1JPFA

Crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
275
structure length
275
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jpfA01
4NM8L 4N5UA 3LV3B 4WI2A 1ITBB 3TBVA 4L5FH 3FN0H 1B0GA 4WUUA 2AK4A 4PTTB 1NBYA 3I02B 1DJSA 4M02A 4CN6A 2MCPL 3EO9L 4RGOH 4A6YL 4LLDB 1K5NB 2FJFA 4RRPG 3O3AA 4OLVL 4K7PX 4YK4B 5MHSE 4S1RL 5BQ7B 4JAMB 4X4ZA 2R2HB 5I1CH 5C08A 4Z77B 2WP3O 3M07A 5IB4A 5J9PA 2A6KA 1K8IA 3KHQA 4WW2A 2Z31A 1CLYL 2GTWA 4M93B 2CXKA 4JGMA 4LGSB 5F9JB 5IMKB 2PTVA 2P49B 1QBBA 2E27L 4XP1L 3WDIA 2VQTA 1FNHA 1XGQB 1VHPA 2Z35B 4MD4B 1HOCB 4NQXB 4F7CA 1CDBA 4PJBF 4EKXA 4HWBA 4Z7UB 4BKLA 4UQ3A 3AS1A 3KWWB 1CU4L 1K6QL 3AS0A 1I8LA 3ILQD 4NZJA 3WIFA 4BUGA 1QBLL 5HDOA 2ADGA 4PRHD 3W39B 3GKZA 1VKXB 2NY5C 4P5MA 4PJHA 5ISZB 4YHNA 4XZUB 2QHRH 3GRWA 3VGDA 2YS4A 1F42A 3D3VD 4JRYA 3PWLA 4TUOB 3NOIA 1S9YB 5E1HB 3QDGB 4KHXH 1NLBL 5DJ0B 5FYKE 2HKHL 4IDLA 1CXHA 3IXTB 5T5NF 4CRPA 4NZUL 1A4JB 1YPZB 5DR5L 3M8OL 4MXQD 5E4IA 5IKCB 4M7JL 1CDHA 5BZWA 2O93L 5C0BA 5HI3C 2D03L 1CYGA 5CMAA 3S88H 1JZ6A 4L3EB 2ZUXA 1EO5A 3HE6B 3BMWA 4BH7B 3H7LA 2I07B 4X5WA 5DHVB 4F37F 1UEYA 3BHBA 3WV0A 3EDKA 3ARBD 3PGCB 2GCYB 4X7SL 4KK5C 1QKZL 3NCJL 4XX1E 4KZEH 5E9DE 2P8PA 4ETQB 1MRCL 3SGJC 1X7QA 2EKSA 3H7BB 4PD4J 5IMOA 3MLUL 2HH0H 3SPVA 3CDYA 5LAXA 2AV1B 5ITBL 4FG6C 3QZWA 1LMKA 1Q1JH 3VXRE 2QQNL 2NZIA 3MRMB 1F90L 4HQQL 5D6DC 5CJ8A 5DSCB 1CFVL 1FNAA 1KB5H 5EIVA 1J05A 5DK0A 4LP4A 1U8JB 2O26U 4JFDD 1U42A 3U0TA 4ODTH 1EFQA 2X42A 2APTA 3T1FA 2CLZA 4E42B 1G0DA 5HHVL 1NUFA 3KLAB 3CDGA 5JHDE 1FYTB 1B2WL 1FIGH 2MSPA 2L7UA 2Y7QB 2F53B 1XF2B 1U92A 5L2JA 4HCRH 4JQXC 1CGWA 1NGXB 4LPTA 1PG7H 4GXUM 5HHMD 5JHLH 5ERWB 4HWUA 3EHBD 2YA0A 3OKKA 1KXVC 5GS0C 1L6ZA 3MJ9L 3D0LA 4D8PB 3GMPB 1DQLH 3QI9B 5K9OB 3MODH 5L7XH 1YEIH 2VLMD 3FMGH 4RMUA 5EPMB 3S5LA 3PDGA 5LQBH 1RZJL 2XV6B 2DYPA 3LS4H 3EFDH 3FQNA 1XGTA 5E8NA 5F9WB 3C60B 4UTBL 3GSOB 5C0AB 4N0RA 1BD2D 2H3NB 4GG6B 3O8XD 5JPMB 1AXTL 3QXWA 2ESVD 1CD8A 4HGWB 1YJDC 5B22A 3OB8A 1F4WL 3BN3B 4Z7QF 4F9PC 3GBML 3GMLA 3DNKA 1HEZA 5LG1A 3BQUD 5D6DA 1MCPL 2A77H 1QSFD 4GAGH 4LEXH 1VPOH 3B9VA 1SVZA 2GJ6E 4LSUH 1WFNA 1FFOB 3RAJH 4H88H 1Y0LB 4JKPL 1L9NA 5ACZA 3VDAA 4OT1L 5A16A 4K07A 3L3GB 2AKRB 4NKQB 2GSGA 4W6WB 5IR1A 3CFKB 1AD0B 5T3ZH 1F4AA 5IBTL 1FVEA 1E4XH 3QA3A 4NZDA 4JQXA 2JIXA 4JO4H 1KT2A 5FYLD 1G6VK 2YRPA 2PXYD 3P4OA 4MCYA 4M1DH 3RVTC 3O9WC 5CD5C 4X9IA 1C12B 3C5ZB 1XZ0A 4ENED 3VXMB 1J0ZA 5TPWL 4P2QD 3TLRA 4ONFH 5K59F 4KDTA 3GMNB 2ZPKL 3BE1H 5HYFA 3WMSA 1JNNL 4S1DD 4XNMA 3H8NA 3GBNH 4NKOA 4YEEA 4PREA 4GKSA 5F9OL 3JTSB 1DUYB 1G7PB 4G9FE 2WIIA 4ODSH 5HHNB 2XPGA 4OUOA 2VDRL 3EYFA 4OZFA 5I8EB 4WGVB 2FNBA 4KMTL 1HHKA 3F6IA 1UKSA 3E2HB 4H1LG 3IXAA 1EVTC 2D4FA 1UACL 2A6DA 5FA4B 3W0WD 5IEHA 3QWQB 3LKQA 4O2FB 4FQ2H 4CVUA 5LWYL 4FFYH 3EGSA 3FB6B 2PO6A 3QO1A 1IQWH 4HLZH 4OFYD 4BJLA 4I5BB 1ORSA 3S36X 3TF7C 5CJQH 1PDKA 1S7QB 1JGVH 4HIXL 1RZGB 3PWVB 1EJOL 4JKMA 3B5GA 1XIWB 2YC1B 4OZGF 2CLRB 4LLUA 2X4TA 4LLMB 1MWAA 1KTDB 2NZ9D 4E41D 4MXWH 3O9WA 5BW7C 2MTPA 4GRWH 2DKMA 1J1PH 3PABA 4I48B 3MRLB 5CD3B 4HS3A 4TSAH 1LDPL 2CRZA 3EJJX 1P2CB 4XCYB 2JK5A 1U8OA 3VRJA 3WFHB 1HK6A 1Q72H 4NJAL 5CGYC 3TT1H 2VDNL 5E6IB 3C8KA 4DVBA 1DVFC 4LHUD 4KKNA 1KYOJ 2O61A 2CK0L 4N8CL 2HVJB 3OXRA 4R2GB 3AREC 3FT2A 4Y4HD 4GT7A 1A47A 2FRGP 2XTJE 4I3SL 5IVZA 3GHBH 6CGTA 2WUBH 1LWRA 3AS3A 4ZFOA 1D6VH 4JPVL 4XVJL 4PBXA 3BD5A 4RGNC 2J6EL 3WHXA 1K3IA 3DLQR 4LCWE 4YJZL 5SV4A 4P49A 3IVKB 2DM4A 4HJGA 4LL9A 1UH3A 4RDQG 4JHAL 3NH7H 3UTSA 3CLEH 2NQCA 4JB9H 3DVGB 1U3HC 1MJ7L 2EE6A 4MJ5A 2BSTB 1BWMA 4TVPH 4N0UB 4QCIA 5T1KB 3SJVE 4ELME 4OTXH 1C5BH 2LU7A 1JWUB 4JO3H 5EOQL 2A6IA 4QHNB 3D3VE 4R7DA 3VRLE 5CZKA 5IFAL 4NOBA 2Y6SC 1WT5A 4N5EC 5EOCL 3P4MA 3R0MA 3B9KC 3JV4B 4FQCL 3MRIB 5C6PB 4XVSH 1BLNB 5HGDB 1VFUA 2V6HA 4XNXL 3EYQD 5BW7A 1UGNA 1RULL 2D9QB 1T03L 1S7WA 2AEQH 3CVIL 4HSQA 5F1NA 3IJYA 3THML 4ZTPL 1DQJB 4IIQA 3TCLB 1A7PH 1I1AB 4NHUE 2BVQB 3MXWH 4HPYH 5IJVA 2ZUWA 1JV5B 2L0DA 4GO6B 2RFXA 1OQXA 4FZEH 4YQXL 3TNMA 1DVFA 5I9QB 3HI1B 3UTTB 5HGAA 3ZDZE 1K8DB 1I7ZB 4EIZC 1NJ9B 2R0ZH 4A6YH 4CBPA 3HE7C 4P5KA 4K9EC 4DOHB 4S1RH 3GSVB 1RZKL 5IGXL 4WHYH 1F00I 4Y5YB 1S7TA 2ATKA 4JDZA 2QL1A 3RY4A 2AV7B 3T77A 3K4ZA 1G9NC 2DIBA 3MRCA 2D9CA 5DQDH 4ZYKA 4PJEE 2DQGL 2OL3L 3FO9B 5CHNB 1DTUA 1R5WA 2E27H 5JO5B 1ND0B 2AJXL 4XP1H 1RU9L 5IROA 1C08A 2APVA 1FVDB 2CLVA 1YMHA 4JN2B 3DBXA 4QY8B 4X9HA 1ZHLB 1BQHA 1U3HA 1WGOA 4LHJB 1FO0L 1XR9A 4AM0B 5CEYB 5FDWA 1UZ8B 5ALBL 3P30L 3QB7C 1IAKB 4KJQD 4Y4FB 5EWIL 3VFSB 1QBLH 3ARZA 1X4XA 4BH8A 1T4KA 3LEVL 4AK1A 4ZTOL 4PJHE 1R3IL 2FLBT 3TZVC 1T66C 3QBTB 1QR1B 4N5EA 4AENB 4GAYB 1CK0H 1XH3A 3B9KA 4HIIB 1MHHA 5E99H 4P5TA 2ITDB 1NDMB 4HWEL 4UBDC 4NM4L 3VCLA 5HHME 1J0IA 5EU6B 4M43L 4M1CD 3JV6A 4NZUH 5IIEA 1NL0L 3GSNA 4F58L 1NCUA 2DAVA 5GRZA 2BC4A 4KJWD 4FFWC 4PJ5B 4Y16A 4U1SA 2D03H 1MY7A 2J12B 3QDJA 3DGGB 4UT6H 4ZAKB 2OQJA 4YDVB 3MRRB 5CCKH 4GMTH 4PD4K 2NXZD 4AT6B 1A7RH 3ZT6A 4EI6B 3UYRH 4XVTH 1BD2E 2PW2A 4XPGL 1LD9A 4X7SH 2R69H 3NCJH 1QLRA 4U1JA 5D1QA 2YD9A 3LEYL 4XP4L 4JM4L 1MRCH 1RQ5A 3I3EA 2IWGA 5JDSB 2Q7YA 4PJ7B 3V5KB 4EIGB 4GRWB 3AC0A 1EMTH 4MVBC 4BA8A 5HVWA 3DX6B 4YHPB 3WJJC 4NQDD 2E7LE 1N59A 3DARA 2IBZX 4U6XB 3ARFD 2QQNH 4IOIA 1JHLL 4HUWA 4PLKC 3C5JB 4HH8A 1ZEAL 1U8LA 2BVEA 2H32H 4LVHC 3IDYC 1N2RB 5I1HL 3PQYA 4ZO7A 2HT4D 4YDJB 2ZZUT 4OGZA 5DFVD 3P4NB 2Z9TA 5F70A 1ZS8B 5DJYA 5DXWA 1S9WB 2E9BA 3SQOL 3IF1B 3CFEA 4NO0D 1UM6L 5HHVH 3KPRB 3G5YB 4JFFA 2VTFA 5INCA 2GJJA 5EG6C 4GQPH 5IHUL 3DYOA 1HXMA 5FYLE 5KANI 1IC1A 5DJCA 1JNHA 3PNWA 1G9ML 1U41A 3ARRA 3ZT7A 4I0PA 1KACB 4ERSH 4GUPB 1LNUB 2CJUL 1ED3A 2E5EA 5LXGH 1ZLWK 4PBWD 3DJ9A 2DB8A 1DLFH 2AJSL 3SKOB 4IS6B 3GIVA 4I2XA 4D0BA 1FL5A 4NSKB 1BJ8A 4XBEL 4F7PB 1U8PA 1MI5D 2BRQA 1RZJH 4NT6A 3KPMB 1P7QD 1ETZA 2CD0A 4ZUWA 2BNRE 2MQ0A 1INQA 3R0NA 2VXVH 4Z95H 4NWUL 1YEFH 3VWJA 1DBJH 4JRWA 3VFRB 4MX7A 5F7DB 1FE8L 2H26B 4HS6A 3LV3A 3X13B 1F4WH 1MCIA 4DKFH 2CIKA 4K8RC 3BRFA 4EI5C 3L3JA 1ADQL 4E0RB 4MCZB 1QEWA 1RK1B 4MS8C 1LK2A 2BJMH 4LLDA 2VQ1B 1A6VL 4P2RE 4BZ2L 4MD5B 4LGRB 4U49A 4Z7VA 3LRGA 4O5LH 4A6YB 5GISH 5DMKB 5JOFA 3C8DA 3TIEB 4UZGA 4QRPD 2N7BA 1RJLA 2NY6C 3ZKND 1U8IB 5I8KH 1S7UB 2IALA 4U6YA 4OT1H 4NN7C 4YH6A 4ZFZB 2X2YA 3FQUB 4TRPH 1Z9OA 1AGBB 3OKDA 3MRFA 5IBTH 4QRRD 1D5IH 4ODWB 4E41E 5BRZB 2H9GA 4PJ9C 2QTEA 1H9VA 2IAND 3L5HA 3MA9H 4OIIH 5KS9A 1NKOA 3K2UH 4BQCA 1IGJA 1WITA 1E28B 1SY6A 1T1XB 1FP5A 3DI2B 5TPWH 3LD8B 5D2NB 1AD9B 5HI4C 4FXLA 1WZMA 4KQ3H 1HZHH 3OF6D 3GMOA 1I8KB 4MSWA 3HMWL 3A6CL 1JNNH 2PETA 2PCPB 4Y19E 5EZIL 2Z93B 1JGUL 2X4NB 3HMXH 3NZ8A 3RWJA 3S6CA 4H8WH 1YEKH 3I6LE 4U05A 4L9LA 4DEPB 5DD3L 2DQEL 4I3RL 5DI8B 2DMKA 3RWEB 2A73B 4I8DA 2VLRD 1X4ZA 2PYED 2X4QA 2NNAB 4JZOA 1Q9KA 2Z92A 1RIUL 5IW1B 5J7CC 2NTFB 4F7EA 5FO8A 3L7FA 1L7TL 4LSVH 4EI5A 4XHJD 1LP9A 1UACH 2HT2C 1ZT1A 4G6ML 1FV1A 3TH4T 5FV1L 3FZUC 2AK1H 4WU5A 2VQUA 3QHZH 4N0YL 4NO3A 1F6FB 4XXCC 1MAKA 2A74B 5D7IA 3ESVF 3DO7A 3RWDA 1M6OB 1B88A 3UCRA 5EOTA 3NN8A 1TIUA 1UQSB 4MGXA 1EBPA 3H7BA 1EUTA 1FNLA 4KVCL 1KJ2L 3IDJB 5FYJL 3SDCB 1IT9L 4HV8A 4HIHB 3HFML 3KLSA 4LVEA 1BOYA 2FIKB 1JL8A 1ZA3A 4PJ9A 4PJGF 1A6UL 5KG9B 3Q3GB 4YFLF 35C8H 4C56E 4K94C 2B4CL 4QXGL 3IYLW 1MFBL 4ZQKA 1KYOK 5D7LA 1YZZA 3G5XB 1JZ5A 3S34H 2W91A 3DVFA 3HZVA 2EXYD 1JJUA 2M8XA 2GI7A 3GSUA 3NMEA 1YUHA 5KTEL 2H32B 4H0IA 3SDAA 1URLA 1AO7B 5E5MA 1VADA 5C0IA 5IV2A 1MCFA 5DA0B 3RX8A 1K9TA 1FQ9C 5JW4M 3E6HA 4R4BB 4LKCB 5BS0E 2F53A 3EDDA 1F4YH 1FZJA 1HIMH 3OKOB 5KVEL 5T1LA 2RCSL 3H3PL 1PBYA 5FOBA 3QDGD 3PWNB 4BZ1L 4KI5C 1P7KA 1KF9B 1WZKA 3PHQB 3NFNB 4O2CB 4JPVH 1TETH 3UXFA 1PD6A 5C09A 4EXPX 4XVJH 2EEDA 3GMPA 5I8OL 1QRNE 2J6EH 5JQHC 2VLKE 3LN4B 4QHLB 3ELAT 4G5ZH 3QCTH 4L3ED 5EPMA 1MQKL 4ZUVA 2VXTL 1EAPA 3HE6D 4JHAH 4L29B 4OCNC 2IBGA 2FX7L 2CDFB 5FEBA 5C0CB 3WS3B 1Q9OB 4WI4A 1HSAA 4PLOB 5T1DH 1QLEL 1L0YA 5IVOA 5GGVL 4HKXB 1GGIL 4HEPG 3OJVC 3DVIA 5EOQH 5L8LB 4LCYB 4OCXH 4RAVB 4AH2A 3RHWK 5C2BH 5EOCH 4FOMA 2WQRA 4G59A 3I3BA 1K3ZA 3WFDL 5AZEL 3BKYL 3JWOC 1RULH 1HH6B 1V7MH 3G9AB 1OWWA 1T03H 1FFNA 1WBZB 5BVJA 2VUOA 4OM0H 3THMH 1NC2B 5I6XC 4GJTB 4ONHA 4MQTB 4R90H 3I75A 3TN0D 2OLDA 2P8MA 4WO4C 5FK9A 3O2DA 1FYTD 1D5BA 1NC4D 3F5WB 4LGPB 4JY5L 2XFXB 5CILH 2RBLA 2UVEA 5C0GB 1EPFA 3H42L 1C12A 1RVFL 2JELL 5DK2B 4D9LL 3L3KB 3IKKA 3VD4A 5ALCH 3LKNB 3IDGB 4G8FB 4NN5C 4OZIF 2DQGH 2OL3H 4G8IB 3OV6A 3WFCL 3QIBD 4FRWA 4X7TA 2WBWB 4Y1AE 3TV3H 3L3IA 1N5AB 1RU9H 3QJHB 3QI9D 4HKZB 1KFAH 4JZJB 4R3SA 2BCKB 3QUMH 1CICC 5LGHH 1EEZB 2H8PA 2HJKB 4JFXA 4XPBH 1HN1A 3L9RB 4DW2H 4K3DL 3O0RL 4LLYB 4Q9RL 1FO0H 3UBXG 3SEPA 5AD0B 1D9KB 4E5XB 2ITCB 3BP5A 3P30H 4M6NL 3DUSB 4PJCB 1EEQA 1MH5B 3C60D 2JCCA 4XWGL 5GHWH 4LSTL 3HG1A 4QYOB 1YN7B 2IH1B 3GHEL 1DBML 3LSOB 1R3IH 1LO5A 1IC7H 1BJMA 1U8NA 3L6FB 3PGFH 2FJHA 3BPLB 3V52L 4YR6A 4R7NA 43C9B 4HWEH 4NM4H 1OTTD 1AQDA 5D9SB 4LHQB 4PV8A 5HHOA 1YEGH 4DTGH 1U91B 2HMIC 3V0VA 4DGVL 3MLSH 4XMPL 5F3BB 4WO4A 1RZGA 4W81A 1EHXA 3EAKA 2AW2A 1I7TB 2DRUA 2R2EA 3L3DB 5J1AA 3RL1A 5EC1A 2OI9A 3SY0A 3D0VA 3VWKA 1H3TA 4YGVA 3I2CL 5FO7B 2A83A 4M9OA 1AHWB 2YBRA 2Q76B 2H6PB 3K80A 5B38B 5IVXE 4DQOH 4P9MH 5DTFA 2DIAA 3FCTA 4RNRB 3LEYH 4XP4H 1WBYA 3E8UH 5L0QB 1CFTB 3VXMD 3BZFA 1OAYL 4QRQB 1SBSL 3VFOA 3E6FA 5TFSL 1PW3A 4NGHH 2HRLA 2UYLB 5E03A 2IPKB 1MCWW 3GI8L 4PJFF 2YWZA 2MQ3A 2ICES 1RFDL 2DTML 3HB3C 1BVKB 4JFEE 4MXQC 3MBXL 3HRZB 4MWFB 5DVLA 1KLGB 1ZEAH 5ECJE 4XCNB 3PGDB 1JCKA 1ZLVH 2Z0BA 4R97C 3QFJB 5HYQA 2BSRA 32C2A 2XN9D 5FUZH 4TUKL 1MPAH 2NY4B 2E9JA 1CIUA 5ESVA 1QSEE 2W9LA 3SQOH 4P9HL 4P23B 5INDA 4M7LT 3RJDA 1UM6H 3UAJD 4CADB 3ARBC 1PEWA 4N1EA 1QFWI 2UZYB 3NFSL 4XNQB 4XBPB 1YMMA 5IHUH 3CLFH 4NRZA 4K3JL 1RI8A 3VXSD 2B1HL 3L5IA 5DJAA 2EDEA 3WIIL 1XGPB 4Q0XH 5TDNB 5GJTL 4Q2ZA 2CJUH 2HAZA 1TJGL 1I9IH 1T0MA 4GRLB 2A9NL 3ULVE 4RIRA 3MZGB 5DRZA 1KJ3H 5IHLB 4FQJL 4ALAL 1TZGL 1ZWIB 3TO4B 5C86A 4PRHA 5TE6H 1IAOB 2OSLA 5D2LB 3UJIH 4FQIL 2VLRE 4MNQB 2PYEE 2OTWA 5GS1C 4O2EB 12E8L 1DL7L 3QQ4B 5H2BB 3U7AA 1CGTA 3Q6GL 1BVLB 1DN0B 3GUTA 2DQHH 4WU7A 3V7MA 3HR6A 1QLFA 4MZ3A 4POZC 4X6BA 2W0LA 3CC5B 4G9DA 3RUGB 3VXNA 2CDGA 1ZGLP 5CJOH 3UTTA 3IJHA 4JFYA 5B39G 2FYYA 1KXTB 1DR9A 5GGTA 5I66B 1E4JA 2MMXA 4BZ2H 1MVFA 1IAIL 4PRIB 1IGIH 1KN4L 4RDQF 4Y2DC 4QRSA 4JRXB 3BUTA 1QQDB 1ODAA 4NQEB 2X4RA 3MNZB 3MV8D 4Z7OF 5CBAB 4PJXA 1IQDA 2VLJB 4UMGA 4ORGB 3RIAK 5D93B 5I76A 4KTDH 4WFED 2OL3B 1OSZB 3T3PF 3V7AE 3MNVB 1AJ7L 3RWGB 2DI7A 1TVBB 3OZ9H 1WQVT 2O5ZL 5E2UH 4I1NB 2VDKL 3MROB 4Z7UE 4KTEH 3INUL 4BK5A 3NGBB 3BQUC 3O2WL 1M05A 1FO0B 1JFQL 4XMLH 5HHXL 5T33L 2DLFH 5ISZE 2F58H 4PJIA 5LGJA 2X41A 1XGUB 1G7LB 4FFVC 4JFDA 4RCAA 4MQ7B 4KDVA 4ZFGH 4F2MB 2WINA 3MRNB 3EOAA 2EDOA 2A6JB 2C9AA 4UOJA 1J8HD 3FOLA 2FHCA 5EU6A 1CFSB 3U4EB 1YC7A 3VXOA 5IMMA 3W9EB 4Z9KB 1YPZE 1Q9WA 2VIRA 5BXFA 3MBEB 1T04A 4PLJD 1MRFL 2WIMA 2BX5A 4ZAKA 4ENEC 3FT3B 4M1GH 1IMHC 1YECL 4Q97A 4N0YH 2BXZA 4RGMC 4K55A 4IM8A 4S1DC 2I5YL 2VERN 3QUYD 1ORQA 2OK0H 3DTXB 4G7VH 5T3ZD 4MJID 5MERB 3RVVD 3FOMA 1MAML 2PKDA 1WZ1L 4OLXL 1OW0C 2YD4A 4Z6AT 2C1PA 4KC3B 4KVCH 3V95A 4Q9CA 5FM5O 1IT9H 4YO0B 2FWOB 3GMRA 3LH2L 1MCCA 1YA5A 3DHMA 2VRAA 3O8XA 5ESQA 1ZHKA 2VSCA 4OGAD 1DEEA 4JPWH 3TT3L 1XF3A 2ARJA 4OAWB 2BSSB 2B4CH 4WWKB 1KGCE 1JF6A 3O6LH 1J18A 1MFEL 2P24B 4TSBH 1EJ6A 1QHPA 4X8JA 3BQUA 3MLVH 4QXTA 4HS8L 1U8MA 3HUJA 5D1ZA 1KJVA 3ZE2F 5BZDB 5KTEH 4HAFA 4S2SB 3C8HA 5TF0A 5BOZG 1QSFA 1A3RL 1OP9A 1HHJB 4NQVA 1L9MA 4DKAA 3BP7A 4I77L 5FO9A 1FVCB 4K71B 3HKFA 1FYTE 2Y5TA 3BDBA 2R4RL 3NZHL 5I1JL 1WCBA 2F53E 2IGFL 2VABA 3SDXF 4X6FA 3Q48A 4N0CA 3X11A 2R56L 4XC1L 5HDQH 4X0KB 2CRYA 3BGFC 4FTVB 3MUGA 4L4VD 3UMTA 2RR3A 1FLRL 4BM7A 5ADOH 43CAB 3PJSA 1EK3A 1BVZA 2V7NA 2PXYA 4KDWA 4JHWL 2WBJB 5HYJB 4P2QA 4RX4A 3D9AL 3BGMA 3NVQA 1MQKH 3TJHC 1A5FH 1N3NA 4PJDF 2FX7H 4DZ8B 1CG9B 1CLCA 4RISL 1U9KA 3PWUB 4FQXC 5C0AE 4PJBA 4CJ0A 4G6FB 3MV9B 1IGCH 5GGVH 3U6RA 4GG6E 1FGNH 4BFBD 1BOGB 1GGIH 4HDIB 2X10A 3TBYA 3IFPA 3U36A 3FB8A 4CU7A 1TJHL 3P0YL 1RHHA 4E0RA 2GAZB 5DJXA 5FF6B 3P9LB 4RQQB 4X7EC 4HKBB 3W5MA 5J3HD 5CIPH 5AZEH 1QVOB 3VD7A 3V4VL 5CJXC 3P4LA 4CDGC 4OJFL 3PIQA 4LRIC 4QGYA 3VH8G 5ICYA 2Q86A 5EO9A 4YHLL 4JGJA 1I1YA 2V2WA 3QUXC 4OFYA 4G6AC 5E8PB 4L8CA 3KYOB 3G08B 3TP4A 1TTGA 2ADJA 3DMMA 4OUUA 1RIHL 1CGUA 1HHHA 3MA7A 2BOCB 1T0NB 1P4IL 4LASL 5FYKU 2R0LL 3H42H 1A6AA 2JELH 3UJJL 4D9LH 1T22A 3FTGB 5F96L 3EBAA 3EYVA 3QHFL 2WANA 4OZHF 1QACA 3QJFB 3EYQC 3JUYA 3BAEL 3GEWB 5HVHC 3R8QA 3U82B 2Z93A 4TVPD 1QBML 5B3JE 3L3OA 1FC1A 4MB4A 2DBJA 2X4UA 2K9UA 2CKBA 1I8IB 2FO4A 4K3DH 3O0RH 2BVPA 4K7FB 4EN3B 4X6DF 3FONB 4KRLB 4G43B 4M6NH 1IKNA 4JN1L 4WFFD 3MACL 1WZLA 5TDPB 3VDBA 3LPWA 4LSTH 4MLSA 3QPXL 1AIFB 3HG1E 4Y4HA 4HC1A 1CVRA 1ZAGA 1UC6A 3DXAB 1WFUA 3IU4L 4P59H 4FP8L 4P2YA 2P4AB 1RUMH 5IW3A 1UB5B 1OWRM 4URTB 3IB4A 5DC4B 1HSBB 2FIRT 3FQWB 3L1OH 5CAYB 2DLIA 4LRIA 5KVFH 3QDHA 1G7QA 3MREB 2VAJA 4C58B 4D3CH 1N6QL 3T0DA 1A4KA 3OAZK 4BFEA 1CBVH 4NNYA 4P4KB 1NEZG 3QEUB 4GG8B 4XH2A 4X83A 4KJQC 4KUZL 1INEL 4RA3A 1W0VA 3MV7D 2RGSA 3MCG1 4NBXB 4MDIB 2O5YH 4LCUB 1CFQA 4X4ME 2MJWA 3P77A 1DE4B 1FYHB 3G5XA 1F58H 2GK0A 1I3RB 1MCLA 3E1F1 2NMSA 1I4FB 4XP6L 4Y5XB 1TTFA 1SBSH 5TFSH 3VGGA 4M1CC 3WUZA 5L6YH 3QHTC 1M7DA 3D85D 1ZHBB 5L8KB 1NGZB 5C0JA 2FGWH 4OF7A 2DTMH 1T2XA 4PRPB 2DM7A 3MBXH 1LO4L 1ZLSL 4KJWC 5DQJB 2EIZA 4F8QA 4IRSC 1RUAL 3FAXA 2AP2A 3C9NA 2BNQD 1FGVL 2ZUUA 1OB1B 1CF8L 2NXZC 4L4TB 1UA6H 2DMCA 3OJMB 5HHQB 5J11C 1B3JA 4MB5A 4XRCB 2EH7L 3EOTH 4UDUB 3MJ9A 4U6VL 4CW1A 1MOEA 1F3RB 1V3MA 3B9DA 1YMME 3F12A 4G3YL 3QXAB 3SOBH 3W81A 2XA3A 2B1HH 3TGXA 3ULUH 5H8DA 1MCWM 1F6LL 1YYLL 5A2IH 1TENA 4PBVC 4R96A 3WD5H 3I50L 4P3DB 2P5EB 5DUML 3HAEH 1W72L 5ESAA 4S1QL 5GJTH 1RK0B 5HPOA 1DUZB 3ZE1E 3RBGA 4N0UE 1DFBH 3ARFC 5IHBA 1KTLA 1OGAB 2B8OT 5I71C 1CT8B 1F3JB 5HGGS 5I1KH 1H8NA 5IB5A 1A6ZB 1KENL 4ODUA 4LCYA 1MJJB 4ELKB 5F1KC 4P2OB 4XCCL 3OHXB 2HT4C 1WBXB 4FQJH 2BVTA 5DFVC 3HAEG 1LE5B 1J0YA 1NANI 1XF5A 2RQ8A 2YUXA 2AJUL 5HI5D 4U0RB 1R24B 4ZPTB 4EUPA 5E2WL 2N4IA 5DJ2A 5CUSL 1WBZA 3TJEL 4RFEB 3BP6A 4LEOB 5CIPB 2Y5EA 4NHCL 4NYLA 12E8H 1DL7H 3VFWA 4FQQA 2PW1A 4XNUL 4KKLD 2FBJL 4NQTA 3MTRA 5FB8B 3SKNB 5FKAA 5GIRA 3QXTA 1EXUA 3RGVC 4HBCH 1GYAA 3V8OA 5FKPB 1G1YA 2P48B 3UTTE 4YBQD 3S96B 3T65A 3RVWC 5JUEH 3F5WA 3MJ7A 4DOHE 5KVDL 1S5HA 1IAIH 1TCRB 3DURB 4KKAC 4HZLB 3BDYL 5MEPB 5DK2A 1EAJA 5DRXB 5ID1B 3DX8B 1N0XL 4JO2L 3ULSA 4Q58C 4HWBL 1KTKE 5MENB 5E08L 5EUKB 3WNLA 2CK2A 4M6OH 2EC8A 4QO1A 5IG7A 3S37H 1T1YA 3SCMB 3AROA 1B6DA 3ECBA 2AJZB 4OZGA 1FPTH 3ZDXF 5C1MB 3GRWL 2AXGB 2VZ3A 2IFFH 3HNTH 2X7LB 4NQDA 5IFHL 5C0CD 4E5XA 1G7JA 3INUH 5I19H 4C83B 5I73B 3O2WH 3KLDA 4JDVA 5IHZA 1EZVX 3QUZB 2NY1D 4QXUH 1JFQH 4U1NB 1PYWA 3BPOB 1UCBH 3WE6B 2H2PD 4HHAB 3WXVL 3C6LA 2J88L 2VR4A 5HJ3A 5E4EC 1I9JL 1KJMA 2XTLA 1MCBA 4ZXBB 3BW9A 1MCEA 3C87A 1ZGLM 4Q9QH 1YYML 4ZUUB 5IMLB 3G9VA 4JEGB 3TA3B 2NW3A 3I6KA 1AI1H 4NO0A 4XB7A 3W11D 4YHIA 2OTUB 5EU6E 4P0DA 4G6JL 3QQ3A 2G9HA 4NO2B 3RVUD 3QAZB 2JKXA 4G6KH 1NCBH 1AP2B 3RVXD 4IRZL 1NC2D 3QEQB 4PJ5E 3WUWB 2XQYK 4MAYD 3U48A 5K9KB 3RY6A 3OKLB 1CR9H 3G6AA 3MNWB 1AGDA 2L4OA 2BDNL 4A2LA 1YECH 4KJPD 4OQTH 1NMCB 1P1ZA 4V1DB 1I3VA 5DZLA 3HPJA 2J7LA 4XX1G 5D1XB 2I5YH 3ULVC 3P11L 4HIJA 5KSAB 4GSDL 1MAMH 1JRHH 1MI5A 4JFZL 3REVB 3BWUC 3EJZD 4G8GB 4M5ZL 4U1IB 4PJ7E 4GRWE 4R4FH 4ZG1A 4Y2OA 4U2ZA 2JB6A 1BFOA 3IETB 3O4LD 1NAMA 3RPKA 2B0SL 1DCLA 4X5XA 3CIQA 2GIYA 3RNKB 5DQ9B 1JNLH 4M6AA 4L3CA 4F57L 4R4ND 3TBSB 4PJ8A 4YEFA 5MI0B 2F15A 4OCLC 5H35A 15C8L 2YPVL 1QUNA 3MLXH 1A3RH 4XI5D 5EH1A 2Z91B 3KPRE 5IM7A 4I77H 3F7VA 2ZOLA 4YK4C 5GGVY 1F4XL 1TJIL 2D7QA 4QRPA 2VE6B 2R4RH 3EDFA 1YY9C 5IOPA 3VRIA 5T3XE 2R56H 2C3VA 2X1XR 3KAAA 3NA4A 1JPSH 4M93C 1S78D 4U6HB 1YQ2A 1FLRH 4R0LC 4QRRA 1CLOL 2I24N 1NPUA 3L5JA 4ZO8A 4C4KT 3QYCA 4QWWC 1PKQB 3EFFB 4C54A 2MHAB 2EXYC 2W38A 3D9AH 4Z78B 5ACLA 2Y9RT 1CTOA 3OF6A 5A2FA 1MLCA 3MLYL 2C5DC 3DV4A 4HJJL 1QHOA 5ELIA 4MQXD 4TUJB 4NUJB 1TZIB 2YD3A 3B3IA 4AYFA 3QISA 3QDMB 4JFOB 1JYVA 3QFDB 4CL7A 3H2WA 4YDIH 2W60B 1AXSA 5C8JB 1QRKA 5TGBA 5EU7E 4OKVB 5EBLB 3BH8A 4CMMB 1OTSD 2Q7NA 3HZMB 3GSXA 5I1LB 1GPOL 1DBKL 1WWBX 2Q6WB 5DS8B 5F88B 4BSWB 3A6OA 1DBBL 1UYWH 5DD6B 1EVUA 2ICWB 4OJFH 3V5DA 3WJLC 2CUIA 3OKMB 3AAZB 5HYSG 2IQ9H 1RZIA 3HE6C 2Y25A 2V17L 1M7IB 1K4DB 2NY4D 3VJ6B 5CINH 1BZ7B 2EYTB 5EC2A 3MUZ1 4POYA 1NAKH 2EIDA 4QT5A 4JZNA 2VISA 5BRZE 1RIHH 1I85C 4JFQB 3BKCH 1V7NL 3PWPB 3EW3B 3U9UA 5CEXB 1P4IH 3MQIA 2DJ4A 4R0LA 3O4OB 5F96H 4DVRL 4Z7WB 4JKWA 5KSVB 2C1OB 5EO1B 3LZFL 5D2NE 2DQJL 5EOCJ 5I16B 4QF1B 4MA1C 4ZSOB 4GRLD 4M61A 2VXUH 1YJDL 3ZDYF 2O5XL 3LDBC 4F3FB 1QBMH 2IAMB 4NO5A 4WW1A 1BWWA 4NDMB 5EU5B 3BIKB 2WWKO 3TN0C 4FQLH 1HYSD 1JF5A 3N1FC 4XPFL 5FAAA 5F3HA 5C0RH 2XWJB 4I18B 3MACH 4YX2L 1JPGA 3DROA 3JWDC 3AM8A 3DUUA 1FL6A 3S4SA 4IRJB 1CXFA 2FDBP 4XPHH 2GSIA 4M4PA 3IU4H 3ARDD 1PSKL 1V3JA 2CGRL 1A3LL 4UIMB 4XCEB 3IDUA 4MA3B 1EGJA 4QOKB 2AXHA 1CXKA 1KULA 1MLBA 3S35L 3SDXB 4ZDHB 3QIBC 2QR0B 4LDEB 2X1QA 4J8RA 4HGMA 4OCRH 3QI9C 4PRID 3O3EA 1NFDF 3MLTA 4NBZB 4XAKE 5D71H 4OSUL 2P42B 4LIQL 4NQED 4PY8I 3LQAC 1WWWX 5KSBF 5CWSB 2FX9H 1IM3B 1MUJB 3EJYD 4HIEA 2VLJD 5TE7L 2FCBA 5F93C 2ZSWA 3RNQB 5DJDB 5F9WC 4UNUA 1F45A 3C60C 3D39B 3MFFB 4PY7A 3G04A 4PRAA 5A2LH 4JJ5B 3QWOB 4YPGB 2EXWD 2P24A 3ARGD 1YNTB 3REWB 4HFWB 3NABL 4KRPB 4OF6A 4I4WA 5F1SA 5E1AB 2EYRB 3BKJH 4LPXA 4HBQA 4AEFA 5I30L 3O3UN 1D5XB 1OTTC 3FKUS 2VDPL 2Q1EA 3CH8A 1AO7E 4ZFOL 4APQB 3LN5A 4Q6IB 3TBTA 3ARSA 4MNGA 3MJGX 4Z7QE 1LO4H 4KRMB 2NX5B 4KFZC 3CGTA 2BY0A 3TN0A 1IC5L 1JPFB 1PQZB 3WSQL 1RUAH 1H5BA 1BEYL 5FECA 3VXUA 1FGVH 4PUBH 1XCTB 4WI7A 1IE5A 4ZUSB 3W2DH 2UZXB 3VA6A 4ZD3L 1RZ7L 2EH7H 3KYMA 2DQIH 4Z0XA 1RJZA 4X80H 1R3KB 3VFPA 3F7YB 3WFEL 4GAJL 5CKAA 5C0CE 3HS0A 2WK2A 3QIBA 2YEZB 3I50H 3GJFA 4RMTA 1W72H 4S1QH 3GI9L 2YSSA 1SHMA 2FEEI 3B83A 1ES0B 1CZ8L 3KXFD 3O6FB 3STZB 1OSPH 2FJGA 1FAIH 4UAOC 2LFGA 4OZHB 4TTDD 3OAUL 2W0PA 3CK0L 2WAHA 4C55A 5ID0A 5J06A 4UB0H 1JZ7A 2Y07L 4YDKL 5C07B 3P73B 1BZQK 3MRGB 2GT9A 4X6CF 3LRHA 1ADQA 2P5WD 1HNGA 3UAJC 2UWEF 3G6JF 4ZS6D 4V2BA 3TJEH 1T21A 4RRPA 3MLZH 2HN7B 4NHCH 4U1HB 3E2HC 5EZLB 4XNUH 4WJ5B 3HPLB 1ERNA 4KQ4H 5DMYA 1AR1D 1P53A 3MC0A 3WNPA 1LEKA 2Y36L 5D6CB 3QG7H 1PG7X 1UWEL 2F54B 1HQRB 4NZRH 3I6GA 4YIQA 4U7MA 3FO1B 3TYFA 4LSSH 2BSED 2WY3A 5JW4Q 5KVDH 3AU1B 4HPOH 1UZ6F 2VDLL 4I0CC 4UDTB 3TNNB 5LKNA 4O58L 3HI6L 1AFVL 4KK5D 4ZNEE 4OD2B 1FAKT 4FTVD 4HWBH 2VDOL 5MEOA 1IBGL 4UUJA 2R2CA 1AKJD 2VDQL 2ZOKB 1MREL 2E6PA 3FB5A 4OZGE 2OM5A 5HPMB 3KNBA 2HLFC 3WO4B 3OB0H 4X98A 4PJGA 5IVNA 3RPIA 4YHKL 4LARH 2R23A 4OCYL 5E6IC 2VLLB 1PKOA 4PJCE 3CMOH 1LEIB 3CH1A 4U1KB 3WXVH 2FR4B 2XN9A 5TDOA 1I9JH 5DWUL 4BFIA 1UB5A 4HF5H 3U46A 4CMHB 4PGBB 3X12B 4KJYA 1OAUH 3G5ZA 5SWSB 1KCKA 3C2SA 4M5YL 3E0GA 4U7KA 3ESUF 3VXTB 7FABL 2WQ8A 1IEAB 1BF2A 1MEXH 2R0WL 2OYPA 4PJAF 1LK3L 3UBXI 3VMNA 1K4CA 5L2KB 3R06A 3VXSA 4GFTB 1LDSA 4ZOCA 2AI0H 5GS0D 2LTQB 3I9GH 3IJSB 1G9NL 1ACZA 1CIDA 4N8VG 5CSZA 2CR3A 3FHAA 4OIBA 5IEKA 2B2XL 4PP1D 2NXYD 5DZNA 4YFDB 3IDNB 4P46D 1KUMA 3TFKC 1KJ2A 2HG5A 3H9HB 1ZLWH 1DDHA 2VZUA 3H9SD 5KOMC 4XTRD 4M8QB 3KPSD 3UEZA 2I9TA 2DKSA 3P11H 1R3HB 3LKRA 4GSDH 3IFLH 1EV2E 3QULB 4JFZH 3V6OC 1FBIL 4O02L 1X6NA 4M6ML 4QHMB 4IDJH 4PR5B 1OCWL 3T4YA 3SDDB 4OCSL 2CRMA 1KIPB 2B0SH 3D5OF 4ZO6A 2GUOA 2DQTL 3LEXA 4AG4L 1RV6X 1KCUL 4MAUH 3QFJE 5KJRH 4HUXA 4YNYB 5EIIB 2CUMA 4F57H 4PG2C 3FFCD 4NQCD 4FQ1H 5I9QC 1UM4L 1GGBL 1U95A 4K3HA 3V6FB 1WV7T 2YPVH 5DD5L 4K7PH 2I60L 1UXWA 5KAQG 1BJ1H 4S10A 1HXYB 1TJIH 4NIKB 3MV8A 4NC1E 3O3DB 3OGCB 4TN9A 1YDPA 2FB4L 1SJHA 1CDCA 4YXKL 3FQRA 2V2TB 4J4PC 3RTQB 3CZJA 1JHTA 3VFMB 5B21A 4OGAC 5DT1L 5J6GA 4KAQH 4XPTL 5C0FB 1D5MB 5BV7L 1DSFL 1W72B 4OZIA 4IJ3B 2J8UB 1N64L 3T0EB 3V2AR 3N50A 1MSPA 5JDJA 3S5LG 4DGYL 1S5IH 2X1OA 4EDXB 4HWNA 5JR1H 4DN3L 4KPHH 3C08L 1MY5A 1JN6A 3KPTA 4Y4FC 5EULV 3B6SB 1VFBA 3TBVB 3MLYH 5D2LE 3O11A 4PGJA 5B8CC 4MNQE 4HJJH 1MFDH 1B0GB 4U1GC 4WUUB 2AK4B 5GJSH 2YPLD 1FFPA 4WI6A 1NBYB 1NBQA 5C70A 1CE6A 2FJFB 2ED9A 3O3AB 4GH7B 4Z7NF 1X5HA 1JWMA 5F7NC 5J13B 5D7JA 3RUGE 4HUMB 3JTTA 4GBXD 5C08B 4EDWL 1TNNA 5CZXD 4UIKH 5IB4B 5J9PB 2A6KB 1K8IB 4WW2B 2Z31B 3MRHA 2GTWB 1KLUA 1LEGA 2APFA 4KROB 4PRIE 2HYMA 1Z2KA 2C3WA 4JRXE 5DGQA 1JYXA 4IMKC 3GSQA 1MJ8L 4OGYH 5MENA 3QRFM 2VLJE 4OLYH 3QUYA 4F7CB 2IADA 1P4LA 1CFNA 3FRUA 4MJIA 3MSPA 3WO3B 4BKLB 3ULUF 1Q8MA 4UQ3B 4UT9H 3WIFB 1JUFA 3AXLA 3CDCA 1DZBA 2ADGB 1V7NH 3RKDC 4P5MB 4PJHB 5AWNL 4YHNB 4Y7MA 4DVRH 4RBPH 9CGTA 2A1WL 3LZFH 3QNXA 3PWLB 4JRYB 5J3HC 1UJ3A 3MRBA 5SX4H 2DQJH 4OZFH 5JQ6L 5CGYD 2OZ4L 4OQ1A 4ZXBA 4K8RL 4PJFA 2ZCLL 4NRYA 3LS5H 4H1LA 5BZWB 4H25A 4X7DC 5C0BB 5B8CA 3ARED 2XZAL 1SEQH 3ZHKA 5SWZD 5CMAB 4YX2H 4QTIL 5I17B 5JA8B 2OR8A 1XEDA 4X5WB 3H0TA 4LCCC 1GZPA 3BHBB 2OMBA 1CXLA 4JHBA 4L4VA 2E7BA 2JF1A 4QTHA 1PSKH 3K8MA 2CGRH 1A3LH 4KKCD 2BXYA 3Q2CA 2P8PB 5B3NA 4WNQA 1X7QB 1WFOA 2EKSB 3BPNB 1MWAH 5IMOB 1KELH 3KPOA 3BEWA 4JGUA 5LAXB 1A6WL 5GRUL 4HX1A 3VW3L 5F7MC 3QZWB 4WVRA 4IMKA 2GYSA 3NTCL 4OSUH 5FHAL 3I85A 1KSRA 4UU9A 3VFUA 5DYOB 1N4XH 1J05B 3GKWL 5DK0B 3K1DA 4HWZA 1QSZA 5HY9A 4DFHA 4OCMC 3BD4A 3ROLA 3SCMD 4K3EL 3U0TB 5FUOL 3ZTJH 4L9DA 3T1FB 2CLZB 3DPBA 4NKDA 4WCYH 1TQBB 5EZOH 3CDGB 1MF2L 2CQVA 2ARWA 3MPCA 3NABH 5FGCB 5F6HJ 2ICEA 1U92B 5L2JB 5ITFA 4TQEL 3CFJA 2VDPH 3ZTJG 3FFDA 3ERYA 1RHFA 3FQXB 1MVUA 2OP4H 3OKKB 2EICA 3CCHA 5C9JA 3D0LB 3WSQH 3HE7D 4QHKI 2VDML 2IH3A 4YC2B 3LPFA 1YEEL 1J7VR 4AMKH 1N8ZA 1VFMA 2C26A 1WWAX 3MX0A 2FBOJ 3VXUE 5E8EA 3L3HA 1P6AB 1SM3L 1KIQA 3IKCA 1EO8L 5IESL 4LCCA 5DDHA 3ISWA 2DYPB 3EFFA 1RZ7H 2YKLL 3ZLQC 3FQNB 1XGTB 4M9PA 5E8NB 3O6MH 5HYJE 1WAAE 2KH2B 2CMRH 3SE4C 1A0QH 3WFEH 2AABL 4KRNA 5TQ2L 2VITA 4GAJH 3UP1A 1RUPL 3UYPA 2X6MA 4PRBA 5DMIL 4K94L 1ZLVK 4XC3L 3MV9E 1CZ8H 3GMLB 1HEZB 3SKJL 3VGHA 5JPNA 2XACC 1A7NH 3OAUH 4LCIH 4O9HL 4G8GD 5T1MA 1G7IA 3B5HA 4XPAL 1JMXA 3TZVD 1T66D 4TPRL 4PV9A 4UV7L 1BIIA 5J4MA 3ALWA 5FFLA 3FO0H 5ACZB 1HINL 3OQ3B 3KPNA 3O2DL 5A16B 2RIKA 3AS2A 5IR1B 4X7FC 2GSGB 5I15L 3PDOA 3HN3A 5FUCC 3CXDH 3L95A 3QA3B 2BVOA 2JIXB 1KT2B 5DGRA 3P9MA 4LLQB 2R0KL 3P4OB 1LQVA 4MCYB 1XZ0B 3S36H 4IBLT 1MHEA 1LO3H 4MNHA 5DURB 1OP5H 4M3KB 5EA0L 3QUKA 4XNMB 5E5UB 1Q9LA 1AFVH 3SDCC 4NKOB 5KSVA 2MKLC 4PREB 4GKSB 4ZUTA 1KPRA 3VXQA 1YEJL 2R29L 3MV7A 3ULUD 2VDOH 2XPGB 1IBGH 5IJKA 1X9QA 3O2VH 1SMAA 3TIDA 4X4YA 3SE4A 1MREH 3EYFB 5I8CA 2ZCKL 4B7LA 5E7BA 5J57B 4OZFB 5J8OA 3EO1A 3ARPA 1NCCH 5F7HA 3UZEA 4KKLC 4JCMA 1EFXD 4PLKD 4BSVA 1F11A 1NCWL 1A1NA 2D31A 3D85A 4YHKH 4QHUA 5ACMA 1HHKB 3E3QC 4ZO9A 3JWOL 3IXAB 2F19H 4OCYH 5LCVH 2A6DB 1S9VA 4YBQC 3HR5A 3CJJA 5IEHB 3LKQB 3GSNH 2PN5A 3EGSB 4KI5F 4OGXH 2PO6B 3DXAE 2ICWJ 2BNQA 5MHSD 3QO1B 1J1OL 5GRWA 3MYJA 1UT9A 1ORSB 3B9EA 4JPKL 4WGWB 1HE7A 2OR9L 1YNKL 5C0NC 3UC0L 4RMWA 2R0WH 5GSRA 4ZFFA 3ARYA 4LLUB 1VB9A 2X4TB 4H20H 4WDIA 4M7KL 5CP7A 1MWAB 3LHPL 6FABH 5TE4H 4ODHH 2ZUQB 4JDTH 1DQQA 2B2XH 3O9WB 1RMFH 2YXFA 4MYWB 3P0GB 2I25N 1H15A 1E4WL 3SGEI 4HS3B 2X4OA 1RZJC 2WM0A 4K7PY 4PJDA 2JK5B 1U8OB 2H2PC 3VRJB 4JANA 3PXHA 5HBBA 3C8KB 2XG4A 1S7XA 4AEHL 4GXVL 4RFOL 3LY6A 4DVBB 2HJLB 1NUDA 1ZTXL 3PL6A 2O61B 4FXKA 2GY5A 4O02H 5E1AA 5IB1A 3OXRB 1WEJL 3FT2B 4RZCA 4APQA 2D3VA 1PZ5A 3QCVL 5IVZB 2VH5H 1YNLH 2YPKB 4PTUA 1NFKA 4PRPE 3MCKA 4CN1A 2FZ3A 4MS8D 4ZFOB 2R8SH 5F97E 2IAMD 1AGCA 2RJMA 3EYSL 3QNZA 2V5YA 3WHXB 3CSYA 4QRUB 4ODXA 1U6AL 1U2CA 4TNVK 2YHGA 4HJGB 4KJPC 1GGBH 3CX5J 4L4TE 2NY6D 2DM2A 1QFUL 3UTSB 4NRXA 3T8XA 2WWMD 1B0RA 2W0KA 4MJ5B 4IRJD 3N85H 1R3KA 4KUCD 1OAQL 4QCIB 5JXAL 2XQBL 1R0AL 4DWHA 1JGDA 3EJZC 4CVXA 2FB4H 4JQVC 5E9DD 4IEFB 5F7FA 3F8UB 2A6IB 2P5EE 4R7DB 3L5XH 5IW6A 2JJTC 1NLDL 1MCOH 5DT1H 4UV4L 5HHPA 3QCUL 1OGAE 2HFGL 3P4MB 4ZPVA 3IAGC 5BV7H 1UEMA 2KBGA 4JZJC 4OZHA 2DQDH 3MOBL 1N64H 1S7WB 1UFUA 1RUQL 5F1NB 4H8WC 3IJYB 1J5OL 2PR4L 4IIQB 1D9KC 4NOFA 2OJEA 1D6EA 3C08H 3D69A 5E70A 1VACA 1FG2B 3JXAA 5IJVB 1OP3K 5KN5A 3D39D 3HC0A 3WN5A 2Z8RA 1Z5LA 1DVFB 5GGTL 2EDRA 3KLHC 1GIGL 3LQZA 4X6DA 2XI9A 5JHDD 5HGAB 3AB0B 3UDWA 4M7ZB 2RAMA 4P5KB 4P99A 1S7RA 5KSUA 3WBDA 1S78C 1S7TB 2ATKB 4JDZB 3T77B 3RWFA 3MRCB 5DHXB 2Q8BH 5BMFL 4ZYKB 4MAYA 4RGNB 3RDTA 1R5WB 3MRKA 4MA8H 1CTNA 3OG6B 3BKML 3TPKA 2CLVB 1JI2A 4ELMF 1RJYA 1YMHB 1SY6H 3TYGH 5MENE 3DBXB 1BQHB 1U3HB 3VRLF 1H3XA 3RJQB 1XR9B 2IFGA 1AHWC 2H41A 5FDWB 3V7AG 4XP5H 5TF1H 1HDMA 5GGSA 2R1YA 3BOVA 3IDXH 2BY3A 3BESR 3BN9D 4BH8B 1T4KB 4U4BA 5FV2A 2AGJL 4R6UA 2DMBA 3O4LA 4CDHA 2OCFD 3U9PH 3QO0A 1EHNA 4NUGL 1HWGB 1XH3B 3B9KB 2BRRH 1UCTA 3WLWC 1MHHB 2EECA 2JTDA 5EIQA 4P5TB 3VCLB 5JQ6H 4OF5A 3HMXA 3JV6B 4CNIA 5FXCH 5IIEB 3GSNB 2ZCLH 1X5AA 2V7HA 1YN6A 2NLJA 2KUTA 4GW5A 2BC4B 2F8OA 2GJ6D 2NY4C 4Y16B 3QWRD 2QJDA 2E9WA 2XZAH 4U1SB 1IGYA 5E2JA 4YUEH 3QDJB 2NYYD 2OQJB 1SYVA 1HHGA 4D0DB 5JLZA 4QTIH 4UINL 5EO0A 2NY2B 3RP1A 3T4AA 4NC1C 5ETUB 2YK1L 1HH9A 4PJEF 1A7OL 3QEQE 1C7TA 4GW4A 2AEWA 2PW2B 2WUCL 4EOWL 1LD9B 1FZOA 1INDH 4WIQA 1QLRB 4U1JB 5D1QB 3WIHA 3B2VH 1UADC 2EDFA 3O45A 4LOUC 2D7NA 2Q7YB 3MV11 2LQRA 5I18H 4V1DE 4G7YH 2DLGA 1DANT 4GRLC 1AE6L 3U7YH 1L8JA 5DVMA 1N59B 2WLZA 4XGZA 4RSVA 5JXEC 2V9QA 4KY1H 4F15C 4IOIB 1N7ML 4G8GE 2CDEA 4HUWB 3NIFF 3ILPA 4G9FD 1HYSC 1U8LB 4FA8A 4CGTA 3PQYB 4P3CL 1J0JA 1FFRA 2BZDA 4K3EH 1PGRB 2Q8AL 5DJYB 4EJ1C 1FIEA 4PY8J 3CFEB 3U7WH 1G0YR 2K7QA 4JFFB 4PLNC 3VGBA 3S9DB 5INCB 2A9MH 3UO1L 4AEIL 1HXMB 2IBBA 1GOGA 5DJCB 2FATH 1JNHB 2HT3D 3PNWB 3MLWL 1X44A 2P43B 4I0PB 5FYLL 4GKZA 4XNYL 4OV5A 3MXVH 3ZO0A 1ED3B 4XWOD 1HCVA 1AY1L 5F7WC 4WEUD 2JJSC 4D94A 3KPQA 1AQKL 3Q0HA 1EHLL 3TH3T 1MCSA 1T1ZA 3EJYC 1CGSL 3GIVB 4I2XB 3HA0A 5C0DA 4OD1H 3QIWA 4D0BB 3DI3B 1HKLH 4G42A 5GSVA 1U8PB 1EO8H 4NT6B 1QTYT 1ETZB 4J3TA 4ZUWB 1H3PL 1PKQE 4WUKL 1INQB 2EXWC 3VDCA 2VXQL 4UOW0 5HVFB 3ARGC 5SV3A 3VWJB 5BV7B 3K81A 1V3KA 4EDXA 4MX7B 4X9GA 2NY3B 2G75A 4HS6B 1CICD 3NGBC 3B6SA 3T3PE 5F7UA 5E2TL 3BMVA 2CIKB 4O00A 1NCAL 3L3JB 4J7RA 5DUPL 5ADPH 3SKJH 1QEWB 2RHEA 1LK2B 3NA9L 3QDME 5IT2L 1FH5L 1BBDH 1UENA 5ANMA 3MUY1 3U4BH 3IGAA 4LVHB 3IDYB 4XPAH 4Z7VB 5IBUB 3UTZA 5KAQF 4TPRH 5JOFB 2XTJD 1LGVA 1RJLB 1PLGL 2R1WA 1RZFH 2IALB 1J88A 4U6YB 1XF4A 2DLTA 3V5HA 4NKIH 3O2DH 4LAQL 3ARDA 5I15H 2DQFA 3OKDB 3MRFB 2HMID 2ZUTA 4LCWD 2H9GB 3Q1SH 4HLJA 4TOYH 4HUKB 4U6TA 3VI4E 2R0KH 1KPVA 5KS9B 4TVSa 4NPYA 1IGJB 2DICA 3KYNA 1BZ9A 1FJ1A 1R3JA 1VA9A 5I1EL 2JJSA 5FGBA 1UKTA 3GMOB 3SJVD 4MSWB 3OAZH 3PWPE 4TTDC 4OLWL 4J3SA 5EBGA 2ZG2A 2CKBL 2F74A 3HNVL 4Z7WE 4EQ3A 2DD8L 3NZ8B 3QNYA 3RWJB 4DK3A 2ZCHH 3BYTA 3UBXA 4L9LB 1UWGL 1CGXA 1KC5H 4ZSOE 4ZS6C 4RWHA 4WWKC 3CFBA 3L7EA 2ZCKH 4HC1L 5J6HA 2UZIH 5AYUH 3JVGC 3T0ED 3HB3D 2X4QB 3QUMA 5IK3A 4Z8FL 4JZOB 1P84J 1Q9KB 2Z92B 2VL5A 1BGXL 1AR1C 1C16A 1NCWH 2FSEA 2L7JA 5EU4A 3V6ZA 2F5AH 5ICXA 1KB9J 4F7EB 2A38A 5FO8B 1IZKA 3L7FB 4PB9H 4DAGH 4EI5B 1X5IA 1LP9B 4U1MA 3P9WB 3OR7A 1ZT1B 4K71C 1FV1B 4HUVA 1RUKL 4J6RL 4WU5B 5I17A 4NO3B 1F6AA 3B43A 3BD3A 1B4JH 4CVZB 1J1OH 5D7IB 3SE8H 1KCVL 3DO7B 3RWDB 5EOTB 3NN8B 4QOKE 4YXLL 4JPKH 4N8PA 1FCGA 5CEZH 4ODBD 2AQ1A 2GTZA 5DK3A 3SDXE 2OR9H 1E6OL 3UC0H 1FRGL 4HV8B 2WBJC 2ADFL 1ZA3B 4PJ9B 4CU6A 1JIBA 5EDXA 5DYOA 4LQFL 3O3BB 5D5MA 2R1XA 2XZQH 1YQVH 3BPCA 4ZQKB 1JYWA 1IM9D 5D7LB 3GNMH 3KXFA 3HZVB 4HXAL 3TPUA 3ARXA 3UPCA 3GSUB 3D39E 1F5WA 1YUHB 3QG6A 3ME0A 4RAUA 3SDAB 1UM5L 3BO8A 3UYOD 1M71A 5E5MB 1VADB 5C0IB 5IV2B 1GHFL 2ORBL 4RFOH 4UTAL 2XKNA 3OGOE 3E6HB 3WLBA 1WTGT 1OVZA 2W9EL 2P5WA 1FZJB 2H45A 2GY7B 5T1LB 4DUXA 4POZD 5FOBB 4PS4L 4MHHG 3FQXA 3JVGA 3CX5K 1FORL 7CGTA 1P7KB 4Y5VC 5I1DA 2COQA 1X5ZA 2NX5E 4OFVA 3I3DA 5C09B 3MUHL 1MCJA 3S35X 4PP1C 2DF3A 2NXYC 4Y2DD 1U6AH 4P46C 4JR9L 3TVMD 1NCDL 2YD1A 3WKML 3RQ3A 4ZUVB 4YHZH 1EAPB 4XTRC 4FZ8L 1GOFA 4GAFB 3ALXA 1HI6A 1HSAB 2NW2A 3MCLL 1E6JL 1V3LA 1UJTA 1R0AH 1VFAA 1X5LA 3SGJA 1CL7L 1UWXK 3IFOA 5KZCD 1QPPA 5HYIA 3IDMA 3UJTL 1AKJA 2ZKHH 3T2PA 1JPTL 4MD0A 2DKUA 4AH2B 3OL2A 4UV4H 5GS2D 1Z3GH 3QCUH 3MMEA 3F7PC 3JSSA 5A2JH 4M62L 1G0XA 4OZHE 3PXJA 1U3JA 4Y89A 3LKPA 1FFNB 1LO0L 3S97C 5BVJB 4JO1L 4FFVD 2ENYA 4PP2A 1J5OH 2PR4H 4KXZI 4EN3C 2QEJA 3DVNA 4E9LA 5C07E 4ONHB 3RHWF 1DQTA 3I75B 4WEMB 1QNZH 4N90E 2P8MB 4YXHH 4FNLL 5FK9B 5GGTH 4KMQA 5B39A 1GIGH 1OPGH 1BJ1J 4UI2A 4WI9A 1NGPL 2YN3A 2YD6A 1D5BB 5E94A 4M4RA 4LLQA 1O7VA 1QYGH 1OAXH 3RBSA 2IBZY 5F1IA 3ETBF 4Y5VA 2G5BB 4NQSA 5L8JB 2IG2H 2F54E 4WEBL 3LOWA 2V2XA 5BMFH 4RWYH 1CE1L 1NQBA 2F8VA 1LE9A 1M7XA 4P46A 4X7TB 4NFDA 3L3IB 2D0HA 4LMQI 3EZ8A 3OJ2C 4P4KC 3H9SA 1NFDA 5KVMC 4R3SB 3MOAL 1JMZA 3KPSA 4XP9H 4Y4KD 2H8PB 3V4PH 4JFXB 3BSZH 2XQYG 5KSBA 1J12A 3BFOA 3BP5B 1WSST 2BNRD 1T6WA 5TH2A 2NY0B 4L8BA 2JCCB 2B4CC 3HG1B 1F2XK 4Z0BL 4FFZH 4Y5XC 1V05A 4F9PA 3K46A 1LO5B 1A8JH 1S3KL 4GBXC 1U8NB 2Y4SA 5CZXC 3QRGL 1JE6A 2FJHB 4YR6B 4JPIA 4KHTH 4R7NB 5H37H 4DGIL 2V5TA 1AQDB 2HFFA 3FFCA 4P2RD 1IKFH 4NQCA 4PV8B 5HHOB 3V0VB 4C57C 5SWSE 5DJ8A 4WO4B 1H0DA 1FDLL 1OAKL 5H37G 2GK2A 4JM2F 3VE0A 2R2EB 3CU7A 5J1AB 5L2KE 3RL1B 4UINH 2OI9B 2WW8A 5EC1B 4HLZG 3D0VB 3SY0B 3VWKB 2YK1H 1A2YA 2VWEE 8FABA 4YGVB 1GL4B 4EBQL 2A83B 2YBRB 3T2NH 4YE4L 5I0DA 1R3LA 4YWGH 5DTFB 3GSWA 3FCTB 1WBYB 4NCC2 3TJHD 1NAML 3BZFB 1VSCA 2BNUA 3E6FB 3VFOB 2HJLA 4FQXD 1UXSB 5DEGA 5DLMH 4Y19D 4P2OC 2J8OA 1N7MH 1KN2L 5E2VL 3RZCD 3I6LD 3QR2A 1IGFL 5EUOF 2HLAA 1KG0A 3A67H 3ARVA 1MRDL 2BSRB 32C2B 4U0RC 5HYQB 1FZMA 2XNAA 2YPLA 3PHSA 2YPKA 4LU5H 4S1SL 4OZ4A 5F6IB 5DVNA 5ESVB 4UILH 5INDB 1OF2A 2KDGA 4X6CA 2F9BT 2UWEA 3G6JA 4GBXA 4QRUA 5C7XL 5T3XH 3TO2A 1ZANL 1NMBL 1BQUA 1YMMB 4KKCC 2AVGA 4NRZB 5DD0H 2VC2L 3MR9A 4LVOC 5DJAB 1VFOA 2B1AL 3T08A 1NFIA 3QUXD 3MLWH 4L8DA 1OY3B 4YHOH 4G6AD 5GZNC 1YY8A 4Q2ZB 3TF7A 2PO6D 1T5XA 1OARL 1T0MB 1VDGA 4RIRB 4Y8AA 1E4KC 1ONQA 4WY7H 3U1SL 1CGSH 4LF3A 4KKBC 5IVXF 1NGQL 5C6WH 3PDDA 5DRZB 3QEGL 2D0FA 2QQKH 1GAFH 1I7UA 1TXKA 1FNSH 2W1NA 2IPTL 3SCMC 5IB2B 4PRHB 1U8QA 3EYUL 2OSLB 2IEPA 3ES6A 4C56D 4WUKH 2J8UE 3IRZA 2VXQH 3T0EE 2CH8A 2DDQL 3MFGB 2OTWB 4CVWA 3VG0L 2UY6A 2ATPA 3KR3L 4ZOEA 4NM8H 2P46B 3GUTB 5I73C 1FG2A 3PV7A 4WU7B 5CBEA 1GC1L 1QLFB 2YUVA 3QUZC 4X6BB 3V4UL 4G9DB 3KJ4B 4WWID 3VXNB 2CDGB 3VD9A 2V9TA 4WUUE 2AK4E 5F21B 4S0TD 5GS3A 2MCPH 3NA9H 3EO9H 4F33A 3IJHB 4JFYB 2FYYB 3AREA 3OKNA 4OLVH 4JHZA 3TA3C 3SKMA 3DX9A 4N0FA 3G6DL 3NCMA 5BS0D 5M94B 3MLRL 3VH8A 4QRSB 2DQCL 5C08E 2X4RB 4P57A 1I1FA 4ZNCD 1DBAL 4DK6A 4PJXB 1CLYH 1IQDB 1G7HA 3J8F7 2OMNA 5CS7A 3D2UD 3WNKA 1XT5A 4XNZB 5T5NG 3DGCR 1QRND 1BFVL 1A6TA 4WHYG 2VLKD 4PJAA 5I76B 3ULVF 1X5FA 4OM1L 1A14L 3ZL4L 1NMCC 2GW5A 3MRDA 1CU4H 1K6QH 4F9LC 4HFUL 4IOSD 2X44D 1MIML 3QIUD 3RIAF 1M05B 1E4KA 4HK0A 2B39A 4PJIB 5LGJB 1P84K 4JFDB 3HLAB 4JRYE 4Q7DA 1KB9K 3NPSC 2WINB 3EOAB 4N9OB 3VFGL 4K23L 1NLBH 3FOLB 1QO3A 1ZHNA 5LBSL 2HKHH 3SO5A 5JNYA 3S98A 5DR5H 3VXOB 5IMMB 1Q9WB 3M8OH 3DRTA 4CUCA 4M7JH 4PGEA 1II4E 2XXCB 2VIRB 4OCWL 3MRQA 5BXFB 3GZKA 1TITA 1T04B 5C0BE 4KK6C 1IFHL 2E7HA 4IRSD 1ZLUK 1K2DA 4HULB 1EGJL 1T80A 4D0DA 5ETUA 3HE7A 4FQHA 3CFIC 3N1PC 3IDIA 1FLTX 1FZKA 1GH7A 3GGWA 3RKPA 4PGCA 1ORQB 5TQ0L 4GQ9L 1QKZH 2HKFL 1JI1A 1H3GA 2X40A 3FOMB 2X09A 1HNFA 1I3GL 4JM2D 3ULUC 4YXLH 1NEZA 1YEDA 2C1PB 3OB0K 1XCQA 3MLUH 5GXBB 1QFWL 5F7YC 2GFBA 3GMRB 1FRGH 5ITBH 3UPRA 3HRPA 4Z7UF 3O8XB 5ESQB 1ZHKB 1RURL 2ADFH 1DEEB 4Y1AD 3S8WA 1XF3B 1F90H 2ARJB 1VERA 4HQQH 3PHOA 1CFVH 4OFDA 5I1GL 3CFDA 1IL1A 1D7FA 2YRLA 4F9LA 1H3UA 5DRNA 1BQLL 3LKSA 2EDLA 4X8JB 3BQUB 4QXTB 5D1ZB 1U8MB 3HUJB 4R26L 1KJVB 1QSFB 1UM5H 2QQQA 3TZVA 4NQVB 5IBLD 3BP7B 1GHFH 5FO9B 2JB5L 1B2WH 1YPZF 3GMQA 5IFJA 2Y5TB 3B2UC 3SE9L 5FGCE 1GXEA 1WCBB 4LLWA 2VABB 2VZTA 4X6FB 3X11B 3JWDL 3BP4A 4P5TD 3AY4C 1IC4L 1EO7A 3RGVD 3KJ6L 3MUGB 4MA7L 4LK4A 2JJVA 4HKJA 4BQ9A 1W0WA 3PJSB 2HVKA 3MJ9H 3RVWD 4IHOA 2V7NB 1C5DA 3OSKA 2PXYB 3FQTB 5D72L 2AAVA 4BQBA 1K85A 4KKAD 4GRMA 5K9JL 4S0SD 4Y16D 3WXWL 3X14A 1NCDH 1T3FA 3WKMH 4MXVE 4P2QB 2YUWA 4YDLB 3BGMB 4LPWA 4Z76A 1N3NB 1FSKB 3LB6D 1PX4A 2NY2D 3QEHA 3BT2L 2JJUA 3D87B 3MCLH 3MZTA 1E6JH 4UTBH 1BFSA 2X9YA 4PJBB 2EIBA 3U6RB 1AXTH 1KIRA 1ZV5A 3O4OC 4XHQA 2QSVA 2DWDA 4MVBA 3CFCL 4DCQA 3WJJA 4OLZL 3HAEA 3TBYB 3IFPB 3U36B 1GGTA 2N56A 3FB8B 5CLWA 1DQDL 1RHHB 1T1WA 4EUPH 5DJXB 3GBMH 2DN7A 1EFXA 2IAMC 1MCPH 5DJZA 4JFED 1VEOA 3FRPG 4L5FL 3U2SB 5CFHA 3RL2B 3W0WB 3PIQB 3FN0L 5A43C 4I18C 4JKPH 5ICYB 2Q86B 1CL7I 2N1KA 1X5KA 2YD5A 2WWMC 4RGOL 1I1YB 5DHYA 5EO9B 3U83A 2V2WB 1T89C 1QSED 4FNLH 4IRJC 5GPRA 4L8CB 2QV2A 1TZHA 4JFFD 5I1CL 2ADJB 1NGPH 3VG9C 3DMMB 4OUUB 1JWSA 1HHHB 1XR8A 3MA7B 4XCFL 3W9DB 4QRTA 1G6RA 2IF7A 1A6AB 1T22B 5DO2D 3PP4L 4WHTA 1ZVYA 5I74C 3EYVB 4QEGA 4DZBA 1H8SA 2ZPKH 1P5UA 3ZYZA 1AXIB 1CS6A 4UQ2A 1TQCB 3ULVD 1MHPL 1QOKA 4GG6F 5F9OH 3L3OB 5C6TL 3MOAH 2YOCA 2X4UB 2CKBB 1OGTA 2FO4B 5GQBA 4EZMA 2VDRH 3UTOA 5KSBE 2BVPB 4LHUB 1F97A 2LABA 5JOPE 2EDWA 2QHRL 5C71A 4PRDA 4FMFA 2OZ4A 4Y4HB 4KMTH 4Z0BH 5MEQA 2NY3D 1IEBA 3ZHDA 4D9RE 4X99A 3F6LA 4KHXL 1BREA 1BHGA 1C5CL 4ISVA 1S9XA 4MS8A 3QRGH 4BYHA 2E7MA 5LWYH 4DGIH 1MCDA 4CVZA 3HZKA 1G7QB 2FEDD 3QT2A 1EDQA 1YY9D 1E0OB 4HIXH 5BVPL 4PP8C 1WC7A 1A4KB 4I9WE 3DV6A 1EJOH 1TVHA 4NNYB 3U4AA 2GKIA 5E8DL 4XH2B 4RBPK 3T0VA 5E9DA 1AGFA 4FABL 3BN9C 4UOW1 4QWWD 1W0VB 3G5VA 3O3BA 1FNFA 1CFQB 4P48A 1VGKA 2HH0L 3P77B 4LIQE 5B3JF 2GK0B 3GDBA 1LDPH 1Q1JL 1NAMH 3VMPA 3VXRA 5B38G 3O6FC 4NJAH 2VDNH 1M7DB 1T7WA 1KB5L 5C0JB 5ISZD 2E8YA 2CK0H 3JV0A 4N8CH 5E2VH 1OTUD 5EN2A 2EIZB 5AG8A 4WI3A 3OR6A 4DKDC 4I3SH 3SDYL 3C9NB 5JHDA 2NYYC 4HG4J 1FIGL 3EKCA 3SGKC 1ZT4A 1T7VA 1WFTA 4FN0A 2CIIA 4ZS7L 2Y06L 3MGTB 5C7XH 4CW1B 1PG7L 4N9GA 3F12B 5JHLL 5EFIA 4KI1A 3NFPA 3UTSE 2X4PA 4XXCA 1MJ7H 2OR7A 4R96B 5C3LD 4NKMA 5FM4A 4XMKL 1DQLL 2VNCA 3MRJA 5ESAB 3MODL 3VU2A 3MGAA 1HHIA 1YEIL 3DX7A 1KTLB 4NC2B 1ZA6A 3FMGL 5IB5B 5LQBL 1KBGL 4ODUB 5IFAH 3LS4L 1GSMA 3JZ7A 4FQCH 1MNUL 3BUYA 3EYUH 1XF5B 4AL8L 1NDGA 1NBVL 4XNXH 4EUPB 1MCKA 5DJ2B 5EZJA 2DDQH 3CVIH 1KGCD 3BP6B 1MHCA 4NYLB 4ZTPH 3VFWB 5BCAA 3ARTA 4FQQB 2PW1B 3BEVA 1KCSL 1WK0A 3JWNC 2HT3C 1GC1H 3V4UH 5FKAB 5GIRB 1CD9B 2A77L 4YQXH 1EXUB 5CZVL 4KTYA 2GHWB 3SDAD 5JW5A 4LEXL 3BXNA 4D9QE 4XWOC 2NTSP 2GJ6A 3T65B 3PG2A 4LSUL 4CMHC 3QWRA 4L8SC 3MJ7B 5CP3A 4H88L 3MLRH 1S5HB 2F53D 1RZKH 2V5MA 5HYSA 2VYRE 5IGXH 2E6JA 2G5BA 5HDBF 5T1LD 2E9IA 2NXZB 3SGKA 5T3ZL 3ULSB 1SYSA 3U0PA 1E4XL 2ARJQ 4ODVL 4RGNE 3ROOA 2VWEC 4OI7A 4JO4L 3B9AA 5IG7B 2AJXH 5CGMA 1T1YB 1BFVH 4Y88A 4M1DL 2EDQA 1IAIM 3ZE1F 1A21A 3ECBB 4OZGB 2V5SA 4PJAE 4QXWA 4J1UB 2FECL 1S7VA 4ONFL 4NQDB 3LRSA 1R5VA 3WL9A 3BE1L 5C2UB 1G7JB 5ALBH 3M1BA 3QQ9D 4JE4B 3GBNL 4JDVB 5EWIH 5IHZB 5C0AD 1T5WA 4G9FA 1PYWB 3LEVH 4TULL 2XXMB 2WP3T 3C6LB 4ZTOH 4B50A 4RFNC 5HJ3B 5GZOC 1KJMB 2UVFA 3BW9B 3F62A 2XTJC 4JY6A 2NW3B 2A2QT 3I6KB 5EBWA 4NO0B 5IQ9A 4F8TA 2ZG1A 4K23H 4YHIB 5EBMA 3BZEA 1I7RA 2PTTA 4M43H 3LCYA 4U3HA 2MQCA 2AJYL 2FO1A 1NL0H 3QQ3B 2MWCA 2G9HB 1FN4A 1MFAL 2AQ3A 4YBHA 4F58H 2PNDA 2VJXA 5FYJU 1JK8A 3STBA 3HZYA 4FQ2L 1OP5K 4FFYL 1EGJH 4Z5RA 2YUZA 3QDJE 3G6AB 4J3WA 1AGDB 1IQWL 1NBZA 5HYEA 4L8SA 5CJQL 5E7FA 1P1ZB 4OLUL 3HPJB 4XPGH 3FJTA 1UB6B 2HKFH 4PGDA 3RTQC 4HIJB 4WV1C 4JM4H 1B0WA 1I3GH 1MI5B 1ZSDA 1S7SA 3C5ZD 5GGUA 2W65B 5IQ7L 2VKWA 4Q9BA 2JB6B 1BFOB 2NPLX 4MXWL 1NAMB 1UXSA 4IJ3C 2I9LA 4S11A 3U0WL 3T0EC 1J1PL 1CICA 1JHLH 4X5XB 4LLAA 4GKOA 1X5JA 5I1GH 5I1HH 4L3CB 3C09C 3PQYE 4PJ8B 5IB3A 2KQMA 3GIZL 1ZT7A 3O6KL 5EB9A 5H35B 1A64A 2QHLA 1P5VA 3VGAB 3HG1D 5IM7B 4JFFE 3F7VB 2ZOLB 1E27A 2JB5H 3DETD 4QNPE 1JGEA 3WKNA 2B5IB 4QRPB 5J13C 4U2YA 2WUBL 5BOPA 1A7QL 1D6VL 5IOPB 1G9MH 3VRIB 2C3VB 2Z31C 1IC4H 4Z7NE 4KROC 4LCWA 4QRRB 1NKRA 2EDTA 1CI5A 4B41A 1JF1A 1PAMA 3NIDE 3UTQA 3M17A 4HUUA 3OJDA 2AJSH 1BX2A 4I2XE 3KDMA 5IB2A 4XBEH 3GJFH 1XIWD 4TVPL 5J1TC 3PP3H 4IMLA 3SJVA 3OWEA 4PJ7F 4GRWF 1I8LC 4ELMA 5CEZD 5EU3A 1MLCB 4OTXL 2ICCA 1C5BL 3TCXA 3DV4B 1CDUA 1Z9SA 4JO3L 1U3YA 4NWUH 3RWHA 5JMRA 3D3VA 4WV1A 4O51A 4X6EA 3B3IB 1CD1A 1FE8H 3PWJA 4LKXA 4AEEA 2HLFD 4EXKA 3BJLA 3WDHA 4XVSL 3STLA 1AXSB 1DQDH 4R8WL 1ADQH 3MO1A 1AGEA 1Y6NR 4WTXA 5TGBB 4MXQA 2AEQL 5E6ID 3UPAA 1WWCA 3BH8B 2BVUA 3HTLX 1A6VH 4NHUA 1A7PL 3GSXB 3MXWL 4HPYL 4R2GD 4LFHG 4Z7VE 4FZEL 1A9BA 2NY7L 4G80A 3TVMC 3V5DB 3RWCA 1UH4A 3RX5A 1SJEA 2P7TA 1RZIB 5C0EA 1B9ZA 2R0ZL 3ARBA 3GJEA 1QA9A 5EC2B 5E00A 1BPVA 3BH9A 3KPPA 1HQ4A 4QT5B 4JZNB 2EE9A 2VISB 4JLRA 1YMMD 4GLRI 4P4RA 3GB7A 4PJEA 5DQDL 3S7GA 4XCFH 3U9UB 5KS9E 3K3QA 4GOSA 3BPNC 4XBGA 4R0LB 2WNGA 3TFKD 2E7LC 3PP4H 2M1KA 1OLZA 4TYUA 2W07A 5T1KD 4X8XA 1TDQA 3HMWH 3ZE0E 3A6CH 2W9DL 5AUMA 1IM9A 2HA1A 3EYOA 4M61B 3V79C 1MHPH 5EZIH 1JGUH 3ALPA 3HLAA 5C6TH 4NO5B 4WW1B 1MFCL 1Y18A 5DD3H 1C1EL 3DHJA 2DQEH 2YN5A 3WS6C 4I3RH 5ICZA 5GS1A 5F3HB 3SO3B 4L4JA 1TQBC 1Z0NA 3FB7A 5HVGB 3DIFA 1JPGB 3DROB 1CK0L 1RIUH 3DUUB 1FL6B 2BHZA 2A0LC 3S4SB 5E99L 2G5RA 1I1AD 2GSIB 5HHMA 1L7TH 1C5CH 1X5XA 2DWEA 1LP9E 4YFLI 4G6MH 4HJ0C 3GSRA 3MJ8A 3UTTD 1MLBB 4Y2DA 3OXSA 4KVNL 3TVMA 5F1OB 1GZQA 2XZCL 4YC2C 5D7IE 3BWAA 1V8HA 4J8RB 5IF0A 3O3EB 3MLTB 3P40A 3J7HA 4N8VA 5FDYA 4UT6L 2CUHA 1SBBA 5CCKL 4GMTL 1KJ2H 4Y4KC 5BVPH 5FYJH 1T2QL 1A7RL 4J4PD 2G60L 3UYRL 4FMKA 4XVTL 1BD2A 2GITA 4HIEB 1I8MA 3HFMH 5E8DH 2ZSWB 2R2BA 4L1HA 3VI3F 2R69L 1A6UH 4KV5E 2ESVA 1F3DH 2J8HA 4FABH 4PY7B 3G04B 2EC9U 1BQSA 4QXGH 4GKNA 3CVHA 4PRAB 1MFBH 1EMTL 1TMCA 1R6VA 5D7LE 2E7LA 4PDCE 1A9EA 4I4WB 3NCYP 4OB5L 2AJ3A 2GEEA 2DBLL 4HZAA 4WFGE 4GS7B 3Q5OA 2DI9A 4MA1B 4Y4FD 4JREB 4QLRA 2WV3A 4HG4K 2ZJSL 3AMKA 3LDBB 3LN5B 2H2SD 3TBTB 2KZ1B 4MNGB 1NMAL 2J2ZA 2ZUSA 2VN4A 1Z9LA 1HCFX 3TN0B 1OHQA 4JY4A 3CZFB 1OP3H 3WS6A 5KVEH 2RCSH 3H3PH 1IGTA 2GJZA 3MRPA 2BFVL 4YFEA 3SDYH 1H5BB 4BZ1H 5EU6D 5FECB 3VXUB 5I0ZA 1NC4B 3OKEA 5C09E 5I8OH 3FQTA 4ZS7H 2Y06H 4J12A 3KYMB 4PJ5D 4Z0XB 1RJZB 1EZVY 1FNEA 5FGSA 2VOTA 3VFPB 4ERSL 4ZAKD 2VXTH 1PVHA 5FA3A 3ZKMD 4C59B 5LXGL 1C8PA 3RI5K 3HS0B 3QIBB 2EDHA 5D96C 1DLFL 4KDTC 1QLEH 1T20A 3GJFB 4XMKH 1QFPA 2YSSB 5L9DL 4MHHI 5F89A 4JG1L 3FL7A 1OW0A 4Y4KA 3PV6A 4LBEA 2FJGB 4PG9A 4AIZA 3GMMA 3RZCC 5ABDE 1KBGH 2ZSVA 3RKDD 4OF8A 2R4SL 2BNRA 2Y72A 2X70A 5ID0B 2VXVL 4Z95L 1YEFL 2UUDH 2WZPD 1DBJL 1MNUH 3V0WL 4AL8H 1NBVH 3WFDH 2GT9B 3BKYH 1O0VA 4HH9A 2F8XC 4U1LA 4JFHE 4MLIA 3U2SA 3RL2A 3NBNA 1T21B 4DKFL 3W0WA 2KPNA 2IMMA 3TBWA 4WFHE 5F44A 1KCSH 2BJML 5D1ZD 4P2RA 1LEKB 5AEAA 3WEXA 2FD6L 5CZVH 5I1AA 3BJ91 3KPRD 2PO6C 4W68A 4O5LL 5GISL 3I6GB 4YIQB 3TYFB 1CGYA 4JY5H 5I8KL 3WNOA 3W9DA 1P6FA 4N0CD 2AXFA 1RVFH 3D18A 4ONOA 4KI5E 5T3XD 4CAGA 2APWA 3KPLA 2Z4QA 1DLHA 1U8KA 1TCMA 1Q0XL 4TRPL 2D2OA 4E41A 1D5IL 4ODVH 4MDJA 4TTGA 5MEOB 4UUJB 5DEFA 3WFCH 2ZUQC 1H3VA 1NGWA 3MA9L 4OIIL 3K2UL 1KNOA 3FB5B 3TJHA 4GW1A 3KNBB 4X98B 4PJGB 4RX4D 3RPIB 1U93A 2BOBB 1HZHL 4KQ3L 4Q9RH 2RB8A 4FQXA 1L7IL 2IPUK 4LHUA 4NQUA 2R23B 4Y19A 1SEBA 4EVNA 4YAQB 3HMXL 4UAOB 2MFNA 3CH1B 3EO0A 4XWGH 1ZGLA 2JCCE 4H8WL 3RZCA 1YEKL 3GHEH 4TULH 1DBMH 3T3ME 2XN9B 1E4XI 3CPLA 4H1LH 5GGRA 5TDOB 4BFIB 3K8KA 2P8LA 2G2RA 3U46B 5BJTA 3V52H 5ILTL 4KJYB 2PYFA 5DUBA 3G5ZB 2DQUL 1UVQA 5CJXA 2FECI 1BBJA 3HI5L 2AJYH 1AR2A 1J0KA 1J10A 2X9XA 3QQNA 4LSVL 5HHOE 1MFAH 3NIGE 3VGEA 1K4CB 3R06B 3VXSB 4DGVH 2QKIA 4RMVA 4XMPH 3U79A 3DO3A 2IQAA 4LLVA 1BM3L 3QUXA 3WIHL 2AK1L 3QHZL 5CSZB 3ZZ1A 5IEKB 3K74B 1B4RA 3DRQA 1KJ2B 2HG5B 3WUWG 5CEZE 4JFPA 3QIUC 1DDHB 3I2CH 4OLUH 1EX0A 5ENWA 3DMMD 1U3ZA 5BRZD 3ZHLA 3CSBA 2I9TB 2XWTA 1OM3L 1BECA 3LKRB 3WNMA 1WT5C 5IQ7H 1OAYH 1HILA 4C56A 2EC9T 1EEYA 35C8L 4KH2A 1BFTA 4NWTL 3VXPA 3GI8H 1N0LA 3QXDA 3SKUD 5E8OA 2FHBA 3OBAA 1RZ8A 3T4YB 1RFDH 3U0WH 1DEDA 4PJCF 2ZUVA 3S34L 2GUOB 1IJ9A 3IU3A 3LEXB 1KB5B 5J56B 4IIQC 3RWIA 2FEEL 1XGRA 2FL5A 4HUXB 4TUKH 3GIZH 3O6KH 4H5SA 5HGHA 4KK8D 3VFTA 1U95B 5BS0A 4P9HH 1JZ4A 3AB0C 1N26A 1F4YL 4M7ZC 1HIML 1I3UA 1KCLA 1UXWB 3MGTA 4F7MA 3NFSH 4HMDA 2VZVA 5DFWH 1NANH 3MV8B 3LKOA 4K3JH 4JM2C 1A7QH 3EOBA 1YDPB 4WTWA 1SJHB 3D2UA 2XZZA 5JORA 2APBA 3WIIH 1TETL 3ZYJA 3FQRB 4FXGA 5HD8D 1QRNA 3C5SA 1JHTB 4DKEL 2VLKA 2HJFA 4MJ6A 4LVNB 1CDIA 5J6GB 1TJGH 2ERJB 1NGYA 4G5ZL 2A9NH 3QCTL 5IROC 4XAKD 4OZIB 4YHYB 3LIZL 5T1DL 4X4XA 3SDCD 4ALAH 1TZGH 3QIUA 4WTZG 4PRHE 1JN6B 3SGDH 5DVOA 1VFBB 4V2CB 4FQIH 3O11B 5IBLC 1B90A 5FM5M 2HFEA 4OCXL 1FFPB 3Q6GH 5C2BL 1CE6B 2JJWA 1J8HB 2EEAA 4MMZC 4P5TC 4XVUD 1JWMB 5D7JB 1V7ML 2DJSA 3IRPX 4R8WH 4YBLB 3JTTB 1AO7D 4OM0L 4HD9A 3ZTNL 3Q6FA 4AZ8A 2VMFA 1NCTA 2XIDA 4LMQE 3MRHB 4IRSA 3I84A 1KLUB 1CWVA 1D5ZA 1LEGB 1TPXC 1KN4H 4R90L 2HTKC 3LAFA 1VEMA 4Y16C 5H94A 1LVEA