4NQDA

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
260
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIEIDYGDILPSGDGTYQAWASIELYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 260
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqdA01
4Y4HC 5DK3A 1JGEB 1BWMA 5KANG 2GKIA 5JORA 4AQ1B 5GGSA 1OTTD 1OAQL 4BSWA 3LKNB 4NUJA 3HNVH 1BFSA 5TE7H 5EZIH 4PRPB 3VXTA 2WBJA 1MHPL 1GPOH 4PJAA 5DD0H 2FDBP 2ZP0T 5BRZA 3KR3L 1MFBH 4NN7B 2WM0A 3ARQA 4DEPC 4L3ED 2R0WH 4NJ9H 4K7PH 3FKUS 1CS6A 3AREC 4YHOH 2WQ8A 1XF5A 5A2FA 4FQIH 2FBJH 5DWUL 3C5SA 2MTPA 5JOEA 4ZS7L 1NGYA 1EMTL 2R56H 2AJXL 3PWPD 4XWOD 1HXYA 1O5DT 4V3EB 3GJEA 5JORB 5GGSB 4FFVD 5DZLA 4BSWB 4PGZA 1V7NL 3VXTB 1HYRC 3EYOA 1J8KA 1U93B 4UU9A 5B38A 3V8OA 1KCUH 1NBZA 2WBJB 3RKDC 3HE7A 2EC9T 3KAAA 3WO4C 1AC6A 3T0DA 1X5GA 1MHHB 3JVGA 5BRZB 3ULUH 3FRUA 1ROWA 4QXTB 3B2UC 5KAQG 4UV4H 5KSBE 5EG6C 4GRWE 1QLFB 2B4CH 5L8LB 5ACZB 2EEBA 4YIQA 1GGUA 4U4BA 3C5SB 3QDHA 2QQLL 2HT3C 3E0GA 1NGYB 4PGCA 4IHOA 4WI6A 2VIRA 1HXYB 3GJEB 5FECB 1FFOA 1Z5LA 5D8JH 1JWSB 5IIEA 1T2JA 4L8DA 4HPOL 4OCYL 5B38B 3T1FA 4TUJA 3HE7B 1F3RB 4JQXA 1INDL 4YHPA 4BFIA 4CU8A 3WFDH 5LWYL 4X7DC 4AIOA 3D25A 2FJFA 1RJYA 3FRUB 3FL7A 4S0SD 4ZNEA 1B2WL 3ARBD 3RVXC 4KVNL 1XMWA 1H5BA 2MWCA 4ZAKD 3QNYA 1MAKA 5JPMB 3RWJA 1AXSB 5GXBB 2V6HA 4PGCB 1K4CA 2YN5A 4HXBH 4IHOB 3C60D 1QBML 1MY7A 1IGIL 1FFOB 2CJUH 3JVGC 1GOHA 1Z5LB 3CVIH 4PJDE 4HH9B 3FB8B 4P2QE 5DRXA 4R3SA 2D7QA 4L8DB 2G5BA 2YS4A 2E8ZA 3ZSTA 1JJUA 2X09A 4YHPB 4BFIB 2FO1A 3RIFK 3DYMA 3O6LL 1T5XA 3P77A 2FJFB 1RJYB 2OTWA 5F7YC 4OUOA 4WI5A 4Y4HD 3HUJA 1H5BB 2JJTC 4MLSA 2APVA 1KCSL 1NGQH 2XICA 4JM2F 4NO2B 4DN4H 3RWJB 3C8DA 3PP3K 1JE6A 1PQZA 3C9NA 1BJ1J 2DQUH 3GKWH 1EK3A 1K4CB 2X9YA 4JQXC 3GSXA 4YPJA 3UYOD 4NQSA 3HA0A 2NY4B 5DRXB 5B4MC 3PWUB 4R3SB 3EZJB 4WFED 2G5BB 1P7QB 1KB5H 2DQTH 3DGGA 1A9BA 1I1FA 1XF3A 5HDQH 3ALWA 1T5XB 3P77B 3ARSA 3H3PH 4MDIA 4UDTA 1S9YB 1A2YA 2OTWB 2BOCA 5C3LD 2PXYA 3HUJB 1T1ZA 1LO0H 4L4VE 1OF2A 1RVFH 3I75A 1CL7H 1PQZB 3T65A 3RKDD 4OB5L 5SWZA 3JWDH 3GSXB 1EJOL 2X89A 3DSNA 4QY8A 1MJ7H 1HSAA 4NQSB 4MLIA 1J0KA 4X4ZA 3W9EA 1L6XA 1I8IA 3B2UD 4BUGA 3LEYH 3DGGB 2EDXA 3LKPB 3FQUB 4O5LL 1CF8L 1I1FB 1XF3B 2ZUTA 4J3VA 5D71L 4URTB 1RK0B 1A2YB 4NQDD 2BOCB 4YHMH 2HT3D 2PXYB 1T1ZB 3MJ8A 4K3GA 2VAAA 2A6IB 4MJ5A 2YD4A 4DGYL 3CSBA 1ZLUH 1JN6A 1HDMB 3I75B 3WJLC 5IT2L 1QSED 3N1PC 3T65B 5SWZB 5IBUB 1UKTA 3L3GA 3CU1A 4HC1A 2MPAH 3CVHL 3MC0A 4QY8B 4BA8A 1HSAB 1RAMA 4J7RA 1OSZA 3L7FB 3RVXD 4OCSH 1I8IB 1T1WA 4JO1H 2MMXA 3UZEA 3KPQA 3KJ4C 4PG9A 4R0LA 3S5LG 3TBVA 4L4JA 4OCWH 2GY7B 5I2IA 3SGKC 3FZUC 3MJ8B 4PV8A 2VAAB 4MJ5B 3E1F1 2F53D 1JN6B 1UWGL 4QRPE 2HMIC 4Z7NF 4APQA 1KCRL 2V17H 2IFGA 3L3GB 4O00A 4XPAH 1A6AA 1CD1B 1EHAA 2W9EL 4XPFL 3VXUD 3HI5H 3PXHA 1OSZB 1MCOL 4GXUN 4WY7L 1T1WB 5EOCH 3NIFF 1JF1A 1FNSL 3KPQB 4DFIA 4PG9B 4JHAH 4YBLC 5E2UH 4R0LB 3TBVB 4JHWL 4MCYA 4BQ9A 3INUL 5I2IB 3CMOL 3EYVA 3D39E 4JREB 5CJQL 4PV8B 5T1KD 5B4MD 2P24A 2G60H 3IDJB 5IFHH 3PGFH 4APQB 1YEEH 4DVRH 4ODXA 3LCYA 4WWKA 4NZTL 4RX4D 1U91A 1WCQA 1A6AB 5SWSE 1IKNC 2WLYA 2GTWA 1OQXA 3VWJD 4NM8H 4MXVF 1BZ9A 5DUPL 4JY6A 1SVZA 5F9AC 2OK0L 3CDFA 4L8SA 5ILTH 4UNUA 1JF1B 1XIWA 2IBZY 2DQFA 1YEJH 2HYMA 4N0CA 4MCYB 1V3MA 1DUYA 3MV9E 3EYVB 3C5ZA 4GKNA 2CIKA 3UTZB 1QFWH 4OGZA 2VH5L 2P24B 3R8QA 3C09B 2P44B 1GZQB 4JO3H 3ARWA 4OKDA 4WWKB 4TNVF 5FAAA 5CZKA 4YO0A 1U91B 1QG3A 2DLHA 2IFFL 5CGMA 4PYHA 1BZ9B 5B3JF 2LU7A 4JY6B 1VEOA 2DQJH 4L8SB 1XIWB 3QDGE 2QR0A 4OLUH 2DQFB 5JPNA 2E6PA 3QRGL 3ULVL 3RY6A 1DE4A 5JXEA 3EFDH 3WE6A 4W6WB 1IAIL 5I1JH 1LO3H 3ME0A 3C5ZB 2YWZA 4GKNB 2CIKB 4LLDA 5TQ2L 4I18A 1CXLA 2DQCH 3W0WD 1DVFC 2G2RB 2C3HA 1U58A 4JFDA 4DZBB 2OP4L 1S78C 4ZODA 3RIAK 5ACLA 2QSTA 2R1XA 4HW6A 4XNYH 4QNPF 1S5IL 2A2QT 3TH2T 1UEMA 3JWOH 3FZUD 5JOFA 2ZG2A 5JPNB 4PJBA 1DE4B 4P3DA 2FD6L 2HMID 3WE6B 1F6AA 1F4HA 4LLDB 2VXUH 4I18B 4HPYH 5DJZB 4P59L 2E7BA 5TDPA 5EWIH 2VLRE 3ULUC 3UP1A 1U58B 5HTSA 2IPTH 4ZFZA 4JFDB 5MEND 4U0RB 3KYKH 1QRKA 3UZVB 2DIJA 2R1XB 2B4CC 4XVJL 1XR8A 4PJHF 5HGHB 1JPSH 2HRPH 4OKVA 3AVEA 3RDTA 2EE2A 5HGBA 5I74C 5T3XE 5DMKA 5I1EH 5JOFB 4JPKH 2OXGA 1EHLL 4PJBB 4P3DB 4F9LA 1F6AB 3EDJA 2VDLL 2AK1L 1WZ1L 3VXOA 4R6UA 2AI0H 1SY6A 3GMQA 1NBQA 5TDPB 1E4XH 4ZO8A 4MHHG 4ZFZB 1QD0A 1LDSA 1FAIL 3T0EE 1J0HA 1T4KA 3RJDA 2E7CA 3OAZH 5I8OL 5L9DH 3VGAB 1UCBH 4OKVB 2DDQH 3RDTB 4OCXH 5HGBB 5E08H 1F4AA 4MWFA 1CTNA 5DMKB 1JP5A 1MRCH 2D7NA 4J3OC 5EC1A 3X12A 2AJZA 5I17A 1C5BH 1ZA6A 2YN3A 3QIWC 3HCVA 3VXOB 3CH8A 1F4XH 3RI5K 2P42B 4DKFH 3VRJB 2ZCHL 4X9FA 3WIHA 1WZKA 1CD8A 2VE6A 1T4KB 3OXRA 3ZE2E 1D5MA 5F7KC 2IWGA 2ED8A 5HGDA 3VI4E 4MWFB 3W9DA 4MX7B 3PGDA 1U3HB 1CK0H 3X12B 4LGRB 2AJZB 5I15L 1DVFD 5I17B 5JW4R 1VFAB 3WNMA 1ZA6B 3UBXG 4G6JL 3HCVB 1S78D 4UIMA 3ZTNL 4WTZA 4W4OC 3RFZC 1UFUA 2PTTA 3LSOA 2VE6B 3FO0L 3OXRB 4RMQA 4FFYL 1ZGLA 3DRQA 4NT6A 3BPNC 2KL6A 3C8KA 5HGDB 3NZ8A 4RAHA 3VFWA 4ZSOB 3W9DB 5MHSE 3PGDB 1ZOXA 3JWDC 1CN4A 2BDNH 2R0LL 4JRYA 1M6OA 3FO9A 3SQBA 1CDYA 3ULUD 1JL8A 3TFKA 1UC6A 4PRHD 5J6GA 4GAGH 3R1GH 1QSVA 3OKEA 3BT2H 1F11A 4OZFG 4XMKH 4JO2L 4WCYH 3GO1L 1MEXH 3RPIB 2PTTB 1NCCH 3LSOB 4I1NB 4M7ZB 1A14H 3VA6A 4HGKC 1DLHA 3MJ7A 3WUWA 1A7NL 4XCFL 3DRQB 1K6QH 4KU1A 4NQUA 4X9IA 2UWEF 1GH7A 1II4E 4NHUE 2MOVA 3C8KB 3MXWH 4LRNH 2BNRE 3NZ8B 3VFWB 4K71B 2RAMA 5LG1A 4MAYD 5DJ6A 3DX8B 2D4FA 4JRYB 2K7PA 1M6OB 1G84A 3FO9B 2IPUG 1EJ6A 1T04A 3OKEB 2YKLL 1F11B 3QA3A 3LHPH 3S88L 1KSRA 1RUKL 3G5XA 2XTJB 3T1WA 1BVKB 3I9GH 3OJ2C 4PPTA 3MJ7B 1DSFL 5TE6H 3WUWB 5EPMB 4CVZA 2VXQH 5GRVK 3MOAL 2MCPH 1UG9A 1FG2B 4Y4FC 3QIWD 4NKDA 1UADC 3IB4A 2AKRA 4P2RE 2X4SA 3UXFA 1HHJB 3MRIA 2WWKT 3MO1A 2RBLA 4P0DA 2N7AA 5DJ6B 4MNQE 2CH8A 2CUHA 2E9BA 1XH3A 1NDGA 1T04B 5E9DE 1J88A 2DM3A 1EVTC 3QA3B 3S96A 2XACC 1EGJH 1QO3B 3BVNA 4TVPE 3BEVB 5LVEA 3G5XB 1MF2H 2BFVL 4DKEL 4CVZB 4NRYA 5HYIA 4KMQA 5CP3A 4XPHH 4JR9H 1AXTL 5DEZA 4NKDB 3T2NL 2AKRB 3MO1B 3C6LA 3A67L 5CZVL 2R29L 4PJEA 1N4XH 5K9KA 2YSSA 1XH3B 1NDGB 3QDMD 4R26H 5FIEA 3VI3F 4OV5A 5IFAH 4RISH 1UM6H 4N0UE 4P9MH 3MLWH 4JHZA 1KENH 2ZUQB 2X41A 1YYLL 5HHVH 4WU5A 3MXVL 4G42A 4NRYB 5SX5H 5T3ZH 1BREA 2UUDK 3SE8H 3WIIH 1ZTXH 1J1OH 1XZ0A 5LQBL 3C6LB 3S9DB 1JNNL 5ABDE 4YHYC 1UM4H 3CFDA 3QB7C 5MI0C 5K9KB 2YSSB 1IAIM 4JFQB 3MLVL 4JM2A 4OV5B 5CUSH 5CEZE 1CE6B 2G5RA 1TFHA 5D7JC 5IBTH 3RY4A 1PG7X 3FB5B 5EORL 1RFDH 4ZUUA 5E8OB 4I3RL 1F4YL 1G7QA 3MCLL 4G42B 3CPLA 1U8IA 1MQ8A 5CEXA 2DYPD 1TCRA 5HXMA 1GGCH 2J4WH 1NL0H 5FM5M 4Y16C 3GSNH 1AGCA 5BMFH 4JM2B 4OGXL 3KPRD 3SOBL 4WV1C 3GBNL 3JWOC 5FGCB 1P1ZA 5I0DA 1BD2E 1M71B 1YYMH 4Y4FD 1J8HE 1OAXH 3CK0H 2VLME 3QXAA 4NHCH 4JY4A 4M1DL 3VD7A 5D7LA 3CDYA 1JK8A 1U8IB 5EUOF 5I1LB 4IBLT 4YGAB 1V3KA 3DXAE 4S1DC 1KCVH 3KHOA 1A0QH 1YN6A 3CDGA 5CEXB 4BSJA 2AJUH 2F15A 12E8L 1TCRB 1NBVL 3WO3B 2P5WE 2F5AH 2QLVB 4PFEA 3MSPA 4ALAL 2J88L 1UWEL 1AGCB 4HMEA 1PVHA 2Y25A 4XCNA 5E2WH 4LSTH 4TN9A 1P1ZB 4E42A 1KLUA 4J4PC 2NXZC 3MGAA 3QXAB 4E9LA 1KCGC 4KZEL 5BV7H 2B2XL 1JK8B 2XN9D 5IB3B 5ITBL 5HYEA 1YN6B 5DVNA 4N8CH 4M93B 5K9JH 1NCAH 2D9QB 4QRRE 4G8EB 4H25A 2A9NL 3H3BC 2XZAL 1GCFA 3CSGA 5I73B 1NUDA 2I5YL 1YEGL 5EOCJ 4KRLB 1H3XA 4HQQL 5DDHA 4UILL 3JTTB 1KLUB 3TPKA 2NCMA 3OPZL 2B1HL 4PRBA 1SVCP 4P2YA 2R1YB 1INQA 1F5WA 2VTFA 3FFCA 4K94L 3Q5YA 3CX2A 4MMZC 1CBVL 3HAEA 3BMWA 1I9IL 3CC5A 4DGVH 4JFED 5D7JD 4H25B 5AG9A 3LB6C 1Q0YH 3BSZH 4Y19D 4YHZL 5J9PA 3LRSA 5IV2A 2FIKA 4PJ7F 1U6AH 1C1EH 4P5KB 4LVEA 3MR9A 2H1PL 2ADJA 4KPHL 1CDGA 4HXAH 5CD5C 4PRBB 1RI8A 5EN2B 1DQLH 4MS8C 3TJHC 1J1XL 1INQB 1YEFL 4HWZA 2OTPA 4LCWA 1AQKH 3FFCB 1VA9A 5ISZA 4Y16D 3RU8H 3RWFA 3HAEB 1G6RL 3UTSA 4LKXA 2C3WA 5JA8B 2OI9A 2C4FT 3WXWL 1QSFD 5IQ7L 3QWRD 4K3HA 4X5WA 3SE9H 4FQCL 1HE7A 1SHMA 1UQSA 3MV8D 5FM4A 5EU6B 3BE1H 5J9PB 3LRSB 5IV2B 2FIKB 3U79A 3U48A 3FB6A 5HHXL 3DHJA 5TQ0L 5JHLL 1H8OA 3MR9B 2ADJB 3NZHH 4AJ0A 3RTQC 4S1DD 1RIVH 3ESVF 3BH8A 2QBWA 4X5XA 4GJTB 4UAOB 4HWZB 4LCWB 1ADQH 3SJVD 5DLMH 4P9HL 2ERJC 3RWFB 1FDLL 4M4PA 3UTSB 1L8JA 1DN0A 5DHVH 4LKXB 1FG9C 3P73A 1MH5B 2YMXL 4R7DA 3UPAA 3EFFB 1OAZL 4X5WB 3EYSL 1FZKB 4J4PD 4JO4H 5C08E 2NXZD 4LLVA 4WGVB 2SEBA 4L8CB 2WP3O 1TDQA 3LN9A 3FB6B 5FYLE 5JXAL 2RB8A 3L9RA 2OI9C 4OTXH 3BH8B 4X5XB 4W81A 3VGGA 2ZCLH 5C0CE 1C12A 4G8IA 2EDRA 4HJJL 3ZKXC 5JIKA 1DN0B 5GQBA 5D96C 4EVNB 3IS0X 4Y8AA 4GXUM 2VUOA 4R7DB 1J86A 3LD8C 5JDJA 2DLFL 1YMMD 3BP7A 4X7CC 2F19L 2SEBB 4OZIF 4X7EC 2AGJH 5GRWA 2BVQA 4LPUA 1D3CA 1BZQK 2FBOJ 5F7WC 3L9RB 1HK6A 4JRXE 2YA0A 1FFPA 4M00A 4U6XB 2F5BH 1TJHH 5ALBL 2COQA 5DA4A 1MFCH 5CP7A 1C12B 1HIML 3SDYL 4G8IB 5IW1A 4PJ8A 3MLRL 2L4OA 4FQLH 4FFWC 3SE3C 3IAGC 1PKQA 3QHFH 3OX8B 2E7LA 1A5FL 1TJGH 3BP7B 4U49A 2R0ZL 3OF6D 3C5JB 3QDAA 5CD5D 4CAGA 5EO1A 4WDIA 4MS8D 3TJHD 4P49A 1T89C 1NFDE 4X6CF 1OB1A 3K4AA 3QIBA 2BVQB 4UTBH 1NCUA 3SKNA 2WUBH 1FFPB 1G7PA 5DS8A 3CFKA 4HIJA 3O4LD 4NQXB 5I1HL 1KEML 2JCCF 2HKHH 5CP7B 4HH8A 4PJHB 4OLXH 4PJ8B 3BP5A 4F33A 4LARL 5HHQA 4U3XA 1BM3H 4AYFA 3GSNA 2HTLC 2QTEA 3RTQD 1TVHB 2V9TA 4KI5D 1N5AA 5EO1B 4WDIB 5DFWH 4RIRA 1YEIH 1GHFH 4LASH 1OB1B 2CKBB 4GAJL 1OW0C 3SKNB 4J23A 4NDMA 2GHWB 2YRZA 2YWYA 4P48A 1G7PB 1TETL 5DS8B 3CSPA 3VFNA 4ERSL 3ET9F 4MSWA 1S9WA 3ZT6A 3TF7C 1B3JA 1J1PL 3TJEL 4GLRI 3BP5B 3V0VA 3SO3C 1NLDL 4F33B 5TFSH 5HHQB 3QIBC 4LPXA 5J3HC 4I5BA 3RVUC 1HSBA 5HHOA 4RGOH 5GSVB 4LFHD 1FNGA 3MOBL 4XVUC 4KK9C 2H3NB 1P5VA 4RIRB 4OF5A 1J5OL 1EO5A 1N5YL 5DURB 4NDMB 1HCFX 5EU7C 5IB1A 2Z8WC 4YE4H 4NWUL 3EOTL 2VABA 3QWQB 3VFNB 1S9WB 5C07D 4NN5B 1VEPA 3V0VB 2P8MA 1BBDH 3B9KC 3VFMB 4M4RA 2R9HC 1JZ7A 2I07A 2NY1B 4E41A 1HSBB 3HC4L 3ULVF 4DN3H 1ZKAA 1FNGB 3FOMB 1CIDA 3S98A 4DUWA 3PV7A 1ZWIA 1NGWA 5D7KD 5D1QC 1IEAA 3B43A 5HI4C 4M6NL 1F00I 4LVOC 4YUEL 3U1SH 2APXA 5IB1B 4G5ZH 3T0WA 1F3DH 2VABB 4UT7L 1FFNA 3CMGA 2X10A 1Z2KA 5DVKA 4DTGL 3HLAA 4M03A 2UWEA 3L3IA 2WINA 2E8YA 4J3UA 5L8KB 5GZNC 1FAKT 4WW2F 1ACYL 1UA6L 2P8MB 1ZLVH 2I07B 4N0YH 3ARXA 3B9VA 3MRLB 5DQ9A 2QSCL 5BV7C 1MAML 4GXVL 4WU7A 2ZOLA 3GHBH 1ZA3A 2IC2A 1ZWIB 3KLDA 2AEPL 1IEAB 3IAPA 4WI7A 4ETQA 5GGVY 1EZVY 1GVIA 4IRSA 5I30H 1FE8H 1BZ7A 3IS1X 4JQVA 4J3TA 4HF5H 4YHNA 1FFNB 3PL6A 3FHAA 1KIPA 3I6GA 4JY5H 3HLAB 2UWEB 3L3IB 2W1NA 1R3IH 5T3ZD 1RD6A 3B9DA 3M17A 1GIGL 5I76A 1FIGL 3LPWA 2VDPL 4IIQC 1LEGA 2H45A 3OL2A 5DQ9B 1QFPA 1WF5A 4HKBA 4WU7B 2ZOLB 5C7XH 3OKMA 1ZA3B 1FRGL 5IK3A 4Z0BH 4ODTH 1MCHA 4ETQB 2GSIA 4DGIL 1BGXL 3MLYH 1CVRA 1F8TH 1BZ7B 5EBGA 5GJTH 5J3HD 4YHNB 3FN0H 3QCTH 5D5ME 1J9CT 3PL6B 3LZFH 1KIPB 2GI7A 3I6GB 3RVUD 2DM7A 1BJ8A 5SV3A 3NCJH 3UJIH 3WNKA 3M17B 4D9LH 3S37L 4U1LA 2VLKA 5ETUA 1LEGB 1QRNA 5KSVA 1YPZF 4IRSC 2EDKA 4MXQA 3OKMB 5IK3B 4RFNC 4F80A 3IGAB 1TQCC 4X83A 2DM4A 2GSIB 2XZCH 1EEZB 5EZOH 1KJ3H 2VUYA 3MUHL 2IANA 35C8H 2EIEA 4M8QB 3I84A 3NACL 5B38G 3B9KD 3VFVA 2HVJA 2R9HD 2PF6A 1ZEAL 4HZAA 2LTQC 1AGFA 1PFCA 3T4YA 2QHRH 3QJFB 4QYOA 1SEBA 3Q2CA 2VLKB 5HY9A 5D1QD 5HI4D 2R4RL 1CD9B 5ETUB 1QRNB 5KSVB 2ITDA 2VRAA 3QUYC 2OJZH 3NFNA 2F54D 4PRIE 3WFEH 1IGMH 4WEMB 4XTRC 4AT6A 5D70L 3FT4A 4L3EE 5EOQH 5GZND 4UI2A 1GL4B 4G6KH 3EDKA 4D9RD 4PJGF 4PJ9B 3WD5H 4XMPH 3VFVB 1DN2A 4CMHC 1MJJA 3P30L 4NM4L 5L2JA 1EZVX 2KQMA 2V2TA 3T4YB 4D0DA 4PTUA 4WEBH 4QYOB 1SEBB 4TYUA 3F7VA 3O6KL 3ARFA 1JNLL 1O7VA 2ITDB 3UTTA 3ZDZF 1T3FA 5TGBB 5C0EA 3DVGA 5B8CB 5GRVL 2OZ4L 4KTDL 4Q9RL 4AT6B 1AJ7L 4ZUTA 3FT4B 3OAUL 1GJIA 4LLUA 5F93C 4HFWA 4XH2A 1H3PL 4TNWK 1MJJB 3DUHA 2PW2A 3QZWA 4V1DE 4D0DB 4PTUB 1J0JA 5HD8C 4Y89A 3E6HA 4POZD 3ARFB 5I1GH 2IG2L 2A74B 4I48A 5HVGB 1T3FB 5C0EB 5JR1L 3HI6H 4QKXB 5DRNA 5GGQH 2VZTA 4ZUTB 3NIGF 4NKIH 3VG9B 5KVMC 3DRTA 1U8PA 4LLUB 1Q0XH 3BKCL 4NO0A 5DI8A 4PDCE 4HFWB 2RCSL 4XH2B 3GBLA 1JYWA 1TPXB 4KUZH 5F1SA 1IM9A 4LQFL 3AM8C 4EUPA 1HZHH 3WCYA 4C56D 1MVUA 1EEYA 4F57L 1G9NH 4PJCA 5EZLA 4NFDA 4I48B 3E3QE 4I0KA 2IBBA 5ANMA 1IGFL 3WDJA 5IBUG 3IXAA 1M7IA 5CSZB 5DRNB 1A6WL 2GJ6D 3DRTB 1U8PB 4NO0B 5DI8B 1E6OL 2VLJE 1IM9B 1R5VA 2A73A 4PGBA 3QUYD 3BKJL 4HCRH 4JPIA 1HINH 2DLTA 1CT8A 1MVUB 1SJXA 3SKJH 1EEYB 1CDHA 3VXRD 1U8QA 5EZLB 1CLYH 4WFEE 1NFIA 1K8DB 3UJTH 4Z95L 5ANMB 5DQDH 2R2BA 1M7IB 5B3NA 4L1HA 3GUTA 3SCMA 3P9MA 4FQXC 3RBSA 5JTWA 3EO1A 1LO4L 2E3VA 3LV3A 2AJVH 3GRWL 3MV01 1R5VB 2A73B 3B4NA 4PGBB 1MJUL 5IVXF 4JPIB 1T1XA 4AM0A 1CT8B 4H26A 2DD8H 4H5SA 5IWLC 1EAJA 3TZVA 1MIML 5FYKU 1U8QB 2ZUVA 3MLZH 3E2HC 3P4MB 4U6TA 3M07A 4PJ7B 4K3EH 2R2BB 3BISA 4AG4H 1A6TB 1H8SA 3B5HA 3UO1L 3GUTB 4NQDE 5GS0H 1HHGA 3QXUA 5E6YA 3P9MB 1JGLH 3WFBL 1B0GA 4Y2DA 1G9EA 3EO1B 5HD8D 5ESQA 3MRMA 3LV3B 3A6BH 4YC2C 4GRWH 1QSEE 3RWGA 2HT2C 1RZFL 4PBVC 2EYRA 4UINL 1T1XB 4AM0B 4WGWB 4H26B 4H5SB 1K3IA 2GJZB 1MFAL 2EXYC 3GSUA 3TZVB 4PLKC 5GGRA 3SCMC 5BZWA 1L0QA 4I3GA 4G7YL 3VGDA 5EO0A 4UT6H 4IOFC 3QFJD 1UH4A 3B2VL 1DQQB 3BPOB 3MROA 2ADGB 2IMMA 1JNHA 2DICA 5IB4B 1HHGB 3LQMA 4IRJA 1B0GB 4Y2DB 1IGJA 5FEBA 5ESQB 3DYOA 4WEUD 5I6XC 2F53E 3MRMB 4L9DA 1I1CA 1S3KH 1I1AC 4Y1AE 2VDRH 3RWGB 2EYRB 1RIHH 1XF2B 2OR7A 4BH8A 5IFJA 1YEDB 3MX0A 5BXFA 3QQNA 3GSUB 2XZZA 3G6JA 5BZWB 3BJLA 5C2UB 3ZHDA 5IBLC 4OZIA 5EO0B 2Y5EA 3FMGH 4OF0A 5FUCE 1JNHB 3QO1A 4IRJB 4YAQA 4P5MA 5DRZA 1IGJB 4LSRH 5KOMC 3O2DA 4EIGB 5HDBE 4OZHE 4TSBH 4QCIA 4ELKA 4PD4J 1F58H 3MPCA 1PEZA 3QHZL 2DWEA 2B7DT 4FMFA 1KN4H 4YXKH 4UT9L 4D8PA 3GEWB 1ITBB 1A4KB 1MJ8H 4JHBA 3G6JB 2OYPA 5GS2H 5MEQB 1P7QD 5FGBA 4FQXD 2J5LC 5IHZA 4OZIB 4FFEX 3KYOA 3QO1B 4PP2A 8CGTA 2CDFA 2ZZUT 3MRFA 1OP5K 3IDXL 3QI9C 3NFSL 4YAQB 4P5MB 1BAFL 5DRZB 2JCCA 3CVHB 4ELKB 3KPSD 4QCIB 1KPVA 3L5HA 3RIFF 4HK3J 5FYJL 5ADPH 2ARJA 2NY5L 2DWEB 1RHFA 1CFQA 5J6HA 4HIXL 2XV6B 4D8PB 3OKOB 3D9AL 2VXSH 3O41A 4M7KL 2R8SH 1YECL 1JPGA 5IHZB 1EX0A 1IBGL 1A3LH 4NC0B 3KYOB 1JWMA 2VXTL 1I8LA 4PP2B 2CDFB 3MRFB 2HT2D 1PSKH 5E5RB 1WGOA 2R0KH 1TZHA 2PYEE 4U0QB 4HJ0C 1NC2A 2JCCB 3B5GA 4GMTL 4S1RL 2EXYD 1KPVB 3W0WE 4PLKD 5GJSH 1W0WA 1S7SB 2ARJB 1SEQH 2P47B 3QUKA 4R90L 4L29A 4LHUA 1E6JH 1CFQB 4IOFD 3TVMA 1KG0A 3Q1SL 1GC1L 3CLEH 3BGFC 3VXMB 2D3VA 1JPGB 3GI9H 1CL7I 2W07A 5ENWB 5IVZA 3BWUC 2EDOA 4JDTH 3TN0C 4DK3A 3TESA 1CXIA 1Y0LA 4RDQG 1I1AD 1P7KB 1ZLUK 4XAWH 4XHQA 3F5WA 1U8LB 4HFUH 4YBQC 2YPLE 2DBLH 3QPQC 3TO4A 2MQ3A 3DTXB 4MHHI 1FN4A 4IDJL 1W0WB 3EDFA 3QUKB 5IBLD 2ICWB 4ONGH 4L29B 4LHUB 4M5YL 5AUMA 5MENE 4LPVA 1HWGB 4P46A 3TVMB 4PR5A 1KG0B 2Y1VA 4PP8C 1NCBH 5D7IE 4TQEL 2EDQA 2DIBA 2YD1A 3HTLX 5IVZB 1LEKB 1QYGH 4X9GA 1Y0LB 5IMOA 2P5ED 1YEHH 1FNAA 4U05A 3F5WB 3LQAH 5INDA 5J06A 3V0WL 1E4WL 2Y4SA 4XHJC 5HYJD 3TO4B 4OD1H 1R5IA 3BYYA 3GGWA 3GSVA 4UIKL 1BQHA 3OGCA 1QA9A 5ALCH 3L3DA 4FABL 3O11A 3EOBA 4P46B 1AC0A 4PR5B 3QUXC 3D3VD 3O2VL 3S34H 3QI9D 3QNZA 4WTZG 5A3IC 3UAJC 3S7GA 5DVOA 1PZ5A 3S8WA 3MLUL 3QUMH 1QVOA 4F58L 5IMOB 2GK2A 1JUFA 1G9NC 2BZDA 1KEGL 4KC3B 1P4IL 5INDB 4NUGH 4PJIE 3CFCL 3G9VA 2B0SL 4UNTA 1JI2A 4LCCC 3GGWB 3GSVB 1BQHB 1NMCC 2AW2A 3OGCB 4MD4B 4WW2B 4JFXB 4LU5L 4XP4H 4CN1A 3KJ6L 3O11B 3EOBB 1RZJH 2NLJA 1CDCA 4N5EA 1KIQA 5E2JA 4FQ1H 3D48R 1LQSR 4XVTL 3QNZB 4U6VL 1PZ5B 4HJ0D 5DD5H 4WFHD 4XNMA 3WUWG 1SJEA 4JVUA 3T3ME 1GGIL 1RZ7L 1A4JA 2WWKO 4ONFH 5KSBA 4U2ZA 4HKZB 4AMKL 2FB4L 3MGTA 5GRJL 4PS4L 1TXKA 1UZ6F 4JQIH 4JKWA 1CYGA 1XR9A 3TN0D 2NLJB 4JFPA 1KIQB 1QFWI 4X9BA 1EH9A 1YPZA 1FFQA 4HBCL 3O9WC 1YC7A 4OM0L 1D6EA 4LVNB 1KPRA 3QPQD 3IJSA 2GITB 4XNMB 1BQLH 1SJEB 3AB0C 2P46B 4QOKD 3MRBA 1UXWA 3RWHA 4TRPH 1JHKH 1R24A 2I27N 3SDXE 1A4JB 4LLAA 5KSBB 1I9EA 2PW1B 3MGTB 5D6DC 3IDNA 2CRYA 2A1WL 3D5OF 3JSSA 4U3CA 4JANA 1Q1JH 2YA1A 5GS0C 1XR9B 3FTGB 2EDEA 4JFPB 4NRXA 4PJDA 1YPZB 1D6EB 2NY6B 4XC3H 4XHJD 1KPRB 3IJSB 5J12C 4WRLA 3OKDB 3RA7L 3F58H 2YD3A 5T3XH 3MRBB 1UXWB 3NCYS 3RWHB 3WS6A 1R24B 4PLOB 4PJGA 3N85H 2B5IC 1CFBA 3QUXD 3QXTA 2A38A 4BQCA 4JAMA 1YQVL 2BSRA 3H6JA 4XP5L 2MCG1 5I71C 5A3ID 3UAJD 4JANB 4DOHE 2JB5L 3BMVA 3FQNA 4JEGB 4NRXB 5JMOC 1FNHA 2NY0C 3VW3H 5KS9E 4P3CH 1FIEA 5GGSY 1FVCA 3WLWC 2BNQA 4GKOA 3RGVC 4PUBL 1OSPL 2Z92B 4K23L 5JOPD 5BVPL 4IOSD 4PJGB 2X4PA 4Z18A 4RSVA 4HKJA 2HRLA 4L4VA 3UJJH 3K3QA 4CVXA 4JAMB 2BSRB 1OT1A 2P4AB 4G9DA 3BD3A 5IP4A 1JGVH 2Y6SC 3GJFA 3FQNB 4RBPH 3MV7A 5AYUL 3MRRA 3QXDA 1XGYH 4Y5XC 4S2SA 3B8SA 3V6OA 5HSFA 3VRLF 5L7XH 1W0YT 2DQEL 1E4XI 4X8JA 1FVCB 1U3HD 3ESUF 5C0BB 2BNQB 3NIDE 4WUUE 2ZPKH 5EZJB 1G7MB 4KK6C 5CAYB 2R2HA 3L6FA 3QDME 5DSCA 2D7TL 2X4PB 5AZ2L 5K33A 1I8KA 4L4VB 4CVXB 3UDWA 3O9WD 5L6YL 4G9DB 3KLHC 4M5ZH 5JHDE 3EYFA 3NCBB 4KKAC 3D2UD 1A1OA 5CFHA 5C0AD 3GJFB 3GMPB 3MV7B 1NLBL 1DFBH 3QXDB 1I75A 4P5TC 4S2SB 4Z7WE 3DMMC 3HRPA 1NGPH 1F4WH 3ZHLA 4M48L 2R15A 3QPXH 4X8JB 3S3PA 3U30C 1LP9E 3P4LA 4NN6C 3MRPA 4ODSH 4X5LA 2CLZA 2R2HB 3GMNA 5DSCB 5GS0D 4OQTH 1J10A 3B83A 1I8KB 1RZGB 3JV5A 3OZ9L 4YK4B 4ZFFA 4BK5A 3EHBD 1AR1C 3T0BA 2AABL 2DJ4A 3EYFB 1UH2A 2I9TA 3TA3C 4LCIH 3W2DL 5KJRH 1CGXA 4C59B 4B5EA 1Q94A 2CK2A 3MRJB 5DVLA 1D6VL 3ZT7A 1KFAH 4CW1A 1EO8H 4YDLB 4XP1L 4G80A 1WT5A 2R2EA 1RJZB 4JZOA 5CZXC 3MRPB 4NKOA 1MCNA 2AVGA 1L7TL 3GKZA 3J7HA 4K8RH 3KPRE 3D39A 3I2CL 1MFDL 5I1CH 4EDXA 1MHCA 1B4JH 5DJXA 2NY0D 4CJ1A 5IVXA 4DJMA 1AFVH 2I9TB 3WLWD 3MCG1 4R9HA 5SWSA 3RGVD 1QKZH 4G6FD 2PCPA 2XT1B 1FSKC 4KVCH 2CMRH 4RFOH 4BELD 1TIUA 2W9LA 2YPVH 2NR6C 1JZ8A 2R69L 2R1WA 4CW1B 4OBSA 3O45B 1ETZA 5CIPA 4P2QD 4MJIA 4CU6A 4G80B 5I75C 5F6IB 2EC9U 4JZOB 4P57A 4NKOB 1JPTH 2I60H 1ZAGA 2VDNL 4EBQL 3EJJX 1HOCB 3HAEG 3D39B 5C3TA 4Z76A 1FYTD 4EDXB 1MHCB 5DJXB 4POYA 4X9HA 5IVXB 1W8OA 1WBZA 3K81A 2C5DC 4LEXL 2NXYB 3TBYA 3LQAC 1WQVT 1WT5C 1I9JH 3G5ZA 4YFLI 2PCPB 2XN9E 4OLWH 4KK6D 1I7UA 1F2QA 4CNIA 2MKLC 3H7BA 4CVUA 5GS2D 1JYNA 5BW7A 3ZL4L 1ETZB 4O9HH 5CIPB 4MJIB 4NOBA 1NSNH 1OAUL 4P57B 1FZOB 3BQUA 4KKAD 5LBSL 2D03L 5FYKD 3THML 5F9WB 3QDJA 3RWIA 3DLQR 4XP6H 4P5TD 3DMMD 3U4AA 3MJ9H 4JZJC 4NQCE 4TVSa 2X42A 3LMJL 4AEIH 1IE5A 4EI6A 1KULA 2YZ8A 5C8JB 4MXWH 5CBAA 1DZBA 3G5ZB 3PDOA 3JTSB 3PP4H 1I7UB 4CNIB 2X7LA 5DD1L 2VL5A 3H7BB 2FHBA 1P53A 2YD9A 5DHYA 1K8IA 1EXUA 1R0AL 5EIVA 2J6EL 4JFEE 4JCMA 1RZJC 2UZIL 1EPFA 3NTCL 3SQOL 3BQUB 1AR1D 5F1OB 4BQ8A 3QUZA 3K46A 4Y19E 4WTXA 3TA3D 1OGAB 3QDJB 3RWIB 1DBKL 2OXHA 4CN4A 5D6CB 5SX5K 2AERT 4EI5A 5CEZH 4NC2B 5BW7C 2D31B 4EI6B 5J0BA 3K7UA 5F96L 1A47A 5CBAB 2KH2B 3MJ6A 3PDOB 5CZXD 3SY0A 1K85A 4ZFGL 2VL5B 4WFGD 5D2NB 2VWEE 5DHYB 3PIQA 1EXUB 1FPTL 3SDAA 1QSFE 2A9MH 1T83A 3LAFA 2VISA 5E6ZA 3HNVL 5TE7L 5EZIL 1P6FA 3MV8E 2AJSH 5FHBH 3DSFH 5ADOH 2HT4C 3V52H 5HI5C 5DD0L 2Q7YB 3CAFA 5C0NC 1NAMH 1JGUH 2C3VA 1MFBL 5C6TL 2NR6D 3DX7A 2R0WL 5HYQB 4K7PL 4GW1B 4YWGH 1KXVC 4QRPD 3T0EA 2D0FA 1LEIA 4FQIL 3ARGC 1MRDH 2FBJL 3QUZC 3SY0B 4PJXE 2I9LA 5HGAA 1WLHA 1T5WA 1OT2A 3ZDXF 1QR1A 3MUJA 3PIQB 4MB3A 2VZ1A 4OAWB 3SDAB 4L5FH 3HG1E 5A1AA 3IXTA 2VISB 4NIKB 3RZCC 1T6WA 1KCUL 1ZHBA 2YRPA 3P0VH 2N1KA 3VGFA 4HK0A 3J8F7 3ULUL 2C3VB 4O4YH 3DX7B 2VZSA 5I8KH 4OSUH 4UV4L 5ICZA 5EH1A 1SQ2N 5K9OA 2VAJA 1DBAH 3DECA 4RWHA 2I9LB 1SBBA 1T5WB 4W4NA 1QR1B 1MRFH 1P2CA 1YMME 5D8JL 2K9UA 3IXTB 4GS7C 1DBMH 1ZHBB 3Q0HA 3T0EC 2ADFH 4FOMA 3ZTJG 3LKSA 3WFDL 3MV9D 4ODWA 3ILPA 1ZV5A 4QTIH 5ICZB 1UWXH 4LSPH 3ZE1E 3A0OA 5K9OB 3D6GA 1K4DA 3F62A 3U9PH 2CJUL 4WI3A 4GSDH 1KCLA 3CVIL 2NY2C 3H9ZA 3V5DB 4ZQKA 4KJPC 2QSQA 3QDGD 1RZKH 1UYWL 3JZ7A 5DJ0B 3LKSB 5F7HA 1A6ZA 1Z9SA 4ODWB 2EDHA 3ILPB 4RMUA 3BRDA 4MQXC 1KUMA 3QIUC 1G1YA 4YZFE 3T77B 3MNVB 1AGEA 2Q86A 1NGQL 4DN4L 4X6DF 2NMSA 1E27A 4NHUA 4RAVA 1K4DB 2DQUL 1FZJA 2NTSP 3GKWL 1NAKL 1SY6L 2HT4D 5HI5D 1I7RA 4S1SH 5C0ND 1VADA 2W60A 1NFKA 4KI5E 4ZQKB 4FNLH 5EU6D 2DIAA 1KB5L 4Y0GA 5E4EC 5D93C 5HDQL 4PRDA 4V2BA 1A6ZB 2X6MA 5C0JA 4JG1H 3ARGD 3H3PL 4ODUA 5ESVB 4A6YH 2PO6C 1HKFA 4Q0XH 4EN3C 3B9AA 5E70A 2KZ1B 4QHMA 3NH7H 1LO0L 1RVFL 1MFEL 1E27B 1PEWA 2JJUA 2VLRD 1OTUC 3SKUD 3RZCD 2L7JA 4NHUB 1CL7L 4RAVB 1U0QA 2XA8H 3JWDL 1FQ9C 5H94A 3LDBB 3GSQA 1I7RB 3HHRB 4M3KB 1PD6A 1I3UA 3QR2A 1VADB 3MRGA 2W60B 4XBPA 1MJ7L 3SE4A 2WAHA 4RFEA 3V4VL 3QRFM 4MNQA 5DZNA 2AS5M 1UJ3A 1AO7D 4ZOBA 5T3XD 5DVMA 5C92A 5E9DA 3LEYL 3QAZC 5JQHC 1AIFA 3WNNA 1I7ZB 1C16A 1U3JA 1XFPA 2QQLH 5DR5H 1M4KA 5C0JB 4GRLA 5FYLH 5KSAC 4LPYA 5F9OH 4QHMB 3HB3C 1AD9A 4K8RC 1NMBL 4Z7UE 4OF6A 5JLZB 1YC8A 1U8HA 2QL1A 4OQ1A 3R06A 3GMRA 4JLRA 4R4FH 3GSQB 1FL6A 3V9FA 1WWBX 5C0RL 2MPAL 3BZ4A 4XBPB 3U6RA 4MA7L 4Y88A 1MIEH 4RFEB 1FV1A 4MNQB 5E24E 1UJ3B 3OG6B 4OCSL 5E9DB 3LPFA 3V7AG 1AIFB 4J6RL 5D7KE 1U8MA 2QKIA 1C16B 5DXWA 1QBMH 4GRLB 4OCWL 3TGXA 4GG6E 5IVNA 4H0IA 3LS4H 1AD9B 1LO5A 4PJ5A 1N2RA 2EDTA 2NY2D 3PXJA 2OR9H 2QSVA 5F3HA 4KJPD 2N4IA 1HXMA 3R06B 3GMRB 4JLRB 2V17L 4XPAL 3OHXA 5C0FB 4JPWH 3HI5L 4L4TE 4P23A 3QCVL 3VDAA 2FRGP 4MQXD 2CXKA 1S9KC 1KCSH 2YUWA 3QIUD 5IMKA 5EOCL 5BS0E 1U8MB 2QKIB 5E2TL 4JHAL 5E2UL 4MGXA 5GGTH 3T8XA 4Q9BA 5HHPB 4PJ5B 4PG2C 2FX7H 3WNLA 1T03H 5F3HB 1GGTA 2G60L 2EEAA 3VXQA 5IFHL 3PGFL 1YEEL 4DVRL 1HXMB 4MVBD 5M95B 2XQBH 1IAKA 3ZE0E 2BVOA 1IQWL 4PD4K 4P23B 3IDYC 2PO6D 4NM8L 2YD6A 3X3GL 4EN3D 5IMKB 1JYXA 2YD8A 5ILTL 5GZOC 1T66C 1VACA 1YEJL 4OB5H 4P4KB 5DT1H 1OTUD 3T8XB 2BY3A 1J8HA 4ZPVB 3UYPA 3OV6A 4PLJC 1QFWL 2XZQL 4MNHA 4OJFH 1IL1A 4NSKA 4H1LA 4M6OH 1YNLH 3DXAA 5MEOA 3GSRA 1IAKB 3L5JA 1KJMA 3ISWA 3TT1H 2Y06L 2P5WA 3OXSA 3FQRA 3MNWA 3T3PE 3V4PH 3ALXA 2BNRD 4GG8A 5KSAD 4FS0A 5AD0B 1B6DA 4HX1A 2DQJL 1OAKH 2OCFD 4K8RD 4HUVA 4OLUL 4W6XB 4GW4A 3CVHH 1IT9H 5I1JL 1LO3L 5D4QA 3DYPA 4R96B 1UZ8B 1RU9H 2AXHA 4MNHB 3DO7A 1IL1B 4NSKB 4H1LB 2ZSVA 1CQKA 3NCYP 2DQCL 2FLBT 2FYYA 4FZEL 1PLGH 4UBDC 5MEOB 1T20A 5F7DA 3RL1A 1KJMB 4HGMA 2HH0H 1WIPA 4Z7VF 3E8UL 3OXSB 1T22A 3MNWB 4XNYL 4LIQE 4GG8B 4P2RD 3NA9H 4HX1B 1CXFA 2AV7A 4HUVB 5D1ZA 4GW4B 1KCRH 2P43B 3L5XL 5HPOA 3V0AC 4XPFH 2W9EH 4D9RE 1P84K 5K93A 2EZ0C 4UZGA 2E27H 1MCOH 5GS1A 1HKLH 1WEJL 5GISH 3DO7B 1WISA 2VXUL 2ZSVB 1QSZA 4HPYL 5FDYA 2FYYB 1T20B 5EWIL 1XEDA 1S7VA 5F7DB 1X5ZA 3INUH 3KYKL 4K9EH 3F6IA 3MRHB 1T22B 5CJ5A 4Q58C 1JPSL 2HRPL 2HFTA 2Q8BH 1CLZL 2AV7B 5I1EL 1K5NB 3GI8H 4JPKL 5D1ZB 4WJ5A 1J12A 3PF2A 2Z8VC 5IKCA 4X0KA 1OVZA 3NA4A 5GS1B 5HPMA 5M7QA 3IDUA 3AY4C 3QG7L 2IQ9H 4F2MA 3I3BA 3RBGA 1X5JA 1RUMH 1E4XL 1VGEH 5GZOD 1T66D 5CSGA 5F7LB 4F37K 5L9DL 2H6PB 1UCBL 2DDQL 4KROB 2VH5H 4OCXL 4PLJD 5E8DH 1U95A 5EU4B 4WJ5B 1EUTA 3BESR 5IKCB 4KRMB 4X0KB 3V8CA 1C5BL 2YA2A 1G0DA 4PJAF 5CEZD 5A2LH 4GBXA 1IGYA 1RZKC 4HMDA 5HPMB 1IAOA 1F4XL 3F8UB 4DKFL 4F2MB 2VNCA 1HH9A 3LKOA 3KGRA 1KTDB 4C56E 5L2KD 3ULVH 5KVGH 2YXFA 4H0HB 3TYGL 4J2XA 2ZSWA 5JIPA 4M62L 3KPLA 3W82A 2CSPA 1I85C 5KVDL 2IGFH 5T5NF 4B50A 4IEFB 3NVQA 1U95B 2FL5A 1CK0L 2BXYA 3D87B 3HZVA 2GJ6E 2CDGA 4UBDD 2OP4H 2EIDA 1A3RH 1DP0A 2YRLA 4GBXB 1IGYB 3T2OA 1BD2D 1IAOB 2VLMD 4U1HB 3LKOB 2ITCA 1CDBA 3DOSA 2BSSA 2ZSWB 4PRPE 3VXRE 3KPLB 1AHWB 3QJHA 4GMSH 2EZ0D 4LSVH 4OF7A 1EIBA 2GCYA 1RK1A 2BDNL 3HZVB 3IFNL 4JRXA 4PJ9D 5IJVA 3BJ91 3BPLB 2J3SA 3MA7A 3BYTA 3R1GL 4GAGL 4XVJH 3BT2L 4XMKL 4WCYL 5EIIA 2JIXB 4QRQA 1MEXL 5LGKA 1NCCL 3HE6A 2HJLA 2IBGA 3FQTA 4Q9CA 1MLBA 4BH7A 1BIIA 2ESVD 4QXWA 4Q9QH 5C09A 1BFTA 2XA3A 1K6QL 3QJHB 1KLFA 4LRNL 3MXWL 4QRRD 1NFDA 5BRZE 2GCYB 2X70A 3VGEA 3EAKA 1ZGLM 1RK1B 3PDGA 1LQVA 4NZDA 5F88A 1GOGA 1ZSDA 1JPST 1FAIH 3VWKC 5IJVB 1MCPH 2VR5A 2AK4A 3MA7B 1DLFH 3LHPL 3N1GC 5EIIB 4QRQB 2EKJA 3HE6B 1UENA 2HJLB 3FQTB 5I18H 2AQ3A 1HHKA 3I9GL 4MA1C 5TE6L 4BH7B 5J13B 4F7MA 2VXQL 4WUKH 5C09B 3MYZA 5GPRA 1N6VA 4H88L 4JJHA 1YY8A 2X4NA 2X70B 3MGOB 1LWRA 5F88B 1ZSDB 1Z3GH 1MCJA 4D94A 2JJSC 2AK4B 1FL3B 3H0TA 4P2OA 1MPAH 2Q3ZA 4JPVH 3BZDA 1EGJL 4R97B 4B41A 4GKSA 3MUGA 1MF2L 1VGKA 2D2OA 1EO7A 1HHKB 2I26N 2GYSA 5IB5A 5TF0A 4F7MB 3HMWH 2QHLA 5LXGH 1OL0A 2LU3A 1A7OH 5E8PB 4XPHL 4JR9L 3S6CA 1EAPA 3C08H 3ZTNH 1F97A 1HYSC 1YY8B 3LKRA 1SJVA 4L3AA 1KBGH 3BUYA 3GSWA 3PWNA 2UZYB 2GK0B 2X4NB 5CHNA 4ZNEE 3U0PB 4NQEA 5JUEH 3OJVC 4RAUA 1MCQA 2BY1A 4UQ2A 4WFFE 2Z31A 1N4XL 4HUMB 1DJSA 2LQRA 2MNUA 3KXFA 4R26L 3SDCB 3H0TB 4P2OB 3EO9H 5IFAL 5FKPB 1UM6L 3QQ9C 3FO1A 4P9ML 1QFWM 3MLWL 1KENL 3TC9A 4HG4J 4GKSB 1LDPH 3MUGB 5HHVL 5E5UB 3ARRA 5D2LF 5IB5B 5T3ZL 2WMPA 3DHMA 5IJKA 1JV5A 1ZTXL 3LKRB 4OI8A 1PG7H 1J1OL 3GO1H 3BW9A 3PWNB 4LHUG 4NQEB 5C08D 4RAUB 4KFZC 4UQ2B 3HUJE 2Z8SA 2Z31B 5J1SC 3V6ZA 3KXFB 3HFMH 4HK3N 3JTCA 4KQ4H 5FYLD 4X6DA 3KPSE 3FO1B 2Z35A 2JTDA 5CUSL 2ICCA 3UTPE 1RFDL 4I3SH 5C0CD 2O61A 5DHXB 5DMYA 1IC1A 2C4FU 3TLRA 5T1LB 4XCYB 2AQ1A 3VWKD 3MYJA 2ZNXA 1B88A 1JV5B 3G5YA 2XKSA 3BW9B 3S88H 3NPSC 4G43B 2VYRE 1GGCL 2J4WL 5CD3B 1NL0L 4IMKC 3O3BA 4OIIH 4M9PA 4Q6IC 4XX1G 3GSNL 3V6ZB 3VXSD 5BMFL 4X6DB 4WWID 1F3JA 2W92A 4ZXBC 2Z35B 5H2BA 1A6PA 1KACB 1YNKL 2DLEA 3MFGB 5SWZE 1KTKE 1YYML 3CK0L 4XB7A 4Y2OA 4O2EA 1PYWA 4NKQB 1U8KB 1BQHG 2XFXA 4LLMA 4JCLA 1N6QH 2V7HA 1A0QL 3G5YB 1JNJA 4YDIH 2AJUL 3VA2C 2VXVH 1MCFA 3AC0A 3FB7A 2F5AL 3I50L 3O3BB 1IRAY 4K9EC 2YD5A 4JFFA 2NX5A 2E7HA 3NGBB 3SBWC 1F3JB 5D5MA 4LSTL 3RAJH 3NOIA 1FJ1A 3VG0H 3T2NH 3X13A 2OL3H 4KK5C 1CLOH 2UYLA 1FORL 1WWCA 3D85A 1PYWB 5BV7L 4OFYA 3O8XA 3V7MA 2XFXB 4LLMB 4M7JH 4CADA 1P7HL 2V7HB 3T2PA 5KZCB 4C83A 4N8CL 4MYWB 3QQ9D 4P3WA 4F9PC 4QEGA 5K9JL 3O3DA 1NCAL 2AEQH 2P5EE 4I0CC 1QLEH 3S35X 2CK0L 3RX5A 3FB7B 4DKDC 4NOFA 1L4IA 5JO5A 4JFFB 3ULUF 2NX5B 1UM5H 1MCBA 2C7UA 4QHUA 1XGPA 4FP8H 2Y72A 1M05A 2CO7B 3QISA 3X13B 3N9GL 2RFXA 4XPGH 5IB2B 2UYLB 3O2WH 3D85B 3ES6A 1SJHA 3O8XB 1DQML 3MZGB 4C83B 2KZWA 4IS6A 4DGVL 3ULVC 2X05A 3PWLB 2WNGA 1F4YH 5JO5B 4L3EA 4QLRA 1SYVA 2FGWH 3BSZL 4C58B 2C7UB 4QHUB 1XGRA 1XGPB 3HC3H 1M05B 1U6AL 1C1EL 1MREH 4YFEA 2X4UA 1ITCA 3O81A 3PWPA 2RFXB 1DQLL 4XNQA 5CS7A 5JNYA 1G7HA 3ES6B 1SJHB 1AQKL 1OGTA 4MD5B 3U0WH 1WAAE 4OGXH 4WW2C 3V2AR 3SOBH 3ZLQC 4W68A 6FABH 1INEH 5DJAA 5DTFA 4WFHE 3KS0H 4NFCA 4IS6B 3QQ4A 4ZXBD 3TBTA 4R4NC 4KXZH 5TF1H 4L3EB 5CEYB 1ZHLB 5C6PB 1SYVB 4AY0A 3BPCA 1T0MA 3BE1L 3LH2H 1ZVYA 2J8OA 3PQYB 4M8VA 2X4UB 2VERN 1RIVL 3PWPB 1R6VA 4XNQB 3L3JB 4X99A 3VXMD 4GQ9H 5JNYB 2J88H 4X6EA 1G7HB 5DC4B 3BAEL 3WSQH 5DLML 5DJAB 1C7SA 3QQ4B 3TBTB 2BVUA 4QOKE 1P4LA 2IAMC 1LGVA 3ARBA 3B6SB 4KV5E 4XWOC 3MODL 3UPCA 4JO4L 4KK5D 2DBJA 4ZAKA 3BPCB 1T0MB 4OD2A 4BJLA 3ECBA 5LCVH 1A7BA 1BIHA 3NABH 2CRMA 1MQKH 3KYMA 3C60A 3IFLH 4OTXL 5TE4H 2FR4A 5FK9A 5KVFL 4Z7VA 2XZAH 9CGTA 4X6EB 3GM8A 3D1MC 3WL9A 2ZCLL 5DMGD 3U7WH 1IM3A 5FGRA 3TPUE 4XNZB 3RWDA 1CGUA 1PBYA 4HQQH 3E3QA 1A9EA 4HIEA 1T6VN 1P4LB 2B1HH 4ONHA 2F9BT 4Y4HA 3ARBB 4IDLA 2NY6C 4P4RA 4ZAKB 1JMXA 3BO8A 5E95B 4OD2B 1TTGA 3RVTC 2AGJL 2ZWLT 1WFUA 3ARDC 1I9IH 1BECA 2NTFB 1OARH 3HNSH 3KYMB 3C60B 1CGTA 5FK9B 4Z7VB 1TJHL 3BKMH 3ULVD 2ICEA 3WXVH 3WL9B 1IM3B 1MFCL 1CICB 5LAXA 3RWDB 2PUQT 1RQ5A 2CR3A 4HUXA 4FQLL 1A9EB 1X7QA 4HIEB 5ID1A 4YXHL 3QEQB 5JOPE 1TJGL 4ONHB 5FO9A 1J1XH 4KJQC 2XPGA 1YEFH 4P4RB 3HI1A 1BEYL 3BO8B 4KDWA 1WFOA 1FO0H 3DBXA 1G6RH 4UTBL 3P4NA 5D72H 3W11C 2WUBL 4Y5VC 1JZ4A 5IQ7H 2QADC 2BVTA 4FQCH 1ZVSA 2ICEB 2HKHL 1UACL 4DEPB 5LAXB 2AV1A 3EOYG 4OLXL 3AREB 4C57C 4HUXB 5JHLH 1BM3L 1X7QB 1QHPA 4ZUWA 4LAQH 5ID1B 4NQDA 4YGVA 3AMKA 5FO9B 4NKMA 2XPGB 1F6FB 4PRID 2NW3A 1HCVA 3DBXB 3BKYL 1G0YR 1YEIL 4LASL 5FCUH 5DJ8A 4ESKA 3WFCH 3P4NB 1M1SA 1QSEA 5F7UA 1PJ9A 4YR6A 5A2IH 3WO4B 5C0AE 5KBNC 1ZVSB 1WBXA 2IAMD 3TWCL 4EXKA 4KHXH 3ZKQD 4ZSOE 2AV1B 2H41A 4AZ8A 1FP5A 5TFSL 3EBAA 4NUJB 1E28A 4DAGH 2J12B 4ZUWB 2HTKC 4U1IA 4NQDB 4YGVB 1FC2D 3VCLA 4CMMA 4RGOL 4NKMB 4PJAB 4HWBH 5CGYC 2ZUSA 1DCLA 1PW3A 2NW3B 3SDDC 2F53A 4O58L 5DJ8B 1IEHA 5T5FH 3CZJA 4ZPTA 5FCSH 4LOUC 4YR6B 4K2UL 1ORQA 5I1KH 1XF5B 2GAZA 4YE4L 1LMKA 3LY6A 3VXUA 2WW8A 1WBXB 4O2CA 3OJDA 2Y7QA 3MBEC 3BN3B 4V1DD 2NY6D 2J8UE 4OCRH 2JJTA 4TSCH 3S36L 1AI1H 1Q9LA 1MNUH 1JFQH 1NUGA 3RVTD 1BBDL 1E28B 3ARDD 3EYOB 4UU9B 4U1IB 1NBZB 2V5TA 15C8L 4KDTC 4CMMB 4DN3L 2YK1H 1YUHA 2VQ1A 5T1KA 3G08A 2F53B 4PJEF 4OZHA 3TNMA 3MLRH 1WZLA 2XTJE 4FZ8L 4ZPTB 3K74B 4RX4A 1ORQB 2GAZB 4YIQB 1A5FH 4G5ZL 5KN5A 3VXUB 2DQDH 2R0ZH 3DUUA 4F3FA 3VWJA 4O2CB 2ATKA 3OJDB 2Y7QB 2VIRB 5MERA 4KMTH 3MLPA 4KJQD 4LPWA 3D0LA 1Q9LB 4N9GA 5IIEB 2EO9A 3P4OA 1JZ5A 2F58L 3T1FB 4TNVK 4N0YL 4TUJB 3W11D 5FDWA 2AJYH 5ID0A 3GHBL 5IR1A 2QADD 3D25B 1FYTE 3DIFA 2VQ1B 5T1KB 2XNAA 3QNXA 5F71A 3TNMB 4KHTH 4JN2A 3QNYB 3RJQB 3VRIA 5I30L 5FUCC 1FE8L 1OP5H 2VLJD 3DUUB 4F3FB 3T4AA 1X5KA 1OY3B 5MERB 4JY5L 1R3IL 2UY6A 3CNKA 4GW5A 3TV3H 5C0BD 3EYUH 4C54A 4YX2H 4N9GB 1N8ZA 1TTFA 2XRAH 3WJLA 4Y8DC 4WI4A 5FDWB 3ARYA 5FYKE 1CFSA 5AAMA 4RMWA 3U46A 5ID0B 3KPMA 5C7XL 1T0NA 3DIFB 1RZ8A 4MZ3A 3JWNC 3VWJC 4ODTL 4M1GH 1B90A 4RBPK 3W0WA 2EKSA 1NLDH 4JN2B 2B1AL 4LCYA 1F8TL 5GJTL 4ZS6C 3T4AB 3C9NB 3QCTL 2HTKD 3MOBH 3SGKA 2YUVA 5CGYD 3NCJL 4GW5B 4KK8D 3UJIL 1BBJA 3SDDD 1N8ZB 1GAFL 4D9LL 4OT1H 5GGRY 1RHHA 5CLTA 1NUFA 2FH6A 4NWUH 1MCWM 1A9BB 4LOUD 5EBMA 5C2BL 4I0PC 4TUKH 5I19H 3U46B 1CFSB 3KPMB 4AL8H 1T0NB 1RUAL 1P4BH 4MDIB 4UDTB 3DURA 3MLXH 5D7SH 4DQOL 3FAWA 3W0WB 2EKSB 3MBED 4XMLH 2DLGA 1MWAH 1KJ3L 1TVDA 4BYHA 4LCYB 4RMRA 3NCFB 1NJ9A 35C8L 1OF2B 5D2LA 3KJ4B 5T1MA 5MENA 1SM3H 4LDOB 2P45B 3JV6A 2EYTA 3O2DL 2V9RA 3QSKB 4RGMC 1A7PH 4WFGE 2GUOA 1BBJB 5J11B 1N59A 4UUJA 3W9EB 1RHHB 3G6DL 5EBMB 5TPWH 3U2SA 2DQIH 4TTGA 4LHQB 5GGVH 2OJZL 3Q3GA 5MP6H 1IKNA 1V3JA 2F8OA 1U8JA 3VD3A 3WLBA 3DURB 3PHOA 3AS1A 3WFEL 2A0LC 1IGML 4MAUH 5D2LB 4G6KL 3TBWA 4YBLB 2NZIA 4XMPL 3WD5L 4Y1AD 2J6EA 5GIRA 4MA3A 5FXCH 1KXQE 2GUOB 1QR4A 3K8LA 1CI5A 5CWSA 2EDLA 1N59B 4UUJB 4HEPG 4XCCH 2FHCA 2P8LA 3Q3GB 4PJIA 3LN4A 3B3IA 1U8JB 1RULL 3IF1A 3V95A 1OOAA 2HAZA 2RIKA 5JZ7C 3TBWB 4LSDA 2NYYC 5FF6A 5DJCA 1X4YA 3RNKA 1XCTA 5CWSB 3JBG7 4FQQA 1H0DA 4OZFH 3ZT5A 1D5IH 3CIQA 1CWVA 1DVFA 1FNFA 5I1GL 2P8LB 3LN4B 2VC2H 3B3IB 4ZS6D 1ZT7A 2Z8RA 3IF1B 3EDDA 3HI6L 4YFLF 5GGQL 1ZS8A 3S37H 2FZ3A 4XNUH 3V4UH 4LAJH 5CJOH 4H8WH 1IFHH 4ODXB 4KUZL 3DROA 5K59F 5E56A 4OIAA 4I0PD 2ZJSH 3CLFL 5DJCB 2GTWB 1XCTB 4O02H 4FQQB 3VFPA 1H0DB 2IADA 4HWBA 1DVFB 1G9NL 1JWUA 4LSQH 3FONA 3NACH 5FHAH 4IJ3B 1OGAD 1TCMA 4M43L 4PRHA 3SDXA 4ODVL 1XGQA 1ZT7B 1DUYB 3RRQA 3TNNA 4Z7NE 3WJJA 5MEPA 1WSST 4I77H 2PYED 3ARPA 1ZS8B 4Y4KC 3SPVA 1JF5A 1I3GH 4R4BA 4Z7OF 2DAVA 3DWTA 2APWA 5H37G 3FHQA 3DROB 4YO0B 3WDIA 25C8H 1FGNH 3GIVA 4HCRL 1HINL 5D70H 3VFPB 3BI9X 5IF0A 1IQDA 2IADB 4MAYA 3SKJL 2A0LD 5DMIH 2C1PA 1CLYL 5EU6E 2QR0B 4PRHB 3HS0A 5DQJA 1PAMA 3IVKA 4NM4H 1XGQB 3TNNB 5DQDL 5MEPB 3SPVB 2YPLD 3ZDYF 1I1RA 5I74B 3T04D 1N6UA 4LCWE 1NDMA 4MXVE 2DM2A 3DV4A 1AE6H 4FHBD 5E6IC 2EDWA 3GNMH 3QIWA 3GIVB 4NGHH 3WJJC 2DD8L 5IF0B 2D7OA 3OAUH 2WUCH 1AR2A 2C1PB 4LVHC 3SEPA 1AO7E 5J89A 1JHLH 3MLZL 5JZ7D 3LDBC 2XKNA 3HS0B 5DQJB 3IVKB 1H3PH 3BIBX 2J2ZA 4K3EL 2NYYD 1MVFA 1AKJD 1RPQA 1DQDL 4AG4L 4V3DB 3JV0A 4FA8A 5GS0L 3AGVA 1I8MA 2IBZX 1JGLL 4BZ1L 2Q3AA 2EE6A 4MAYC 5B3JE 4DZ8A 4NO3A 3A6BL 2PR4H 3QIWB 5CILL 2DLIA 5AYQA 3U36A 3WN5C 1KB5A 4S0UC 1A3QA 1XR8B 3RKPA 4W4OA 4IRZH 4JM4L 3ARUA 5C0IA 1HI6A 1KIRA 2H32H 3H9SD 4JKMA 2F74A 4K07A 4OGAC 1CDUA 3T3PF 5JQ6H 3QDMA 3VFUA 2XKNB 4HZLA 4MMXC 1N3NA 1FVDA 1JRHH 5TJWK 1KJ2H 3DV6A 1KIUA 3TH3T 3AS0A 1MI5D 4Z5RA 4QHKI 1TNNA 1I8MB 1HNGA 1ZGLP 5KVEH 4PV9A 4BM7A 4QNPE 3GMQB 4CKVX 4DZ8B 1N64L 1S7RA 4FFZH 4RNRA 4NO3B 3MTRA 4Z7WA 5C6WH 1RMFL 1XGTA 1S3KL 2CGRH 4G9FD 2VDRL 5J8OA 1D9KC 1KB5B 2ADIA 1A6WH 3G6AA 4EKXA 1AXIB 1LP9A 5C0IB 3AS2A 4JDZA 4Y4KD 2F74B 1VEMA 4TPRH 3UYRL 4H1LG 1JZ2A 3QDMB 1RUPH 3VFUB 5EC1B 1BQUA 1N3NB 3BKJH 1MWAA 1FVDB 3FMGL 1UWXK 3DV6B 4ZOCA 4Z5RB 5K9QI 3TP4A 3BPNB 1OLZA 1EHNA 4PV9B 5FKAA 1MY5A 4LSRL 4PJHE 1S7RB 4TSBL 3MLSL 1XGTB 1F58L 4K3JH 3OG4B 3W5MA 2WWMC 1VFMA 2DYPA 1D5MB 4J12A 4YXKL 2ADIB 3G6AB 4ZTPH 2E7LE 3U7YH 1LP9B 5E0QA 5FO7A 1MJ8L 2X5PA 4QO1A 4HG4K 4N1EA 3LQZA 3GRWH 3KPRA 1AY1L 1MJUH 5E6ID 1OM3L 4Y4FA 3HZYA 4UIMB 5FKAB 5SV4A 1EDQA 4KY1H 1J0IA 1D5XA 4UOW0 3RUGE 4P4KC 4L1DA 3PWVA 4OZ4A 3K4DA 4FTVD 5FYJU 2ID5A 5DJ2A 1R3HA 1ZGLB 4NT6B 5FO7B 3O6FC 2VXSL 2R8SL 3M8OH 3VFOA 2W9DH 3LQZB 7FABL 3P40A 3KPRB 1A3LL 1ERNA 2YOCA 3QYCA 5J6GB 4Y4FB 1PY4A 3HZYB 1CTOA 4L3CA 3PWJA 1PSKL 2R0KL 2XQYK 1D5XB 4G8FA 4LMQE 1OAYL 4G7YH 2XN9A 4NNPH 2GIYA 3PWVB 4OGAD 5GJSL 1SEQL 1DLHB 4WI8A 5DJ2B 1R3HB 3DVFA 3QHTC 3ZZ1A 2D7PA 4YHKH 1SMAA 3VFOB 2DTML 3GI9L 1QBBA 1Q8MA 1MCDA 4JGUA 1Q9KA 4JDTL 2VDOH 1QOKA 4L3CB 1NMAH 3PWJB 1D9KD 3BH9A 1CR9H 2DBLL 4G8FB 2V2WA 4KDVA 2YD2A 5HDLA 4WHYG 1DL7H 4ONGL 3MRDA 1DQJA 4JFEA 1C5CH 5D7JA 2LFGA 3ARZA 1NCBL 3MBXH 1MCEA 5J1AA 3QCUL 2X4SB 4Y19A 3MRIB 4WUUD 1Q9KB 4K3DL 2EYSA 1QYGL 5DFTA 3CXHJ 1YEHL 3GDBA 3LQAL 1NCWH 3BH9B 2J7LA 2WWMD 4N5UA 4TSAH 3S96B 3BVNB 4OD1L 2YC1A 4YHYB 2UWEE 1BLNA 5MI0B 4Y16A 1I7TA 5JHDD 1E4KC 1TENA 4RGNC 1P9MC 4X98A 1IC5H 5ALCL 4LDLB 1U9KA 4WV1A 1LE5A 3MRDB 1DQJB 4JFEB 1QSFA 5D7JB 5CKAA 3NFSH 3QWRA 5J1AB 3MZTA 3ZKNC 3S34L 4H8WC 4F15C 3MV8A 4QT5A 1J0ZA 3IKKA 1EBAA 3MLTA 3Q6GH 4PJEB 5FYJH 2KKQA 1I1YA 3QUML 4P4KD 5IUSA 4LL9A 5HVHC 4CGTA 2XI9A 2BMKA 4HIXH 1NEZA 3F7YA 4RRPA 3HC0A 4GH7B 2YC1B 4Y5YC 1B0RA 5DRWA 3SJVA 3VU2A 3O6FD 1I7TB 1SBSH 4WU5B 3V7AE 4PJXA 5L2KE 4X98B 4WV1B 5E1AA 2VXTH 4XP4L 1LE5B 2BCKA 1QSFB 5CLWA 4FQ1L 4J4PA 1XZ0B 3LN5A 2EDFA 4QT5B 5DD5L 3MLTB 3CFDB 3L7EA 1I1YB 4UDUA 2BMKB 3IRPX 4HJGA 1NEZB 3FJTA 1GC1H 2VWEC 4KGJA 3MACH 4ONFL 1B0RB 3SJVB 5E8EA 4ZUUB 4M6MH 4PJXB 1G7QB 4Y7MA 3LVEA 4JQIL 4G8GD 5E1AB 3CPLB 4JVPA 5E99H 4QRTA 1YMMA 2XG5A 4WO4C 3VI3E 2NXZB 3QT2A 3LN5B 4CU7A 4LIQH 1BQLL 4UDUB 1AHWC 4HJGB 4TRPL 1JHKL 1FC1A 4XXCC 4QXUH 5F7EH 3EUUA 3NCMA 5E8EB 2VMFA 1HILA 4JY4B 1Q1JL 1ED3A 1NBYA 4XRCA 5D7LB 4QRTB 1WJ3A 2ESVE 2GY5A 3OF6A 2A83A 3CDGB 4MS8A 3TJHA 4XC3L 2A6KA 4OD3H 4PJCF 3F58L 3MREA 5IQ9A 4RGND 4XCNB 1T2XA 5T3XL 1Y6MR 1YY9C 1BWWA 1E0OB 3DVIA 3N85L 3O2VH 4E42B 4PY8I 3O4LA 1UVQA 4H20L 4MD0A 5AAWA 1LD9A 3LEVH 1VESA 3LS5H 3ZKND 4NQCD 1UKQA 1HILB 1HWHB 3MLUH 4MJ2A 1AQDA 1X5AA 1NBYB 4XRCB 4HS6A 4OLYH 3VFSA 2A83B 3RTQA 3OKNA 3CFCH 2CUIA 1W72H 3GMMA 4OI7A 2O5XH 2DI7A 5BOZG 4JB9H 3VW3L 1FCGA 2K3TA 5J13C 4HAGA 3MREB 4LU5H 5IQ9B 3KJ6H 1CGVA 4PJFF 5DDHB 3O4LB 5EUOE 4DWHA 1UVQB 2NY3C 4XVTH 4MD0B 1LD9B 3UJJL 1WZMA 1AQDB 1JGVL 3OKYA 4MCZA 3L1OH 1GGIH 4HS6B 3VFSB 1Q72H 5KG9A 2ICWI 1XGYL 3RTQB 3OKNB 3CC5B 3EDEA 5I9QC 5L7XL 2QV2A 5T33L 2ERJB 3Q5OA 4L9LC 2JJVA 1U3ZA 4F37F 3SN6N 1NANH 3HPJA 3KVQA 4LSUH 3MRCA 3ULSA 2YHGA 5AZEH 3VMPA 4OM0H 5C07A 4KI5C 4WO4D 3DGCR 1MCLA 2GT9A 4M5ZL 1Y6NR 2HFEA 3SDCC 3TCXA 5ISZB 4HV8A 2DB8A 4MCZB 5KG9B 2ZKHH 2OSLA 2OI9B 2X4RA 5EBLA 4GAFB 1A6VH 4XI5C 5FUZH 5D9SA 3QPXL 3HG1D 1IGCH 1Z9LA 2A1WH 1UQSB 4JFZH 5CCKL 3ZKXB 4RZCA 4TOYH 5DUML 1EGJA 5D96B 3QEGL 3SE3A 1KPUA 3HPJB 3MRCB 3LD8B 3ULSB 1UXSA 4MA8H 2JIXD 5C07B 2GT9B 3EIFA 1RSFA 2PETA 2HFEB 1T89A 4PYGA 4MJ4A 4HV8B 4LCIL 4TTDC 5E94A 3KPTA 3FQXA 3GHEL 4ACPA 2YXMA 2OSLB 2X4RB 5EBLB 2B20A 1DBJH 1YY9D 3P73B 4PJ7E 1KFAL 1YQVH 5D9SB 4R8WH 1EO8L 5CINL 3G6JF 1FBIH 5DEFA 4AIXA 4LLVB 5DFVD 3FOLA 3RVWC 1C5DA 1FGVH 3C6SA 1KPUB 5IVOA 3A6CH 3VXSE 4K8RL 4U1GC 2A6DA 4MDJA 1L6ZA 3T0VA 1UXSB 2FX9H 4LP5A 1B4JL 2ZUUA 4UV7H 5IG7A 3H42H 1HQ4A 4Z7QF 1AFVL 1MCCA 3LEXA 1OW0A 1D5BA 4J3WA 1QKZL 2E6QA 2A6JA 2O5ZH 3FQXB 1JTPA 4U1JA 1WAAF 2EDJA 2CMRL 4RFOL 1NC4D 2YPVL 2NY3D 3TF7A 5DEFB 2VDMH 1WUNT 3OSKA 1C5DB 1JPTL 2I60L 3C6SB 2RQ8A 2A6DB 4MDJB 5DGQA 3WMSA 2Q76A 3O3EA 5D1XC 5IG7B 1HQ4B 3CFBA 3C2AH 3MV11 4LPTA 4DW2L 4OLEA 3LEXB 4TVPL 1D5BB 2XG4A 5IW1B 2A6JB 1I9JL 1MCSA 4POUB 1RUQH 5AZ2H 4OLWL 4U1JB 1PKQB 4NO5A 2HJFA 4O9HL 1NSNL 1QEWA 3SO3B 4KKBC 3B9KA 3SDCD 3QIBB 2Q76B 4M48H 3CFKB 4HIJB 4V2CB 3IT8D 4YDKL 4XI5D 1OWWA 3ZHKA 4AEIL 5D1QA 1F90L 1C08A 3NCEB 3PP4L 2KUTA 3R0MA 2F54A 1IAMA 4NO5B 3GSNB 4XVSH 2HJFB 3OZ9H 5GRYA 4HAFA 4IM8A 1N5AB 1QEWB 4N68A 3B9KB 4TTDD 4C4KO 4ETYA 1Q9OA 5EFIA 5HI3C 5CEZL 4MSWB 2H26A 5KW9H 5DJYA 1GC1C 4PRAA 4JRWA 1C08B 4B0MM 4LVOB 4UB0H 3RVWD 5T1LD 4G6AD 3SGEH 3I2CH 2ENSA 2F54B 4X6CE 2Y07H 32C2A 4I5BB 4UOW1 4WHCA 5HHOB 2A9ML 4KQ3H 4BQ6A 5CBEA 5L0QC 2JCCE 5FHBL 2AJSL 3DSFL 1JF6A 4DUXA 3V52L 4IIQA 1H15A 1NAML 5BV7B 5LGJA 5EFIB 2KPNA 3FCTA 5HBBA 2H26B 3MNZA 1KC5H 4J1UA 2R23A 3VXME 4YWGL 5BVJA 4PRAB 4PB9H 2VDNH 1MRDL 2IH1A 3AUVA 4E41B 4L4TD 1BFVL 3X3FH 4L5FL 5D1XD 4X6BA 4LEXH 4EXPX 4Z6AT 2LABA 1NGWB 2QQNH 5CBEB 5BS0D 4YEFA 4JGJA 2BVEA 4EQ2A 2WIIA 2X4TA 4IIQB 3P0VL 1H15B 5HDOA 2ARWA 5LGJB 3FCTB 4C56A 2MQ0A 5I8KL 3MNZB 4XP9H 4OSUL 5BVJB 4HC1H 2WINB 2AEWA 4LCUA 4FN0A 4KKBD 4OV6F 5L88H 3STZA 3TT3H 1MRFL 5FYJD 4X6BB 1JTTA 2GJ6A 1EFXD 4I2XE 4OM1L 1ODAA 5EU5A 1DBML 4POZC 2ADFL 2Y5TA 3OKKA 2X4TB 4TULH 4K7FA 4IRSB 3QUYA 4N1HB 1ADQA 1TNMA 5KSBF 5B39A 4QTIL 4GRWF 5I8CA 3O6MH 1L0YA 4RFNB 5DHVA 4XX1E 2UZIH 5KANI 1TQCB 3ULVE 2A77H 2CR6A 4LSPL 3VXRA 1FFRA 4LCUB 5I76B 2J8UF 2X40A 3STZB 4R2GC 3U9PL 2LTQB 4HKBB 4GSDL 2GJ6B 4QRUA 5HI3D 1W2KT 5EU5B 2GW5A 1RZKL 5T5NG 2Y5TB 3OKKB 4ZFGH 2LAGB 1ZT1A 4K7FB 3QUYB 4D3CH 1OD9A 5EDXA 1RIUH 1FPTH 5B39B 5I8CB 3TEUA 1CFTA 5DHVB 2VSCA 2RJMA 3VXRB 1U93A 4NZUH 4QXGL 4WTWA 4U1LB 3P3YA 2W65A 1MHHA 3CFJA 4CMHB 4PJDF 3P0GB 4S1SL 5C6TH 1TJIH 4QXTA 3W5NA 2ORBH 4QRUB 1QLFA 2FSEA 4FNLL 5ACZA 4ZUSA 3PQYD 2W0LA 1ZT1B 2IANB 4I9WE 1KTLA 4JG1L 4A6YL 4GOSA 2HVJB 5FECA 4Q0XL 3LIZH 4S1QH 1CFTB 3K2UL 1AGFB 4NN7C 1JWSA 3NH7L 1KGCE 2W65B 4YHLH 5GHWH 5HY9B 4G7VL 3QFJA 2XA8L 3CFJB 4NQVA 3NFNB 4RMSA 3AM8A 4ZYKA 2FSEB 3JUZA 5JPMA 4N0RA 4ZUSB 1AXSA 3AAZA 2WBJC 5T1DH 1NKRA 5DR5L 1KTLB 3PABA 4KXZI 4K55A 1CGSL 5FYLL 1J7VR 5F9OL 4HH9A 3FB8A 1YPZE 5L2JB 2CO6B 2WZPD 1WICA 2JF1A 2V2TB 2H2SC 2FATH 2OMBA 5I1IL 3F7VB 3QFJB 2L0DA 4R4FL 3RHWF 4GFTB 5HHMD 3OQ3B 4NQVB 3UTTB 3KG5A 1MIEL 3QFDA 1KYOK 4ZYKB 1NPUA 3DVGB 4NO2A 3VD4A 4KUCD 3AAZB 2D7MA 3HE7C 3PABB 1URLA 1QLRA 1N0XH 1LO2H 1ZLSL 1KN2H 3LS4L 3OR7A 4R2GD 4XZUA 3PWUA 2PW2B 3QZWB 3BFOA 1CICD 1P7QA 4FQXA 1UYWH 2OR9L 3E6HB 4ZD3H 4XAKD 2M2DA 1ZXQA 3S37X 1S9YA 3QEQD 3N1QC 4JPWL 1VFBA 4PJGE 4D9QD 3QFDB 3VDCA 4EDWH 5IWLA 4O51A 2Y36L 3KPSA 1EBPA 1NAKH 1SY6H 3E2HA 2BVYA 2HFGH 1QLRB 5GGTL 3BDYH 3OR7B 4XZUB 2HJKA 1EEUA 4EUPB 2FX7L 3M1BA 1H5BC 1T03L 4FQXB 3ZDZE 3P11L 3LKPA 3ARED 3FQUA 5C0BE 4UNVA 2BNQE 1HHHA 2XQBL 4PJCB 4PRPD 2FH8A 1RK0A 4OLZL 1VFBB 5EOTA 3IXAB 1F45A 2A6IA 2NY4C 4PJFA 4Q2ZA 4KZDH 1MFEH 4O51B 1HDMA 1MHEA 3KPSB 4MNGE 5FUOL 5IROA 4YQXH 4MB5A 1KJVA 2VDQH 3WDHA 2MKWA 5DT1L 3E2HB 3H8NA 3MV7E 5HYSA 3WIHH 3V4VH 4LLWA 2HJKB 3L7FA 3V6OE 3GK8H 3M1BB 3GFUA 4OJFL 4M6OL 4WI9A 1YNLL 4JN1H 1HHHB 2EH8H 2Q1EA 5TH2A 1DANT 4AQOA 1V5JA 2WBJD 3NIGE 4YC2B 4ENEC 1I1AA 3TT1L 5GRUH 1NFIB 4XNXH 5EOTB 5L8JB 3V4PL 5JW3H 1NMBH 4PJFB 4Q2ZB 2P1YA 3HNTH 5BRZD 2M1KA 3O3AA 1OAKL 1MHEB 3SCMB 2H2SD 1KJVB 1CD1A 5C0RH 1JZ6A 1IT9L 5C9KA 5HYSB 4MA7H 5FFLA 4LLWB 4FMKA 1RJLA 1RU9L 2PXYC 2I24N 1IVLA 1LK2A 4J6RH 1PLGL 1Q38A 4KTYA 5I6XB 5IROC 2HP4A 5TH2B 3HE7D 1I1AB 2HH0L 2P5EA 1REIA 5J7CC 3BD5A 4OIBA 3X11A 4FQJH 1VHPA 5HYJA 5J11C 5F8RC 3NA9L 3O3AB 3W81A 3GBMH 1CFVH 3IDJA 2X1QA 3CD4A 4OCLC 5DYOA 1WFTA 3D3VA 3QCVH 1IKFL 1RJLB 2E27L 5FB8A 1HKLL 5GISL 4PY7A 1OPGH 3QI9A 4F7TA 1LK2B 2XTLA 1QNZL 5E2TH 4HS8H 1XGUA 5GGRB 5I1DA 2DQHL 2P5EB 3GM0A 4K9EL 3X11B 1ES0A 3UTZA 3MROB 1K9TA 2BERA 3QEUA 5HYJB 2Q8BL 3PE9A 5DK2A 4HUKB 4NWTH 1PY9A 3GI8L 5IVXE 1GZQA 4WFFD 2J5LB 2HFFA 2VLLA 2ZCKH 4R0LC 2Z93A 3WV0A 1IQWH 4AEHL 5DYOB 3D3VB 1CZ8H 2E5EA 3EJYC 5FB8B 4NC1E 3X3GH 3CXHK 4PY7B 3FN9A 1M7XA 1UB6A 3QI9B 1A6UL 1WAAA 4JREC 4F7TB 2IQ9L 3OMZA 4BH8B 5IFJB 2NY4D 4MJIE 5BXFB 1RUML 1XGUB 4UTAL 4NBZB 1VGEL 4APQC 5I1DB 1BFOA 3UC0H 4JVWA 2C26A 2YPKA 1ES0B 3EJZC 3QEUB 2XZQH 4ZFOL 2VKXA 1V8HA 5AWNL 5DK2B 5E8DL 5FYKH 2G2RA 2HFFB 2VLLB 5HVWA 4DZBA 2Z93B 5IHBA 4CUCA 1I9RL 2Y06H 4KRPB 3TN0A 1YJDL 4ENED 1H3WM 2P48B 2RR3A 3B8YA 3CXDH 4HULB 1UB6B 1A1MA 3UTPD 5CP3H 4LBEA 1Z0MA 4YFDB 2XY2A 2FO4A 1A7RH 3C09C 1X5LA 5KVGL 2UV3A 1BFOB 4WWKC 4QOKA 5GRZA 2YPKB 1OGAE 4HUUA 4JKPL 3QDJE 2W0KA 2IGFL 5HVFB 2BRRH 3BGFB 5DJZA 2HKFH 4FZEH 2PXYD 4FQ2H 1ND0A 4L8SC 5KTEH 3DI3B 1XIWC 4IJ3C 4N0CC 3E8UH 3TN0B 4NJAL 1A3RL 1LHZA 1AD0A 5SWZD 3VH8A 2HWZL 3DPBA 3C5ZC 5HGHA 2X89D 4QHNA 4ZO6A 1A1MB 5J6HB 3TPUA 5D2NE 4LBEB 3N1MC 4XT1C 2FO4B 4CBPA 3O41B 4HUWA 3L5XH 1ACZA 3ZE2F 2Z91A 1R3JA 4QOKB 1P84J 1TZIA 4HUUB 2GQHA 3VI4F 3H9HA 5A40E 1U42A 1WEJH 1JWMB 3QUXA 4KAQH 2BVPA 4GMSL 3TO2A 4OCNC 4LSVL 4PLNC 1ND0B 1TZHB 1BP3B 1NC2B 1NGZA 4Z0XA 3RY6C 4U1MA 5JXEC 1V7MH 4QGYA 2DTSA 4LGPB 1AD0B 3VH8B 5FOJA 5IESL 4QHNB 1CE1H 3TPUB 1CLZH 4I18C 1NEUA 1F3DJ 4LCCA 4HUWB 5CMAA 2Z91B 1A7QH 1R3JB 4ZDHA 2GSGA 4Q9QL 1TZIB 4U0RC 3H9HB 4NP4H 5F1KC 3N1FC 3QUXB 2BVPB 3QG7H 3EJYD 3TO2B 3VRJA 1FH5L 4KTEH 1NGZB 2E9JA 4Z0XB 4U1MB 3IU4H 4HCRA 1FN4B 4J3SA 1MCPL 5E8NA 4APQD 3RUGF 1DLFL 5AUMB 5FM5O 4Q97A 3EJZD 4MX7A 4FQPA 1U3HA 5I18L 4LCCB 1GGYA 5CMAB 3GIZH 4LRIA 4HLZH 1NMCB 4ZDHB 1VFAA 3H9SE 2GSGB 4WUKL 4JFOA 2DJSA 1YDPA 4NFBA 3UBXI 2VJXA 4AEEA 3VGAC 4X7SH 3RDTC 3ZYZA 3O9WA 2AXJA 1CDJA 1QBAA 1MI5E 1SMOA 3CCHA 1R5IB 3TYGH 3D2UA 1KNOA 4ZTOH 1Z3GL 5C0AA 3K80A