 4KTDH 4YZFE 5KSUA 2VWEE 5IWLA 4XXCC 2B0SL 4I0PC 2Q8AH 3C09B 3PUCA 1CFVH 3LKSA 3O6FC 3TVMA 4O2EA 3VFSA 1HXYA 3A6CL 1MFCL 2DMBA 2A38A 4PRPA 3WE6A 2VLLA 4JEGB 4CJ0A 4KPHL 1WV7T 1KIRA 4FQCH 5IKCB 3NFNA 5DQ9A 1U93B 4M7ZB 1QVOB 4GS7C 4Y2DD 3WHE1 3JTTB 3OB0K 2V2WA 4WU7A 4P59H 5MEPB 5CBAB 5D2NB 1DANT 43CAA 3OKKB 3KYOA 4G3YL 2CDEB 1DEEB 2WANA 4JO4H 1A14H 2F54A 3F7YB 2P5EE 3U0TA 3OGCA 2Z92A 4NOBA 4DVBB 4GG8B 1FCCA 4OQTA 1FFPB 3ARXA 4PRAA 2YPKB 5TE6L 2CQVA 1A3QA 5GHWH 4FQJH 1BZQK 4I8DA 4GRLD 3MRKB 1B2WH 5LGHL 4R6UA 2E6PA 3TH3T 2OXHA 1JGDA 4PR5B 2FBJL 5F7EL 2AJXH 1LEGB 3GSWA 3OXRA 4UTAL 3VMPA 3UJIH 4LK4A 1RZ7H 4OZFG 3RWJA 3HZMB 3RWGA 2O61B 3MZTA 3TN0C 3WEXA 1GCFA 1FYTB 2NY6D 3SDDD 3ZL4H 5HSFA 4MAYB 5DGQA 4FQXC 1C12A 3MRMB 4LGRB 3JV4B 4WTZG 3CDGA 4JFEB 5A2FA 1MCCA 2EYRB 2BNRD 4EJ1C 3D2UB 2BDNH 1KTLB 1ED3A 3BKML 4MD4A 4YQXL 5GS3A 3QYCA 1I7ZB 2QR0B 4UZGA 4UNVA 3DRQB 4G6ML 3BH9B 1QSZA 3QUZD 4PV8A 4OCXH 2VERN 2GJ6A 4MXVE 4QOKB 4OSUH 4PJCE 1QP1A 3SQOH 3WUZA 5GS1C 3G6DL 1UCBL 1PSKH 3T04D 5F9JB 3DVNB 1J8HE 1IL1A 4QRRB 4KKCD 1RURH 2ZWLT 5FAAA 1KCUH 4CMMB 4DKAA 1O7SA 5C0GB 3G6JB 4ZD3H 3BUYB 4PB0H 4WEBL 5IG7B 3RY6A 4KUZH 2ED9A 1P7KB 5FYLE 4X8JB 4OD1L 3P4LA 4W4NA 3G6AB 2XTJC 3QHFH 1MCWW 3MLRL 3MOBH 3TT3H 1DBJL 1TPXB 5HYJE 4PBVC 2O5ZL 3EDJA 4GJTB 2I5YH 4DEPC 1DQQB 3RI5K 4U1LA 1K6QH 3BQUD 4KC3B 5BQ7B 4TVPL 4LSSL 3MRHB 4NP4L 3UTQA 3QWRD 3IJYB 3U4EA 5DLMH 3I6GA 4XMLH 5IHBA 2VABB 3MRBA 4F2MA 3UTSB 5JHLH 2OBGA 1GZQA 1BM3L 5GIRA 4P48A 2AEQH 3EGSA 4ZFOB 1T1ZA 1G7HB 1R3IL 3QZWG 2WM0A 5I8CB 3OJ2C 1CGSL 5F3BA 4PY8J 2Y36H 5JUEL 3JTCA 5FUCC 1FL3A 4OLXL 2CR3A 1CWVA 1EAPB 4MNGB 3VFPA 1HIMH 1BWWA 3D39E 3VXPB 5GRJH 3SO3B 4QTIL 2YPVL 3KHQA 1BFOA 4KK9C 2EDRA 1FDLL 4Z7QF 4YWGL 2BSTA 4HIEA 3WN5C 2XG4A 4CU6A 3NGBB 2R9HD 4PJIA 1B0GB 1D5MB 2P44B 5FDYA 1WISA 2CKBA 2J8UA 4RIRB 1Q9WB 5I1GL 3H3PH 3K8KA 2HA1A 3MMEB 4JM2D 1NCWL 2PW1A 5HJ3A 4OKDA 1SJEA 1G7LA 4XWGH 2BNQB 2JB6A 4LSDA 1EJOH 4DKFH 1P2CA 1U6AL 5FHBL 3NCYP 5DJ0B 4NBYB 4L3EB 4D0DA 1MEXH 2VUOA 1CDYA 3FFCE 4UOW1 3RTQC 4PJXA 3MGTB 4XNUH 1WUNT 3O4LA 3LKSB 3TVMB 1R0AL 3SE3A 1XR8A 3DNKA 1MHHA 1FQ9C 2ZSVB 3K1KC 3BKYL 4H1LB 1YJDC 5ADPL 5IQ9A 2VXQL 4DN3H 1RUKL 4LCCA 1CDIA 4IRSB 5EIIA 4HS3B 5E5RB 3S9DB 4LAQL 5F6IB 3CXHJ 2P47B 4HWNA 2NX5E 3RVWD 5CEZD 2OK0H 3T0EC 2DTML 5KW9H 2R2HB 5EU7C 2AJSL 3QDMB 4NUGH 3OKKA 3O3DB 1J10A 3U0TB 3GUTB 2VH5H 4XCNB 2R2EA 3LQAL 4U1MA 4PRAB 5KSBF 1A6TB 2GJZB 1RZKL 1REIA 1B9ZA 1BF8A 4YPGA 1U8PA 2DQJH 2H6PB 4HUWA 3SDXB 5FCSH 1X4XA 2JLLA 3SCMD 1YEKH 1MRFL 1JPFA 3SGDH 5I1EL 4UAOC 3WHXA 4MNHB 4PRPE 4NN6B 1CQYA 3TO2B 4A6YB 3BPCA 3QDHA 1RIVH 1AGCB 5IFHH 3JUZA 1IZKA 3RWEA 5EG6C 4ONFH 4LLMB 5SV4A 4I3RL 3VD9A 4NQED 1D7FA 1FGVH 1IE5A 2R9HC 1AQDB 1G7PA 4XGZB 1KLGA 3OV6A 5IB4B 2HKHL 3V6OA 5D2NA 5EBMB 3C8KA 4PJ5B 3F7YA 2AABL 3CVHH 4ZXBD 3JTSB 4MJ6A 2KBGA 3K4DA 3CVHA 4Y19A 4YDJB 1CQKA 2QHRH 4NQCB 3UTPD 5DHVH 5D7IB 2VAJA 4OZFA 4ZS7L 4LPCA 1X7QA 3SGDI 1J11A 1UACH 4N90E 5FCUL 1XZ0B 2HFTA 2IBZX 2UVEA 2VXQH 2UY6A 3FN0L 1QNZL 2DDQH 2J2ZA 1HHJA 5IFJA 3QZWB 5E5MA 3S34H 5GGVY 1IGMH 1FYTA 3HMWH 5CD3A 1OTTC 5D7LD 3ARGB 4ZUUB 2QQNH 1MELA 5H94A 4U6VH 5FECB 5HI5D 1KXQE 4JZJC 3GBNL 3NFSL 4OM1L 2GTWB 4JO1H 3G6AA 3HE6C 4RGNE 2COQA 1LP9B 4MA7L 3VFVB 5FUCE 1KENH 3T2OA 4AIZA 4NM8H 3P30H 1KCSL 1YUHB 1Z0MA 1V5JA 2VKWA 5DD3H 3W0WA 3DRQA 1OTSD 4O4YH 3UAJC 3IF1A 4L9DA 3TM6A 3UP1A 1NBZB 2W9EH 4RGNB 4KI5E 2Q8BH 5C6TH 3ZKQD 2XPGA 4DW2L 4F7PA 5C92A 4U1JB 3RVTC 3ARGD 3KG5A 4CVXA 3IVKA 4TVSa 2F5AL 1XF2A 2IAMA 1CLCA 3EZJB 1OARL 4H1LG 2WIIB 1VACA 5E2WL 2P5WE 4GBXA 4K3DL 1DLFL 5E9DE 4B50A 5EOCJ 1TZHA 4WO4D 4G9FA 2X9YA 3EYUH 5DTFA 1KB5A 4XHJC 1NFIA 2BERA 4X5LA 5LGJB 2G75B 4QGYA 3B3IB 4YXHH 4OFVA 4BSWA 4NOFA 1R3JB 2CK0L 1I3GL 2D7PA 1DUYA 4PLNC 1HHKA 1RUPH 4JKLA 3UTQB 2Y6SC 1MHEA 3P11H 3OZ9L 3JWDH 1UB5B 4KI5F 3DBXA 4YZFF 3T0EA 4QRSA 1CFQB 5I8KL 3HI5H 4NN5B 1G7HA 1EO8H 2AKRB 3SPVB 5DUBB 1FP5A 5DMYA 4Z78A 5DMJB 4P3DA 2F54E 3FN3A 5EPMA 3QEHB 2B20A 4XCCL 5CJOL 4RGOH 1RZJC 4M1GH 5E9DA 3NZ8A 1IGTB 5DJDB 4X6CE 1C5BL 5LJYH 3UZEA 1L0XA 1HQ4A 1RK1B 2MKWA 5MEQB 3OAYH 4K9EL 1AGBA 4G8IB 5IB3B 1MVFA 1FZJA 4OB5H 1V3JA 4JO2L 3VRJB 5FM5O 4E0RA 4FQ1L 5FHAH 5D70H 5I15L 3BIAX 4OZGA 3T0AA 5DRWB 3CXDH 3HLAA 4H88H 4W6YB 4KJYB 4HWUA 4UT6L 3O9WA 1JP5A 2MPAH 4XBGA 1ZVYA 3TN0B 2BXYA 3BZFA 3U46B 3L3DB 4XH2A 1G7MA 1N6VA 1I9RL 4XMKH 5I71C 2P24B 4P2QD 3MR9B 3WXWH 4GW5B 4KQ3H 3GSQA 3T1WA 3BP6B 5E2TH 5E8DH 1RZ7L 2ZJSH 3I3EA 4Z8FH 4H1LA 4JFFA 3JV6A 4HIXL 1JPSH 4PRHA 4NZUL 4U33A 1ADQA 4HFUH 3D25A 3BN9C 4MZ3A 3FQXA 3MBED 4OLWL 3OR6B 4Y4FC 5GGVL 3FN9A 2HJLB 1YQ2A 3QJFB 2CLZA 2ZUVA 1MLCB 4L9LC 4Y4KD 2EYTB 5DK2A 2R2BA 4CJ1A 2O5XL 4JN1L 4WRLA 1BQSA 1VGEH 5INCB 4QHUA 3RNQA 4D3CH 3TF7C 5IB2B 3LSOB 1G9NL 5T1KB 43C9A 4NHUB 4HS8H 4XNQB 5L8LB 2ZSWA 3VWJA 4NNPL 5I8OH 4YDKL 3AVEA 1MHCA 3L3GB 4ZXBA 5D1XD 5ITBH 3RU8L 1PDKA 1A3RL 3I9GL 3OJMB 3MSPA 1ZHKA 1WBYA 1GGBH 3HB3D 5CUSH 3MLZH 4Y5YB 2DQTL 3RTQA 3A67L 1OWRM 1H15B 1YN6B 3CJJA 4OCMC 5J3HC 4C83A 4Y5XB 3FFCD 3N50A 1ZLVK 1NMCB 5ITBL 3O8XC 4M43H 1ZGLB 2V7HB 4QRQB 3HE7A 3CFDA 4P5KB 3HR5B 3BPLC 3ZZ1A 4KKLD 1WVZA 4KK8D 4YHPB 3ILPB 3QUML 1HHIB 4RAHA 4XAKD 1VFAB 4Q6IA 1U0QA 3QEQD 3N1GC 1TJHH 3VA2C 4WI5A 2YXMA 4IEFB 3X14A 4M7JH 2WV3A 4F3FA 4P2RB 4FZEL 4ZOCA 4XNZC 2XXCB 4OGXH 4I0PD 5GZOD 3MNWA 4OF7A 4X4ME 4AJ0A 3UTZA 3BDBA 2DYPB 3MA9L 1UM5L 4W68A 4G8FB 3KPRA 4YX2H 2IG2L 2OJEB 5EORH 3AGVA 1MLBA 2MCPL 1A3RH 3I9GH 1Y18B 3HI1A 4PREA 3H7LA 3ARED 4XP1L 4LHQB 4YIQA 4IDJL 3C60B 1A7QH 1DBBH 2IALA 4BZ2H 4HG4J 4JRXE 1OB1B 3KPMB 3ZTNH 1MCJA 3ZLQC 3EYSL 3EOTH 1Y0LA 1JV5B 3KPNA 3PGCA 4X7DC 5ECJE 2IG2H 4UTBH 4PRPD 3NGBC 4NQTA 1VEMA 4AK1A 5FHAL 4GBXD 1DANU 4P2QE 1UH3A 4J1UB 3AS3A 2X1OA 3TWCL 3RWIA 5LVEA 5FO9A 1R3HA 4M7JL 1CG9B 2CLRB 4IJ3C 2ZCLL 5D93B 4DKEL 3MLPA 3ARVA 4NFDA 5CSZB 3VXUB 5A16A 5J06A 4J8RB 3CFIC 5GGQL 3KDMB 2YC1B 5J6HB 1ZXQA 2B7DT 1CLYL 4F8QA 3KPLA 3NACH 5JNYA 4GFTB 5C09E 4M8QA 3B2VL 3MRLB 3SBWA 5F97E 4PGBB 5JMRA 4WWKB 3TJEL 1ZLSH 1NGPL 5K59F 3VGBA 3PHQA 2KZ1B 3OKLA 1X5KA 5HI3C 1FNSL 3HHRB 2AJ3A 3GRWH 2X4RA 4I5BA 1U8KB 1YMME 5CBEA 3BP5B 3QQ9D 3UBXA 1ZANH 2CRZA 4QXGH 4HV8B 3LMJL 5TQ2H 3O41A 1H3UA 3DTXB 1MFAL 2HLAB 3L5XH 3F12B 4Y2DB 4EI5D 3CMOH 5GZOC 5ITFB 3FQTB 2AJYL 5TGBB 2X41A 3CU1A 4MQXD 1CXKA 4G8GE 3H7BA 3MLSH 1JPTH 4MZ2A 5T3ZE 2EO9A 3PL6B 1OY3B 4XBGB 3UBXG 1FN4A 1QFPA 4GKZB 4QRSB 2V6HA 4JJHA 3IFNH 2OTPA 5IJVB 2Y6SD 4R0LA 1G1CA 4A2LA 4HWBA 4BH8A 5GS1B 4PJ9B 4G6FB 5JPNA 2GJ6D 3O11B 5DMKB 4ACPA 1GL4B 1A0QL 4I18B 3JV6B 4V1DD 4HULB 3V5HA 4WFGE 4HIXH 3EOAB 2W9EL 4X0KB 4X7TB 4HXAH 3VJ6B 5F9WC 2EIZA 2DD8L 3RUGE 2YR3A 3V4UH 4P23C 2R2BB 3MRGB 4LRNL 5T5FH 4H0IA 2JK5B 4LHUA 2NY3D 1I1AC 3HLAB 5IV2A 4H25A 1OP9A 2AXJA 3PGDA 3TYFB 4X80L 5CSBA 3B2VH 5D1QD 1IGYB 3HE7C 3DURB 4DK3A 3HRZA 2CDGA 2DM3A 4FQ1H 2Q3ZA 2XWTA 3HUJA 4NRYB 4C56D 1C1EH 2R1YA 2DYPD 3HNSL 3MRIA 2ATKB 4ORGA 2Y06L 4XCYB 1C5DA 5D5ME 2DTMH 2NQCA 4HS6A 1UCTA 3FQXB 5K9JH 5BV7L 2WBJD 5DHYA 1U8IA 4UTBL 4NNXB 1DN0B 2P1YA 5JOFB 4LFHD 3S35X 1BAFL 5D2LE 5HHMA 3HAEA 2F19L 2VWEC 3H8NA 3WJLC 1RU9L 3DIFB 3G5XB 5EO1A 1IILE 3R4DA 4NUJB 3D85B 4LCWA 3WJJC 4I18C 2Z35A 1T3FB 1VPOH 4PTUB 1TQCC 2G5BA 3BH9A 3PV7A 1GOHA 4PB9L 1PKOA 1R5WA 2EEBA 1II4E 3KLDA 4PY7A 2LAAA 1OTSC 2AQ2A 4LNVA 4UDTA 1INDH 5DUPH 2BVTA 2MHAB 5SWSE 2DIBA 3EYFA 2QSCL 3QR2A 5IBTH 4EN3D 1HXMA 1FL5A 3RTQB 2OP4H 1S7XA 1IL1B 4KXZI 1UYWL 3EDKA 3RHWF 2H9GB 1FLRL 4GMSL 3RVWC 4LSRL 3D5OF 5TPWL 2H3NA 1FDLH 1XGTB 4FQXD 4HKXA 2K9UA 2KDGA 4L5FH 5I1IL 4ODWA 1BEYH 5GS0L 5EU6B 1OAQH 1PEWA 5HVFB 3E3QA 4LU5L 4S2SB 3UX9B 5HTSA 5IVZB 2OL3H 3FQWA 3QQ3A 5KVEL 2LV4A 3JSSA 3U0WL 4Z9KB 3EDDA 4GUPB 4YGVA 3HPJA 3KXFB 3JWOL 2CD0A 4ONGL 2I9LB 4HGWA 4MQ7B 2ZUWA 3P9LB 3S97C 3I50H 1FZOA 3L9RA 3MJ6A 1XGYL 5BZDB 1IQDA 2XZAH 4NBZB 5EULV 1TZIB 1ETZB 4GRWE 3VXRE 4E5XA 1FVEB 4LVEA 4MJIB 3VFGH 1CXEA 3WKML 3LQAC 4FQHA 2RB8A 1J88A 1L7TH 4PGBA 3W81A 4ZPTB 5DJ8A 3O6LH 3DO7B 1EAPA 1TVDA 2GUOB 5F1IA 2AJ3B 3PP4L 1T7YA 1WBZA 3DUSB 4RWHA 3NCMA 3ZE0E 2X40A 4RA3A 2V5TA 3GNMH 2XYCA 1QBAA 3BKJH 3CFEB 1ZLUH 3SJVE 4NCDA 1JNNL 3MO1A 1E27B 5LBSH 3ROOB 2HJFA 4GKSA 4GMTL 3ZDYE 5D9SA 1JWMB 4R4BA 5T3XL 3TBVA 4D8PB 4HFWB 4YWGH 4GBXC 2VQTA 5F88A 3WXWL 3MXWH 1RI8A 3UMTA 2RJMA 3BKYH 3KDMA 2HTLC 1FO0A 5L88L 4NDMA 4D0DB 2BOBB 2IMNA 2OL3B 3C5ZD 3KPLB 4MD0A 4N0YH 5CGYC 5JDSA 3SHSA 4CAGA 3QIUD 1C1EL 3NPZB 3PDOA 4OLXH 3LB6D 5IW3A 3REWA 3Q1SL 4QXWA 2IAMC 5F1SA 3QO1A 3IXAA 2X44D 4DAGH 4ZO8A 3PJSA 1F6LL 2HRPL 2E27L 1IKNC 3RU8H 2WINA 2F9BT 5I1EH 5E03A 3FHAA 2ESVD 2ZG3A 5IMLA 1P53A 2XZQH 2W65A 2IF7A 3MJGX 4L3AA 3T1FA 2VR4A 4LP4A 4XPGH 2NNAA 4TQEH 4XAWL 4K8RC 1TVHA 4XVSH 4HH9B 4HXAL 3TBYA 3L7FA 2YA0A 5I66B 1UKTA 5DSCB 4LNRB 3ZYZA 1AD9A 2DB8A 4W6XB 3UDWC 1YC8A 2APVA 3MLUL 5DURB 3TJHD 4WNQA 1JWUB 2R1WB 4OBRA 3TBWB 5K9QG 3S7GA 3HI6H 4Z7NF 2HVJB 5GHWL 5K9KB 4K7PH 2H6PA 3JWDL 4HUWB 4OF5A 2Q7YB 3IDGA 3ARBB 5KBNC 3S35H 3W39B 3I6KA 5D1ZB 2CGRL 4UV7L 5KG9B 1D5XB 3QIWB 1T7VA 4H8WC 1AD0B 1RUAH 3P4MB 3O9WC 1VFUA 1QEWA 5F8QC 1IGCH 5HYQB 3GHBH 3GMLB 2QLVB 2W07A 4OLYH 5GGSY 4Z77B 3VRIA 4UT6H 4EN3B 2N56A 3SKJH 3MV9B 1J8HD 2WBJA 2YHGA 2FHBA 5IV2B 1F6AB 4Y16B 1MNUH 3U2SA 5TH2A 4KUZL 3GRWL 5D7LB 4MXQA 1D9KC 5E7FA 3GSNH 1ZLVH 1CVSC 3IKCA 5DFTA 4Y4KC 4G6JH 4G5ZL 5J9PB 2H32A 3WBDA 1UJ3A 3VRLE 1IC7L 2DQEL 5ADOH 1S9KC 5J12C 5HYJD 2UUDK 1N6QH 1L9NA 2ATKA 4ORGB 4R8WH 5JLZA 3QZWA 5DQJA 5EIVA 3VXSA 1IEAA 5LBSL 3TO4D 4MCZA 4TUJB 1NGWA 1G9ML 1I8IA 3FO0L 4RAVA 3MV9D 4IOFC 4G6MH 1SM3H 2WP3O 5IMMA 1T2QL 1SJHA 5E0QA 3UYPA 1E0OB 4JZJA 5JOEA 5JXEA 4PP8C 3DROA 2MOVA 2BVOA 3QDJA 4L9LA 3WXVL 1PGRB 4M6OH 3SE4A 2VLKD 4C4KO 4ZSOE 1A6UL 1NLDH 3D6GA 4XP9L 3VFTB 2D0HA 1U3HD 2BHUA 4KJWD 1F4YL 4MVBD 1OGTB 1M7XA 1ZA6A 3GB7B 4JDVB 2C7UB 3GMPA 4NNPH 1AGDA 1R5WB 1JBJA 2NXYD 2P42B 1RY7B 2V17L 4LIQH 4XP1H 1NEZA 3PQYA 2HFEA 3PP3H 4YBQC 3QHFL 2XZAL 4ETQB 3FFDB 3A0OA 4O2FA 3IJHB 5LGHH 3VW3L 5LCVL 3ZT6A 3OX8B 3EUUA 2A1WL 3WSQL 2J6EL 1MPAL 1NBQA 2ICWB 1CVRA 1U3YA 5F96L 3W82A 4KTDL 2Z31A 3O8XA 1MUJB 3PG2A 4K71C 4PRHE 2D7TH 4YHLL 2EKSA 3MROA 5CHNB 3RZCD 4ODXA 4JFFD 4NQXA 3FOMA 4LOUC 4MQ7A 1T21B 4XPGL 1FLRH 1R3JA 2FIKA 2ILLA 2QBWA 5CEXA 1KNOB 3MODH 3U36B 2P8LB 5JA9A 3BWAA 1T5XA 2DICA 1NAMH 4DAGL 1GZPA 4K07A 5EZIL 4L29B 2QQNL 1JZ5A 5EOCL 4G80B 5KSBB 3L3HB 1IAKB 3O0RH 2W92A 2WUCH 5F7FA 1H3WM 3WL9B 2H45A 2A83B 3BIKA 1CD1A 4ODSL 3TA3A 4XBPB 1PEZA 2DQDL 1TVBB 4HGMA 4X9GA 5GGRY 4OKVB 5FB8B 4N8VG 4QXTB 3QA3A 4RNRA 3TA3C 5E9DB 4PLJC 5EU5A 1WBZB 2YK1L 3GI9L 1U41A 5JQHC 5HHNB 1I1YB 2YUVA 4BK4A 2BNRA 3HN3A 4LVNC 4K55A 4O2CB 4KI5C 1RMFL 4TNVF 4UDUA 3UXFA 3PWNA 4GG6E 3SBWC 3MACH 2FHCA 3KNBB 4APQA 5FO7B 3KPQB 5L0QB 3QUZA 5E08L 5D5MA 1JI2A 2QV2A 4OZGB 4NFBA 4I3GA 1X5XA 3PP4H 4XNUL 4EIZC 1DLHA 1RZ8B 3PV6B 3TO4C 2FB4H 1NUGA 3W11D 3GSVB 1FZKB 3X11B 1QPXA 4G43B 4CDGC 3JZ7A 1MAKA 4PJXF 3VFGL 4U1KB 4I77L 4CVZA 5CGYD 4G9FE 5DJZA 4ZPVA 2LU3A 4MNQB 1LO2L 4UAOB 3RI5F 1CDHA 5C0BB 3VG9C 3QNZB 1MH5A 3RVTD 1FRGH 1V3LA 1XGYH 3SE9H 4MHHI 5IMLB 3KJ4C 4PGCA 1GC1C 1VFBA 1B0RA 5EZOH 4BH7B 2NNAB 2A73B 5E2VL 2XY2A 1OSPH 3LKOA 4LCIH 3LRGA 2RR3A 3KPOB 2CIIB 1T89A 1T1YB 4K2UL 4JY6B 4KU1A 3MLXL 3QRGH 4TUOA 1S5HA 2EDKA 4GAYA 5I1IH 4P2RD 43C9B 4MX7A 3QG6A 3BRGC 3IYLW 4WWKD 5KN5B 4U7KA 2P8PB 1UXWA 3Q5TA 3V4VL 4L8SB 5C0BD 2IH1B 5HVHB 1VDGA 4U1SA 4NP4H 5E8PA 5IBTL 4F58L 3WFBL 5D7JD 2NXZC 1T1XB 1AI1H 4LSSH 3RHWK 1Q9OB 1CLOL 4LSTH 1A6AB 3OQ3B 2Y1VA 5AZEL 5KSUB 4WIQA 4PLKC 3DV6A 2O5ZH 1DTUA 2OI9A 3EOBB 3QPQC 3WS3B 3IFPB 1JF1B 1VPOL 3LV3B 3MLRH 3MOBL 4M1DH 4WTXA 5KVGH 3OKDA 4Q9QL 3L3IA 3TO4A 2I60H 4PRPB 3WE6B 3CFJA 1J1PL 4HIHB 4JPWL 1VENA 3MV9A 2HJKA 2ADIA 3E3QE 1EVUA 2HTKD 3S36H 3WD5L 2Y4SA 3PNWA 1M4KA 4NO3A 1QSEA 4OZFH 3ME0A 3O45B 4QKXB 1I4FB 2FZ3B 1NC2A 1NCCH 2VLKA 4OCSH 5ESQA 1KYOJ 1E4WH 4EOWL 1U3HA 2D0FA 3KYOB 4ELMA 2CDEA 1X6NA 3CC5B 1U8LB 5LKNA 1DQJB 4GRWB 1K3IA 4YDIH 5CIPB 1JNLL 4OCXL 1C16A 3CD4A 2A6JB 3QULA 1LNUB 3FFDA 5BXFA 1O5DT 1IGJB 3L1OL 5DZOA 4KZEH 2NW3B 3RDTC 3T4AB 5TDNA 3G6JA 1N3NA 2D3VA 3G04B 3PGFH 5F3HA 4NSKA 3F5WB 5EIQA 2YMXH 4WHTB 3CIQA 4KKAC 4HGKC 4JQXC 4K7FA 1N64L 2DQUH 5EU6E 2R2CA 4RRPG 4B7LA 1ES0A 4J3VA 1DE4B 4XPFH 5AWNL 3GSRA 3GB7A 1OGAD 1GSMA 1D5BB 1KG0B 4P9MH 3SDCD 3CFCL 3HZVA 1A1MA 1T5WA 3IDNA 3L6FB 2BJMH 3LPWA 4AG4H 4Y4HA 1G9EA 3NH7L 1S9WB 4FMKA 1GGIH 1HH9A 1G7QA 3MUGB 3HNVH 4TTDC 5FKPB 3OHXA 1A0QH 3CPLA 2VXSH 2EH7H 4RFNC 2EYSA 2QR0A 2AXFB 4OCYL 4K3JH 1AQKL 4ZFOL 2QQLH 3LD8B 4OUUA 3D39D 2VUYA 5I8CA 3SE4C 5JW5A 5DF0A 5K59E 4Z7VF 3IFNL 5C0IA 4GKNB 2DQIH 4QXTA 2Z31B 1QSEE 4CN6A 2X4RB 4I5BB 4PJ5E 2EKSB 3TLRA 3T3ME 1XGRB 1BQLH 4OZHE 5HPOA 3IETB 3CSBA 2BY2A 3Q2CA 1UB6A 3O6FD 5C08D 2NY3C 5L2JB 3B5HA 3BP7A 2DWEB 1YNTA 4APQB 1P4LB 5I1AB 3MBEB 4QXGL 1EJOL 4DKFL 5D5MB 1GH7A 1ZT7B 1P4IL 4XNYL 4YHYC 1AC6A 4UV4L 3NCFB 5DHVB 4X6EA 2W0FB 3RX5A 1Q1JL 2M26A 4YDVB 1BIIB 3PV6A 3JVGC 3LIZL 1T0PB 4W4OA 5HHPA 1XGQA 4N5EA 1FZKA 1SYSB 4G43A 2V9RA 4JANB 3AU1B 1ULVA 3UO1H 1WCBB 4KROC 4RZCB 3BIKB 3FRPA 3VRLF 5J11B 1NKOA 5GS1A 2VXUL 1VKXA 2R29H 4OKVA 5FA4B 4FQLL 3I2CH 2YPVH 2VLRE 4AEIL 1JFQL 1PD6A 5D7JB 1W0VA 4K94C 3TPKA