1JPFA

Crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
275
structure length
275
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jpfA01
2PUQT 1R6VA 1H15A 4FOMA 5IMOB 1D5XA 2BY0A 4JZNA 3VFMB 5DLMH 4P4KA 5CD5C 5JQ6L 3QNZA 3FL7A 4JFOB 4FXLA 2D7MA 1ZA3B 3KHQA 4R96B 1FFOB 1CE1H 5DJ8A 3O41A 2F5BL 2IALA 3BE1L 3SKMB 5JO5B 2HJFA 4Z7WA 5DVLA 2X41A 4Y2DD 1KCSH 3QHZH 3VFWA 3WE6A 2C3HA 3TPKA 2ICES 1UB6A 2ITDB 3L3JA 4WJ5B 5ICXB 4FMKA 1MJ7L 1VADA 3V6OA 1GGTA 1LO4L 3L3OA 5HBBA 3BMWA 5F7YC 4KDWA 5DEGA 4ZAKB 2NXYB 2ZUSA 5I8CA 3CFEB 3I84A 4Y4HB 4XAWL 3VWJB 5LGKA 4HIEB 3HC3H 5ISZB 4R4NC 1F8TH 1RU9H 1U3HA 5I1HH 1NSNH 3MV9B 4GMSH 2HJKA 3PABB 1QPPA 2DTMH 5C9KA 5D1ZB 4LQ1A 4QYOA 2VLME 2F54E 4MNGB 5F6HJ 2EDHA 2IF7A 4UU9A 1EMTH 2E8YA 3BP7A 5ALCH 3B9AA 1QACA 5DSCA 4AMKH 1JGUH 4IMLA 2DQFB 4KK5D 5DZNA 4LSSL 5HHXH 5T3ZD 5F21B 2WW8A 3NH7L 1JWSA 4W68A 3I9GH 4ZAKC 2VDPH 3JTTB 3D9AH 4PRPD 5F96H 4XCEA 4FRWA 2ICWB 4Y4HC 3WV0A 3QFJA 5ALBL 2WBKA 3G5YA 5FGCE 3BRDA 2AEPH 3AMKA 4R3SA 5IW1B 3V6ZB 2AJ3B 2LAAA 2AQ3A 4PRAB 1OD7A 2OL3B 5FF6A 5E5RB 1WBXB 4K9EL 3H7LA 1XGYH 3CFBB 5D1ZC 1BZ7B 2AXGA 5I66A 3HZKB 4Y4KB 3QWOB 2C1OA 1JE6A 1FVDB 1L9MA 1PX3A 1F6FB 4LSPH 4UNUA 5F6IC 2ESVE 3E6FA 4G7VH 3ZLQC 2CKBA 5DGRA 1AQDB 1BAFH 4YHLL 2B5IB 3MXWL 1V8HA 1UM4L 5KN5B 4DGIL 2J5LC 4E42A 4JCMA 3VXME 5J1SC 1ZHLB 5INCB 1A47A 4GW4B 3BJLA 4V1DA 5DWUL 3S88L 3N0PB 3BP5B 2A0LD 3WSQL 1PJ9A 1S8DB 1EO5A 5I17B 3OJDB 2Z91B 4HCRA 4JFDB 4GW1A 4QEGA 2CDEA 2Y07L 4F7CA 3MJ8B 4LOUC 5KVDH 5C2UB 4FG6C 3HC4L 3PP3K 2I9TB 1CZ8H 2GJZB 5C6TH 3CVHH 1YN6A 2ZUYA 4Y4KC 4X7TB 2G5RA 4ZSOE 3TBVB 4D0BB 3BUTA 2PXYD 1A0QH 1A7QH 5KSAA 1NMAH 3IJSA 2VSDA 1FNFA 3ZDZE 3HR6A 4Z78B 2GJ6D 3CFJA 2R29H 4J6RH 3OAUH 3QUML 1IGCL 1RUML 4I4WB 3B6SA 3RGVB 4OD2A 3DGGB 1DQJB 1JHKL 4N8VG 4WNQB 4JM4H 3ZE0F 5F7EH 4U4BA 3SKOA 3WIIH 4D9RD 1XZ0A 5BV7H 5ISZE 5DFVC 2L0DA 4V2BA 3WFDH 2CLRB 2ERJC 2W9LA 5IEHA 3VGFA 5JDJA 3MODH 2XYCA 5CJQL 3SO5A 5ADOH 5AWNH 3X3GH 1MCFA 4WTZG 4KRPC 5BOPA 2AJXL 1T5XA 4F37F 3BH9B 4UQ2A 3UYOD 1BD2D 3PQYA 1KV3A 4UTAH 3IYLW 2R23A 2VITB 5H2BB 1QFWI 4HPOH 3EIFA 2VLKA 5LKNA 3RGVC 2P5EB 3QHFH 4YWGH 2DKSA 5FDWA 1B2WL 1QLRA 1T20A 3LKSA 4YDJB 3RUGA 1CLZH 4Z8FL 1JPST 1IQDA 2VXUH 4QRPE 5CP7A 1I4FA 1AC6A 2HLFC 1YJDH 1K3ZA 4GUPB 3BISA 4LGRB 1EGJL 4Q0XH 4F7EB 4JY4A 3JV0A 2GSGB 3QUYD 1KOAA 1CE6A 2P5WD 4BFEA 3MZTA 1PY4A 1A2YA 4OM0L 2BMKB 4Z7VB 1SHMA 1VEPA 4PTTA 4JFPA 2X4TA 3W39A 2BFVH 5DEFA 1JPSH 3PHQA 3FQUA 4ZS7H 3FHAA 4Y2DA 1N64L 4JFDE 3C8HA 2H2SC 3AFLA 4MA7H 3HLAA 4JFXB 1JNHA 1RJCA 1KLUA 3CZFA 2ZJSH 4K3EL 1OAUH 4M6OL 3KPSE 1U95A 2XZAH 1U8JB 1XGTA 2AK4B 3V8OA 3QEUB 2WAHA 2FSEA 1TTFA 2I07B 1NANH 3MRDA 3U0PB 1L7TL 2FJGB 3MGTB 1UWGL 4NM4L 4YHOL 1UJTA 5DUPH 5INDA 3FQTB 1LE9B 4Q7DA 5IV2B 5LQBH 4UV7L 4ELKA 1SBBA 2HTKC 3IKCB 3MRJB 3VDCA 3C2AH 3N1QC 2AABH 2EDNA 1P9MA 3ZYOA 1IM9B 2VQ1A 3GSOA 4UTBL 4GS7B 1KJ2H 1UCTA 4OFYA 1G9EA 2WWKO 2EC9T 1P2CA 4PRPA 4KK5C 2P8PA 3QXUA 1CS6A 5FA4B 3ARBC 1HN1A 1KEMH 3RL2B 2VXVH 3P4OA 2H1PL 2XIDA 2VR9A 5E8DL 1J11A 1Z3GL 1RVFH 2P5EE 3EYOB 1PG7W 3GUTB 1KCRL 4NN7B 5DJ6B 1ONQB 1A8JH 1TCRB 1NBVL 1C08B 4PJXA 3D39D 1FLRH 3P9WB 3ZT6A 4G8FA 4HUNB 4UBDD 2E9WA 1JYXA 3GSWB 2DB8A 4JKLA 3TPUA 4R90L 5CKAA 5J06A 4NQSA 4X0KA 3EJZD 3UJJL 2O5YL 2IPUG 5D2NE 4X6CB 1MCIA 4K23L 3L95A 3EYSH 1FQ9C 3FO2B 3WNLA 1MI5E 2V5YA 3CLEH 4QHMA 3QIUB 4ZOAA 2ZUUA 2NY1B 3KPMB 5BJTB 25C8H 4L4TE 5EZLB 2AKRB 4P5KB 5DC0A 5FYJH 3QB7C 3DVIA 2GQHA 3CDGA 4PG2C 1G9NL 1YNKL 2A0LC 4KJPD 2OXGA 4ETYA 3VXTB 5DD5H 1YEIL 2DS4A 4NN7C 4N1HB 3P11L 2PO6D 1LHZA 3TV3H 1SMAA 2N7BA 5LVEA 2WWMD 2PXYA 3IXTA 1WBYA 4XVSL 1I3GL 2XKNA 4XZUA 1RHHB 3DMMD 2CKNA 2WBJD 1JZ2A 2GJ6A 3MV8D 1QD0A 4R4BB 4I9WE 5GRZA 8FABB 3GBNL 4ORGB 1IVLA 1LD9B 3V4UH 5D5MF 2NY1C 4ZG1A 3RVUC 3CSGA 43CAA 2VLLA 2JJSA 1S7XB 3I6GA 3O3EA 3JV4B 5DJDB 3J7HA 5E2TL 3SQBA 4PJFF 3NOIA 1HEZA 4NNPH 5E0QA 4OGXH 4CVZA 4D94A 2VLRE 4MJ5A 4GRMA 5DHVA 4P9HH 1XR9A 5D7IB 3BOVA 2J2ZA 3IETB 4N90D 5J6GB 3RVTC 1X5JA 4KJWD 1G6RL 1K8IB 2Y7QB 4Q9RL 4K3GA 3BESR 4KUCD 5HHVL 4ELME 1Z5LA 1BD2A 3ESUF 1GIGH 1T21B 3ZYJA 1BGXL 2MWCA 1A3LL 4K71C 4DW2L 4NC1E 4ODXB 2DTSA 1QA9A 1ZVSA 4TUOA 4HKBA 4PTUB 3VXSD 2C7UA 4Y2OA 1OQXA 4YAQA 3KYNA 5SWQA 4LQFH 5ANME 4YH6A 3TM6A 2YXFA 4HK3J 4OUUB 5IM7B 4U7SA 3W2DL 4FQCH 4S0SD 3I2CH 4OLZL 1LEKB 2GCYB 2IADA 1UB5A 4JFZH 4YC2B 1C5DA 2EDXA 2HRPL 1PKOA 3LY6A 2IQAB 3DROB 4JFEB 2CLZA 5IQ9B 1UWXK 5C0BE 1T7WA 3QUYA 1NPUA 4RFOH 5IR1A 2P5WA 3PGDA 4X6CE 4G6JL 2BY3A 5K9QI 4L5FL 2J4WH 3IDXH 2QR0A 3QUYC 4Z5RA 1DUZA 5GRYA 3QNXB 4FQXB 2YD5A 5C6WH 3G6AB 4FQPA 4DOHB 3F7PC 4I0PD 5EU4B 3TO4B 4PREA 4X99B 4U1IB 2GK0A 4PV9A 1WIUA 3ZKNC 4PY7A 3TYGH 3JZ7A 1FZMB 3EGSB 1TXKA 1KB5L 3GI8H 4Z7NF 3BZFB 5KZCD 3AB0B 4XHQA 4LNRB 5KTEL 1ZHNA 1HINH 3V4PL 5J9PA 2DJSA 1BEYH 4XMKL 4JZOA 4NT6A 1DN0A 1MJUH 2YA1A 4U7MA 2QHRL 2Q8AH 4BH7B 5C07B 1CXFA 3L3GB 1F4YH 1SVZA 3NCJL 3QR2A 3H42L 1Q9OB 3QQ9D 4YHNA 5DURB 1HKLL 4KY1L 3TBTB 5E6ZA 2W9DH 2OJEB 1KJ2B 4L9LC 5F7DA 5EC2B 3VMNA 4X4YA 4ODSL 4PBXA 2ZUVA 5D6CB 4QF1B 4Y0GA 3ZHKA 1KG0A 4PJHE 2V9RA 4DN4L 1KPVA 2FBOJ 2FATH 5GSRA 2D03H 5F1NA 1J8HD 4OZIA 2Q76B 4LHJB 1VB9A 3RAJL 2QKIB 5DHYB 3V4VH 1M7IA 1F90H 3VI4F 3DX6A 1CFSA 2X09A 5IMLA 2H8PA 1SM3L 4QCIA 3MNVB 4CNIA 5GJTH 3QPQC 1OVZA 4HF5H 1WCBA 2AQ2A 5GS2D 2JTDA 5TE4L 4JR9L 4FQIL 4YIQB 4C57C 4RGND 3MJ9L 3MFFA 5MEQB 3NGBB 1R24A 3AM8C 4WW2F 3G6DH 3QCTL 4LLUB 2AV1B 3MA7B 3D39A 1HNFA 5MEPB 1GJIA 5HI3D 5T3XH 4MX7B 1F4WL 4N1EA 5HY9A 3KLAA 4OI9A 2OI9B 2R0ZL 2BNQB 1BBDL 2WY3A 7FABH 1DSFL 1V05A 2BSSA 4H0GA 3SO3B 5L0QB 2GAZA 3P40A 3LQMA 1OGAB 2J6EL 5EA0H 1YECL 3JV6B 1NGYB 1F4XL 3EJZC 3STBA 3O3UN 1VFBA 2G75B 5TF1H 2OSLB 1DLFL 4HUUA 4PJ5D 1XR8B 3D2UB 1KN2H 3EFDH 5HYQB 1I8LA 4ZXBD 4G8EB 4JY6B 4PLKC 1CVSC 4KKCD 3UPCA 5AYQA 1LO5A 1D5IL 4DOHE 1PZ5A 3LEVL 3R06B 1QFPA 3NGBC 3WCYA 4TVSa 5SX5K 2ZG3A 4XCCH 2PO6A 4U3XA 4HJGA 1KCUH 4XP4L 3VFSB 4NQCB 4PBVC 5L2KB 1MCCA 3LKNB 4M3KB 1DANT 1Q0XH 1R0AL 1INDH 1L6XA 3S3PA 3DMMA 1SEQL 2C3XA 3VD5A 3RNQB 3JUZA 2YUZA 2R2BB 3MV8A 4XP5L 5C07E 2WWMC 5HVWA 4JKKA 3BP4B 4YGVB 4G8IA 2ICEA 4L3AA 3IFOA 4O2EA 3GJFA 3VXUE 3KJ6L 5TPWH 1REIA 2OR8A 5TH2B 4AT6B 1CFQB 4HUKB 1NKRA 2YR3A 4HIJA 2R1WB 1EAJA 1QFHA 3CIQA 1UZ6F 4I3RL 4L4JA 1F97A 2I5YL 4QRRB 4JY5H 3RWJA 3MLWH 2BOBA 2Z93A 5EULV 4ISVB 4OB5L 5IF0B 1RZJC 4P57A 5C0AB 1A7RH 5IVOA 5J11B 4FP8L 3VI3F 1A7NH 1L4IA 3BGFB 4CN4A 1QQDB 3BZ4B 5GS1A 2Y06L 2R1XA 1VCAA 3FB8B 4KK9C 3RDTD 3VXSA 4OZGE 2IAMD 4R0LC 5EFIB 2Q7YB 1YPZE 3RWFB 3TF7C 2XNAA 3GSNH 4Z7UA 3PGCA 2VDOH 1I9JH 5D2LB 2FZ3A 4S10A 4TSCH 3MRKB 3ZE1E 5ACZA 4JPIA 3PWUA 2H9GB 5C0JA 5IGXL 4ZOEA 4OCRL 3CFIC 3TIDA 5EZIL 4QHNA 2KL6A 1MFAH 1HH6A 1LO0L 2Q20A 2JF1A 2OZ4H 3P9MB 4RAUB 1EVTC 3N85L 4M4PA 3VA6A 4FQQA 4JO3H 4TULL 1UYWH 2W92A 1RUAL 3QISA 1DEEB 1WK0A 4K3JH 1BZ9A 3HNSH 1EGJA 1Z9LA 4ENEC 1UJ3B 1Y18B 2R56H 4JJ5B 4CL7A 4I0PA 4AH2B 2B0SL 1S3KH 3HPLB 4Y5YA 3BVNA 5CJ8A 1XCTB 3CH1A 4FMFA 5EDXA 5HI4C 1EHLH 4LK4A 3RWEB 2YEZB 4A2MA 5CAYB 4NNYA 2AK1H 2FD6H 1QVOA 3I02B 5DK0A 2X42A 4O2CA 4MJIE 1BOGA 2ARJB 1JF1B 2CGRL 4RFNB 3OGCA 1LQSR 3QULA 1X4YA 1ROWA 4XC1H 5TDOB 3MX0A 3ZT7A 1N4XH 1OB1B 5MP6L 1PY9A 2H41A 4IMKA 2BNUA 3WDIA 4HBCL 5EUKA 4QO1A 4OV5A 2BSTB 1V7NH 2QQQA 1QSFE 3EOTH 5SX4H 3VWKD 3KLHD 2FHFA 2X40A 3VRIA 3BKCH 2E9BA 5CD3B 4J4PD 4S11A 1U42A 2QQKH 2YOCA 1VERA 1TQCC 1J8HA 2D0FA 5HDQH 2GITA 5DF0A 4PYGA 5ADPH 1JNLH 1JV5A 4ODHH 3FMGH 3TH2T 4FZ8H 3L3HA 2XTJD 3O2VL 4RFNC 2HMIC 1HDMB 4GBXD 4OF0A 4ZS6D 1KJVA 2DOCA 2AJVH 4WV1A 1WFOA 4XPAH 2VMFA 5D8JL 4NZDA 1J1OL 3O9WB 4A6YL 3DIFA 1GHFL 4WI6A 5EU3A 1P5UA 4NSKA 4WV1C 4D9LH 5ICYB 4R2GC 5ITBL 2MCPL 1YMHA 2DQUH 4RGNC 4WRLA 5J3HD 2NW2A 3A6BH 5HHOE 3L3DB 4GMTL 3SGJC 2VLMD 4G6MH 1NGXA 2F54D 2J8OA 1P4BH 3QJHB 5LCVH 1U58A 3NZHL 3HZVA 3WFCH 4HUWA 3LDBB 2IFGA 1LDPL 1W8NA 2WIIB 5E5MB 1KENL 3N1GC 5C08B 4KROB 3X3FL 4W6XB 4LVOC 1IMHC 3WEXB 4G9DB 2ITCA 1MREH 2VUYA 5DLML 4NHUB 4AG4H 5AAMA 5AZEH 4HEPG 4QT5A 4ZXBA 3DURB 3HE6A 1MJJA 1BFVH 2BERA 5JW5B 3KHOA 1AJ7H 3LHPH 4NQVA 2MPAL 1HSAA 5ICZA 1CE1L 1D5BA 3PWNA 2A6KB 5HGHA 3HE6C 1U3ZA 3A6CH 1DZBA 1JNNL 4LP5A 3MXVL 2BSRB 4WEUD 4FS0A 3UBXB 2ESVD 1OF2A 5B38A 3FRPA 1IM3B 4PJDA 4WCYL 3EDKA 3MQIA 4ZUVA 1N6UA 3LKPA 3DI3B 3CDCA 4G43A 1NFDB 1T22B 3ESVF 3SE4C 3VXNB 5HPMA 1I7ZA 2QSQA 3L7EB 1NCBH 3VXMD 1VPOH 4JHBA 3OX8B 2ZNXA 3QUZB 3V5KB 3QO1B 3IDIA 2FO4A 4G80B 1U92B 2NYYD 2JJUA 1ZGLA 4JQVC 1SEBB 4OZ4B 3MNZB 3ARQA 4GKZB 4CMHB 4JANB 2NXZB 1F8TL 3SDCB 5I1HL 1BF2A 3BEVA 1NSNL 4GMSL 1F2XK 5IKCA 1RULH 5FHBL 4L8BA 3GSNB 4Y5VA 4EUPA 1EMTL 2FL5A 4H88L 4MA8H 5ALCL 5FUOL 4Y16A 4MJ4A 3JVGA 4OAWB 4JHWL 5EORL 3S35L 3TNMA 2C26A 3IS0X 1SYVB 1RQ5A 1OT2A 2IANB 5ESQA 3MBXH 1T3FB 1QHOA 3KYMB 4Y16C 1EHXA 3WNOA 2D4FA 5T3XE 3RDTA 2VDPL 2IAMA 2NXYD 2X4OA 2Y5TB 3D9AL 4NO0D 5SWZB 1G6RA 4JKWA 3Q1SH 3VWJD 2AEPL 2HKHH 2YD8A 3BPOB 4MVBD 4P3CL 3CUPA 4CMHC 5ISZD 5I19H 1WC7B 4CDHA 2IPKA 4HV8A 3MV9D 4RBPH 4I77H 4I18A 2ZCLH 3QEHB 2R69H 4Z7WF 3G5XB 2IG2H 2NY2B 1FE8H 1QBLH 4LSPL 1VFAB 1U8NB 2ZOKA 2YD6A 3BUYB 2OJZH 4XH2A 1I75A 1LEIA 4JPVL 1FJ1B 3AS2A 1MCNA 5F1IA 1S5HA 4PD4J 2CDFB 2RFXA 5KVEH 1EAPB 3EJYC 2VQUA 1I85C 2BVEA 1IARB 1FV1B 5IB1B 4JE4B 2EDFA 3BPOC 4PJCB 3MCKB 3CD4A 1AFVL 3VFOB 1CZ8L 3ECBB 4QRPD 2YUWA 5DA0B 3ZDYF 5CJ5A 2O61B 3CVHL 1YEFH 1QR1A 1A7QL 3C6SB 1NMAL 4YXKL 3U7YH 3PV7A 1RUPL 2R15A 4KI5C 2PCPB 4J6RL 5KANG 2FX9H 3OAUL 4HGKC 4XXCA 5E99H 2VN4A 4PLJC 2CRMA 3PGFH 3VWKA 3L5XL 1ZA6A 3RWHB 5F7EL 5CJOH 1AGBA 5F89A 3ARWA 4J4PA 5BV7L 1U2CA 2J12B 4JFDD 1JRHH 2FIRT 3WFDL 1IGYA 1FNHA 2Q3ZA 1OWRM 1R3JA 3MODL 4Y5XB 2X4RB 3SE3C 1AR1D 3DARA 4S2SA 5D1QB 5AWNL 2W0FA 4J4PC 5DR5L 4V2CB 5HGDA 1CT8B 4C54A 4ZTOH 3S3SA 5J6HA 2IH1B 4X9HA 3ARZA 1A6VH 3EYVB 3BXNB 4JFQB 1UENA 3NFPB 4GBXA 5T5FL 3GEWB 3MLYH 4YBQD 3MUHL 3CSBA 3MMEB 2BXYA 2IANE 4UTAL 4NUJB 4YR6B 5KOVC 3AY4C 2BVOA 5EUOE 3RKDC 1K4CB 2H32H 2J1KA 4NFDA 4YPGA 1P6FA 2DD8H 2OBGA 1HHKA 3DX9A 3QHFL 5GRJH 1AD0B 4LASH 3QQNA 4YWGL 4IRZH 2FX8H 2LFGA 2XWJA 4RAVA 1T04B 4RMTA 2V2TA 3WXWH 1MPAH 2HVJA 2F54A 4U6HA 1S7RA 1CLZL 5J4MA 5FO7A 3BIAX 3VD3A 3MJ9A 2F19H 4URTB 3LN4A 3U46B 3VCLB 1Z6JT 3S37L 4Q0XL 5TDPA 1PQZB 1Q0YH 2A83B 4LCYB 1CFBA 4JRWA 2W60A 1S7WB 3VFNA 4Z18A 4NM8H 2EIBA 3F6IA 1BJMA 3ILQC 4QWWD 1EFXD 3ZMRA 4XBGB 2Y6SC 1Q9WB 1A1MB 4HKJB 2QHLA 2J6EA 3MRIA 4P2YA 2EDBA 1ZS8A 3VRLF 3VG9B 3EO0B 4PGJA 2P5ED 2J3SA 3NCMA 2DDQL 5DD6A 3GM0A 3N9GH 4RZCA 4KQ4H 4YPJA 1JBJA 3K1KC 2ESVA 5KVGH 4S0UC 2ADGA 5T1DH 5H35B 1JP5A 1HHHA 1DUYA 2ZJSL 5A3ID 3OKMA 1OAUL 1UH4A 4CU6A 3FFCB 2XZAL 4S1RH 1MI5D 2V17H 3VXMA 1HWGB 1JUFB 5IMOA 3C5JA 4NO5A 5BOZG 2X05A 1QBBA 1Q1JH 5B38G 5FK9B 2W9EH 4L4TD 1LP9E 4JFOA 1U8KB 1NBQA 3BP6B 4IRJC 1CDGA 2IPTH 3WUZA 3E6HB 4FNLH 3VG9C 5HD8D 1ZVHA 3UZEA 3SKMA 5JO5A 4TUKH 3ELAT 4MHHG 5DJ0B 4W4OA 5CWSB 3D1MC 5J8OA 12E8H 1IEBB 3RUGF 5AD0B 2NY6D 4XMPL 1I1AB 1KC5H 1CTNA 3C2AL 2AABL 5ICXA 2JIXB 2ZPKH 2KPNA 4HZAA 1UXSB 4YDIH 4F33B 5IB5B 3KPPB 3CFCL 4FFZL 1KJ2L 1KTKE 4NC0B 4IOIB 4I9WD 4NO0A 1D6EB 3B2UD 1T7ZA 3GMMB 4EUPG 5KSBF 4MAYA 5LGHH 2Z31B 1EO7A 1J1XL 1U8OA 3VWJA 1KEML 2VXVL 3T2QA 3B83A 4LEOA 4MVBA 5ISZA 2NCMA 3VGDA 2V5TA 1RVFL 4MAYC 2FWOB 3NA9H 3NPSB 3NCBB 5BXFA 5IW6A 3IJYB 1MOEA 3RRQA 2Y36H 4L8CB 2VLRD 4WEMB 3E1F1 3S4SA 1WSST 2FLRT 1UWEH 2NNAB 2APTA 4GRLC 1CG9A 2OTWA 4YQXH 3EYSL 1GGCH 5JW4Q 3CLEL 2Q6WB 1NC2D 2AJYH 3RI5K 1F3RB 3OKEB 3EYQD 1L0XA 3NCEB 4CU7A 2ICWA 2ENYA 3OAYH 3S5LB 3NIFE 2Z31C 1A6AB 5IW1A 2AJ3A 3RWDA 4TYUA 4PRAA 2WNGA 3CCHA 1WBXA 4MD0B 5F7NC 5DD5L 3I3BA 3NIDE 4AEHL 3PHOA 3CFBA 4QRPA 4ODWB 3G08A 3U4AA 3HZKA 4BUGA 1DBKH 1UEYA 3TV3L 2WMPA 1JK8B 1DQQB 4R8WH 4HWEL 5C0BD 1TMCA 2EEBA 1DL7L 4U1GB 3MLSL 3O3AA 2W65B 2HTLC 2X4NB 5J1AB 4YFLF 2B1HL 2MQ0A 3FN0H 3HNTH 1ZHLA 1DVFB 5INCA 5EH1A 2XWTA 3QIUD 3ULSA 3KLSA 4HH8A 3OR6B 3CPLB 4WTXA 2BRRH 3BT2H 1S8DA 1MAJA 4JFDA 5HHQA 1VACA 3UTZB 3ARDB 4KRMB 1MHPL 2BVTA 1ZEAL 2NY3D 4JHAH 4OGXL 1FG9C 2H32B 2GJZA 3H7BB 2CR3A 4PJXF 1AGCB 3KPSA 4ONFH 4Y19B 4LLDA 2MCG1 1MRDH 3TBVA 1IC5L 3WO4B 3WFBH 1YNLH 1KEGH 4QRUB 1E6OL 4U1GC 1FZJB 2AEQH 3HAEH 4RIRB 1RZ7H 5FGRA 4HS6A 4NKMA 5JIHA 1DVFC 4UV4H 2WUCH 4I4WA 1IAII 4LARH 1DQJA 4PR5B 3MRNA 3TYFB 3P73B 4FXKB 2P47B 1AO7E 1ZHKB 3B9VA 4LQFL 1RZFH 4A6YA 5JQHC 2NY0B 4BK4A 4QXUH 2XG5A 5T1MB 2HJLB 2YSSB 2ZUQB 2DQJH 1CVRA 5DJZB 5LXGH 1LDSA 1TZHB 4JFZL 1BQHG 3QEGH 3Q5TA 2E6PA 2MSPA 3DV4A 5GZND 1LK3H 3BH9A 4N0CC 4LPTA 4HH9B 1EFXA 2QLVB 3ES6B 3EO1B 1JFQH 2J4WL 1MCEA 4E0RB 4PJBB 2VITA 4OF5A 4X7CC 1QFOA 1JVKA 2P5EA 1ZWIB 1U41A 1CLYH 1YEEH 3E2HA 1FCCA 3RFZC 1WICA 1MHEA 2NY0C 3GK8L 3MROA 1DJSA 4BH8B 1HINL 4HGMA 1U8HB 4Z6AT 4FFVD 1MJUL 1AC0A 2KKQA 5D2NA 1B4JH 2XKSA 4L3EE 5CIPH 1B90A 1MI5A 1W0YT 1TVDA 1F4YL 4D3CH 1L9NA 2PN5A 3B2VL 1KLFA 5I1IH 1B6UA 4P2OB 3F5WB 4L4TA 1A7PL 4EI6A 4YHYB 1AD9B 2BMKA 1FNGA 4CW1B 1KIPA 2BCKA 2EYTB 1AGEA 4UIMA 3D0VB 5I8EB 2EIZA 5IBUB 3FB5B 3TO4D 1XGQB 3CLFH 4DGYH 2LU3A 4JDVA 3TJEH 1FFNB 2MFNA 4AIXA 5IB3B 1J5OL 2VERN 4GRWB 5HD8C 2D03L 3CH8A 1JZ8A 4ZO6A 4M1CC 4JFFE 4M7ZB 3ULUH 3V4VL 1F90L 2HFEA 1G7JB 4QOKB 4DZ8B 1INEH 5T33H 1XIWA 5C07D 2X9XA 4BQ9A 1U8JA 3SHSA 3S35X 4NCC1 4HF5L 5LJYH 2I07A 4LSRH 4PJ7E 4WWKD 4DVBB 1XIWC 4F9LA 3DETD 3HRZA 3VXUD 3FCTA 1DE4B 5CP3H 4YHYC 3BRFA 4JRXB 1BQUA 2DJ4A 4PJAE 3U6RB 1OOAA 2HFGL 5EOCL 4HZLB 1KNOB 3G6DL 3S34L 3EDFA 4J3VA 3QP3A 4C4KT 2VLRA 7CGTA 2V2WA 4EDXB 3MA9H 5T3XL 3IKCA 2E6QA 1KJ3H 2FCBA 1YY9D 4MCZA 1NMBL 5CUSH 5F8RC 1D5MB 4OFKA 5I1EL 3U9PH 3LB6D 3DNKA 4P2QE 4ELMA 3FOMA 4WU7B 4AQ1B 3G5ZB 1MFDL 4TNWK 5EA0L 3RBSA 3FHQA 4KC3B 5F9JB 1W0WB 4KV5F 2DWDB 5JNYB 3IAQA 1NC2A 1EERB 1B88A 4I0KA 4U1SB 2VDML 1J8KA 1KN2L 4NC1C 1B0RB 3MGAA 5GISL 3RL2A 4CVXA 4M8QB 6CGTA 3KXFE 4XNQB 2DQHH 5ANMA 2X44D 35C8H 3AS3A 4NGHH 4KKNA 1ONQA 4PJ9B 3MUJA 1TCRA 4XCCL 3BZEA 3LKOA 1HSBA 1KCUL 2E9IA 5DJYA 1YYML 1T7YA 2OTUB 4D0DB 1CTOA 5FYJD 2A6DB 4LSTH 2DQEH 5C0BA 5D9SB 1U8IB 3LS4H 1Q0XL 5E03A 2NZ9C 4OZIF 2BXZA 5FM8A 2JB5H 1LILA 3RWIB 1OGAD 4X6CA 4U0RB 1MCJA 1WISA 3CVHA 5KG9A 4YZFF 3RY6A 1OTUD 5AG8A 4YBLC 3TP4A 3ARPA 3QIUA 3KPMA 3WS6A 3D2UD 3A67H 3RX7A 3EOAA 5DVOA 1MH5A 3MJ6A 1AKJB 3T65B 3RY6C 3HAEB 4EBQL 1ZT7B 3O6LH 3O4LE 1RFDL 4OFVA 4KZDH 3WS3A 4MQTB 3VXTA 1YMME 5I18H 4N0YL 1KTDB 4NKDA 4JB9H 1FFRA 3IGAA 4O02H 2IGFH 4KJQC 4HKZA 4MJID 3GSUB 2X7LB 3SE8H 1A7RL 2RBLA 3K2UH 1A4JB 3CMGA 5T1KD 4J8RB 4U0RC 1NJ9A 1MCLA 3RP1A 1T1YB 4KAQL 1F6AA 2HT3D 1VGEH 3PNWA 3IDYC 3HZYB 4ORGA 1FZOB 1LD9A 5H94B 1OWWA 2AI0L 1YEDB 1QSFD 1WZMA 2BK8A 4JRYE 3AS0A 2VWEC 4F7TB 2VDOL 1I9JL 4JLRA 4JPKH 3REWA 3U7WH 4G7YH 4PRHB 4XNMB 4PJHA 1N26A 3WKMH 3TBWB 5FO9B 2X4QB 5EWIH 1ORQB 4KH2A 1TENA 3CXDL 4QRRD 1MFAL 4KWUA 3ARGC 5J6GA 4HDIA 2OZ4L 1T5WA 2P24B 5IIEA 2Y7QA 5LGJA 1BVLA 5C0AD 1TZGH 2WIMA 5JW3H 4KUZH 1T21A 1EIBA 2HFFB 5C8JB 3S37X 1B0GB 4ODXA 4K3JL 1RMFL 3KJ4B 1HH9B 5E8PA 2DLHA 4PTUA 3WDHA 3HNSL 3BFOA 4OGAC 4KHTH 2R56L 1YC8A 2VAAB 3S96A 1W72H 4WVRA 1S3KL 1NLBH 3VFUB 1HQ4B 1H8NA 2G5BB 5HHOD 5DS8B 3DVGB 5I71B 5IM7A 1OM3L 3SDYH 2FD6L 2NY7L 4LPYA 1TTUA 4N8CH 1MIEH 2EC9U 1NCCH 4PPTA 5J56B 4Q2ZB 1P7KA 5I1KH 1DDHB 1P4IH 5ITFA 4KUCF 2JCCB 1XF5A 2CIIB 3NCCB 4XC1L 2LV4A 4HWZB 5CSZB 4XPGL 4CJ0A 2VUOA 2FGWH 4RBPK 1I1YA 4OFIA 5FYJU 5IQ7H 3LKRA 4JAMA 3G6AA 3WLBB 3EOTL 3MYZA 5EU4A 3TO4A 3MRFB 1TJGL 2VISA 4X99A 1G7LB 2EEAA 4Z7UF 4U1IA 1CICB 3RZCB 2QQKL 4AEFA 3EDDA 3ULVE 4OZFA 2BY1A 1N2RB 4GQPH 5HDQL 1AE6L 1WEJH 1WZ1H 1L6ZA 4U31A 1RIUH 3WHXB 4PJEB 4ODHL 3BI9X 3FMGL 2CK2A 4FZ8L 4LDLB 4ZUTA 5C07A 3ZSTA 2A6JB 3EAKA 4X9FA 1RI8A 1MFEH 1JHLH 1Q9OA 2AJVL 4XPAL 2OK0H 2EIDA 4WWKA 3CU7A 3IVKA 4PP1D 4I2XB 3VXUA 4XGZA 1S7TB 3TBTA 3HC0B 1KJ2A 2J88H 2YPKB 4WWKC 3UPRB 5IFJB 3DETC 5DZOA 2DQUL 1QLEH 4U1NB 1F58L 4P2RE 1BLNA 4QF1A 2FX7H 4NQEB 4KRLB 4Q9BA 5DDHB 4HUXB 2VZ1A 3NCFB 2MNUA 5FUZH 5LCVL 1MLBA 3PG2A 3WFCL 1RIHH 2VIRB 4PD4K 1MQ8A 4ODUA 2QKIA 5DHYA 2BHZA 1YY9C 4ZDHA 2F53B 5FYKU 5T3XD 1XGUA 4OZGA 5JOFB 1MREL 1E6JL 3RBGA 2JJTA 1YPZA 4P59H 4AG4L 4HT1L 1V3KA 3DUSB 3O9WD 5AZEL 4K94H 4YIQA 2QEJA 5F7MC 3HUJE 1HI6B 1AJ7L 5C3TA 3LHPL 5HTSA 2YN5A 2QSVA 4AK1A 5MEQA 3MOBH 4X5WA 1OPGH 1MAML 4IDJH 3LMJH 3V95A 2X1WL 3A6CL 3ARXA 3MA7A 3EFFB 2VTFA 2ZOLB 4MX7A 2M8XA 5KJRL 3BKJH 2V9TA 2OI9A 3STLA 5ID0B 4WENB 2XN9B 3PWVA 3KWWB 3OQ3B 2DI7A 4U3CA 5HDBE 2VDNL 1BWWA 5MEOB 1CQKA 1B4RA 4MJ6B 1WIOA 3ZKXB 1NCBL 1NGYA 1VPOL 2GFBA 3AVEA 2OSLA 1XR8A 3D2UA 3P77B 1AQKH 5MENB 3WD5L 5HYQA 3ULUE 4G8EA 4G8GE 1HOCB 4FA8A 4JY6A 4MSWB 5EU6E 3QZWB 3H9SE 5IJVB 5F9OL 4Z0XB 2Z4QB 4MJIA 2WQRA 3VFSA 3E0GA 1KB9J 3FB6B 4QRTA 4Z7QE 2XWBA 4HJJH 4MA8L 2YRLA 4JZJB 1CD1A 1LO3L 4IHOB 1WT5A 3I6LE 4UMGA 5T1KA 2R2BA 3MBXL 3TNNA 3BP4A 4YGVA 4YDLB 3TN0B 2WBWB 3IU4H 2CO7B 4Q6IB 3CDFA 3QUZD 1BMGA 1QSFA 1Z0MA 4I2XE 4RRPA 4TTDC 1GOHA 3UJTH 2BOCB 2VOTA 4PJ8B 2HKHL 3ZHLA 1GC1C 4RWYL 2NXZD 5FGBA 3SDCD 5I19L 1A4KB 4QGTA 4LKCB 4WI2A 4I77L 4K2UH 2C1PB 2ZCLL 2EXYD 2R69L 3Q48A 4TUJA 1LEGB 2LVEA 3OKOA 4UUJA 4QRRA 3PUCA 3UBXI 1FE8L 1QBLL 1SBSH 3I75B 1N6QH 4ISVA 1ZLSH 3B3IB 4JDZB 5C0AA 3WUWB 2IMNA 4RAHA 1W8OA 5BS0B 3SKUD 2VZVA 4NKOB 2IAND 1TNNA 3FB8A 5EZJA 3RIFK 3TN0C 1JZ7A 3RL1B 4M9PA 3S7GA 3RJDA 1OD9A 3SGDI 2PKDA 5B39B 3HN3A 4HPYH 5F97E 4OCXL 4KMTH 1YQVH 5HHOA 4L4VB 5ETUA 2GEEA 1F42A 5D7JB 3MRKA 2R4RL 2R1YB 1MCWM 1J0ZA 4XX1E 4KDTA 4QTIL 5IMMB 3CVIL 5DJCA 4HWUA 3VH8A 2P49B 4IIQB 3P9MA 1L0YA 1OQOA 4FN0A 4R9HA 4RA0C 5BRZE 1QFWH 1T0MA 4F58H 1A22B 5LBSH 3LSOB 3WJLA 4YO0B 2NY4D 1JZ5A 5E99L 5BQ7A 3WIFB 1UJ3A 1Y18A 4MLIA 4JJ5A 4X8XA 2EE3A 4HLJA 4AH2A 1I7TA 3WJLC 5CJOL 4R7NA 3HPLA 4RMRA 2KZWA 1XCTA 3UTQA 2ZZUT 3RWEA 2YEZA 5D7JC 4NJAH 4G9FE 3I02A 2A1WH 3CK0L 4ZTOL 3IDUA 3OKDB 1M05B 1JF1A 3QI9B 1QBML 1A6VL 3BGMA 3OAYK 4GXUN 1X9QA 5E5UB 3MLYL 5TDOA 2B1AH 5DJ2A 5C0GB 1T80A 5DMKB 3MLVL 5A16B 4U1LA 3HR5A 2DD8L 1AGFB 2HT2D 2YS4A 3T2PA 5GRJL 2Q7NA 2N4IA 4PJIB 2BVUA 1OT1A 3MRMB 4LASL 4IRZL 2FX8L 3WXWL 4N9GB 1MPAL 3F6LA 32C2B 1KLGB 3T1FA 2XICA 3TBYB 3L5IA 3D3VB 2F19L 2DWEA 5K59F 4XMLH 1G6VK 4N5ED 2YHGA 4M62L 1U8LB 2E7LC 3QI9C 1XGRB 3GJEB 3BWAB 4QNPF 1HDMA 2OMBA 3BRGC 5IVNA 2ZSWA 1ZGLM 3T3ME 1CFTB 4MD4B 2KUTA 3O9WA 4RX4D 1IBGH 3UDWA 1UXWB 1RK1A 5FUCC 5KVFH 5E8NB 4O58L 1Y6NR 5GGUB 1RZKH 2K9UA 2A9MH 5IROA 4ODVH 5IG7B 3PV6A 3X13A 1T0NA 2EDDA 4W6WB 3N9GL 2F8VA 4UDUA 4ZPVA 5EBMA 4GG8B 1XF2B 1FLTX 1LWRA 4QTHB 5GRVK 2KDGA 4FFEX 3C2SA 3HNVL 5T1DL 4Y1AB 5KS9B 5DQJB 1NGWB 1ZHBB 2YD9A 5GPRA 3ZTNH 1FN4B 1JWMA 3IFPB 4LNVA 4U1JB 2VZ3A 4S1RL 2V17L 2B7DT 4NKIL 4WFEE 1WVZA 3B9KB 3VJ6B 5L8JB 3PL6B 3QDJE 3WEXA 5D7LB 3P4LA 2X1PA 2HWZH 4EN3D 4TOYH 4U1HB 1ZTXL 4M61B 4P5TB 1I9IH 3DURA 4NQTA 3UTTB 3V79C 4H8WH 3HMWH 1U8PA 2IPTL 1FNEB 3E3QC 4FNLL 5F9WC 3VA2C 5F3BB 3QNYB 2IH3A 4OD3H 3MV11 3VGBA 1WWWX 4OD1H 3L5JA 4AENB 3OZ9H 2MJWA 1XEDA 12E8L 1JI1A 2BSRA 4L8SA 1H0DB 1DBAL 1KC5L 3P3YA 1FAIL 1IM3A 3HCVA 6FABH 3TWCL 4NPYA 1ZSDA 4MD5B 3C6LA 3QXDA 5BW7A 3BD5A 4LRIA 1G7PA 1E27B 3L9RB 3VXNA 4EXPX 3L7EA 3LEXB 1OAXL 1MQKL 3TFKD 3B9KC 2DMBA 4R26H 3C6LC 3QUZA 3V5KA 2DYPB 3KR3H 4G80A 5LGHL 3TBSB 4BSVB 1G9MC 1SEBA 3MNZA 1JPFA 3X11A 3MRBB 3TIEA 2R2HA 4KFZC 3VFVB 4JANA 1KN4H 3R8QA 3SDCA 1XF4A 3NA9L 1CXKA 4PJIE 1HQRA 4IJ3B 3U7AA 1J10A 3BQUB 2BRQA 5DEZA 4DQOH 2BY2A 5EBGA 4AJ0A 3GSNA 5I6XB 4RRPG 4LL9A 2EXYC 4XPHH 1UWEL 2FHCA 4JPWH 4PB9L 2JIXD 5EIIB 4K3DL 4OAWA 4DCQA 1QSVA 4NQDB 1HZHL 2Q87A 1HHJB 2IANA 4X6FA 1ZT4B 1T3FA 5JPMB 2AJYL 2EYRB 1UA6L 2MHAB 3P30H 4R97B 5EUOA 2OZ4A 3STZA 1U6AL 4NN5C 1KTRL 3RA7H 1EEZB 1AO7D 1SY6L 1I8KA 1ED3A 5I1AB 5SWSB 4IJ3C 5HJ3B 3OHXA 3G5XA 3GHEH 1L7IH 4I13B 4HWNA 1AY1H 1DBKL 3OKLB 4GAFB 1XF3B 1GL4B 1FGNH 1VFAA 2BVYA 3EBAA 3GB7A 3CSYB 4Y1AE 3LN5B 5D6DA 2A74A 5KS9E 4HGWA 1IAKB 1FJ1A 4PRDB 3QIWC 3ZDZF 3MOAL 5DJAA 3MLUL 2NY5H 2ARWA 5D6DC 3FN0L 2D9CA 1EAPA 5EO9B 1EDQA 5IB2B 4BSWB 1HCVA 4GQ9H 5B22A 1IGIH 3BT2L 5I8OL 3UTTE 1R3HB 3KG5A 1OP9A 4I5BA 4FZEL 4WI3A 3KPOA 4PGEA 4LCIH 1G84A 4PJCA 5E2WH 4LPXA 3D25A 3DV6A 3VFOA 4JHAL 4HK3N 3T2NH 2RCSL 5IVZA 2O61A 2P8MB 5FKAA 3WJJA 4ONFL 5GGQH 1M6OB 3ROLA 1MRDL 1N5YH 5KAQG 3FONA 1YNLL 1KEGL 2OXHA 5IB4B 5K9KB 3QDMB 4IRSD 4CGTA 5GRVL 1RZ7L 3OR7B 5IMKB 1LP9A 2EE9A 1FNAA 5EO0B 2YXMA 2OCFD 3ULVL 5SV3A 1ZOXA 2IBBA 1OGTA 1T2JA 2X1XR 4FQLH 4WHCA 1FSKB 3BHBB 3SGKA 3RWHA 3T77A 4X5LA 1R3KB 4YDVA 1NDMB 4RMQA 3QQ3B 4MMZC 5C0IB 4BA8A 1RZFL 3GMQB 5E1AB 2FEDD 3NFNB 2L4OA 4MQSB 1ZANH 2QBWA 1OW0C 2DQJL 2X4RA 5LXGL 1EV2E 4HIXH 4JFFD 4N5EA 2IH1A 3FTGB 3KNBB 3QEGL 1AR2A 3O6ML 1EUUA 3FFDB 1MFBL 3H9HB 3VFRA 3IDNA 1QRNB 3GSXB 3SDDC 4NQDE 1MVFA 4RX4A 2AAVA 1JFQL 4NUJA 4LKXA 4QHKI 3K4DA 1NCWH 3QG6B 1BJ8A 1HILB 1KIRB 2XA8H 1AD0A 4EOWH 4JN1L 1FSKC 1CLYL 1YEEL 2PF6A 2VLJB 1BX2B 1FCGA 3QEQE 1U91A 1YEGH 4LDEB 5SWSE 4F7PB 5C0FB 2J8UE 1IGMH 2ADIA 1KSRA 1QYGL 3PWPE 3U4BH 4K7FA 4DZBB 5DQDH 5BVJB 3VW3L 4ZFOL 3U46A 1B4JL 2ZUTA 4F7MB 1WTGT 1M71B 3UJIH 1P6AB 4KK8C 4ONHB 5I1IL 2ZUXA 3O4OB 4EN3A 3RTQD 2APXA 3GRWL 1JYVA 4XBGA 1AP2B 5F72S 3AAZA 3IJHB 3KXFD 5D5MB 1OP5H 1CLOH 4JCLA 1HXYA 3NCYS 1GZPB 3RHWK 3RPIA 4XHJC 1J7VR 4DGYL 1OCWH 1J12A 3G5VB 3NZ8B 3BKMH 5BZWB 4LLMB 2EH8H 1VFMA 1XCQB 3PDOB 5E2UL 5H35A 3ULUL 3MGOB 3MUGB 4G6KH 4YXLH 5I1LA 1INEL 2Q86B 5J13B 3HE7B 4APQC 5C9JB 3TFKA 3EYUH 3S97C 5E8EA 4LSRL 4S1QL 4WIQA 1K8DB 1N7ML 4ERSH 3BP6A 3D5OF 2VXTH 1H3PH 3ZDXE 2XFXA 1GOFA 1NUFA 1X5ZA 3AREC 3O4LD 4LFHG 4UINH 1OAZL 3BGAA 5TE7H 3U0WH 3VXOB 3T0VA 2DQCH 1A6PA 4OLEA 5E08H 3T04D 4M7LH 1EH9A 3BN9D 1PFCA 2QQLH 3MA9L 5I15H 2BX5A 5AD0A 2V9QA 1KPRA 2YZ1A 5CUSL 2PNDA 1X4XA 1I1CA 4DVRH 2QADB 3FT4B 2JIXA 2IMMA 3FN3A 2P7TB 4M7JH 1FL3B 4F33A 5IB5A 3KPPA 1RSFA 1XF1A 4NUGH 2OR9H 1RJYB 2Z8RA 3SDAB 1N8ZB 3HE7C 4P23B 3X12A 3LQZA 4GOSA 4XWOD 3GMMA 1DTUA 4L8DA 5L7XH 4JRYD 3UTPE 5A2LH 4UAOC 1AO7A 4RMUA 2DQHL 4HLZH 3DWTA 3IF1A 1P1ZB 5FKPB 35C8L 4BZ2L 2OP4H 4X80H 4NGHL 2XY2A 3TT3H 4NFCA 3ALPA 4L8CA 1GGIH 1UM5H 4OSUH 1LE5A 4FXGB 1U8QA 4XNXH 4O00A 3LS4L 1MWAH 1RIVH 3DXAB 4ODTH 4ONGH 2DICA 4KKLC 3QUXB 3GIZH 1R3LA 4P23C 2EIEA 4BKLB 3UO1H 3A67L 1S5IL 3O6FD 4XVUD 3BPCB 5F6HI 1DBJL 4MQXC 3O6LL 3G6JE 4ZO7A 4KZDL 5BZDA 5JXED 5CGYC 4DWHA 5B4MD 2NLJA 4KXZI 5I18L 3HG1B 4IOFD 4JREB 2CJUH 2IGFL 1P84J 5I1CL 3V6FA 3WMSA 2X70B 5KSVA 1K4DB 4RA3A 2LABA 3SE8L 4Y4FC 3GMLA 2HKFH 3K2UL 4ELMF 1JZ6A 4IRSA 2X4NA 2R2EB 1R5VB 2ATKB 3KPNA 5J1AA 1T2QH 1C5BL 3QCUL 3MRCB 4CKVX 3OBAA 4IRSC 3ZKMC 4M4RA 5FOBB 1CGSH 3T0EE 5DMIH 3O45A 4M48H 5EOQH 4M1GL 1A21A 4XPTH 2YKLH 4ZUWB 5E6IB 1B6DA 4G7YL 5JXAH 1AXTL 5F7HA 2O93L 3P4MB 5J57B 3WKML 1DFBH 3SJVE 4WW2B 4HJ0D 3Q6GL 5EWIL 4GW5A 4HQQH 5DD0H 3RU8H 2H32A 3MBED 5GS0C 3H7BA 4JFFA 4BZ1H 3L1OL 4X98A 2YRPA 3LEYH 3I3DA 4O51B 1H5BB 5GIRB 4J3WA 1TZGL 5JW3L 4S1DC 4QRUA 3NTCH 3QO0B 4JQXA 4PJ7A 4X6CF 3V5HA 1I8IB 2L7UA 4DFHA 2UWEB 5DA4A 4PP2A 4PJAA 4KHTL 4X8JB 4U1MA 3GSQB 4PR5A 1IEAB 1W72L 3HZMB 5E00B 4WFFE 1NLBL 4P2RD 3D69B 2EXWC 2KH2B 1KT2B 4LVHB 1BIHA 2NR6D 1VEOA 2V7NA 2JLLA 4WW2C 3SDYL 2EYSB 3RY5A 4Z76A 4N1CA 1NCCL 1SJEA 4NQXB 2VSCA 5I1KL 4JGJA 1SJHB 1P4IL 3C08H 3FQNB 5EIVA 3OKNA 3QWQB 1BZQK 4BSJA 1Z9SA 5DMJB 3QSKB 3DXAE 4HH9A 3RTQA 1F11A 2RB8A 1UACL 1MCPL 1FNLA 2BDNL 3ES6A 1JMXA 2AXHA 2FGWL 4LBEA 4M5ZL 5A1AA 1VHPA 4XNYH 5IQ7L 1MVUB 5JA8B 3KXFA 4F37K 1XH3B 3RTQC 4OZHE 1TETL 5CEYA 1Y6KR 1KB9K 3PWJB 4MZ2A 1RHFA 3IAGC 4HS8H 5DK2A 1EEYB 3FKUS 4PJHF 4LLVA 3SDXE 5JLZB 1LQVA 5C0EA 2DMCA 1YY8A 1DBMH 3JWDL 3FT2B 4E41E 1WEJL 1UG9A 1U8HA 2GY7B 3JWOH 3CZJA 1FYHB 1FH5L 2UZIH 3KPQB 1ORSB 1CD0A 2DLFL 1FO0H 1ITBB 4WHTA 1Q94B 2P8LB 5M94B 4HX1B 2CSPA 4C58B 3M17A 1MFEL 1NAMB 1S9WB 2FBJH 3V0AC 2OK0L 4RWHA 3NFSH 2BNRE 3F5WA 4HIHB 3T08A 1S7QB 1AD9A 3MRGB 3ULUD 5AUMA 4G8GD 1LNUA 5GJSH 1E4KC 2YBRB 2DIBA 1IJ9A 3O4LA 1B9ZA 2J88L 5GZOC 1CGXA 2CK0H 4QY8A 3UTSE 5EU6D 3H9SD 1QLEL 4M00A 1XGQA 1MUJA 5I1JL 1G7HB 4EVNA 5IBLC 1FFNA 1G7IB 1CICD 1VESA 1E4XH 1TJHH 3D18A 2OX5A 4F3FB 3QQ4B 3WFHA 5DQ9B 3QXAA 3QFDA 1JN6B 3L6FA 2G2RB 4UIKH 1D5ZA 5ESAB 1TZIA 1G7JA 3I6LD 4GXVH 4Q9QH 4HHAA 4HIIB 5IHUL 3E8UH 5DYOB 5HGGS 3VXPA 3GIVB 3BYTA 5DT1L 2EDTA 2YA0A 4P59L 4KRNA 4ZUSB 1MWAB 4JRYA 4K94L 2UWEE 2FR4A 4MXQD 5B8CB 3MOBL 4HZLA 1NUNB 1RZ8B 1KNOA 4IDJL 4M7KL 3WFEH 4MA1C 4RFEA 3MTRA 4FTVB 4XC3H 3QCVH 4XVJL 4D8PB 4YHPB 4ETQB 2EZ0D 4JO4H 1OSPH 3BPLC 1D5MA 1JI2A 1SY6A 2ZNWA 1D9KD 3FQXA 4B50A 2RGSA 5DMYA 5L9DH 4J7RA 4ALAL 2CIKA 5D4QA 2Z35B 1IZJA 1DQMH 5FB8B 1KIQB 1PG7L 1MLCB 4JKPH 1NUGA 3DVNB 3UMTA 3O6FA 3L3KB 3LVEA 4LSUL 4YGAB 4LPWA 5DD3H 5B8CC 3EZJB 1CK0L 3RWGA 5JXEA 1QO3B 3O3BB 1A6ZB 1PVHA 3HB3C 4XT1C 4XRCB 3DO7B 2YK1L 3BEWB 1PKQB 4MS8C 1EUTA 5FOJA 2OTUA 5GRWA 5B4MC 3S5LG 3RQ3A 4ZFGH 2ICWJ 4LCUA 3O3DB 4KTEH 2UYLA 3GNMH 2JB6B 4NNXB 3RWIA 5BMFL 3GI9H 4I3GA 1GZQB 2Z8SA 3ARSA 5D1XD 1HNGA 4GAYA 3IU4L 5GGRA 5LG1A 3PWLB 2IQ9L 4OZGF 3V5DA 4HBQA 1YPZF 4PJ5E 4UNVA 3UJTL 4DKAA 1FRGL 3HAEA 5I2IB 5DVKA 4JFHD 3TA3B 3LRSA 3TZVD 1YUHB 3ZL4H 2CDGB 2ZUWA 4ZTPL 2GSIA 5E9DB 4K2UL 4EI5C 5C0DB 3ZE1F 1LK2B 4G9FD 3MBEA 3H0TB 2H3NB 1J1PH 1FVCA 1NBYB 1OTTD 1Q8MA 1SBSL 3C5ZB 2X7LA 1ZLSL 3ULVC 4XXDB 3O0RH 4PJDE 3QXVA 5I75C 1DBBL 4J8RA 1EBAA 3BYYA 4GXUM 2WSKA 2ORBH 1WFTA 3DBXA 4JM2D 2F5AL 4KKBC 5AZ2H 4GKSB 2HVKA 1KBGL 4WU5B 1EEUA 1YEHL 4M93C 1NGQL 3GO1L 5F7LB 4HPYL 4P2RA 4QRSA 1RZGB 1YQVL 4PJ8D 4X6DE 4XNMA 3TA3C 4U7KA 2RAMA 2CLVA 1ORQA 4LAQH 2PW2A 3ARYA 5DUMH 3S6CA 5I1GH 4RGMB 1S9XA 5JMRA 2P24A 1PX4A 5L8LB 2ADFH 3C5ZC 1XT5A 4K8RC 4N8VA 1QFWL 3WLWD 1WCQA 3C60B 5C8JA 5J12B 5LBSL 5D70H 5DO2C 1S9YA 4U6XB 5ENWB 1TITA 3HUJA 2VDQH 2MTPA 3MACL 4WUUB 5CIPA 5I30H 2VAAA 3SOBH 4U6VH 1I1RA 4N0UE 1AHWC 1MNUL 2OMNA 1HQ4A 2G5BA 5DS8A 3GRWA 2C3VA 4FHBD 3EUUA 2VE6B 4M5YH 1OAKH 5HYSB 1MJ8H 2BSED 1T7XA 2A1WL 1X44A 3QA3B 2NQCA 2VN7A 1PKQE 4PGBB 1A1OB 4F8TA 5JIPA 1EO8H 5HHPB 1PEZA 4LU5L 3L5WA 5BVPL 1BIIA 4YDKH 4ZQKB 5JHDB 3RY4A 1SQ2N 1WWCA 2G9HB 3QDJD 3W0WB 2B1AL 3ME0A 4HWZA 3TVMD 1X5GA 5CBEA 1FDLH 3GSRA 3MLXH 3C60C 3MRHB 4I3SH 3X14B 4WO4C 4G8GA 4JZNB 1MHHA 3UYRL 2OM5A 3TESA 1NLDL 3WLBA 2R0KH 5EU6A 1JJUA 3KDMB 3H9SA 4P2CG 3MRFA 2WZPD 3U1SH 1CICA 4J1UA 5DJ8B 1FYTB 3O41B 5E9DE 4JVPA 2IALB 4F80A 4NZRH 2LQRA 3VMOA 3M8OL 5CINH 2FEEL 5FO8A 1UB6B 5DI8A 4KQ3L 5HDOA 1VADB 2I24N 1IC4L 1WF5A 2W0KA 1IBGL 1SJXA 2KQNA 4I2XA 5DEGB 5HVGB 4MXQA 43C9A 3NABH 2A9ML 5EU7E 4ODVL 4BFIA 4P4KC 5I8KH 1UT9A 1YEJH 1U8MB 3SCMA 4MXQC 2B4CL 5KAQF 1KPUA 3GKZA 1CL7H 1U3HB 1MRFH 5D71H 1II4E 2HJKB 2NX5E 1IGTB 1HYRC 3SCMC 1D9KA 4YFEA 3D3VD 3ZTNL 2R9HD 3BP7B 4NZTL 2XTJE 3U0TB 4NZUH 3V6OC 3BIKA 4IMLB 5IFHH 2HWZL 4TOYL 3BH8B 4JVWA 3MZGB 5T1LD 1RJZA 1I9IL 5HVFB 4H8WL 3VD9A 4WUUE 4XCEB 3M45A 2Z8VC 3H3KA 1AI1L 3GGWA 2YA2A 4RGOH 3JBG7 1X5IA 3OZ9L 4R3SB 1WQVT 5F6IB 1U3HC 5ESVB 3CXHJ 4X6EB 4OI8A 4G3YH 1T89A 5T3ZH 4KKAD 4Y1AD 5TQ0L 2AXGB 5I66B 5BRZA 4NC2B 1F00I 2C1OB 5MEOA 4OKVA 2J5LB 3E6FB 4F9PA 5D1XA 2CKBB 3PL6D 3HPJB 3KR3L 4PRIE 1F4AA 3P77A 1ZLWH 3NN8A 4LGPB 3VFGL 4E42B 4CUCA 3UTTD 2GTWB 2E9JA 4N0RA 3TZVA 1NEZB 1GGUA 3QZWA 4OCLC 2D9QB 4G9FA 1DR9A 3IXAB 4TPRL 3RVWD 1H3UA 2Z4QA 4FFYH 4DQOL 2YUVA 3TZVC 4AIZA 1R5IB 3SQOH 5JZ7C 3HA0A 3ETBF 4JZJA 3HAEG 4E5XA 2D0GA 3ARFD 1A9EB 1H3GA 1A5FH 1BPVA 1YN6B 1OP5K 2GW5A 4H0IA 4KI1A 4C83A 3LRGA 1OAYL 3P30L 1JYWA 3IJSB 4JM2A 4Q6IA 5TJWK 1JGVL 5GHWL 3CFJB 1QUNA 3W5MA 3AU1A 3B6SB 4OD2B 2ERJB 3ARRA 2NPLX 3CC5A 3F62A 3KYKH 3RVVD 3SKOB 3BQUD 1XZ0B 1L7IL 1AY1L 2QSCH 1S78D 1W72A 5IEHB 4KRPB 5FCUH 2B39A 4JDZA 4Z7OE 5E7BA 4PGCB 4PYHA 5D7KD 1I7UB 1IAIH 4NQDD 2I9LB 3AXLA 3LZFL 3WLWC 3KPRB 1YYLL 5FV1L 5KSAC 5DZLA 3UAJC 1IGIL 2Q8BL 2R23B 5DUBA 5C2BL 2FB4H 1FZKA 1JGEA 1HYSD 2VLKB 3QEQD 3GBML 5SWSD 3MV9E 2R1YA 4MXWL 2BJML 1QLRB 4PUBH 1T20B 1LGVA 3LKSB 3PWPD 5IMMA 3RUGB 4LCCA 5TGBA 4IIQA 4MNGE 1QKZL 3W11D 1IQDB 1S7UB 3IKKA 5CP7B 1DQLH 3QDJA 4WUKL 1FAKT 3TVMA 5E6YA 3O8XD 3GMNB 2VDRH 1W0VB 2AVGA 1K5NA 4JY4B 4MB4A 2F9BT 3S8WA 1GGBH 1DQDH 3WIFA 5KSBB 5EUOF 4CMMA 4FQLL 5J89A 3DO3A 3JWDC 3NACH 1A2YB 2Q1EA 3FT3B 5C09B 5DJXA 1HIML 4DGVL 3OGOE 5CJXA 2X4TB 1ZANL 3IU3A 3PHQB 1TNMA 3FQUB 4KJYA 4G6AD 3Q2CA 4OLUH 5CJXC 3OKDA 1M05A 3V8CA 5SX4I 3HLAB 5HHMB 4OT1H 1JNHB 3T0XA 1KLUB 1CU4H 3CZFB 5F88B 1I9RH 4YXHH 5C0GA 4P3DA 4ZFZB 4RCAA 4LVEA 5GGVL 2P46B 5DMKA 5A16A 1XGTB 3FN9A 3C5SB 1NMCB 2FSEB 5JQ6H 1MCSA 2XA8L 3MRDB 4EOWL 4PJIA 4G6FD 5DD1H 3MCLH 3EHBD 5INDB 1YEGL 1KLGA 3BE1H 4WEBH 4ELKB 1DLHB 4TNWF 3WBDA 3D3VA 4Y2DC 5DQDL 1TVBA 4GLRI 5DVMA 2BHUA 3C9NA 4HFWB 1U8LA 3CFKB 1CDBA 5JW4N 1T6VN 4J12A 4WFGE 1A7OH 3T0DA 1GGYA 1LO4H 2VQ1B 2R0WL 1OTSD 4MD4A 3O6KH 4F2MA 1XMWA 4XNZB 5T1LA 3ARBB 3BDYL 5E8NA 1AGDA 1LP9F 3UTPD 1U36A 1P2CB 4PRPB 1PG7X 1NMCC 2P8PB 2NMSA 1R5WB 1P84K 3LN9A 3P4OB 1Q72L 3U82B 1OCWL 3IB4A 3SKNA 4GG8A 2ARJQ 4BFBD 3MO1B 3DLQR 1EA9C 2EH8L 4S1SH 2BVQB 4Y1AA 5E70A 4OM1H 4PJXB 4TSAH 5KS9A 1I3VA 4XBEL 1ZHBA 4G8FB 1CFNA 1CDJA 4YXLL 1IT9H 2AV7B 4U1JA 4LPUA 4YHMH 3TPUB 4XX1G 1G7MA 4KKAC 4NQSB 4P46D 4X0KB 3VJ6A 3PL6A 5K33A 3IFNH 3S36H 1P9MC 1SJVA 4RNRA 3QHTC 4XNZC 4ERSL 3UTTA 2VXTL 5EBLA 1H3PL 1JWUA 3W5NA 4YHZL 4QHMB 5TE7L 5HI5D 3T3PE 3U0WL 4UDTA 5HYIA 2DQCL 4N0FA 4NOFA 1FFPA 2FIKA 5ALBH 5E08L 1NUDA 4M7LL 4I0CC 2QQLL 2IBGA 4BZYA 3CDGB 2FH6A 5I15L 3MNWA 1G1CA 2DQTH 4DVRL 2FYYB 2WUBL 3RNKA 3ARFA 4MD5A 4M7JL 3QZWG 1V7MH 5HHME 1MRCH 2OR9L 4PRBA 3SPVA 5CCKH 2PXYB 3ARFC 1WBYB 1WLHA 1P4LA 3NVQA 2XKNB 4XZUB 4GSDH 3MJ7A 2GJ6B 3T0ED 2X4PA 2VC2H 3TBSA 3ZYIA 1X5YA 3LQAC 3HKFA 1X7QA 2JK5A 2GJJA 5L7XL 3NIFF 5FM5M 4Z7VE 2A6IA 3S88H 4PG9B 15C8H 4H20H 3SJVD 2OP4L 4X80L 4HG4J 3TT3L 3L3IB 5E8OA 5IFAL 3BQUA 3NIDF 1GGIL 3I6GB 1UM5L 3O3EB 4NRXA 3NPZB 4OSUL 3MC0A 2O5ZH 1PSKH 4XNXL 1TCMA 1HEZB 4OGYH 4XCYA 3RIAF 4XWGL 2V2XB 4CVZB 2HG5A 2QADD 1INQB 2PW1B 5EIIA 4GRMB 5DHVB 4UILL 1UZ8B 4NQDA 1S9VA 1HHJA 4K71B 2XKUA 3FQWB 1KGCE 3U9UA 2MHAA 1E28B 3SDAD 3GFUA 1Z5LB 2PXYC 5J1TC 1BD2B 2AK4E 5K9OA 2HLAA 3UO1L 3DRQB 4UQ3B 4WFFD 3O2WL 3QUMH 4HKBB 2C7UB 1RZJH 5I1AA 1RK0B 1KJMB 3QEQA 2X4UA 4ORZC 5SWSA 2DBLH 2J8UA 4YAQB 2B20A 1URLA 3PWPA 2JJSC 4RSVA 5DTFB 4ZD3H 2R4SL 2AXFA 4H5SA 3MREA 2BVPA 3ZO0A 2IADB 1UB5B 1BJ1H 1QZ1A 4LF3A 1C5DB 3HI5H 3DXAD 2M1KA 3O8XA 1T2QL 3WIHH 3QUYB 3QUXD 5F3BA 5IR1B 1EHAA 5FYKH 3PGDB 1CGSL 4H0HB 4OTXH 3RVXD 3TJHD 5EOQL 2O5XH 2YKLL 1RV6X 4Z5RB 1R3HA 3W9DA 1DUZB 5JXAL 1GXEA 3QIBD 5F1OB 5I9QC 2Z9TA 3LOWA 4HQQL 4PREB 4JGMA 1B2WH 4KMLB 2GK0B 4E41D 4PY7B 1KIUA 4YX2H 2GTZA 3NAAL 3V52L 3LEYL 1M6OA 3U36B 1IC7L 3GSVA 4G6AC 5J9PB 3BKYH 4NT6B 2WLYA 1SMOA 4DTGH 3QG7L 1EGJH 3OR7A 4HUVA 2BNRD 1N3NA 1QP1A 3BO8A 5EO0A 3TCLA 5A2IH 3P9LA 4YHKH 2V7HA 1S9KC 2D7TH 4L9LB 5H37G 3UTSD 3BHBA 4OM0H 1KACB 2Z92A 4LLAA 4Y7MA 4AEEA 1NDMA 5E6ID 3QQ3A 2PTTA 5C0IA 5E1AA 5F7DB 4HXAH 4MNHB 3IAPA 4X4YB 2PETA 4UT7H 5DRZA 1N64H 4OCYH 3KNBA 4PV8A 5GSRB 2CXGA 3PXJA 3C08L 3GSXA 1OP3K 4OZIB 1T1ZA 4M6OH 1M7IB 4LLQB 5CLWA 1O7VA 2B4CC 4POZD 2VXSL 3MV7B 4XNYL 2H8PB 5CMAB 2NTSP 3QG6A 4QCIB 4CNIB 4Z0BL 2F8XC 1HILA 3DUUB 3UZVB 4C55A 1PLGH 4QGYA 1UWGH 4HS8L 4YHOH 1BX2A 3MFFB 1U93A 1R24B 5C0FA 2C5DC 4NRZA 1DBML 3D39B 3JWOL 5D7IE 5F1SA 3W9EB 4ACPA 2UZIL 5TQ2H 1FO0L 4X4ME 1VGKA 4P46A 4FQJL 4L3CB 1E4WL 2GAZB 3UTOA 1FPTH 2ED9A 2HT4D 2CMRL 3HRPA 4PJ7F 1DN2A 3U2SB 3BSZL 2R8SH 3BDBA 4EIGB 1VFBB 3G6JA 4PJAF 5GGSY 1JGDB 1NC4D 1GZPA 2CK0L 5DMGD 2EKSA 2BHYA 4C56B 3Q5YA 2H1PH 3T8XB 2AJUL 3DSFH 4I48A 1LO5B 1E4XL 1NBZA 3NZ8A 1TJHL 2FO1A 1PZ5B 4NWUL 2X6MA 1BBJA 3ALXA 4LLMA 1QLFB 3PDOA 2PO6B 4HJGB 4UIKL 5CZXD 1RUKH 3MUGA 3QRFM 3MR9B 4UBDC 2Y5EA 1QOKA 4Q9QL 3MSPA 4XI5D 4JFEE 3E8UL 3UCRA 3LIZL 4EJ1C 1M7DB 3FZUD 3UJJH 2FJFB 4K9EC 4IS6A 4PBWD 3T0EA 1NCTA 3MV8B 3IFLH 1NFIA 1EZVX 4HKXA 4G8IB 4ZFFA 3C8DA 5EOTB 4UZGA 4O2EB 3SJVA 3GJFB 3THML 3OJ2C 1I8LC 1TLKA 3DGCR 1UKQA 3QCVL 4XC3L 5FECA 5HGBA 1A02N 2H26A 4HIJB 4TSBL 4KJPC 4KK6D 4PLNC 4Z95H 4YEFA 5H8DA 3QUMB 2XI9A 1YEIH 3FT4A 5GGRY 5E1HB 1U0QA 1FC1A 2PO6C 2YPVH 2ZCHL 2H2PD 1FL3A 2BOBB 2WBJA 3L7FB 2Z93B 3IDMA 3WNKA 3RIFF 3SDAA 3MCG1 1CXIA 3P0YH 3SKJH 4LAJH 4NDMA 4R0LB 2V5MA 3DMMC 2WBJC 3MLRH 1ZGLP 1EBPA 3MV7E 2R1XB 3G04B 3VXSB 5EC1A 5ERWB 3GBNH 1P1ZA 3MRRA 2XNAB 3FRUB 4Z7UB 4YJZL 1UVQB 4NO3A 2XQBL 5E2TH 2FZ3B 3I6KA 1T03L 4GO6B 5EN2B 3K80A 5EO1A 5ACZB 4XP6L 3C09C 1I3UA 3MRPA 3GNML 4QHNB 1HH6B 3DXAA 2LU4A 5HGAA 3SGDH 3EYFA 4KJWC 5GXBB 1T66D 4FQQB 2V5SA 2OQJA 3QUXA 4OZHA 1BGXH 3TJHA 5GS1C 3BPCA 4ZMAT 3SEPA 3QIBA 2PYFA 3VXRB 3LD8C 5I73C 3SDXA 4I0PB 2A9NL 3MRLB 3PIQB 1FNSL 2R0LL 4E41A 1J1PL 4CDGC 3QIBC 5JR1H 4POUB 4KZEL 3F58H 5KZCB 2E27L 1OLLA 5FYJE 3W2DH 4NNYB 5E94A 4OQTL 5TE6L 2BNQE 3O0RL 1QVOB 4OLZH 2HH0H 4O2CB 5L2JB 3CFDA 4NOBA 2IEPA 2R2EA 1R5VA 2ATKA 1OGAE 4LEXH 2BNRA 2OL3L 3OGCB 5C0ND 3T2OA 2EDWA 2ORBL 1GAFH 3QULB 5B21A 3VXQA 4O9HH 3GMRB 5AZ2L 2NW3A 4G6JH 1YQ2A 4NJ9L 1OLZA 3QT2A 4X6BA 3UTSA 4AM0A 5DXWA 4M43L 4ZUWA 5E6IA 4Y89A 2EH7H 1W2KT 1NDGB 3P4MA 5EUKB 4OV5B 5E9DD 3T4YA 1KUMA 4I0PC 4LAQL 1TQCB 5CBAA 4M8VA 4O5LL 4ESKA 3VRIB 1CBVH 4Y5YC 2XG4A 5I1GL 2DIJA 5EG6C 4XCNA 1KB5H 4NQCE 3FB7A 2ADFL 5FV2A 1ZLWK 5L2KE 4G42A 3V4PH 2GITB 5A2KH 2ZG2A 3QO0A 1JV5B 1I8IA 5CSBA 1N0XL 1KF9B 3L3HB 2UWEA 3NCJH 1KJVB 2W0LA 2VDQL 1K2DB 3H42H 1CIDA 3NIGE 4WV1B 4XB8A 3QQ9C 3LH2H 3LPGA 1HKLH 4R2GB 1IEAA 4OKDA 3AC0A 3M1BB 5E00A 5EU3B 4RGNB 3VRJA 1WBZA 3CXHK 4IMKC 4KY1H 4H1LH 1FL5B 2XPGA 2DI9A 3FOLB 1YMHB 2NX5D 4M5YL 4ODSH 5FYKE 3ULVF 2ZKHL 2ZWLT 4NQXA 1J87A 1EHNA 4DN4H 2D31A 4HS3B 4QRRE 5FYLH 4X4XA 5IHBA 4AIOA 3JSSA 4YDKL 1CI5A 3FQNA 5IUSA 5IW3A 3HZVB 1UADC 4LVOB 5C0AE 3RAJH 1J86A 2UV3A 1FDLL 1VFUA 3MLXL 1CF8L 3VFTB 1SM3H 2AEWA 3D85D 2W0PA 1BVKB 4WUUD 2DLIA 1NC4A 2R0KL 5JORA 4LVNC 4QT5B 3CMOH 1I3RB 3HE6B 3U1SL 3MJ9H 2B8OT 4NQVB 1HSAB 3VXRE 5ICZB 4OIIH 5D2LE 1D5BB 3BZDA 2MOVA 5DMGC 1PW3A 4MA3B 3MPCA 3BIBX 5HI3C 3KPQA 1F4WH 4WW1B 1ORSA 4DEPC 5E7FA 1VSCA 1OF2B 5B38B 5DFWH 4HX1A 1Q9KB 4ZUVB 3VGHA 4JQIH 3EO9H 4PRID 1HXMB 4DUVA 5CD5D 3K3QA 4PJ5A 5HPMB 1I7ZB 4HIHA 1S7QA 2MQCA 3FQRB 5HSFA 2X2YA 3HUJF 3NABL 3IDIB 2FO4B 4C59B 4DK3A 5I8KL 1YEJL 4ZXBC 1EJOH 1RPQA 5I76A 2ZSVB 5ACMA 1G0DA 1CL7L 1KCSL 1MRFL 1N5AA 4KKCC 3PDGA 3BEVB 1FYTD 3AMLA 3PF2A 4MDIA 3QHZL 5IKCB 1AXSA 1RZIA 5DQ9A 1JN6A 5ESAA 4IM8A 1M4KA 2YD1A 5HDBF 4EUPB 1IKFH 4HIIA 2NTFA 4Y16B 1OAQH 5LWYH 5KOMC 1G9NC 4NZUL 3TNMB 2H2PC 5IFHL 4K7PH 4LSVH 3QDGB 4O2FA 4XCFH 4XP5H 2X4SA 3MLPA 2M2DA 3ULUF 4X6DA 2IAMB 2X4OB 3HC3L 4R4ND 3VD4A 1G6RB 1RU9L 2LAGB 4RGOL 3KJ6H 2DTML 3P0VH 2FJHA 3CUPB 2LTQB 3VE0A 2IPKB 4HV8B 4QRQB 4XTRD 4I18B 4Z7QF 4G3YL 1T4KB 3ZE2E 1WWAX 3WN5A 4ZPTB 4AMKL 2VB5A 1JGUL 4Y5VC 3O81A 5HHXL 4XH2B 2W38A 1JIBA 4ZAKD 3I9GL 3JVGC 3VU2A 5F96L 3VD7A 3DVNA 4Y4HD 1T66C 1S5HB 4N0UA 3L3KA 4EKXA 3GM8A 3RDTC 2IAMC 4KGLA 3IDJA 3Q3GA 4PGZA 4PY8J 3U4EB 1QO3A 3K8MA 4UI2A 5K9QG 2F8OA 1ZVYA 5IWLA 1XGYL 5D1ZD 1PKQA 2LTQC 2HFTA 3SQOL 1FHGA 1HHIB 3JTSA 4QHLB 5IHLB 1ACZA 4I18C 4G7VL 5IGXH 2DIAA 4OCRH 5EZIH 1A5FL 5F7WC 3AUVA 4NNXA 1BAFL 3H8NA 5C08E 3N85H 1GZQA 1IE5A 3QH3A 1EJ6A 4WDIA 1KB5B 5J0BA 1RUAH 3S3JA 5JPNB 3D48R 4NHUE 5C0NC 1CGWA 4XVTH 1ZT1A 4LHQB 1SYSA 2CDGA 2QQNH 5E9DA 3KYKL 1ZA6B 5C0DA 1LK2A 4FG6D 5KVDL 1AGBB 3H0TA 4EDWH 2ATPA 4LLWB 5C6TL 2QSCL 3MFGB 3KPLA 1IGYB 4Y4KD 5TDNB 3B5HA 1R3JB 2H6PA 4H1LB 4XXDA 4S2SB 3HI1A 2W0FB 1V3LA 5HGDB 1IAIL 1A0QL 1CDYA 4PLOB 5J6HB 3Q6FA 2CGRH 1NFDE 4H25B 1WV7T 4GBXB 2R29L 3MLTA 4X7EC 4JEGB 4MDJB 1MY7A 1FFQA 4NCC2 1YDPA 3EDJA 3QDGE 4OQ1A 4WU5A 5C3LD 4JM4L 1RZGA 2HN7B 3WIIL 1H3XA 5EU7C 4XXCC 4HBCH 5DFVD 1HHKB 3DX9B 3FO9A 3VWKC 2EDOA 2NX5A 3KLHC 1FIEA 4S0TD 4XP1H 3VFPA 5L88H 4PUBL 4J3TA 5ADOL 4RAVB 5IEKA 3X3GL 5E4EC 2F54B 1ND0B 4F57H 1S7RB 4CRPA 5FO7B 2XRAH 4KRPD 1QSEB 4WFGD 4QHUA 1DQLL 1IC1A 1UFUA 1T1WA 3LN4B 4U2ZA 1A6TA 3DTXB 1J88A 1E4JA 3REVA 5TDPB 4RMWA 5SX5H 5JW4M 2DBJA 4LHUB 3O2VH 2XTJC 2W60B 4MWFA 4GBXC 3D85A 4ZS6C 3VFNB 3KPRD 1FO0A 4WUUA 3RHWF 3OJMB 4JM2F 5D8JH 5SWZE 1J1OH 4HPOL 1BQHA 2DQIH 3NACL 3RGVD 4A6YH 5FGCB 5F3HA 1ZS8B 5HHNB 2MCPH 4JFYA 2VE6A 2APVA 2VXUL 3QA3A 5J3HC 4RZCB 2HLFD 4GMTH 4OF7A 5EU5A 4FQHA 1YJDL 3ILPA 2Y9RT 2ESVB 1MHCA 1A3RH 3NZHH 4MGXA 5M95B 1HHHB 1I9RL 4YXHL 3OKMB 3F7VA 2IFFH 4PRIA 3T3MF 4KI5E 3MRHA 3X14A 3VXMB 3X3FH 4IRJB 5HYJB 4HG4K 3C5JB 4NO5B 1R3IH 4NBYB 3P2TA 2DKUA 2YWYA 3KDMA 2BFVL 1JPSL 3DRTA 5DD1L 3F12A 5FA3A 5C09D 1C12A 3MCLL 4ZS7L 3PDDA 2MPAH 1FYTA 2H2SD 5ELIA 4XBPB 1G0YR 4PJCE 3IRPX 4MA7L 1VKXB 4WEBL 1JNNH 1NL0H 3MXVH 3U79A 2WINB 4FABH 4MXVE 3T4AB 2AJSH 2AJZB 5HHMD 4ZSOB 4WCYH 1A7OL 2XZQH 4X4ZA 3SGEI 5ID1B 1CGTA 5F8QC 3VFMA 4U6YB 3X17A 3O6KL 5ACLA 4HLZG 5FYLE 4DKFH 3MRQB 4M6MH 1KXQE 4NO0B 5DUPL 4R96A 1ZA3A 4MAYB 1FFOA 3QPXH 2NYYC 1U8OB 1U8MA 3RGHA 5LQBL 3NMEA 4LEOB 3S98A 2HTKD 1IGTA 1P5VA 5BXFB 5IW6B 1ES0B 4S1SL 5MHSE 2ITDA 4OM1L 4TSAL 4GRLB 4WJ5A 5FHBH 4W4OC 1J0JA 1IT9L 4XTRC 1TFHA 3CJJA 3S4SB 5FHAH 4YHML 1ZXQA 1QSEE 4H88H 5FUOH 1KGCD 1CG9B 3U0TA 4ZAKA 2AERT 3IFNL 4JHWH 5EORH 3RZWA 3S35H 3S36L 2AK4D 3R0NA 1S7SB 2OTWB 3CFEA 3BH8A 4Y4HA 5JOEA 2XV6B 4X7SH 2DN7A 2K7PA 4OFYD 3ARBD 3W81A 4GRWH 1EEQA 4HIEA 2NXYC 3AROA 5EPMB 3MV9A 2C3WA 1IGJB 4PJGB 3PABA 4PJIF 2XA3A 2ID5A 3VWJC 4HXBH 5D1ZA 3RWDB 4P3CH 5E56A 4MVBC 1VA9A 1A6UH 4EZMA 1D7FA 1FLRL 3B8YA 3CCHB 5E24E 5ESVA 4MNGA 4X6EA 1JF6A 4HAGA 2DQTL 3PHOB 3V7AG 4QRPB 3G08B 1FORH 1EXUB 1IM9D 2DQFA 1ZK9A 4C4KO 1V7ML 4MQ7B 1MRCL 3LKQB 1BWMA 5CCKL 1TMCB 4YFLI 3VDBA 5EBWB 3OXRB 5F1KC 3O3AB 4JPVH 3HPJA 3JTTA 4GSDL 4OQTA 4H26B 4KXZH 2VC2L 25C8L 4DK6A 2OLDA 5T5NG 5HYJE 5FYJL 2GTWA 2XWTB 3JWNC 3V6ZA 1TVHB 15C8L 1NEZA 3ULSB 4H20L 2OL3A 3IXAA 5B3JE 1A9BB 4BQ6A 1BZ7A 1FIGH 4R6UA 5HHQB 2O5ZL 1R5IA 1VACB 4Y4KA 1PSKL 3QWOA 4OGYL 1FVDA 1AFVH 1A9EA 1AQDA 5KS9F 3KPSB 4LLDB 1QPXA 4AEIH 3FFCE 5KN5A 3OAZH 3ARUA 4YXKH 4GW4A 4W81A 2B5IC 3V4UL 1RUPH 4Y88A 2NY1D 3BP5A 5AG9A 5A43C 3RVUD 4HS6B 4NKMB 3DX7B 5I17A 1RZJL 3OJDA 2Z91A 3IDGB 2DBLL 3MRNB 3MJ8A 4ZO9A 3L5XH 4HC1H 4NNPL 3WNMA 2I9TA 4ZD3L 4P9HL 4A6YB 1HHGB 2FECI 3RVTD 3TT1H 4X7TA 1CGYA 3OKKB 4PGCA 1AR1C 5TFSH 2KZ1B 5DR5H 4D0BA 1I7UA 3HI5L 1GIGL 2I9LA 3WIHL 1K6QH 4Z78A 2APBA 3DV4B 3K4ZA 5T5FH 3KPRA 5FYKL 4AQOA 4YBQC 4OTXL 1EFXB 1IQWH 3RGVA 3EKCA 3DGGA 2O5XL 4WNQA 3OB0H 3QAZB 1K3IA 1MIMH 3EZ8A 2CLRA 4PJGE 4FQCL 3I2CL 3E2HB 4YX2L 1Q9LB 1RAMA 1MHEB 3MROB 1QTYT 1S7UA 4OGZA 3BKYL 4OV6F 4RFOL 4LGSB 4DTGL 5D2NB 1WAAE 3GMNA 3S37H 5HYSG 1MI5B 2E6JA 1W0VA 3IDXL 2DLGA 1MCBA 5KSBA 4YHKL 5GGTH 1X6NA 1IZKA 3GBLA 2D7TL 3OB8A 4QWWC 2UZXB 5H2BA 1VENA 3FT3A 4L4TB 4LIQH 4EI6B 5C09A 2DRUA 1FNGB 3QAZC 1KIPB 4YHIB 2BCKB 3ZKND 1AGEB 4ODBD 4UIMB 4HXAL 3TYGL 4YDJA 2EIZB 3GI8L 2P4AB 3I3EA 2DDQH 2J8UF 4UT7L 4OCYL 4JDVB 1BEYL 4PFEA 3E2HC 4GUPA 4U49A 2NY6B 5HHMA 2Q8AL 5DC4B 3PHSA 4JFED 4F7EA 4NRYB 4L1DA 5F88A 2GSGA 1NCAH 5A3IC 4ZFZA 1BP3B 2HFEB 5D2NC 1XIWB 1JZ3A 2PTVA 1JHTB 4Z7VA 4BFGA 3C5SA 1A14H 2YMXH 2W9DL 1BF8A 4FQXD 2XY1A 2P44B 1PLGL 2FEEI 3HRZB 3FCTB 4OZFH 5HVHB 1BFOB 2FATL 3WL9B 4RQQB 2BZDA 2VLRB 1DLHA 2CUMA 2V2WB 4JFXA 8CGTA 3HTLX 4HSQA 4HFWA 4CU8A 4KPHH 5TQ2L 3CFKA 3B9EA 2WK2A 4MCZB 4Y19E 4XMPH 2NY6C 3SY0B 2QSTA 1UH3A 4ELMB 3FOMB 1FPTL 3QPQD 2AK4A 5GJTL 4IEFB 1EZVY 3QEUA 1D6VH 3V9FA 3KYAA 5DURD 3CFCH 4FFZH 1CYGA 3ARBA 3U0PA 1NC2B 4CVWA 3MV7D 2R8SL 2FJGA 3MGTA 1BQSA 3ZDXF 3QJFB 3B2UC 1R5WA 1CD9B 3FQTA 3A6OA 1MELA 1BOYA 1J1XH 2BC4B 3LAFA 4F9LC 1LE9A 4CVXB 2CQVA 5IV2A 3NA4A 3DSFL 5ANMB 5HVHC 3MO1A 3D87B 3MRJA 5DK3A 2BVQA 3BZEB 2C4FT 2FLBT 3LKOB 7FABL 1HSBB 1YA5A 3LPWA 1RUKL 5DJYB 1IM9A 4OCSH 2AV7A 2K1MA 5C0BB 5TF0A 4YBLB 3AS1A 1KXVC 1QFWM 3CX5K 5TF1L 3BAEH 3UP1A 3IFLL 1JYNA 3EFDL 5L8KB 3CVHB 4GS7C 5KG9B 1N0LA 5FA4A 4PLKD 4PJBE 4PG2A 3H6JA 1CCZA 3EYQC 2LU7A 3EOAB 3EYOA 3QDHA 1MH5B 3GUTA 4C56D 5DJ6A 1C08A 1KYOJ 4M02A 3WS3B 4Z95L 3GSWA 1KFAH 2NY3B 2FYYA 1JPGB 4AEHH 1JZ4A 2BNQD 4NKDB 1FVEB 3IGAB 4HKZB 1NEZG 2YPVL 1INDL 1JTOA 5C92A 4XPBH 4HWEH 2VZUA 3QRGH 5BV7B 1Y6MR 3FO2A 1NCUA 3P0YL 1DL7H 1GVIA 3SKJL 3MLSH 1H8OA 4BK5A 3IDYB 3GKWH 3MLRL 4BM7A 2B1HH 5BJTA 3B43A 5IK3B 3HFMH 1NJ9B 5EZLA 2AKRA 2COQA 5TPWL 4WHYH 4HWBH 1F6AB 4P5KA 3PNWB 4JN2B 2JELH 1EVUA 3QIUC 4PG9A 2XZCH 2F15A 3G6JF 2VR5A 3WS6C 5D7SH 3L3IA 4EIZC 4JLRB 3REWB 1J05B 2ADJB 4PJHB 4JY5L 3ARGB 3MLWL 4GRWE 4NQCD 2V2XA 1MHPH 5L2KD 1ZEAH 2NY3C 1INQA 2PW1A 1C7SA 4YK4B 2RQ8A 1UZ8A 3T0WA 4HDIB 1GC1H 1A7NL 1RHHA 1T5WB 1WUNT 3B8SA 3QUKB 5IIEB 4QOKE 3FQWA 5LGJB 1BVLB 5BV7C 1IC5H 4R4BA 1E28A 4KK9D 4LPCA 3ZKSD 1E6OH 5GGVY 8FABA 4FQ2H 3KAAA 3ORJA 3DRQA 3GSNL 4UQ3A 2DM4A 5E8PB 4JRXE 1S7XA 3JV4A 5DJDA 1RK0A 1KJMA 3S96B 4XPFH 4TSCL 1NFKA 5ILTH 1YZZA