4NQDA

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
260
Chain Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIEIDYGDILPSGDGTYQAWASIELYSCHVEHSGVHMVLQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 260
sequence length 269
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nqdA01
3PL6D 3X11B 2XWBB 3ILPB 4WW2A 1MJ7H 1RZGA 2D2OA 3I6KB 1OAXH 1D9KC 2HT2C 2NY7L 5DUPL 1A4KA 3BO8A 5JPNB 4RAUA 1F4YH 4YHIB 5DEFB 4NQEA 2B0SH 3SE8H 4P9HC 5C0EA 3I75B 4R0LA 4M6AA 1IGFH 2XTJC 1RZKH 3C8DA 2H3NA 3QIUB 4TVPH 5EO1B 2Y07L 1WWBX 4OLXL 5GISH 5BOPA 3PQYD 3BGAA 1LQVA 4QHKJ 3WXVH 1RUPL 4HGWB 3C6SB 5JQ6L 3K4ZA 5GRVK 4E41B 3VE0A 1GZPA 1ZT7B 3QUXB 3EGSB 1JHKL 3BIKA 5AG9A 2OJZL 4EVNA 1JTOA 1GC1H 1FLRH 5SX4I 2P46B 5FXCH 4PJ9D 1KTKE 4MJIB 5DLML 3FT2A 3BMWA 3IF1B 3V6OC 1BZ7B 5HYQA 1WK0A 1MAJA 5KOVC 2A0LD 2GTWA 5FV2A 4NZTL 1JPTL 2EICA 2F15A 3WL9B 4D9LL 3VMNA 1X3DA 1NAKH 2D7PA 4PJHF 1NCUA 1FNFA 2AJVL 4NQDA 4PJ5A 4RMWA 1B9ZA 3BIBX 4C4KT 1MCPH 4I77H 2W65A 2BSRA 3U46B 2M8XA 4BFGA 3TJHD 2K9UA 3VCLB 1YEGH 3EYVB 1INDH 2Q6WA 4BM7A 1UWGH 2WUCH 1ZS8B 2PN5A 3FT4A 2IBGA 1QFWM 5CILH 1D5XB 4Z0XB 4K94H 3GM0A 1XH3A 4PJFF 3NFPB 4ZS6D 1HHHA 1HHIB 4U6HB 4OCRH 1TVBB 2VB5A 5DVOA 1P84K 4XWGL 4Y5YC 2BNUB 3D2UD 2BVYA 3EFFA 4IRJC 2V9QA 3WFDL 5GS1C 1YMHA 2E6PA 3F6LA 3HNTH 3FQXB 3WUWB 1PZUB 1BX2A 2FYYA 3IFOA 3EOAB 2XWBA 3ILPA 1OTSC 1N6QL 4EN3D 3QXWA 5JXED 5H2BB 5BZWB 3G6JE 5JPNA 1OM3H 4YHIA 5DEFA 1T66C 3V5KA 3EYOB 1LD9A 2ZCLH 3W0WB 3BKYL 1WICA 2VXSL 3RQ3A 3I75A 5DGRA 3O41B 2YPVH 3T0BA 3QIUA 1ORQB 1FJ1B 1I1AD 4P23C 1ROWA 2X42A 3S36H 4Q0XH 4HGWA 5DJAA 3C6SA 4FQHB 5E2WL 3MRGB 4E41A 2I07B 3FFCB 1ZT7A 3QUXA 3EGSA 2Z9TA 3BIAX 3REWB 3NPSB 4DGVL 3C6LC 3O6FB 4OLYH 1F4WH 3ZKND 4OF6A 3PV7A 3RWIB 1XMWA 4LVHB 1S9VB 1CN4A 4YHZL 4KZDH 5FGCE 4R26L 3WV0A 4MJIA 4Q9RL 3IF1A 4PJIF 3VDAA 1F8TH 4RBPH 1BBJB 4KQ4L 5EPMB 3C08L 1M6OB 4HGMA 3MGTB 3AAZA 1MRCH 1J87A 3MLYH 4KY1H 4HQQH 1AO7B 2VZUA 4K7PY 4YDIH 3WL9A 2JJWA 4QXGH 5EBGA 5AD0B 4K8RD 4JN1H 4KUZH 1NDMA 1X44A 4J6RH 5GZNC 4WEBH 4KRPB 3A6OA 4OCSH 4OCXL 4IRSD 3IDIB 5I75C 4Y4FC 1RUAL 5J3HC 3U46A 1CF8H 1JTTA 1KB5H 3VFWB 3PHQB 1Z0MA 4ODVL 4UT9L 4TRPL 4OZGE 4N1EA 3VD7A 2Z93B 2Z8WC 1YNKL 3EYVA 4NKQB 3UTSB 3LQZB 4FQJH 1KLFA 4TPRH 4JHWL 3SGKC 2VXTL 3HAEG 5FYLE 1JNJA 3MV9E 3KAAA 1DBMH 1OAKH 1D5XA 1PKQE 5DJZB 4QRRB 4JCLA 2B1HL 1EH9A 1HHIA 4U6HA 3GI9H 3RUGB 4MQTB 4HT1L 1CXFA 1ZLSL 4JRWA 1H3WM 2BNUA 4IBLT 3W9DB 4ZODA 1J1PH 1NLDH 5DFTA 1NQBA 5DO2C 5ILTH 2X89D 3MA9L 2Y06H 2ORBL 4BZ2H 5I6XC 3FQXA 3WUWA 2NQCA 1XCTB 3RVUD 1YQVL 2YUZA 4M7LT 2L0DA 3EOAA 3V52L 2XI9A 1QFUL 1A7QH 4OZFG 3HNVL 1H8SA 3QQ9D 1ACZA 3K74B 5H2BA 3NMEA 5BZWA 2UZYB 1R5IB 1BM3H 2GJJA 3EYOA 3W0WA 1SY6A 1NGPL 2YZ8A 2J8OA 2WW8A 5D70H 1B0WA 2YA0A 1A1MB 1WBXB 4O58L 4PLKC 4XC3L 1LK2B 2YBRB 3VFUB 4XI5D 1FJ1A 4G8IB 5GGVH 3UTTE 2BY0A 3IXTA 2DYPD 3DVGB 3Q48A 4DK3A 4JFEE 1XZ0B 5IB2B 4FQHA 3MRGA 1RV6X 2I07A 3FFCA 4POUB 3LEXB 1R24B 2OBGA 1NFIB 1WAAF 5J56B 2VDRL 3REWA 1EEUA 3QXTA 3U9PL 1CDJA 2NY2C 1TNMA 4MJ5B 3HR5B 4U6YB 5T3XE 4FFYH 4KXZH 2VLKA 4NM4H 1F3DJ 1RUMH 1T2QL 4P2OC 2CUMA 3ULVH 3ZYOA 1NFDE 3EAKA 5EPMA 3LMJL 1BD2E 5FYLD 2WWMD 3MV9D 4XPBL 1M6OA 3MGTA 2C3WA 4XVUD 2VZSA 2BVUA 3MLRH 5MHSE 1AO7A 4G7VH 4Q9CA 1R5WB 1U2HA 2CPCA 5AD0A 2W60B 5CD3B 3VWKD 1A0QL 1MREH 1IL1B 2VZ3A 4CNIB 1WWCA 4CRPA 2ZJSH 2YUXA 4DFHA 2PYEB 1RULL 4JQVA 3IDIA 4DKDC 3P30H 1NCAL 2EE6A 2A9NH 2R0WH 5DFVD 5IF0B 5ACMA 4WI8A 1SEQH 3VFWA 1D7FA 1QOKA 2YMXL 4QF1B 1YEEL 2EE2A 1YPZB 3KJ6L 3PHQA 2NTFA 1F58H 3RIFF 2Z93A 5EU5B 4L4TE 2CGRL 4NZRH 5E8DL 5C0AB 3UTSA 5SWZB 1DFBH 3LQZA 4I18A 5HDQH 2Q87A 2KZWA 2XV6B 3LQAH 3KPSE 4X6CF 1OVZA 2AABL 5DJZA 5C6TH 4KKCC 2FHFA 4NQCE 1QKZL 4O9HL 4R4FH 4QRRA 3O2DL 2A77L 2GY5A 3UTTD 1KJVB 3RUGA 1IKNA 4JFED 5DWUL 3TJEH 1KXQE 4ZG1A 1R0AH 1II4E 1C16B 1QRNE 3STBA 1RZ8B 3W9DA 5L7XL 4OCWL 5F21B 5HHVH 1XCTA 4NNPH 3S35X 4EOWH 4PRPE 4HC1A 4BUGA 3QNZB 5T3XD 4J4PD 3NZHH 2WUBH 4HWZB 5BCAA 4XNMB 3QAZB 3TO4B 4WNQB 1R5IA 5GGUB 2X10A 2QQQA 4UTBL 2ZCHL 1D5ZB 1BD2D 2X41A 4HIJA 2VXUH 4LSSH 2ARWA 1A1MA 1WBXA 4L3EB 1LK2A 2YBRA 3V4PL 4BH7B 1N59B 4G8IA 2P4AB 3DSFH 1K6QL 5MHSD 4OD1H 1J0KA 5DD5L 1XZ0A 1MIML 5IB2A 1HHGB 3I50L 2QSCH 3RZCB 3LEXA 1R24A 3PJSB 3SGEI 1NFIA 1LP9A 3AS3A 2VLLB 3DHJA 5C2BL 4MJ5A 2ITCB 3BN9D 5HYSG 1FDLL 3HR5A 4U6YA 1DR9A 2EH8H 3ZTNL 4IEFB 3ZHDA 1MCHA 3LEVH 2QEJA 3QRGH 4L4TD 5J1SC 3S34H 1FIGL 2JB6B 1P9MC 4ENED 1DQJB 2ICWI 3IFPB 5CEZH 2X9XA 3KPSD 1GL4B 4MZ3A 4NZJA 5D72L 3B2UD 4MJ4A 2ERJC 2ID5A 1XF3B 3OKMB 4H8WH 4UQ3B 1MEXL 2PXYA 5JMRA 1ZEAL 2AJXH 1R5WA 2VITA 4K2UL 4JGJA 1WWWX 1S8DB 1TXKA 2GSIA 5CD3A 5FCUL 3QWRD 1GGCH 2P5WB 4RISH 1IL1A 5I1KL 2AJ3A 1P4LA 3HG1D 4CNIA 3N06B 1QRND 4YX2L 5TPWH 3QT2A 1KCRL 3HC4L 5DQDH 3CFCL 1XGYH 5D5MF 3H8NA 4M03A 5IF0A 4FQ1H 1PVHA 4K71C 4PRPD 3W81A 4QF1A 3F58L 1YPZA 1QHPA 1NCBL 5EU5A 4WW2C 5C0AA 1IQDB 5SWZA 2FRGP 4LSPH 1FH5L 1DVFB 1CL7L 3ZHLA 3BD5A 4MJ6B 4JO4L 3LD8B 2NY0B 3HZMB 4UILL 4R0LC 3AREB 5DMGD 5FM5M 1KJVA 2XOTA 3LEYL 3RL2B 2GYSA 3ELAT 2HKFH 1C16A 1A02N 1RZ8A 4JDTH 1AJ7L 2V5SA 5JIHA 2IH1B 3D39B 2XZQH 1A6ZA 5HVHB 4V2CB 2VLME 1SVCP 4NNYB 4WRLA 3QNZA 4PRIB 3FTGB 4RA0C 3ULUH 1A4JB 3GNML 4MYWB 4XNMA 5GJTL 3TO4A 1CFVH 2VH5L 3D0VA 4R97C 5BO1H 5GGUA 1KC5L 1D5ZA 4MA8L 3NTCL 3E8UL 1OGAA 3I3EA 4IRZH 1MNUH 2ZSWB 5JIIA 4L3EA 3K80A 5CP7B 1UCBL 3HAEB 4P3WA 2RFXA 4BH7A 1N59A 3SJVA 3MLUH 1B3JA 5JW5B 4TSCL 1EAJA 3HA0A 1UWXK 2UWEF 3QUZD 2NY4B 1HHGA 3HMWL 5CINH 3RZCA 2VLJB 4JKWA 3JZ7A 1N0XH 4RGNB 5AZ2H 4YE4H 3IDXL 3PJSA 3CDCA 4X9GA 4QXUL 2CK2A 2DKSA 4JVUA 5JMOC 3L5JA 4P99A 1KCSH 1E6JL 4PRHE 3DETD 3NA9H 5D1XB 5T1DH 4HKXB 4FMFA 1OW0A 2X7LB 5FGRA 1FVEA 1DQJA 5HGAB 5CJXC 2GY7B 3IFPA 4LQFH 1OT2A 2GK2A 3MLTB 4S1QL 2YD4A 1IKFH 1L9MA 1KEGH 4HFWB 4UQ3A 1JGEB 5DK2A 4FQCL 3U4AA 3KPTA 1S8DA 3VXOB 2Z8SA 5D6CB 2P5WA 3LY6A 3WLWC 5IFJB 3RU8L 2XACC 3EDKA 4DVRL 3BVNB 2C4FT 1A7BA 3OKDB 3VW3L 4ZMAT 5J6HB 1FAIL 5IVZB 4KI5C 1SY6L 1CLYH 4X4XB 1ZLVH 1XT5A 5ESQB 1OARL 3BKJH 2VDML 4U6TA 1DVFA 4JM2B 1DP0A 5TJWK 2BMKB 5ACZB 4MJ6A 4MS8A 1CGTA 4HSQA 3HZMA 1G1CA 1F5WA 4G6JH 4PJ7B 1VCAA 1UM4L 3QIUC 1K8DB 2V7NA 3RL2A 2DMKA 3CVIL 4Q6YA 1ZHLB 4U3HA 5E1AB 3CCHB 3GZKA 3TT3H 1JRHL 2IH1A 3D39A 3GIZH 4AZ8A 4JEGB 2GHWB 1BWWA 3QUXC 1K9TA 1DL7L 1OAZL 4HKJB 3D3VB 2OM5A 4RRPG 4XBEL 4NNYA 4PRHD 1OQXA 4PRIA 3FTGA 1AGBB 5DMYA 4JRXB 5IBTL 1A4JA 1NBQA 3O6KH 1E4WH 1D5IH 1OAQH 2OQJB 3TFKD 3IGAB 1BLNB 4L4VE 1A14L 3SKJH 4FFEX 5C2UB 2ZSWA 4HUUB 1BAFL 5HGGS 3V4VH 5CP7A 3HAEA 2QQNL 5JW5A 1UVQB 1WWAX 4KKBD 2IFGA 4V3EB 4LLWA 2VLJA 4M3KB 3AROA 1CGWA 5GQBA 4M48L 4F57L 3FJTA 4F33B 1OP9A 1X5LA 4F3FB 3JV4B 3ZE1E 4Q6IB 4OZIB 5IB1B 5D1XA 5D71H 5IESH 1CLCA 1H8OA 5CZXD 5EOCL 2ATPB 2RCSL 2C3GA 5EUOB 5C0CE 2Y5TB 3MLTA 7FABL 2MKLC 1VEMA 1S78D 2UV3A 5C0IB 2IBZX 1Q0XL 3NCEB 4GAFB 4HFWA 1BFVL 3QCUL 4TULL 5IUSA 2LFGA 1A6WH 2PUQT 3OKKB 4I5BB 1K85A 4QRUA 1S7WB 1SJEB 4Y4KA 1EO5A 1X5FA 1YNTB 3P9LB 1TJIH 5IFJA 4DW2H 2FJHA 5I1EH 1NUGA 3BVNA 4HC1L 4K07A 1MCIA 4XC1H 5GS2H 3OKDA 3KYNA 2UYLB 3HZVB 4I3GA 5KTEH 5B22A 1MCOL 4AEIH 5JR1H 4UIKL 5J6HA 5IVZA 3RIFK 4OI8A 5E95B 5HYSB 3HFML 1CD0A 1Q0YL 4X4XA 2VXQH 4ODTH 3MV7B 5ESQA 4JM2A 4L4VD 3PDOB 3VFSA 3BQUD 1FAKT 1EFQA 4FZEL 2BMKA 5ACZA 1LEIB 4JO2H 1LP9F 4KROB 3VXQB 4RA3A 3MLVH 4PJ7A 5C7XH 3GI8H 4FQXA 1K8DA 3VMPA 1HKLL 1D5BA 3H3PH 4OIIH 5LXGL 1ZHLA 5I71B 1I7RA 2E5EA 5EZJB 5E1AA 3CCHA 4Z7NF 4P3DB 1A6VL 1S5IH 2FATL 1WVZA 2C9AA 2W0FB 4IDJL 4MNGE 2W0PA 3X3FL 3D3VA 5BRZB 1QA9B 4ZUVB 3DO7B 3NPSC 3MFFB 1AGBA 5JA8B 2CO6B 3O6FC 4JRXA 3TA3B 4O2FB 2IG2L 4HXBL 3L5XH 3P73B 3SOBL 5C6WH 2YUWA 4LVHC 2OQJA 2B1AH 3IGAA 1BLNA 3HUJB 4AMKL 1T1YB 4APQB 5C0CD 4U6XB 4LDOB 2P7TB 4JFFE 1BECA 2DRUA 4HUUA 2ICCA 4Z78B 3QIBB 4HUNB 1X5GA 3IU4H 1UVQA 3D0LA 5BMFL 2W9LA 2J12B 5FF6B 3KXFB 1NBVH 3FT3B 4RFNB 4FP8H 4KPHL 2BK8A 1YPZF 1LE5B 5TF0A 4HUKB 1K4CA 1JUFB 4F33A 3GRWH 1IGIL 4PJGE 3T0VA 5DT1L 3OKEB 4LRNH 3BPNB 4F3FA 4KRPC 1CZ8L 3CXDL 4JQVC 3CFKB 3JV4A 1B0RA 4LPCA 4Q6IA 3JUYA 4OZIA 5IB1A 1LK3H 1IFHL 4JVPA 4LOUC 4D3CH 2NR6C 2ATPA 4P3CL 4F9PC 3CFDB 5EUOA 3ECBA 3FB6B 2Y5TA 3MXVH 4XCCL 1GCFA 2IANB 5C0IA 5I17B 2ZCKL 3OKYA 2W38A 4JG0L 2IPKA 4DFIA 2E3VA 4S0UC 3OKKA 5F93C 1BOYA 2COQA 5GZOD 2DAVA 3FN0H 3P9LA 4I1NB 1S7TB 2XXCB 3BP7B 1IKNC 4NGHH 3EJZC 5DURB 1NGQH 5T3ZE 3DECA 4PR5B 2YD8A 3AXLB 4O51B 4ZFGH 2UYLA 1J1XL 1NGZB 3HZVA 1BVZA 2LE9A 5DXWA 5EZLB 1FBIL 3CU1A 3IDMB 2DQEL 1OAUH 2QADD 3T4YB 3GSRB 4LVNB 2VUOA 5HYSA 1N6VA 5A1AA 1AFVH 5H35B 3NH7H 4Z7UF 2WMPA 2WINA 3P4OB 3PGDA 5I0DA 1F90H 2VL4A 1I75A 4JFFD 4XP4H 1A7RL 1LEIA 4ZFOB 4LDEB 5SX5K 3VXQA 5ISZE 1FC2D 3NPZB 1QLEL 4RAHA 3GJFK 4JM4L 3MUZ1 1NMAL 4NZDA 4XX1E 4M1GL 4EI5D 1EERB 4GKOA 4OTXH 2KL6A 5D5ME 3TZVD 5EZJA 3VRLE 4QOKE 4P3DA 4RWYH 2W0FA 1ZT4B 5BRZA 1M7DA 1QA9A 2NXYD 4ZUVA 3DO7A 3ZKXB 1T0MA 1INEL 4WO4C 1TETL 5T1LB 3WDHA 1F02I 3TA3A 4O2FA 3P73A 5DA0B 4C59B 1J12A 5C0FB 2R0ZH 5HDBF 3AMKA 3HUJA 4PJ5D 1T1YA 4APQA 3QCVH 4U6XA 1L8JA 4X83A 1GGTA 3STZB 2P7TA 4ERSH 1JYVA 1VHPA 2IPTL 1HZHL 4G6AD 4R2GD 1UYWH 3MCLH 3HCVB 3P40A 4JRYB 4JLRB 4NRXB 1NMBH 3KXFA 3FT3A 2UY6A 1DLFH 1LE5A 1NANH 4LLMB 1J88A 2YD5A 1AE6H 1QSVA 1HE7A 1JUFA 1YEIH 4GSDH 3OKEA 4PJDE 5T3ZD 3IS1X 2RR3A 5E9DB 1JGDB 2VDKH 4X6FB 3MLXH 5EO0B 5EOTB 4C4KO 2HMID 4ZTOH 3CFDA 3FB6A 3ZT7A 4DAGL 5IEKB 1FFQA 2IANA 2PKDA 1UENA 5I17A 3SBWA 2APXA 4KV5F 2FB4H 5ISZD 2UWEE 2QSQA 3QEQB 3T0EE 4YHML 3K2UH 4ONHB 1E4XI 1S7TA 2EEBA 4LCWB 3BP7A 5FA3B 5INDB 4KKNA 3T0AA 4KHXH 4P9MH 1BIHA 4QOKD 3TPKA 3LB6C 2WBJB 4PR5A 3AXLA 4HHAB 4KDTA 4O51A 1SEBA 1NGZA 4KKAC 5EZLA 3BSZH 4KK9C 3IJYB 1B4JL 3IDMA 3T4YA 3GSRA 2XQBL 2EXWD 1BQSA 1XEDA 3NAAL 1I85A 4PJEB 3RVXD 4UTAL 5FDWB 3P4OA 5M94B 3QAZC 4IOIB 3TO4C 2ZNXA 2EDLA 2FBJL 5EA0H 5HHMB 4XNYL 3WJJC 4EI6B 3NCJH 3SCMD 5LCVH 5I1CL 2FJFA 2QQLL 3SPVB 1MI5E 3B5TA 4LKXB 3BGMB 1MJ8L 5I1AB 2I5YH 3PV6B 4M6ML 1ACYL 3RZCC 4CJ1A 1OPGH 4Y5XB 2FD6H 2H2SD 4WIQA 4UBDD 1G7LB 1ZT4A 1LNUA 1MFEL 1CR9H 4IOSD 1KB5B 1RIVL 1T5WB 5CLTA 3ARUA 3BESR 2Q3ZA 2IJ0C 4XPAH 5T1LA 4U49A 1V8HA 1ZHBB 1T22B 5H37H 3HLAA 5EIVA 2X4UA 5FHBL 5C0FA 4KMTL 1OW0C 3STZA 3STLB 4HWNA 4KK6C 2Y7QB 2CR3A 4LSUH 5CUSH 4AQOA 2EXYD 4QHKI 1DBKL 1ZANH 3T1WA 1KT2A 5C8JB 3HCVA 4JLRA 4NRXA 2JLLA 3T0ED 3K2MC 1T89A 3OL2A 1U8NB 1HIMH 3N1PC 2Z8RA 4JM2F 4RX4D 3P9MB 5DUML 3DHMA 5E9DA 1JGDA 4X6FA 4R7DB 3TH2T 2X1PA 5EO0A 4PGEB 1ADQH 3WIHH 5EOTA 3Q3GB 1ED3B 2X5PA 5LBSH 4PJ7F 5C0NC 4RRPA 4GQ9H 4XNQB 1IE5A 3OF6A 5J4MA 3WD5H 1I3UA 3O9WD 5IEKA 1NDGB 1JNNH 3DO3A 4I2XB 1DVFC 1UXSB 4F58L 4LF3B 4OCLC 4NHUE 5LWYH 4JR9L 1CI5A 3MACL 3LD8C 5IK3B 4WFHE 2VDOL 2NY0C 3AREC 1MI5D 3MUGB 4JG1H 2YRLA 1MHCA 1CLOH 4ONHA 4WY7H 4LCWA 5FA3A 1A7NH 3BZFB 4OZ4B 3VXME 3RGVB 1Z9OA 3UBXI 2WBJA 5LGJA 4HHAA 1WIOA 1U8IB 3MGOB 4MXQD 4OF5A 4M3JA 1LEGB 5HVHC 5D7JD 1QEWB 3DV6A 3QG7L 5JW4Q 4PJEA 4FFWD 4X6DF 5FDWA 5CLWA 3JWDH 4IOIA 1UA6H 1NL0H 2GTZB 4JPVL 4YPJA 3IU3B 4LSRH 2XA3A 1QHOA 3O0RL 5HHMA 1QO3B 5IM7B 4EI6A 1QTYT 2X05A 4UV7L 3RNQB 3SPVA 2VLKD 4XNUL 1YJDH 4R4NC 1QZ1A 4NIKB 2ICWB 4LKXA 4CVXA 3BGMA 2CKBH 5I1AA 1A5FH 3G6DH 1BJ1H 1MFCH 2VTFA 3I2CH 3MNZB 2NY4C 3IFLL 4GBXB 4DN3H 5FYLH 5EUOF 4RGNC 5ICZB 1J10A 1G7LA 3MBEB 4OZHA 1KB5A 1T5WA 2IQ9L 4HEME 4OUUB 5HDLA 4Z8FH 5JUEL 1ZHBA 1T22A 3MOBH 3G6AB 4X98B 5D1XC 3CK0H 5DR5H 3OAUL 3PABB 1JZ3A 1KCUL 3RAJL 1R3LB 3STLA 3S6CA 5JHDB 2BSTB 4D9RE 2ADIB 5C8JA 4N8CH 4OLWL 3DUUB 3ZDYE 4WFHD 2BNQB 2A38A 4ZD3L 4KUCD 4Z7NE 5IW6B 1GHFL 4EQ2A 4QHMB 5DMIL 4ALAL 1PYWB 1U8NA 4M02A 3HB3C 1WUNT 1RVFH 3VXMD 1XCQB 4LARH 4OCMC 4KI1A 1T1ZB 1KIQB 3FQWB 4ODSL 1A3RH 1LILA 1RZIB 3ARFB 3QIWB 5D8JL 4PGEA 2W91A 3FKUS 5LQBL 3V95A 4BJLA 1ED3A 3IFNH 2X1XR 1V3JA 1Z3GH 4YUEH 4JO1H 1NDGA 5I73B 1GGBL 1N26A 2R4SH 1F3DH 2E9WA 4I2XA 4JCMA 4JM2C 1UXSA 2MKWA 3QISA 2YKLH 1S3KH 4LF3A 4U1LB 5GGTH 5F9WB 5B38B 3V0WH 4UNTA 3MRPB 5IK3A 1OP3H 5T5FL 5KSBE 1S9KC 1SHMA 5T3XH 2QKIB 4EBQL 3MUGA 1O0VA 4PS4H 2X9WA 1SYSB 4DJMA 2VR4A 4HZAA 4G8GE 2BJML 3BZFA 4X7EC 5GGQL 4OZ4A 3RGVA 2YHGA 1M1SA 1P7QB 2OK0L 3HUJF 3EZJB 1U8IA 3MGOA 1F11B 1OLLA 1R3JB 2G60L 1LEGA 2XKNB 4X7SL 1EK3A 2IADA 3KWWB 3WEXB 3OHXB 4DUVA 3D1MC 4LSTL 3C5JB 3O4OB 3UC0H 4DWHA 3L3IA 5FHAL 1ZGLB 1UM5H 2AVGA 2GTZA 3IU3A 2A6IA 4LSVH 1QO3A 1T2JA 4D9RD 3OXRB 5IM7A 2DKMA 2Q76B 4XPGH 3U4BL 3BPOB 4EDWL 1J8KA 2DQFB 3HC0B 3ARDB 4S2SB 3RNQA 2ICWA 3O3DB 2ADFL 2PYFA 1OSPH 3HC3H 3MNZA 3RJDA 3P0YL 4JB9H 5ICZA 3MBEA 2BSSB 4HK3N 1MJ7L 4OUUA 4ZUTB 1OAXL 4HEPG 4QRPB 1VEPA 1F4YL 4QWWD 4Q6IC 4LIQE 3G6AA 4Z7UE 2G5BB 2B0SL 1F6FB 3SE8L 3PABA 3N9GH 2AEIT 4YHOL 4U4BA 1IGFL 1R3LA 5IW3A 2ZZUT 1RZKL 4TVPL 2YPLE 1MVUB 5JHDA 2BSTA 3MCG1 5GISL 3LH2L 2CMRH 4U2YA 1V3KA 1DSFL 2ADIA 3O6MH 3WXVL 1CFNB 1GXEA 1NBZB 1M05B 4UB0H 3DUUA 1MCFA 5EU6E 4FG6C 2BNQA 1Z9MA 4QYOB 1SM3H 5IW6A 2G75B 3U2SB 1PYWA 4G8GD 2NXZB 2WV3A 1XCQA 1GC1L 1FLRL 1MOEA 4X8JA 4EXKA 3VGAB 3CDFA 4LAJH 3RWDB 5I0ZA 1T1ZA 2DL2A 4CVZA 4DOHB 1OWRM 1KIQA 1MJUH 3FQWA 5TH2B 1RZIA 3ARFA 3QIWA 4LEXL 4J3UA 2BXZA 5HDBE 3RTQD 4HFUH 4UIMA 3FFDB 2YRPA 2BC4B 3C60B 1DTUA 4B41A 5J9PB 4N5EA 1IZKA 1QSZA 5E4IA 5GHWH 3AB0B 5JW3L 4QTHB 2E27H 4PV8B 3OKLB 3BDYH 4U1LA 1MCWM 3L7EB 1NAKL 4MGXA 1V7ML 3MRPA 4KROC 4G8FB 3WMSA 3RX8A 5ICXB 5ETUB 2HLFD 3BP6B 4I77L 1P7QA 5I71C 3RWEB 4H1LH 1AGDB 4OF0A 2FEDC 1F11A 1A3LH 4A6YH 1YEGL 2WWKT 1MFDL 2Z92B 1R3JA 3SJVD 2XKNA 1INDL 4XPFH 1MCKA 4PP2B 4K3JH 3KWWA 4XTRD 4KMQA 3WEXA 4PYGA 3OHXA 4M62H 3TA3C 3C5JA 1I7ZB 1SJHB 1IC7H 3MRHB 2ZUTA 5DC0A 4K94L 1ZGLA 2YPLD 2DKUA 4APQC 1RZJH 4Q9BA 4OCRL 3OXRA 1I1RA 3ARGB 3PXHA 1VENA 2Q76A 4Y5VC 1I8MB 3HC0A 3HRPA 3ARDA 3QIBC 4S2SA 5EU6D 2OMNA 3O3DA 1CIDA 1R6VA 1RURH 1DUYB 3QDGB 4RFNC 2ZG2A 4S0SD 3HNTL 5JORB 4JJ5B 3W39A 3V7AE 5KS9B 5ALBH 1Q8MA 3ARSA 4NO0B 4NWUH 3F7PC 3BPNC 4ZUTA 4XGZB 1M71B 4QRPA 4NO3B 2ZCLL 5AG8A 2G5BA 3UAJD 2ADGB 2J88H 3WKMH 2AV1B 4JAMA 2YPVL 4LNRB 1X6LA 1MVUA 1A7PH 4JKLA 4W4OA 3S36L 4Q0XL 1CFNA 1VB9A 3MRMB 4XVSL 1NBZA 2OR9L 2V2WA 2GAZB 3L7FA 1TQBB 3K8LA 4U3CA 1CK0H 4QYOA 2G75A 1W0VB 3U2SA 5E2UL 5F7MC 4OLYL 1F4WL 1PX3A 3DYOA 5HGDA 2CUHA 3V0VB 4MVBC 2PCPB 3MMEB 3RWDA 2I9TB 4C56E 4KZDL 5TH2A 4XH2B 2XKSA 2QLVB 1E0OB 3KLHD 1GC1C 1KYOJ 5FOBB 3M8OH 2BC4A 3C60A 5J9PA 1FCCA 1MRCL 5B3JF 4Y19E 4KY1L 4BQCA 1NCTA 5AUMB 2G2RB 4QTHA 4PV8A 4YDIL 5BVPH 2Q3AA 3OKLA 4QXGL 4Q58C 4JN1L 4KUZL 2H26B 4OZHF 4J6RL 4G8FA 4WEBL 1L6ZA 1BZ9A 2EDEA 4P57B 4ZXBC 3V6FB 4OCSL 5ICXA 3PHSA 5D2LA 5ETUA 4UMGA 3BP6A 4JGUA 5GIRB 5JZ7C 5IB3A 4JQXA 1CF8L 1KB5L 3LS4H 1JNHA 5LKNA 2MQ0A 1UKQA 1AGDA 3KPOB 5ELIA 4NBZB 2SEBB 2Z92A 3FO9A 2MTPA 1EV2E 1L7IH 1UB5A 1I3RA 4DQOL 4PP2A 4GRLD 4NOFA 4TPRL 3ZKXC 3SDDD 4PRBB 5HVWA 1JGVH 2ESVD 3GSVB 3H3KA 1DBML 5JPMA 1OAKL 3F7QA 2F58H 1I7ZA 1SJHA 4YHLH 4F7TB 1Z5LB 3MRHA 4DZ8B 1CFSB 5IB4B 1PDKA 2AK1H 3ROOB 2BVEA 3V0AC 4PGBB 2R8SH 5CJ5A 1U3HB 3O8XD 3I6LE 3GI9L 2ZUUA 3ARGA 1FNSH 2YC1B 2EECA 2VC2H 35C8H 3REVB 5CP3H 1G9NH 1I8MA 4ORGB 4K94C 1CICD 1IC1A 2VMFA 4NCC1 1LGVA 5EOQH 1J1PL 1NLDL 3L5IA 5ILTL 1AKJB 4JVWA 3VWJD 1DUYA 5F9JB 2Y06L 2CJUL 3QDGA 1OP5H 2FEEI 4BZ2L 3RZWA 5IT2H 4FS0A 2EYRB 1T89C 4JJ5A 3NCBB 3GDBA 5KS9A 2C3XA 1P69B 4R90H 1A7QL 4M93B 4NO0A 4U33A 1F00I 4C56D 5H37G 4HXAH 2WQRA 4NFCA 4XGZA 4P23D 5DRNB 1M71A 4NO3A 3KLSA 4X6DE 1R3KB 4Y4KD 5BZDB 2J4WH 2AV1A 5D70L 4BQ6A 4Y19D 4LNRA 2EDYA 3VXRE 1I3GH 5BV7C 3RY6C 3C6LD 3E3QE 5HD8C 1HCVA 3MRMA 2GAZA 1DBJH 1T04A 1AR1C 5J12B 4U2ZA 1UACH 5C09B 5E99H 3ULVF 3QPQC 2YA1A 4YDJB 3DMMA 4NQTA 3V0VA 1EMTL 2IBZY 3PP3K 2PCPA 3MMEA 3Q0HA 2I9TA 4WENB 4NM4L 3N50A 2IALB 2WBJC 5A3ID 1MRDH 4XH2A 5KVGH 4U1NA 2D3VA 4UINH 4RMSA 3VXNB 5BS0E 3QO0B 1J8HE 4FQXD 2V9TA 1AXTH 5FOBA 4NC2B 1B2WH 1XIWD 5DFWH 3L1OH 1E4JA 4I9WE 3BWAA 5E08H 5AUMA 2G2RA 1EHLL 4G7VL 2EIZB 5H94B 1PEWA 1K5NB 1EHAA 3I6LD 2H26A 4G9FE 3O4LB 1NEZG 4P57A 4NP4H 2ZJSL 3V6FA 1JZ5A 2DQIH 1I4FB 5IW1B 1X9QA 3P30L 1JMZA 4WGWB 5GIRA 2A9NL 2R0WL 3U0WH 2BP3A 1SEQL 3OB8A 3T1FB 6FABH 3MNVB 4JREB 3KPOA 5E1HB 4Y5XC 3QUYD 2SEBA 4H20H 5GJSH 4NZRL 2V9RA 1DFBL 4OV5B 3SDAB 5HDQL 5D7IE 1H3PH 1OL0A 3LQAL 3GSVA 2MMXA 5A2LH 1BGXH 4F7TA 3TVMD 3WFCL 1CFSA 5C6TL 2BHYA 5IB4A 3ROOA 2P49B 1X6NA 4PGBA 5B4MC 4PJAB 4F8TA 1U3HA 1YN7B 5FA4A 1Z2KA 5FYJE 5ITBH 1TIUA 2YC1A 3L3HB 4JFDB 4ZAKD 3REVA 1FNLA 1R0AL 4ORGA 3PL6B 5CEXB 3JXAA 1K3ZA 3WFBH 2AP2A 3QUMH 5F9JA 4LP4A 5JA9A 1FFOB 4XRCB 2X4TA 2P8LB 1UM6H 2EYRA 4D9QE 4M7KL 4EOWL 3D9AH 3RIAK 4HJGB 4J7RA 3NZHL 1QLRB 2X40A 1QR4A 5DRNA 2OL3H 3U7WH 5BS0D 3KDMB 3PQYB 3IETB 1J8HD 1DDHB 2E6QA 1R3KA 1WZKA 2OS7A 5BZDA 2VXUL 4TNWF 4LSSL 1ORSB 4OGAC 1S9YB 4I9WD 5D93B 1WEJH 4MCZB 2WLYA 3DSFL 1FO0H 1OHQA 4JZJA 4G9FD 3U82B 3RJQB 2QSCL 4P2OD 4JKPL 2ZPKH 4FRWA 2P8PB 5C09A 4Z7WE 4PJXB 4AEHH 4GAJL 4FFZH 3RGVC 3LEVL 2IALA 3QRGL 4OFYA 5CHNB 1HH6B 3OJ2C 3S34L 3W82A 3QO0A 4KHTH 12E8L 1FCGA 2AXFB 2DD8H 1ITBB 2O5XH 2JJVA 1MCBA 2Y5EA 2W92A 3WXWL 3TPUE 2OLDA 2HJKB 2E9JA 5HI3C 2OXHA 2AJXL 4IMLA 2EIZA 3T08A 4TTGA 5H94A 3A6BH 1YN6B 5F8RC 3B9EA 4H26B 4KJPC 3MJ6A 3GK8H 4WUUB 2C26A 4G8EB 4N0FA 1GGCL 5FYJD 3O4LA 4RISL 4GG6B 4HX1A 4BYHA 4J23A 5IVXE 1RUQH 5TPWL 1JFMA 2FX9H 1I4FA 5DQDL 1XGYL 1EZVX 3M45A 2JCCF 3FRPG 4FQ1L 3GRWA 3T1FA 3TBTA 4D9QD 1DCLA 3MNVA 5ADOH 1WTLA 3AUVA 2VDQH 4GBXC 1GOHA 2CD0A 1HKFA 2ZOLB 1X5AA 3MBEC 2N7BA 1QD0A 3UYRH 3SDAA 3S96B 4O5LH 4LSPL 2AQ3A 2AKRB 3VXTB 2ZUQB 4XB8A 5E56A 1J0IA 3O3UN 3D2UB 3GMOB 4FNLH 5FYKL 3VJ6B 5KG9B 2D7TH 4PJAA 3LQAC 4K23L 1YN7A 5FO7B 1P5VA 1LO4H 2HTLD 3NIFF 3L3HA 4JFDA 2HKFL 1MPAH 4TUJB 3PL6A 5CEXA 1NCCH 5EB9A 1R5VB 3SGDI 2DLIA 4EN3B 2XZCH 1FYHB 4JZOB 5F7NC 3ULUF 1NFKA 1FFOA 4H0IA 2XZQL 4XRCA 2UVFA 4JFHE 1T7XA 1KELH 4QEGA 2P8LA 4TQEH 3P11H 2APFA 2FHBA 3X3GH 2MCG1 3ULSB 4HJGA 4HUWB 2XICA 3ULUL 3PWPA 3EO9H 1C1EH 4X99B 3CH1B 4ZSOE 1I1AB 5GGSB 2ATKB 1CFVL 3QDHA 5BO1L 3KDMA 1EA9C 3PQYA 2E8YA 3IETA 4H5SB 3ARFC 3QIWC 4XMKH 1YEKL 3DVNA 1ORSA 4IRZL 4MXVF 1S9YA 4WEUD 5E2TL 4ZFZB 3UBXB 5D2LF 4MCZA 4N5EC 4UT6H 2C5DC 1QSFE 4RSVA 5I73C 1H5BB 2LAGB 3V4UL 4NKDA 5F9WC 3ALXA 1N0XL 4PJ9A 5AZ2L 4YE4L 5L88H 3OZ9H 4PJXA 4GLRI 5I74B 1DN2A 4JFYB 2DLTA 4OFVA 1EPFA 4P4KD 4RBPK 3KS0J 1HINL 2O5ZL 2X4NB 5T1DL 1P53A 5SX5H 2DIAA 3S3SA 3EDJA 4H0GA 3GIVB 3UO1L 5CHNA 2JF1A 1HH6A 4P2RE 4LQFL 2HG5B 3E6FB 2AXFA 6CGTA 3QO1B 3CLFH 1IKFL 3T2NH 2EDTA 1N6UA 1Q94B 1B6DA 4MLSA 1KEGL 1U95B 2HJKA 1AD0B 4IRSB 3O4OC 3RNKB 1YN6A 1YUHA 4H26A 1RJLB 4G8EA 5KS9F 4JJHA 3TJHA 2DQUL 4GG6A 4LPXA 3AY4A 4KC3B 3BPOC 4WHYH 3ARDC 3HZKB 1BOGB 3MTRA 1G7MA 4H1LG 5AWNH 3KG5A 4FABH 5TE6H 4JFHD 4KJQD 5E2JA 1UJTA 4DGYL 2UZIH 4NPYB 2ZOLA 3MJ7B 4KQ3L 3KPLB 1T4KB 3CVHH 4S11A 3S96A 3BKJL 1JHLL 4UV4H 3KPRE 2AKRA 4DKEH 5B3JE 2KPNA 2M1KA 3MCKB 4U1HB 2ENSA 1T0PB 2DLFH 2ZSVB 3D2UA 3GMOA 1U6AH 3G5VA 4IM8A 1OTTC 5KW9H 2OTWA 5KG9A 4ZPTB 4E9LA 2AERT 4W6YB 2VYRE 5C3TA 3PWUB 1QSFD 3SKUD 1MCSA 5B39G 4TUJA 1IGYA 5FV1L 1A9BA 4HBCH 1CFTB 5FGBA 4YPGA 4EN3A 1FL5B 4Z6AT 5JXEA 2IMNA 4HMDA 5FGCB 1NEZB 3MROB 2VOTA 5HI4C 1XGPB 4JKMA 3K8MA 3ULSA 5EULV 3THMH 2VISB 2NXZC 2RBLA 2VAAB 4HUWA 5EZOL 1L7TH 5DD6A 3SE4C 4X99A 3CH1A 3O6KL 3VGAC 2B20A 1I1AA 2WZPD 5GGSA 1E4WL 2ATKA 3EJJX 4MCYB 1D5IL 4P2RD 2DYPB 4H5SA 4BA8A 5HXMA 3BEWB 2J6EH 1MQKH 1JCKA 3QHZH 3WO4B 4ZFZA 3UBXA 1PG7H 2XN9E 3V4VL 1DQMH 3RKDC 3C60C 1IILE 3HE6D 1Y6KR 4HK3J 3AB0C 1H5BA 2J8UE 2FGZA 5TGBB 1WLHA 3NCYS 1KENL 4XHJD 3QFJE 5CBAA 2XQYG 3OR6B 4OZGB 2CKBB 2BVQB 1JTPA 2I26N 3MRBB 3S88H 5FO8B 4PYHA 1PKOA 2WSKA 4LKCB 4JFYA 3MV9B 4LASH 2X4NA 4WWKD 4CMMB 1PKQB 4QTIH 5IESL 3GIVA 1QACA 1KFAH 1PBYA 2FIKB 3E6FA 4YAQB 3KPRD 3QO1A 5F96H 3SKOB 1ZGLM 5F97E 4XB7A 1G7QB 1A6AB 1Q94A 3ZLQC 3ZE2E 1EJOH 1U95A 3FO1B 1AD0A 2I9LB 3TBYB 4IRSA 3RNKA 1I9RH 2WAHA 1A6WL 4J3WA 5L2KB 3BRGC 4U0RB 3RA7H 3ARGC 4OF8A 1NUFA 1TJIL 1UWEH 4G3YH 4DW2L 4D2NA 3ULVE 4S1SH 3NIDE 4Z7QE 5GRUH 5I1EL 1BOGA 4Q97A 3G6JA 5HGBB 4XC1L 3ZSSA 4KVCL 4LRIA 2J5LB 4OJFH 1OOAA 5T33L 3F7YB 4YWGL 2YWYA 5KTEL 1MF2H 1G6RH 4AEIL 5JR1L 4NPYA 1FNHA 5DYOB 1SBSH 4NKIH 4BFIB 3MRJA 1CLZH 3KPLA 2AW2A 1ADQA 3WIHA 2VXQL 2NW3B 3QYCA 3UZVB 3ZTJH 1ZVHA 3RBGA 4PJBE 4JFEB 1YEFH 2FGWL 3MCKA 4U1HA 1GPOH 2FH8A 3GMRB 4JO2L 2DWEB 2NPLX 3ABZA 3LRGA 2XN9D 2X89A 4ZPTA 3MLVL 5I16B 1CYGA 2R2EB 4M7LL 5C7XL 2X9YA 1MELA 3PWUA 3GSNH 3H3PL 4OIIL 2NX5E 3DI3B 1AHWB 5ID1B 4FXLA 2FHCA 2ARJB 3MZTA 3QFJD 2AQ1A 1CFTA 5TQ0H 4GG8B 4N0RA 4MMZC 3WCYA 5TDOA 1NEZA 3LDBB 3MROA 1NFDB 3WN5B 4X0KB 1UEMA 5FYKU 3ZKSD 2Q86B 1WBZB 1FQ9C 4P46D 3GMMA 5HHQB 3ALPA 2VISA 1KG0A 43C9B 2VAAA 5TF1H 5K9JL 1YYMH 2Y9RT 4ELKA 3K46A 5GPRA 2B1AL 2DYPA 3QH3A 1UKSA 5J1AB 3BEWA 3U4EB 3M1BB 4F37F 5ALCL 5F1OB 4TNWK 1UADC 5K9KB 3H6JA 3VD5A 4XXCA 3IU4L 3PGCB 1KACB 1NMCB 2QV2A 3FQUB 4ELKB 1BWMA 4K9EH 1I1FB 2I60L 2X4OA 4FP8L 1QSEE 5TGBA 2QBWA 1U8PB 5F88B 3UJIH 3NFSL 3UYOD 5C9JB 3E2HB 3OR6A 1IGJB 4OZGA 3GRWL 5EBLB 2CKBA 3ULVD 1H3XA 4L4TB 3MV8E 4LRNL 1QR1B 1FNEB 3MRBA 2XPGB 5FO8A 4LKCA 1J7VR 3KPSB 3RKPA 3MV9A 4PG2A 3U7YH 3RWGB 1P4IH 4CMMA 1LK3L 1LEKB 3PXJA 1PKQA 2C4XA 2LTQC 2FIKA 2OTUB 3T2QA 4YAQA 3VWKA 3SKOA 3MXVL 3QXDB 2VWEE 3HG1B 2DLEA 4PTTB 1A6AA 1QRNB 2CDEB 3FO1A 2I9LA 5CFHA 4I13B 5IVNA 3GO1H 3QULB 1U8JA 1RMFH 2NX5D 1ZVYA 3HKFA 1U3HC 5ANMB 3FN0L 2APVA 3TBWB 4PRAB 3PWVB 4NGHL 1SBBA 2DQTH 4WUKL 1NGQL 1NC2D 1EVUA 1OSZB 3UP1A 4QXWA 4D94A 5HGBA 2KBGA 1TLKA 4U6VH 4ZFGL 5EBWB 3F7YA 3FOMB 3VDBA 5B8CB 1OAUL 1JPST 4BFIA 2FLBT 1A2YB 1E4XL 4QRRE 5HPMA 4NN6B 3OGCA 1L0YA 3GEWB 3FOLB 4M93C 1AFVL 1KXVC 3UTTA 1KIRB 3NH7L 2KQMA 3UJTH 4JFEA 1F90L 2E6JA 5IOPB 4XBGB 4XP4L 3GMRA 5HDOA 2HWZH 2DWEA 4YDLC 2MHAB 4BK5A 4PJXF 5FCSH 4IDLA 5I16A 2R2EA 2W07A 4GXUN 5GGTA 2XA8H 1QSED 1AHWA 5ID1A 2ARJA 1FYTE 4J4PA 5CIPB 3ISWA 2JCCE 4KTEH 2N4IA 2B2XH 3GSXB 5J12C 1NFDA 4C58B 3WN5A 4RWYL 3MV8D 4YQXH 4OKDA 3MJ8A 2Q86A 1W0YT 2YA2A 1UT9A 4XCYB 4QRSB 1BD2A 4NCDA 5HHQA 4NDMB 4H1LB 3FRPA 5CWSB 5SWQB 4JDVB 2BCKB 5CMAB 4CVWA 3TF7A 1VFUA 3PDDA 2R0ZL 3TGXA 5J1AA 3FZUD 3QCVL 3VRJB 3MOAH 4ERSL 4M6OL 4MXWH 3E6HA 2AS5M 1BIIB 25C8H 3MRCB 3WLBB 4N68A 3PGCA 3S3JA 3NIFE 2BVOB 1GGYA 1UYWL 1YECH 3MCLL 1I1FA 1NMBL 1TNNA 4LOUD 1U8PA 2DJSA 2QHLA 5F88A 1ZKAA 3LPGA 4XPHL 5C9JA 1YEJL 3E2HA 1IGJA 1YEIL 5EBLA 1V7NH 4GSDL 4L4TA 4OV6F 5B39B 4LIQH 1BF8A 1FNEA 2XPGA 2Q1EA 4QXTB 5CEZD 4Q9QH 1E6OL 2F5AL 3HPJB 3KPSA 1A6PA 1JFQH 2X70B 5F7KC 4AT6B 5A43C 2XY2A 1LEKA 1U3ZA 4UOW1 5DRXB 3SGJA 4NQCA 4O2EB 2I25N 4ZTOL 4OIAA 5I2IA 2OTUA 4PJHB 3MRFB 1IM9D 5DHYB 1XF2B 3WHE0 4MXVE 2J7LA 5KVFH 3QWRA 3QXDA 3SDAC 3HG1A 1V05A 4GJTB 4PTTA 1QRNA 2CDEA 1N7MH 2WWKO 3TIEB 5HI5C 1B6UA 1A8JH 4G6KH 2PYEE 3N0PB 2FB4L 3DNKA 1IGTB 3SHSA 3UTPE 1PSKH 1J11A 3QULA 5EORH 1T7VA 4PRPA 1OY3B 5HVGB 1LO3H 3GSQB 3TBWA 1FYTD 1JZ7A 4PRAA 1WZMA 1RPQA 2F9BT 3PWVA 3B2VH 3PL6C 4KHXL 1OSZA 1ETZB 3B6SB 2H45A 1ZLVK 1SVZA 3G08B 5EBWA 3FOMA 2APWA 2EDNA 2FLRT 5B8CA 1IC5L 4I3RL 2DMCA 4PJFB 1A2YA 3LV3B 1MRFH 4LNVA 1TCMA 2VIRB 5F3HB 2XZAH 3FOLA 4JFXB 3ARQA 5CSZB 1KIRA 1FL3B 1WIPA 5IOPA 4XBGA 5FUOH 5L2JB 1QVOA 3DUSB 2EEAA 3LKNB 3OX8B 5EA0L 2MHAA 4GKNA 3NCJL 2Y23A 3NABH 1FVCA 2PW1B 3IDJA 5D93C 4WO4D 5DVMA 4BZ1L 2I5YL 2A1WL 4PRHB 4HPYH 5CIPA 3DYPA 3ALWA 3VA2C 3N85H 1OPGL 3GSXA 4R7NB 4JKKA 4DCQB 3X13B 1CR9L 4XCYA 4QRSA 3AMLA 3QDME 3OAYH 4NDMA 2NLJA 4H1LA 4XPAL 3TCXA 4CUCA 5CWSA 3T09A 4XAWL 5SWQA 1KIUA 4K8RL 1I8KB 4JDVA 4XX1G 2A0LC 2BCKA 3W5MA 1FRGH 1T21B 1OF2B 4GS7B 2B7DT 5GSVB 2AV7B 4PB0L 3VRJA 3QUZA 2FL5B 1A21A 4HS6A 3FO0L 4MD0B 5F9OH 4LSUL 5CUSL 1BIIA 1ZANL 5ABDE 3MRCA 3WLBA 3G6JF 2GSGB 2OZ4H 4PBXA 5SV3A 1FZOB 4N90E 2BVOA 3UTPD 2FX7H 4LCIL 3BXNB 4MMXC 4S1RL 5CEYB 2EH7H 3TJHC 2DOCA 4Z77B 5B39A 2EIBA 3AY4C 4QXTA 3HPJA 2OP4H 3G9AB 5F1NB 2X70A 2NY6D 4AT6A 1P7KB 3WFHB 4LSDA 4P59H 1ADQL 3WIHL 3U83A 5ICYA 3OQ3B 4QCIB 1S9WB 2Z31D 3MLWH 5DRXA 3CMOH 4O2EA 3BT2H 1YY9D 4GQ9L 5DHYA 3VXPB 2IAMC 5C0GB 3WD5L 4XCNB 1OB1B 4ZS6C 3UJJH 1JNNL 4U31A 3QCTL 2ZUQC 1JF1B 1F42A 5LWYL 8FABB 5DUPH 4PJ8D 2AEQH 5EIIB 3T0DA 4G9DB 3ZDZE 2MSPA 4V1DE 1J9CT 4WY7L 3GSQA 4HWUA 3RFZC 5K9OB 1JJUA 3O2VH 5E8PB 1A7NL 1GJIA 2Y07H 1ETZA 5FGBC 1ONQB 2X2YA 4EN3C 2AJUH 3G08A 4L4VB 1BEYH 3BQUB 5MEPB 3QDMD 3B9AA 3VFNB 2DBLH 1C08B 1T1WB 4PJFA 4CJ0A 1FVDB 3LV3A 2VIRA 1QBML 5F3HA 4JFXA 4LLAA 5CSZA 3OR7B 2KUTA 1FL3A 1I1AC 3JWDL 3T3MF 2D0FA 1UA6L 4U1IB 1NL0L 4YDKH 4LSRL 5J0BA 5L2JA 4OZGF 3DUSA 3LKNA 2AJYL 2VKWA 1U9KA 1YDPB 5C86A 1WGOA 2Z91B 3V8CA 4N90D 3VGBA 4UNUA 2PW1A 3HI5H 5SWSE 3IS0X 5AYUH 4KVNH 5HYJE 1YJDL 5IMLA 5MI0B 3SDXE 2CKBL 1A5FL 3VG0L 4PRHA 1H5BC 4TTDC 3I2CL 1JHTB 3U30B 3BUTA 4DN3L 5BOZG 5FYLL 4R7NA 3TFKA 5ID0B 2GQHA 4D9LH 4ELME 3X13A 3Q2CA 5C0CB 1A6UH 4ZO7A 4HK0B 1EUUA 2CRYA 3PIQB 3MOBL 4HMCA 1T21A 1OF2A 1LO2L 3CK0L 5GSVA 1CXKA 4M7JH 1S7RA 1N64H 4F37K 1KJMB 3KPQB 2XFXB 2FL5A 2D9CA 3QPXH 4K8RC 2X1OA 4R8WH 3VDCA 4N8CL 3K3QA 4MAYA 3B83A 4IRSC 3QI9D 5I15H 3RL1B 5CP3A 3NN8B 2EC9T 4LHQB 4RGOH 3VGFA 4Q7DA 4V1DD 5CEYA 5FEBA 5IFHL 2HKHH 4ZDHB 4AENB 2YS4A 4Z77A 1RVFL 4LARL 4OB5L 2OI9A 3ZSTA 4QHNB 5F1NA 1A3RL 1FSKC 5D1QD 5TFSL 3C8KB 4LRIC 5IJVB 4U1KB 3P77B 4X9IA 3IFNL 1C7SA 4CU6A 1U58B 3ARED 4L5FH 5FOJA 4YUEL 1FNAA 4MB4A 5C0GA 4LEOB 4XCNA 1OB1A 3FB5B 3EW3B 4KRNA 3V79C 2BY2A 2R4SL 4LGPB 3DWTA 1JF1A 2YKLL 1S3KL 4HLZH 1C12A 2WBWB 3TNMB 5GGTL 3IB4A 3V0WL 5GRWA 8FABA 4TSBH 3FQTA 4J3XA 3EDDA 3RPIB 5L0QB 5F7LB 5GS2D 5EIIA 1FO0B 5T3XL 4MNGB 4G9DA 5SWSD 5HYJD 3BKYH 2XT1B 4PS4L 1ZXQA 1CE6B 3RVUC 2QADB 5E8PA 1ZLWH 4PBVC 4LAQL 2MWCA 2F5BH 3SDYH 4X6CB 2P1YA 1JWSA 3QQ9C 3VE0B 7CGTA 1TDQA 4L4VA 4HG4J 1J1OH 3BQUA 2JELH 3O11B 5MEPA 4JFFB 3VFNA 1O7VA 2VXVH 1CGUA 4K3HA 1C08A 2YRZA 2PF6A 1FVDA 3OAZH 4XP5H 3J8F7 3OR7A 3UC0L 5IFAH 3BZDA 4CN1A 1JGUH 3X17A 4EI5B 4U1IA 4ODXB 3FT2B 4LSVL 3RWFB 3TZVB 4YHZH 3RVVD 4EJ1C 1YDPA 4PJGB 3WO4C 2Z91A 1RJCA 3JWDC 4HAGA 1U8OB 2NXYB 4HIIB 2GITA 3TV3L 3V5HB 3RDTD 3LRSB 3ZT6A 1BPVA 1JHTA 2PNDA 3T2PA 4JB9L 3T2OA 1YJDC 2PR4H 2EDQA 5ID0A 4PJ5B 4KTDH 5C0CA 4WU5B 4OM1H 1B90A 3LKSB 4HK0A 3ZO0A 1FG2B 5KVMC 1IT9H 4NJAH 2WWMC 4PG2C 1DN0B 4X6EB 4Y8DC 3FN3A 5FYJH 4R2GB 4XVUC 2R39A 3E0GA 3N9GL 2H32H 4IIQB 1KJMA 2V2XB 3U1SH 4PJCE 3KPQA 1EDQA 2XFXA 4O02L 5IHBA 2CMRL 2EDHA 3O6ML 4KGJA 2R0KH 2DQGH 4A2LA 2HVJB 4WTZG 1T6WA 4JHWH 5I19L 3RL1A 3NN8A 5DFVC 2M26A 4XMLL 2EDDA 4UZGA 4ZDHA 3QNXA 4AENA 4U0RC 3QUMA 2CLRB 3OXSB 1Z6JT 3WE6B 4C83B 1MJUL 4G43B 5IJVA 3C8KA 2J5LC 1MJJA 4U1KA 3QP3A 3P77A 5GS0D 2IWGA 4HFUL 1U58A 3IFOB 5ISZB 2VR9A 2ORBH 2DQHH 5E6YA 5KN5A 4LEOA 1KBGL 3FB5A 2XG5A 5GHWL 3K1DA 1EZVY 1AP2B 3N1MC 2E27L 5DHVH 3V5KB 5D5MB 3ZZ1A 3TNMA 1LD9B 2NY1D 4QOKB 3RPIA 5TQ2H 2P48B 1FO0A 4LHUD 4MNGA 1MHPL 3PWPD 1JPSH 3WS6A 1CE6A 3MOQA 5IGXL 4X4ME 1XR8B 1AHWC 4XC3H 2EDWA 5DJAB 4Z0BH 4J4PC 4U7KA 1VFAB 4X6CA 3MV7E 3BD3A 2C4FU 1A3LL 1OTUD 3LDBC 4NYLA 3WN5C 3O11A 5I18H 4JFFA 1Q1JH 3QQ3B 4XPFL 2YD6A 4K3JL 1JP5A 5GS3A 4M62L 3SCMB 4OQTH 1OCWH 3GJFB 3VI4E 1XAUA 4EI5A 4YBHA 3TF7C 4ODXA 5JXAH 5HHOE 3RWFA 1QRKA 1RZJL 3TZVA 1JWMB 2X6MA 1T2QH 4PJGA 5HPOA 3DX6B 1JPFB 4PJDB 3AAZB 4GOSA 1U36A 1NPUA 2CUIA 3WIFA 1NMCC 1U8OA 3KNBB 2YZ1A 4HIIA 3VXUE 1EEQA 2FBOJ 1VGEH 4TVSa 1RURL 4XPBH 3V5HA 3LRSA 2QQKH 3QRFM 3GHBH 3BN9C 4XPTH 1NDMB 5E0QA 3E2HC 5ALBL 4HPOL 3BYYA 4WU5A 4NWUL 3LKSA 4ENEC 1A0QH 1FG2A 2DQCH 3AC0A 1L6XA 1CDIA 1CVRA 1DN0A 4X6EA 2FEEL 5JOFB 1YEHH 3MRIB 2J88L 2UWEB 3SGJC 4I8DA 2KDGA 5KSVB 2E7LE 4IIQA 2V2XA 2R29L 2PTTB 3T0EB 4QHLB 1YEEH 3WNLA 4C55A 2CGRH 1AXSB 2HFGL 2HVJA 3VMOA 4BZYA 2HJLB 3WSQH 4HIHB 2X1QA 1BQLH 3MV11 5H8DA 4MA7H 1QKZH 3O2DH 5C3LD 2CLRA 2JB5H 2A77H 2BRQA 3OXSA 3MV7D 5FM8A 5DJ6B 3QNYB 5E5UB 1EXUB 3WE6A 1FGVH 4C83A 1ZT1B 4G43A 2UY7A 3EYFB 4K7FB 1MCQA 5B8CC 1CT8B 5ISZA 3M8OL 3KS0H 1T7YA 5IV2B 1MVFA 4NN6C 3CFEA 1MI5B 1AP2A 5DMGC 3S36X 3R0NA 2XXMB 5BVPL 3P0VL 5HHOD 5D5MA 4OLUL 4QOKA 1C7TA 2FEDD 1NGWB 2QSTA 2ZCHH 4C57C 1KJ2H 5DF0A 3VXUD 3AGVA 1CCZA 3IXTB 5D7JB 4MD4B 3S7GA 1XR8A 5DC9B 3LS4L 1VFAA 5I1DB 5E6IA 4ACPA 2VAJA 3DGGB 4N5UA 3UXFA 1Q9WB 2V17L 3QQ3A 1L7IL 1X5XA 1A47A 3EOYG 3BAEL 1CFQA 3SCMA 3WFEH 2F58L 3GJFA 1M7XA 2VLKB 1KJ3L 3L9RB 4HULB 5C2BH 4DTGH 2R8SL 1JWMA 3A6CL 1CE1H 1RI8A 3DX6A 1JPFA 2VC2L 4P5TD 1LO0H 3PWJB 4O2CB 4PJDA 1FIGH 3EYUL 3R0MA 2YD9A 1SMOA 3CSPA 3DRQB 3RPKA 4XCFH 1DE4A 3L5WA 4F2MB 3KNBA 5EOQL 4KRMB 1RZJC 1WZ1L 3GBML 3Q1SL 4I48B 1A64A 2IQAB 4M8VA 5IT2L 3ESVF 4GAGH 1KN2H 2GK0A 3DETC 4G7YH 1ZA6A 1A1NB 2ICEB 3OJDA 4R90L 2NNAB 5FCUH 4HXAL 1G6RB 2LU7A 5I1KH 4YX2H 1KCRH 4NHUB 5JOFA 3CVHA 3MRIA 3CFCH 3T3ME 2UWEA 4JRYE 2J4WL 2NTFB 5KSVA 2F8VA 1G0YR 2PTTA 3T0EA 4QHLA 3V7AG 3F58H 4I18B 3L3GA 3QA3B 5EWIH 1HNGA 4MVBD 5DURD 1AXSA 1UGNA 3VXMB 4RX4A 1PGRB 4NC1E 5IMOA 1DBJL 2HJLA 1FH5H 1MHHB 3EFDH 1BJ1J 4HIHA 2HVKB 3TN0D 5E99L 3WO3B 4JO4H 2B8OT 2EDRA 2J1KA 3H9ZA 5E2VH 1ZV5A 2L4OA 4KRLB 1YNLH 3BJ91 1H0DB 4LCUB 5DJ6A 3HE7D 3QNYA 1EXUA 3TYFB 3O9WA 1ZT1A 1MRDL 4UINL 1N5YL 3EYFA 4ETQB 4K7FA 1AJ7H 1AXTL 1CT8A 5IB5B 1FZJA 4ZXBD 3QEQE 1OP3K 2X4QB 5IV2A 4ZUUB 3L1OL 1MI5A 3ZE1F 5E08L 4RFOL 2J6EA 5ITFB 3O6LH 1DBAH 2ZUYA 5I1GH 1KOAA 1L9NA 5FECB 2CRIA 2N1KA 4W6XB 4L3CB 3LQMA 4WU7A 1NGWA 4HIJB 3KGRA 3WDIA 2EKJA 2M2DA 1WCQA 1YZZA 5T1KD 4NP4L 4MXQA 4EIGB 4HJJL 2DQIL 1QBBA 4RNRB 2AQ2A 3OB0H 3LPFA 4MD4A 5D7JA 3U0WL 6FABL 2DQDL 2L7UA 5I1DA 4NSKB 2LU3A 4EUPH 3GKWL 1Z9SA 1HH9B 4H20L 5GJSL 3BZ4B 3DGGA 1LP9B 3TFKC 1Q9WA 2W1NA 1H3PL 4XVJL 3IDXH 4CAGA 1BGXL 4JRYD 3PWNB 4UAOB 3L9RA 1AY1H 4GS7C 3VFMA 2DI8A 4KKBC 3HN3A 1V5JA 4GW4A 5IMKB 1AH1A 4PD4J 3D87B 5ITBL 2V2TB 3PWJA 4O2CA 3WKNA 3RI5F 3L6FB 1C5BH 3DRQA 4S1DD 4L4JA 4F2MA 3WFBL 4S1QH 2PXYB 4I48A 3QUML 4NJ9L 1KPRB 4EZMA 3UPRB 3EBAA 2VITB 2IQAA 2GSIB 1UM6L 4JE4B 3PG2A 3D9AL 2AJ3B 1P4LB 4FHBD 1A1NA 3HNSL 1YC8A 2ICEA 4YFLF 2NNAA 4KFZC 5CZXC 1SMAA 1INQB 4BQBA 1G6RA 3IVKA 2ENYA 4JY5L 2AGJL 3U7WL 2Z4QB 2OCFD 4NHUA 5DMJB 2GUOB 1EX0A 1S78C 4IMKA 1FFNB 1IAKB 3AVEA 3QEQD 2W0KA 5KSBB 1X5JA 3VW3H 1KTRL 3OBAA 1TZGH 3ARYA 1WEJL 5B3NA 1KCKA 1HQ4B 1FO0L 4G8GB 3QA3A 4WV1B 3VXMA 5LG1A 1KNOB 3R1GH 2BOCB 2ZPKL 2DTSA 2VDMH 3GSNA 1MHHA 5FM5O 2HVKA 2CIKB 4K7PH 3RY4A 3OMZA 3RVWC 3OKOB 3RTQB 5JQHC 1U8HA 2BX5A 3B43A 4AEHL 3CFIC 4F15B 1H0DA 2EZ0D 4LCUA 5DK0B 3TYFA 4FFZL 4KKLD 4XMPH 2A2QT 3MLZH 5DVKA 4RQQB 3OPZH 1A6ZB 3BQUC 4KHTL 4PJGF 4ETQA 3EHBD 2DD8L 5IB5A 4IHOB 2O5XL 5D7LE 2X4QA 4HLZG 4ZUUA 1XF4A 1DL7H 1RD6A 5ITFA 2A6KA 4X5XB 3D0VB 3A6BL 4OCNC 5DJ0B 5FECA 3GK8L 1RJYB 4L3CA 2BERA 3LKRB 1OGAB 1MFBH 3Q6GL 3LAFA 3C5ZD 1BREA 1RUQL 2FX9L 2RFXB 3B9KA 3SJVB 4QHUB 4RNRA 4WTZA 5I30H 5MI0C 4RFEB 4MNQE 4Z7UB 2QQNH 5CZVH 4KXZI 4GRMB 4NSKA 5ADOL 3U30C 1VSCA 3TLRA 3BP5B 1HH9A 1C8PA 4NNXB 3DRTB 4YHPB 3BZ4A 3TIDB 4OM0H 1K4DA 2ICES 2YPLB 4HH9A 3UYRL 1FL6B 4O5LL 4F57H 4DUXA 3EO0B 2A6DB 2F19H 1UJ3C 3KYAA 1T80A 3PWNA 5EU6B 1CDUA 4FNLL 2Q20A 2FR4B 1FVEB 2D7TL 3IXAA 3N1FC 5IMKA 5T3ZL 4HDIB 4OUOA 4AL8L 5HHNB 5C0BE 2V2TA 3LIZH 1MPAL 5KSAD 3L6FA 3VXSE 2YXMA 4NQCD 2XZCL 4U1MB 4MQXD 5DK2B 1KPRA 3UPRA 2HT3D 1KELL 1F6LL 4TQEL 4OGAD 4B7LA 5C6PB 4GAYB 3X3GL 4TULH 4NO5B 2BVTA 2F54E 1TPXB 1INQA 3EO9L 3NA4A 1C1EL 2IGFH 5MERB 4RZCB 2Z4QA 3VRLF 3S98A 4XMKL 2GUOA 4DN4H 1FFNA 5KJRH 1IAKA 5D7LD 5KSBA 3C09B 4P2YA 4OGYL 4W6WB 5E5RB 1F3JB 2VUYA 1HQ4A 4G8GA 4WV1A 5GZOC 2XQYK 1Q0YH 4GW1B 4Y4HD 2CRZA 1KNOA 4YNYB 3QR2A 2A6JB 2BOCA 5L0QC 2OSLB 4PY7B 2BY1A 4N9GB 2CIKA 3OZ9L 3R8QA 1DQDH 2V7NB 3VH8G 3OKOA 4YK4B 3RTQA 4MNQD 5HVFB 3VFTB 2QADC 5DK0A 3F7VB 5HI3D 1GSMA 4ZO9A 3KYKH 5TE4H 4KZEH 1MFNA 4U7MA 4B53A 4RQQA 3Q5OA 2PTUA 3K8KA 1LWRA 4M9PA 4PJDF 3CLFL 4IHOA 2FATH 3T2NL 1U2CA 4L8SB 4LL9A 3BDXA 4X5XA 5FUZH 3BE1L 4FQ2L 4LSQH 5LGKA 4LFHD 1RZFH 5DJ0A 1AI1L 3UDWA 1KN4H 3S3PA 2DTMH 4EI5C 4HXBH 4GBXD 1RJYA 3MRLA 4KMLB 3LKRA 5C0BD 5JDSB 3L5HA 4KWUA 3TZVC 2O61B 3BZEB 3HPLB 4XNZC 3VXSD 5HSFA 1CGSH 4WI3A 4YIQA 5KANI 4QHUA 5AWNL 4FABL 5TE6L 2NXYC 4GRLB 5F9AC 4NCC2 4RFEA 2F53E 5I1HL 3SDDB 4NHCL 1Y6NR 3NZ8B 4Z7UA 2ESVB 4GRMA 2UZIL 4LLWB 1XFPA 5GS1B 3BP5A 2J3SA 4ONGH 2F54D 4KPHH 3DRTA 4NNXA 4YHPA 5F89B 3TIDA 2YPLA 1T03H 5E5MB 1FL6A 3O8XB 3EO0A 4UV4L 4DKEL 1F97A 2A6DA 3H9SE 2Q7NA 2F74B 4PLJD 1KLGB 2NCMA 1CICB 2B5IB 5EU6A 2DIJA 2P5EE 5JW4R 1CQKA 4R2GC 1U6AL 2VN4A 5KW9L 1PEZA 3VWJB 2FR4A 4IIQC 1IFHH 1I3VA 4OZFB 1OP5K 4HDIA 5HHNA 2WANA 3BD4A 3DGCR 3RRQA 4P3CH 3PGFH 2BDNH 4C56B 4U1MA 1KTLB 4U7SA 4G6ML 2ZCKH 3C2SA 4BH8B 4QRUB 4ETYA 3GMQB 4GAYA 4Y4KB 3THML 4NO5A 2R1YA 2EKSB 1LE9B 4Y19B 2HMIC 4MB3A 3TNNB 2FJHB 5GRXG 5MERA 1YY8B 4RZCA 4Y1AE 3ZKMD 4GRWE 5FYKE 3KYNB 4I0CC 4GMTH 1GOFA 2VLMD 2J6EL 3MJ9H 1H3VA 5D7KE 3QHZL 1PG7L 3MPCA 3WNNA 4KTYA 1J0ZA 1BHGA 1F3JA 1FBIH 2D0GA 3D25B 4JO3L 3VFSB 2QL1A 3L3KA 4GUPA 4GW1A 4NUJB 2HP4A 4YNYA 1I8LA 2A6JA 5IHUH 1W72H 4YBQD 2A83B 2OSLA 4PY7A 1TITA 4N9GA 4FQIH 3S88L 3LRHA 4FQXB 2QHRL 1D5BB 3P4LA 3GB7B 2F53D 3VFTA 3HR6A 2VZ1A 4HF5H 2EXWC 3F7VA 1XIWB 3I3DA 1I7RB 4YDVB 3KJ4B 3SEPA 3RVXC 4LLUB 3WIIH 3C87A 4AQ1B 1KFAL 2PO6D 5D1ZD 3NVQA 5I1JL 2GI7A 4ONOA 5F96L 3IAGC 2DF3A 3H9SD 5C92A 4TYUA 4HKBA 4L8SA 5DZOA 1P4BH 1F4HA 3SCMC 2P5ED 2P42B 3TM6A 1I9RL 2R1XB 1OD9A 2HTKD 1IAIH 2OZ4A 2VSCA 5JDSA 1XGQB 1BVKB 3RA7L 3SKNB 2O61A 1NCWH 1PQZB 3HPLA 3BZEA 1UWEL 4G3YL 4OFPA 3SDCD 3QUYB 3V5DB 2H2SC 4S1SL 3DXAE 4UBDC 3LHPH 2FIRT 3D0LB 4P2QE 5GSRB 4GRLA 2LV4A 3INUH 4OJFL 5EZIH 3SDDA 3NZ8A 2ESVA 4X6DB 1KCGC 1MF2L 1G6RL 5F72S 4CN4A 4IRJA 4OCYH 1SBSL 3TVMB 5GS1A 4NKIL 1G9EA 4KUCF 1K4CB 1AR2A 5F89A 1G7PB 4NM8L 1CLZL 1KLUB 3SKMB 2HRPH 5E5MA 5J7CC 3O8XA 3CNKA 4MAYD 4Y1AD 4V3DB 1B0RB 1YEFL 4ZAKB 2EXYC 5IQ9A 2F74A 1KLGA 1CICA 5D7KD 4Z9KB 5HI4D 3VWJA 4HUMB 2Y36H 3FAWA 2DBJA 1U8MB 4A2MA 4OZFA 3ECBB 1B0GA 3GSNL 3RI5K 4UUJA 4ODBD 2HT4D 3G5XA 5EC1B 2FECI 4WFFE 4C56A 4DAGH 4CBPA 4P23A 4GKSB 1CU4H 2IPKB 3V6ZB 1KTLA 2ILLA 4BH8A 3MRKB 1J8HB 5FK9B 2J8HA 2V5MA 3GMQA 3EYQC 1U8KB 3BH8B 3RKDD 4N0CD 2EKSA 5CJOL 5TF1L 1YYML 1NKRA 2YK1H 4Y19A 1LE9A 1UH4A 3TNNA 4YHMH 5D7SH 3CFBB 4JPKH 3C6LA 1YY8A 2DLHA 1HXYA 4Z95H 3FB8B 1G0XA 2YD7A 1CGXA 3JWOH 3TT1H 1FE8H 4OFDA 4G80A 1CXIA 4K9EL 3D25A 2WINB 3PGDB 1Q72L 3UJIL 3EJYC 4NUJA 4FQLH 2QJDA 2A83A 3DXAD 5KVEH 1T2XA 4MXQC 1JNLH 4P2QD 3GB7A 5LAXB 4J2XA 3ZDYF 3U7YL 1P4IL 3OWEA 1XIWA 4JFOB 4YDVA 4LLUA 4FFWC 1IAII 5K59E 1M7DB 5MP6H 1ZSDB 4JHAH 1T0MB 4RMVA 2H32B 4H0HB 2BFVH 2R1XA 3SGKA 1ERNA 5C07E 4URTB 3WNMA 2VDPH 4KK5C 2HA1A 1XGQA 1BVKA 3SKNA 1PQZA 5FHBH 1IJ9A 1VERA 2OTPA 3QUYA 4WFFD 3V5DA 1U3JA 2DQTL 1D6VH 2ADJA 4EUPG 5GSRA 2KH2B 3MV01 3LKPB 4HGKC 4U6VL 5E8EB 4X6DA 2Y6SC 1EO7A 4NC0B 5KSBF 1IVLA 2I27N 3TVMA 5DC4B 4WHTB 4K3DH 4EKXA 1G7PA 3EOTH 3VXRA 3CX5J 1KLUA 3SKMA 1IGMH 3E3QA 4TUOB 2CLZB 1WITA 3T3PE 3UJTL 4ZAKA 3QG6B 4I0PD 1ND0B 5CGYD 1Q9KB 5DUMH 2HWZL 1I9IH 5IROA 4IMKC 1JL8A 2EE3A 3L3DB 4I4WB 1VACB 4Z7WB 1U8MA 5IP4A 5L9DL 1VESA 5LGHH 4I18C 5I8EB 3MRDB 3RX5A 1DQTA 5EC1A 2DB8A 4IOFD 5GS0H 4KTEL 5CS7A 1YQ2A 2B2XL 3P4MA 4GKSA 3BGFB 3V6ZA 2CIIA 4YQXL 5BS0A 3MRKA 1J8HA 2C1PB 1FPTL 5EU3B 5FK9A 4OAWB 5DEGB 1U8KA 5D2NE 3I9GH 3BH8A 1VGKB 2VDOH 4QRQB 3TPUB 2HFEB 3CFBA 5DJYB 3FB8A 5F6IB 1SEBB 4G9FA 3FQNB 5E94B 4DVBB 1F45A 3DI2B 4P2OA 4MXWL 5EFIA 5F44A 25C8L 3DUHA 4ZO6A 4G59A 4GH7B 5C07D 3QG7H 3VU2A 4OGXL 2VLRE 4P4KB 1MCCA 4XHQA 4Z7VE 3MA7A 1EGJH 1HYSD 3QB7C 5AAWA 4JPVH 4K9EC 4NFDA 2HJFB 1AC6A 5E8NB 4NRYB 2FJFB 4Q9QL 5D7IA 1NC4D 5LAXA 1JFQL 4GXVL 3QJHB 4ODHL 3CDYA 4JFOA 4XVTH 4W81A 3QXAB 2W9DH 1LNUB 5KVFL 3IFLH 5CBEB 1ZSDA 1HSAB 4MA3B 3MRRB 3MGAA 2H32A 4PP1D 1EHNA 1N7ML 2D31B 3MYZA 1RIUL 1AKJD 1PSKL 3HLAB 2X4UB 2GKIA 4UAOC 3RY5A 3U79A 5EORL 1PLGL 1SYVB 1HYRC 2LVCA 3QZWG 3OAUH 1LO3L 1KT2B 1GAFL 8CGTA 3B2VL 2R1WA 2NY3D 3AS1A 4ZSOB 3MXWH 3LKPA 4F7PB 1VA9A 2PXYC 5E8EA 1KEML 4QWWC 4MDJB 4OLWH 5DD1L 4WHTA 4BK4A 5KANG 3VH8A 2LAAA 1MRFL 1S9XA 4XZUA 2MJWA 1GHFH 4WI9A 3S37H 4QY8A 1QSFB 5DMIH 4TUOA 1BVLA 2CLZA 5JIKA 2VDNL 3QG6A 1ND0A 5F7EL 1Q9KA 5FUOL 3ZT5A 3MODH 3DTXB 3ARBD 3HRZB 3L3DA 1MAKA 2XYCA 1SQ2N 1VACA 4I4WA 3NABL 4Z7WA 5LQBH 4HCRH 5GGRB 3JUZA 2VLRD 5I8EA 3MRDA 4WV1C 4YXKL 1NLBH 1T20B 1FIEA 2BVPB 1KJ2B 1GGUA 2F8OA 2N56A 5SX4H 3N85L 1JBJA 2NZ9D 4P2RB 4D0CB 1ZLUH 2C1PA 5EU3A 1GGIL 4L29A 1VDGA 4OAWA 1MHCB 5DEGA 1VGKA 1UH2A 3RTQC 4QRQA 3TPUA 2P47B 3V8OA 4EBQH 4CW1B 2HFEA 4KK8C 4FFVC 1FRGL 4W70A 4F15C 3HE6B 5DJYA 1CVSC 5LGJB 3FQNA 5E94A 3CPLB 5INCB 4OQTA 4DVBA 5F9OL 5J1TC 4LU5L 4M6NL 5ECJE 3DV6B 3ILQD 5IVXA 2IBBA 1L4IA 1U3YA 2OZ4L 2FX7L 1XGRB 3ZYJA 5E6ID 3FHQA 5GGRY 4P4KA 1RAMA 2HLFC 2EDJA 1S7UA 1CXLA 4LSTH 2Q8BH 3UDWC 4WWKB 2EH7L 4X9FA 2WBKA 4R9HA 2HJFA 5E8NA 4NRYA 3KPRB 2OP4L 4CVXB 4M4PA 4P59L 4XTRC 5FUCC 3QJHA 1H9VA 3MLWL 4FTVE 4JN2B 4RGMB 3CMOL 3QXAA 1CGVA 3U7AA 3BT2L 1NAMH 4OZHB 4PP8C 1MFAH 4OSUH 4WUUE 5CBEA 4LPUA 5F3BA 3UJJL 1HSAA 4MA3A 1A22B 3MRRA 4PB9H 2HRLA 2ITDA 2D31A 1C5DA 5CD5D 1EAPB 1F4XH 3GSOB 2AEQL 1IM3B 1NANI 3DROB 1QFHA 3HI6H 1N8ZB 1SYVA 2NMSA 4YHOH 4BFEA 3MFGB 3O2VL 5DDHB 2JTDA 4V2BA 4ZSOA 9CGTA 3PHOA 3LH2H 2MPAL 4F7PA 1DSFH 2AJUL 2DICA 3ET9F 1BEYL 4KJWD 1U93A 3O2DA 4MDJA 3MBXH 1G9ML 2DBLL 3UAJC 1IGCH 2XN9B 1PY4A 4XWOD 4M7ZB 1TPXC 3O3EB 5BJTB 4F7EB 1QSFA 2J8UB 1PY9A 1YC7A 4YDKL 4NFBA 1T5XB 2K3TA 3DTXA 3ZKQD 2GJ6E 3QFJB 3MR9B 4GFTB 4N1HB 1JPGB 2R9HD 1V3LA 3HRZA 4P0DA 2CXKA 4LEXH 4NQSB 3C09C 2E8ZA 1UZ6F 3P9WB 3HI5L 4ZS7H 3VI3F 5GGRA 5AYUL 4KVNL 1OD7A 4P46B 1Q38A 3LZFL 1T20A 2O93L 3R8BB 2BVPA 1KJ2A 3SY0B 2OR7A 1I8LC 2DQJH 4MS8C 1B4RA 2P24B 1JGLH 4XXDB 5JW3H 4P2RA 1X7QB 2NY5L 4P2CG 4D0CA 1A6UL 4JHBA 1JF6A 1V7MH 4EUPB 2A9MH 3KLHC 2HN7B 1P2CB 4YK4C 1RU9H 4KDWA 4CW1A 1X5IA 4FTVD 2H2PD 2G5RA 4PGJA 3HE6A 2UZXB 1HHJA 5GRJH 4M7JL 2R0LH 1N64L 1T1XB 4WUUD 1G7JB 3CPLA 5INCA 3ARZA 3QPXL 2IADB 2W0LA 4J3OC 4R8WL 1M4KA 5CJXA 1MFDH 4L8SC 1TVDA 4KDVA 5HHXL 2DJUA 4Z7OE 1XGRA 3L3IB 2ZOKB 1FN4B 3VFVB 4Y16D 5I15L 2A6IB 4RGOL 4WWKA 4JY4B 1KB9K 2HKHL 5DQJB 2DI7A 4YR6B 1KF9B 3ZHKA 2IAMD 3JV6B 4CGTA 5GGVY 1GIGH 2DJ4A 3A67L 2CK0H 4PJBB 3KPRA 1DZBA 2YWZA 2PYFB 4GRLC 4ISVB 2DDQH 4NOBA 3SDDC 4JN2A 3W11D 2G9HB 3DBXB 4M1CD 4L5FL 1R3IH 5IIEB 1OGTB 3OTTA 4LLYB 2NX5B 1CBVL 3O8XC 3X11A 1HSBB 3QDAA 1KULA 2GJ6D 3I6KA 2AK4E 1EAPA 1NC2B 4YGAB 1CICC 2B5IC 3GSOA 4TSBL 4JFZH 4OQ1A 1IM3A 3DROA 5BV7H 3IRZA 1RJZB 3MUY1 3VWJC 1KTDB 1N8ZA 4ZQKB 1AGFB 5DDHA 3HTLX 2F5BL 1YMME 5EO1A 3SDYL 2UUDH 4HKZB 4LLQB 4R6UA 5E7FA 1KB9J 1J1OL 4XVSH 3LPWA 2JELL 2OR9H 1RFDH 2VXVL 2E9IA 3BW9B 4Y4KC 2XN9A 2E7HA 2X4SB 2YD3A 4X8JB 4XP5L 3O3EA 5DJDB 1P84J 5BJTA 4F7EA 3ZE0F 5IFAL 4CVZB 4Y7MA 2J8UA 4TTDD 5E2UH 1BJ8A 1QSEB 1JGUL 1F2XK 1G9MC 1T5XA 3OJMB 3QFJA 3MR9A 1JPGA 4OLVH 4UIMB 4NQSA 4M5ZH 4CVUA 5D7IF 3MV8B 1BZ7A 5GRZA 4UOJA 1A7OH 4P46A 3CX2A 2HLAB 3IDYB 5KVDH 3SY0A 4QGYA 2JK5B 2Z8VC 5BXFB 2P24A 3QZWB 4XXDA 1H3UA 1X7QA 2PR4L 2V7HB 2GW5A 5A3IC 4KTDL 2E9BA 4OM1L 4LCYB 4Y2DD 4EUPA 4FQXC 2GIYA 2HN7A 1IT9L 2A74B 1P2CA 4NJAL 1MWAH 5TDPB 2NY5C 3B9DA 4QT5B 4W68A 5FYJL 1XIWC 4HAFA 3KJ4C 1T1XA 3U1SL 1G7JA 3B9KD 1T83A 3GGWB 4I3SH 3VCLA 1N4XH 3T04D 3IJHB 2AK4D 2R0KL 2DQGL 1S7XB 4DQOH 5I8KL 2ZOKA 1FN4A 3VFVA 5A2KH 1AXIB 2RHEA 3CSYB 3MSPA 1ZS8A 4OF7A 4YGVB 5F1KC 3IJSB 4JY4A 5DQJA 3RVTD 4Z0XA 4YR6A 5T5NF 3JV6A 1YMMD 2O5YH 3B8SA 3NFPA 3QUYC 4BKLB 1IM9B 4YHNB 2H1PL 4PJBA 1TVBA 4RDQG 4X5WB 3GSWB 1LDPH 1Q9LB 4ISVA 1CDYA 3CC5B 1FLTX 1PX4A 4PY8J 1AQKH 2EEDA 4Z7WF 1HCFX 2G9HA 4OLZH 3W39B 3DBXA 3TVMC 5D4QA 3UZQA 2CJUH 5IIEA 1OGTA 2DQHL 4WJ5B 5L2KE 3FMGH 2YXFA 4LLYA 2NX5A 3E3QC 1EHXA 1HSBA 1FYTB 4ZAKC 1BBDH 3KHOA 2JCCB 4U1GB 1NC2A 5TQ2L 1JWUB 5IROC 4JAMB 1RJZA 1KTDA 2D4FA 1JPSL 4DGIH 1EBPA 2PETA 3K0WA 4WFEE 3O41A 4ZQKA 1AGFA 1MLCB 2Q8AH 4XP6H 1ORQA 1Y6MR 3H3BC 4Z0BL 4GKZB 2V2WB 4HKZA 4LLQA 3VA6A 3L7FB 4ZTPH 1UXWB 2BXYA 5DD0H 5I18L 2GCYB 5IVXF 1Q1JL 1BQUA 1P6AB 3BW9A 3FONB 5J13B 2X4SA 2XTJE 2JIXD 3S8WA 3U6RB 4OQTL 5DJDA 1OCWL 3GBNH 5HGDB 5IBLD 2LABA 4WO4B 1QSEA 4AJ0A 3O6FA 4DUWA 5JXAL 1EMTH 3RWIA 1S9VA 2V5TA 5GRYA 4XP1H 5EU7C 1A9EB 3MV8A 3SGEH 4J1UB 5IHLB 1BBJA 1C5CH 1GVIA 2HLAA 1VGEL 2PW2B 4ZOCA 2QQKL 3GHBL 3OAYK 4XPTL 4PUBH 2JK5A 5BXFA 2LU4A 3QZWA 4ZFFB 1EHLH 2V7HA 3CFJB 1BZ9B 3MNWB 3V6OE 3OG6B 4LCYA 4WW2F 4M4RA 5KZCD 4LP5A 1MCPL 5D2LB 2A74A 4FA8A 5I1LB 2DQCL 5TDPA 4LHUG 2NZIA 5IB3B 4U1JB 2QR0B 1YEHL 4QT5A 1JNHB 2IMMA 4QKXB 3H9YA 1TJHH 3DYMA 5JOEA 5L2KD 3FO9B 3GGWA 1UB5B 1I3RB 1UWGL 4F9PA 3MRQB 2WUCL 4JPWH 3IJHA 5JPMB 1B88A 1S7XA 4NZUH 5CILL 1UQSB 3SQOH 2BRRH 3DURB 3CSYA 1U8QB 4YGVA 3KHQA 2NY6B 3WSQL 4CDHA 1PG7W 3IJSA 5DQ9B 1BQLL 4WFED 1VEOA 3WFCH 2Z31B 5C9KA 4K55A 3O3BB 4MA7L 3VGGA 1NUDA 2JB5L 4BKLA 1IM9A 2CXGA 4YHNA 1D9KD 2HT2D 1FGVL 4X5WA 3NCCB 3GSWA 3QJFB 1Q9LA 3HG1E 2H9GB 3CC5A 4KAQH 3QBTB 4TUKH 5E4EB 5C71A 4XCEB 2XTJD 4PJ8B 5DTFB 1KYOK 4WJ5A 1GYAA 4OLEA 4M7KH 4LVOB 1RHHB 5ANME