1JPFA

Crystal structure of the lcmv peptidic epitope gp276 in complex with the murine class i mhc molecule h-2db
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
275
structure length
275
Chain Sequence
PHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
publication title Zooming in on the hydrophobic ridge of H-2D(b): implications for the conformational variability of bound peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 69
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jpfA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jpfA01
35C8L 4PJGE 4M7ZB 1QKZH 3TFKC 2DYPB 4EBQL 2FHCA 3VXUE 3EJYD 1X5FA 3UTSB 5JO5B 1JF6A 1VESA 2B1HH 3VGBA 1CDHA 1X5YA 3HAEA 4PREA 1ZHKB 1HH6B 1X6NA 2OP4H 3TNMA 4LSDA 2YC1B 1ZEAL 4GQ9H 4KAQH 1HHIB 5EU6B 5CJ5A 3KS0J 1HI6A 1T5XA 4X4ME 1KJ3L 2RQ8A 2A6IA 2VLRB 4Y1AA 1T1WB 2BY2A 1I7RA 1YNKH 4K8RL 1F6AB 2IAND 1JWUB 3RGVC 1FLRH 3SKNB 3ZSTA 3VGHA 4Z6AT 3TNNA 4PRHB 3O8XB 4JVUA 3OPZL 1ZANL 3U7WH 4PUBL 1CBVL 1LO3L 2EE6A 3UTQB 5IV2A 4NQDE 1RU9H 4JR9L 1HHJA 2HJKA 3TIEB 5C0EA 5H8DA 1OY3B 4FQJH 4OZIE 4YFLF 2UYLB 1ZGLA 4GAGH 4POZC 4WDIA 5I76A 3FO2A 2G60L 5D1ZB 3TBYB 4UQ3A 4NQXA 3NCYP 1OB1A 5TFSH 2DQEL 3QDGA 5DJ0B 4PJGB 2FLRT 4AH2A 4PV9B 1OT2A 3VXUB 2VDRH 4X9HA 5B8CB 3CUPA 4FZ8L 4MWFB 4J3TA 3VFOB 2BNQD 1WFNA 3TYFB 3RTQA 3H9YA 1D6EA 3BKYH 2X9WA 2GK2A 5F9OH 5KZCD 2Y4SA 1KPUA 2NXYB 5IB5B 1D7FA 4BYHA 4XCYB 2DQUH 4E0RB 2I07B 4RFEB 1EMTH 1LEKA 5IIEB 5KW9H 2OK0L 3DX7B 1FNGB 3DHJA 1XCQB 1NFIB 1X5IA 1FGNL 1MI5E 1QFWL 3AY4A 3L3JB 4NKDA 3NCBB 4MHHG 3RQ3A 4WO4B 1CLZL 5IVZB 3U46B 5E08L 3GMQA 4MJ6A 3ES6B 3IDIB 3Q1SL 4NQDB 5H2BB 1OAQL 5TE6H 5C0CE 4OZIB 3DTXA 4E41E 4GKSB 1ZE3C 1YEHH 4PS4H 1RSFA 3ROOA 2VDML 2HT2C 1UA6H 4UDTB 1U8OA 5D7SH 5GJSL 32C2A 1QO3B 1T1XA 1PZUB 4YPJA 2YD3A 1KSRA 1MCHA 3MODL 3BP7B 2W0LA 3KLAB 5C0DB 1MCDA 1KIRB 2VLKA 3GFUA 4OBSA 2FBOJ 4X4YB 3ULUD 1YZZA 3I6KA 4PJEF 5I18L 2R9HC 1KIPA 5T1MB 4G3YH 1EFXD 3OL2A 3Q6FB 5TF0A 5EZOH 3CPLB 4LASL 1QSFD 4HIXH 1PY9A 4R8WH 1RPQA 2JTDA 1XIWB 3B2VH 4GH7B 5EO9A 1MIML 1EEZB 2OL3A 3ARBA 1RJYB 2X5PA 5FKPA 4YWGL 1MI5B 2H6PA 3OKLA 2K1MA 2IADB 4PJXE 3IB4A 2IALA 1S5IL 2BVOA 3K2UH 3RRQA 5C0CB 1RZFL 4WW1A 5FK9A 1DP0A 1VADB 3LSOB 3I75B 4E41B 1CDGA 1CQKA 4LLQA 3QDME 3P77B 1D3CA 1RIHH 2DYPA 4IDJL 3UTSA 5JO5A 2KKQA 1C5CH 2HVKA 1J9CT 1YEIH 2Q8BL 2VDNH 3WFHB 1OQOA 5GRWA 5BV7H 1HH6A 1KXTB 3G6AA 1A6VH 1UWEH 4AEIH 3QEQD 1T20B 4KMTH 3TN0B 4YZFE 3WD5L 1HHIA 2R2BB 2OJZH 3CX5J 1CXKA 2APWA 3AREB 4YBQD 1AIFB 5F89B 1FGVH 3IRZA 3VD4A 4PYHA 4Y89A 5E94B 1RAMA 1OGAA 5BOPA 4PJ9D 3SKNA 4B53A 3MOAH 2YXFA 1DQQB 1HZHH 1OT1A 1QFWI 3O8XA 1MHEB 1UYWL 1QSED 2YUXA 3EHBD 5T1LD 2R0ZH 2H45A 2YPKA 4K3EL 4LPYA 3UTQA 3STBA 3V4UL 2YZ8A 2BNRD 3TIEA 4F58H 4KHXH 4U6YB 4OFVA 1WZ1L 2XWJB 4G7YL 4PJXB 2UYLA 5HDBF 4CGTA 5JR1H 7FABH 5A3IC 4UTBL 3F7VB 5CAYB 5D1ZA 3TBYA 1FPTH 3CFCH 5D1XC 4ZUWB 3JWOL 4X9BA 2VL5A 3QDMB 1YYLL 4W70A 1GC1L 5ADOL 3IDJB 2AERT 2JELL 3E1F1 4AL8L 4MWFA 4I0KA 2LFGA 3VFOA 1UXSB 2X70A 4DN4L 3UC0H 2N7AA 2QADC 2NY5C 1T22A 2PO6A 3ZO0A 1C5DB 5IB5A 2W92A 1P6FA 1DBBH 1N6UA 3H7BA 5F7EL 2WQRA 4XCYA 2X89A 5JHDD 2RBLA 4E0RA 1CF8L 5DQDH 2QSQA 4N8VG 2APVA 4WHTB 4RFEA 3UCRA 3DX7A 4P2CG 4M5ZH 5EIVA 1NFIA 5DRNB 2BZDA 1DUYB 1JF5A 3L3JA 4WO4A 3U46A 3KLDA 5D6CB 5T5NF 3QWRD 5LGHH 1CDIA 3ES6A 3IDIA 5H2BA 4JZJC 4Y5YC 1AFVH 4JZNB 5F1NB 4U1SB 2OJEA 3N9GH 2C3VA 4OZIA 1RUPL 4PD4J 1SYVB 1PVHA 1DVFC 1NGQH 4X7SL 2AJXL 5IQ9A 1AGDA 5CBEB 4M1GH 4L4TE 2HTLD 4M9OA 1CGSH 1BQLH 2NY1B 1F6FB 4Z7NF 3WO4C 4OLZH 2H32H 1HHHB 2O5ZH 1AQKL 1HDMB 1QO3A 1AXTH 2V7NB 3BP7A 3KYAA 2P8PA 4HWEH 2YPLD 1HN1A 4PP1D 5D71H 3KPRD 3DWTA 1KIRA 4R0LB 4Y2DC 2OR8A 4Q9RL 3NA4A 4LFHD 1MFBL 4NRXB 2WUCH 4PPTA 4PJIE 2V5YA 3HUJF 5T1MA 1QBLL 3DVNB 1IAII 2FO4B 4OF0A 3CPLA 3MUJA 1MCLA 1XIWA 2AABL 5ICYA 3FMGH 1EEZA 3PDGA 3FQRB 5A16B 3ZYOA 1RJYA 2F5AL 1RVFL 1MCIA 2IC2A 2IADA 4QY8B 5DJYA 2DM7A 3VE0B 1W8OA 3D5OF 1IGCH 4S0UC 4PG9B 5I1LB 5C0CA 4IHOB 3W11D 4XBEH 1VADA 1QFWM 3I75A 4E41A 3PV7A 3BW9B 3QUXC 2ICWJ 3T0BA 4WY7L 2DOCA 1NDMB 4L4TB 2OXHA 3V7AG 1LO0L 5TQ2H 2R1WA 3OJMB 4DVRH 4ZNEE 2ARWA 4MXWL 2OLDA 1U6AH 4GQPH 5DZNA 4FQHA 4CRPA 3MRIB 1T20A 2V9QA 4KRPB 1J1XH 3TN0A 2R2BA 2BVPB 4XPGL 3CH1B 5D7KD 1X5JA 3QUYC 5F89A 3FOLB 2KQNA 4KJYB 4F7EB 1OPGH 1UZ6E 5E94A 4PJIB 3W9DB 4NN6B 5CZXD 2NR6C 1DQQA 4NO2B 3KJ6H 4KWUA 4M6MH 3GJFA 3GNML 1MHEA 3GRWA 3P30H 4H8WH 4OZFB 3T0AA 2UZIL 2GY5A 4GMSL 1SJHB 2ICWI 4S1QL 3VXSE 5JUEL 2XWJA 2YHGA 1QQDB 4PJXA 1J8HA 2P7TB 2ZOLB 3C60C 4KUCF 4WEBL 3WIHH 2DD8H 2EDDA 3F7VA 3NTCH 1TPXB 3L7EA 3SDAC 4ZUWA 1NCCL 1JV5B 3S36L 1EJOH 2ADFH 2GCYB 4ODSL 1R0AH 4W6YB 2V2TB 1JVKA 3F7PC 1UXSA 3QO1B 4LFHG 2GTWA 4M1CC 5CP7B 5DRZA 1T4KB 1XMWA 3LKOB 2ITDA 1C5DA 4PLOB 5DC4B 3CX5K 5B39A 1AKJD 4LVNC 3HR6A 3ARGB 5CSBA 5IBUB 4K3JL 1GIGH 4YDIH 1BD2A 1JPSL 4UT7L 5DRNA 3TFKD 1I8IB 3LS4L 3L7FB 4PJ5E 1DUYA 3PQYE 1PLGL 2DLGA 5FOJA 4O58H 3MRDB 3EYQC 3UDWC 5D6CA 2RB8A 2D3VA 3MZTA 4W81A 4JZNA 5F1NA 4JPVH 2ZUSA 1CLYH 2CQVA 2X9YA 3VXSB 5EBWB 4KGJA 1SYVA 3S5LA 5KSAB 1FIEA 1YJDL 2R0KL 5CBEA 4YGVB 3ABZA 4KI1A 5EUOF 1LNUA 4AIZB 5EC2B 4RDQG 3RGVD 2UZYB 1XF5B 2F5BL 1KCKA 1BZ7B 2V7NA 3O4OC 3CVIL 2FEEL 5CUSH 1NCAL 4EOWH 2VWEC 4BQBA 1GPOL 2VC2L 4FQIH 1Z3GH 3QNXB 5HHVH 1KCSL 2HTKC 3S88H 4LCWA 1F97A 4KZDL 4POZD 3D87B 2VLME 3GSOB 3P4MB 1UFUA 4M00A 1JNJA 4JPKH 1NFDE 5B38A 5KTEL 3NIGF 1T6VN 4PJHF 5GSRB 3TVMB 1NCWL 5EZIL 5A16A 4ELKB 5AZEH 1MCFA 4PJ5B 4GG6F 3PQYB 4YK4C 2ZNWA 1JNHA 1OCWL 2FJGA 4QY8A 4KHTL 2CXGA 4PG9A 3U7YH 4YHZH 2K7QA 4IHOA 4OZFH 1C1EL 3UJIL 1YPZF 4PD4K 5I1AA 4XP5H 3EYUL 3JVGA 5D70H 3T0VA 4TNVF 3MLTB 3RL2B 1NDMA 4L4TA 3ECBB 1D5MB 4TNVK 1P7KB 4Z7UF 4NDMB 1QYGL 3HKFA 2A6DA 3NIDF 3HMXH 4X6BB 3S37H 2NY7H 5FOBB 5C9JB 2D0GA 2CR6A 2GY7B 4NWUH 3A6OA 5K9QI 3MRIA 5FCUH 4U1GB 2VZVA 4I3SL 3MLZL 1MFCH 2DQCH 4KJYA 1Q0YL 1EXUA 2Q6WA 3RTQC 3I85A 1M7DA 5D8JL 1JNLH 1ZHBB 4DW2H 1FAIL 4GXUN 3EFFB 4PJIA 1X5LA 3NCMA 5IG7A 4HC1A 3ZE0E 1OVZA 4AEHL 1DLFL 2W9DL 5I15L 1I8LC 4XAWL 1IZKA 1RZ7H 1JIBA 2HT2D 3RVWC 3TZVA 2PETA 4LLUB 1NFDB 2DDQL 2HWZL 3PHQA 4ODHL 1XGPA 4OZFA 2CLVB 2MNUA 1J7VR 5GGQH 4OF8A 5MEQB 4J3UA 1SJHA 1WBXB 3EOTL 1KELL 1QQDA 2X44D 1JYXA 1CZ8H 3QPXL 5IW6B 2ZOLA 2YKLH 3P11H 5I30H 3HTLX 4IRSC 4G6FD 5GS1B 3R1GH 3IDNB 4P0DA 5IUSA 4U7SA 1JV5A 2R9HD 3G5VB 2XZQL 2EXYC 4QF1B 4OT1L 4NQSB 4XNYL 4UU9A 4U6VH 4LAQL 2CRYA 5JW5B 1LQSR 4PJCF 3QIWC 1XGYH 1SVZA 4Q6YA 1HQRA 4ZNEA 1AGCB 1WK0A 1VEMA 3ULVE 2V2TA 5C3TA 4R2GB 2ORBL 1FFNB 2VXQH 3QO1A 4PGEA 2QADB 1O7VA 2BMKB 3D39E 3K2MC 2FB4L 1EHNA 5CP7A 4PJ5D 1T4KA 1WFOA 1WCBA 2XXCB 1IC1A 1T83A 4MCYB 3NN8B 2JCCA 4KTEL 1RULH 4LSPL 1UJ3B 1VERA 3ARGA 4Z7VE 5IW1B 2YWZA 1WAAF 4YXLH 1L6ZA 3L1OH 2JB5H 1DBKL 1I8IA 3L7FA 1G7HB 4RFOL 3VXRE 1EVTC 5MEOA 4DGIH 3HMWH 3MRDA 4JZJB 5T1DL 2XRAH 3MV9E 1KEMH 4YHOH 3BAEH 2VZ3A 4KMLB 5IMMA 2QHRH 4YDVA 3O0RH 3VXSA 4ERSL 2Y07L 5EBWA 4JPIB 4MAUH 4AIOA 3PWPA 5KSAA 3S9DB 4OZ4B 3ZKXB 4M5YH 1CDBA 3J7HA 3HNSL 4YGVA 1KCUH 5LAXB 1FG2B 4KTDL 4AIZA 3DV4B 5EC2A 1XR8B 5ADPH 4EUPB 2ADIB 3QISA 1XF5A 2D7TH 1BZ7A 2APTA 4WW2B 1A6TB 2GYSA 5C92A 2R39A 2CJUL 3GDBA 2P5ED 4XGZB 4X6DA 2VL4A 4G7VH 2YN5A 3QNXA 2O61B 3OHXB 2EH7L 3C6LC 3BYTA 5ESQB 3BQUC 2A83B 3VXNB 1S7QB 2BVEA 3UTOA 5A3ID 5C0RL 2WWMC 5EPMA 3ZE2F 3P4MA 5T33H 3UBXG 4Z7VB 2EC9T 5D1XD 5CZVL 3WO3B 2PW1B 5DVKA 5GSRA 5KANI 3TVMA 1D9KC 3SQBA 1WISA 4ELKA 1EAPB 4UZGA 3REVB 4NQCA 4ZSOA 1DQML 2H26A 1GVIA 3VXRB 3PQYA 3FAWA 5T5FL 5IESL 1BAFL 4PRPE 4JFOA 3FFCE 1GAFH 3MV9B 1JJUA 1I9RH 3WNMA 1VEOA 3WFBH 5FO9B 2QQNH 3BRGC 4JO1H 3QUXB 3E3QA 3G9AB 3NIFF 3MUHL 4WUUE 3O3BB 4MA8L 3ME0A 1X5HA 1DSFL 3MLTA 5J1SC 4XCEA 1D5MA 3G04B 5BVPH 1P7KA 3O6KH 4NDMA 3B9DA 5DD3H 1F8TL 1SY6H 3NA9H 4LHUB 4R4ND 4BZ2H 3HG1E 4X6BA 5I74B 5FGBC 5FOBA 1AC0A 3C6SA 1BGXL 1UM4L 2X4RB 1JRHH 1UEMA 3F7RA 4YHLH 4XP9H 1TNMA 4OQ1A 4FRWA 4G8GA 5C2BL 1YUHA 4U1IA 3KLHC 1NBZB 1GGTA 1ZHBA 3ARPA 3EFFA 1DVFD 1KUMA 2NY5H 3ZE1F 4XCFL 1SMOA 2RCSL 2PO6C 2VZ1A 1CU4L 4MXQC 3I2CL 4LLUA 4JY4B 1NFDA 1KJMA 3PP4H 1OARH 2CLVA 5I75B 1RURH 3QI9C 4I18C 5MEQA 3D2UD 2OTUA 3WJLA 4J6RH 1WBXA 4PRPB 2VSCA 1XEDA 2NY2C 1NEZA 2F53D 2RFXB 3FFCB 5I1DB 5KVDL 3K8KA 1J0HA 4MLSA 4Y2DD 3FB7B 25C8H 3SDAB 4Y4KC 3IDNA 5GS1A 1E28B 4Y5VC 1QPXA 1QD0A 1TIUA 3NACH 2R4SL 3D39D 4WUUB 3UZEA 1QHOA 1ZHLB 2A38A 2WLYA 4QF1A 2JB6B 4NQSA 1GXEA 3H7LA 5C71A 5FHBL 4OLXH 5JW5A 3VD3A 1NANH 3GI9H 4QHMA 3C2AL 3VCLB 1AGCA 5HGDB 3Q3GA 3KPLB 1FFNA 2V17L 3T65B 4LQFH 1OAUL 4KFZC 3HG1B 1KEGH 4ZOBA 3TO2A 1IAMA 4EUPH 2HYMA 3MGTB 4LKCA 5M94B 4ZDHB 4MCYA 1R5IB 3RWIB 5D7IF 4UIMA 4P2RD 3ULVH 4O00A 1VGEL 3QG6A 2J5LB 4HW6A 3ZZ1A 2VNCA 5IW1A 5I1GL 1I3GH 4BQ9A 3HE7B 4JGUA 2P8LB 4WIQA 4BZ1H 3BPOC 3PP3H 1DL7H 2X10A 1CD8A 5ILTL 1A7PH 1MH5A 3TO4B 4EXKA 3NH7H 3TH2T 3BEVB 4JPIA 5I73C 3O6FA 3IKKA 4GW5A 3N1GC 3CMOL 2ED7A 4U1LB 3CMGA 3QUYD 5GRVL 3RWJB 5C70A 1OOAA 5LAXA 2KUTA 2F58L 4KVNH 1FG2A 2DTMH 1Y18B 1CIUA 3DV4A 2OMNA 1XR8A 4I3GA 4Y19D 4GAYB 5M95B 4EUPA 3L6FA 2UWEF 2NR6D 3LAFA 1G7IB 1S7SB 1RFDH 4HS6B 4WW2A 1WWBX 3VFTB 1ITBB 5C1MB 3IFNH 5I2IB 2VLLB 4XGZA 5DTFB 2M8XA 3MACL 3GJEB 2DF3A 1CE1L 4CU7A 4JGJA 1ZT1B 4GXVH 5ESQA 2XQBH 2A83A 3C60D 1S7QA 3E8UL 3LHPH 2YRZA 1G1CA 4Z7VA 5KG9B 3PE9A 4PRDB 1OHQA 3P0YH 1RZJC 4LSTL 1EAPA 3HN3A 3LH2L 3OKMB 3VXRA 3KPMB 5D1QB 4TUKH 3WIIH 2R56L 3MV9A 2OI9C 3P4LA 4MD5B 5GS2H 3OXSB 3VD5A 4DAGL 3FRPA 3BGFB 1TJHL 5FO9A 2F8XC 4M1CD 1P7QD 4I0CC 1PAMA 3MNZB 4LSVL 3QIUB 4M4RA 3LMJL 3O3BA 5L0QB 4FNLL 3P0VH 4KK6C 3G04A 2X4OB 1RK1B 1S7UA 4X9IA 4LHUA 1ZVSB 1KFAL 5KVGH 2WK2A 3WS6A 2VDLH 2NTFA 1A7RL 2X4RA 3LQAC 1RHFA 4P46B 3RX7A 4XNMB 2WAHA 2HG5B 3GSNL 2X9XA 3EKCA 1K6QH 3IDGB 3O6MH 1A7OH 2ZPKL 2EDLA 1NBZA 1P9MC 1W72B 1DQTA 1NBVH 4KROC 1RUQH 1U3HD 4G59A 3V5KB 4RMWA 3OAYK 1EO5A 2DBJA 2B1AH 4JY4A 1H3TA 5LGJA 4ZFZB 4U2ZA 3LPWA 3VFRA 2B4CL 4P3CL 2V9RA 3T8XA 3QUZC 4RAVB 4PRPA 3LKQB 4LEXH 4OFIA 5FYLD 1NBYA 5I8OH 1DBJH 3FFCA 5I1DA 3RI5K 2JLLA 1V7NL 5EC1B 5DA0B 2Y6SC 1TITA 1BMGA 4P3DB 1E28A 3WXVH 1U8MA 1U8KB 2HTKD 5FM5O 1NCUA 5T3ZE 1ZHLA 3GHBL 2WUBH 3B9VA 1PBYA 3HC3L 2JB6A 5TDNA 5TF1L 4CVXA 3MLYH 3W0WE 2H1PL 1A6UH 3VCLA 5HGDA 1VFMA 4Y1AD 4HIEA 4LNVA 1WSST 3HG1A 4NJAL 5ABDE 4U0RB 3SDYH 3MGTA 5FYLH 4ZDHA 4S2SB 4IRJB 3UEZA 1HNFA 4LMQE 1R5IA 3RWIA 5CKAA 2VYRE 4RGNE 1TZGH 4P2OB 1NLDL 1PSKH 3HC4H 4JQXC 1GZQA 2A6JB 4LVEA 3HE7A 3SKOA 4Y4HB 1PG7X 3L95B 1NMBL 1TXKA 4I3RH 5J6GA 5DFWH 4JFDD 1S7TB 4RAUB 3HNTH 3TO4A 3ZL4L 4MNHB 5JIIA 3BEVA 4ELMF 4JKMA 1YDPB 4OIIH 1CFQA 3CXHJ 4U1LA 4DEPC 4JKPH 4V3DB 2X4SB 3RWJA 4ISVA 3O9WB 1QFPA 1P2CA 4XC1H 2ID5A 5E2VL 3RTQD 4PJEE 5I1JL 4RQQB 1Y18A 4Q6IC 2W60B 4CVZB 2YXMA 4QRRE 2NY4D 1EFQA 3U30C 3JUYA 5FGSA 1A0QL 1G7IA 1S7SA 4NKIH 4DUXA 5IWLC 4PP2B 5F6IC 3RVWD 5BO1H 4HS6A 4MNQD 3W0WB 5C0GB 3R06B 2VLLA 3F6LA 2I9TA 1Q0XL 5HYEA 5DTFA 3FO0L 3HB3C 2WZPD 3C6LB 3CZFB 3GJEA 1BF2A 3WUWB 1EA9C 4N8CL 4IM8A 1CXHA 1NCBH 1ZT1A 2YBRB 3F7YA 1R5WA 2YK1H 4QKXB 3HZMB 4IRSD 3MC0A 4RGNB 3B4NA 1FO0B 5FM4A 1MJ7H 4QRSB 3ETBF 5KG9A 5TPWL 4PRDA 3TCLA 4O4YL 1HSAA 1IGTB 2EXYD 3D85D 3FN9A 2UY6A 1W72H 3RVVC 1E4XH 3T0EA 4JHWL 3QIWD 4MD5A 1YECL 3HAEG 2EDHA 2VQTA 3OXSA 1NCNA 3O2DL 4FFZL 4HKZB 4M61B 3X14B 5ID0B 5JXAH 3RA7H 4J23A 4WU5B 3QIUA 5HI3C 1TZHB 3U1SL 5F9WC 4NC2B 3MRQA 3CLFH 5L2KB 1G6VK 1U9KA 4PJEB 3QUMB 1JMXA 2X4OA 4G42B 4QRRB 1B6UA 4XCCH 1ZVSA 4L8DB 5LXGL 4XPFH 3N1FC 2ERJC 4M7LH 3KPSD 3VFWB 4YHPB 4J4PC 2APBA 3QCTL 1Y6KR 2HG5A 5GGUB 3ZTNL 3VWKC 4LVOB 5DHYB 5I8KH 1KXVC 1SQ2N 3L3KB 4TSBL 1QSVA 4M6NH 5FM8A 4I5BB 3V5KA 4D9QD 4G6AC 2BCKA 5F7LB 2HH0H 2YMXL 4ZFZA 3OTTA 3VA2C 2MKWA 1AY1L 4RAVA 3LKQA 1JGLL 1CFTA 1RIUH 1U95A 2Y06H 3S34L 4ZUSB 4WFEE 1YC7A 3WNKA 2GJJA 4GMTL 4M9PA 3V0WL 4L4VD 3BO8B 3GMLA 4U05A 1U8KA 5T1KA 4WEMB 4BKLB 3BQUD 2VB5A 4IRZL 2WWMD 3B2UC 4R97C 5HY9B 1HKLL 1G0XA 4Z77B 1D9KD 4OCWH 5GRVK 3WKNA 1OGAD 3VG9B 4H1LB 4KC3B 4NJ9L 5T3ZH 2EEAA 4M7JH 1FFOB 1KN2H 4LCUB 4QXGH 4S2SA 4IRJA 1YNTB 1GGBH 4LSSH 3MOBH 1NC4B 3V52H 2VRAA 3EW3B 4WFGE 2FECL 3QEGH 5J8OA 2A6JA 2A1WL 4WHDA 3GMPA 1KLUA 4F9PA 2MCG1 3L95A 5D72L 1Y6MR 4NKOA 1FNFA 4K71B 1FO0H 1S7TA 4RAUA 2F74A 2BC4B 1LO2H 4BFBD 2AJUH 4OQTA 2VXTL 4NYLB 2E7CA 3W9EA 5KVMC 5E2UL 3ARWA 5HHMA 2X4SA 3O9WA 1DBAH 4RQQA 3KLHD 4PJDE 3MLRH 2W60A 4U7KA 3V6FA 4EI5B 3HUJE 2MCPL 4ALAH 1FL5B 1MFDH 3MCG1 3IETB 3E3QC 5FUOH 3SKJL 1TVBA 1MCSA 2PO6D 2QQKL 2DI7A 5I8CB 4MXQD 4AJ0A 5C0GA 2DQHH 2X89D 4H88L 3QUMH 2GTZA 3QI9D 2VXSL 3CZFA 3WUWA 3FB8B 1QKZL 1R24A 3FQNA 2NY2D 2NQCA 3HZMA 3P9WB 2A0LC 4L5FL 2X1QA 4Y4KD 3BPLB 2IMNA 1IC7H 5DUPL 1DE4B 2J8OA 3IYLW 1GGCH 2OP4L 5HHOA 4JM4H 3S96B 5DHVB 4YXKH 4GQ9L 5JQ6H 3CDCA 3AM8A 3DO7B 3SE4C 3O4LE 4UMGA 5GS3A 3TBTB 3DXAA 1YNKL 2ZSVA 2I5YH 2BSRB 4HKZA 4YE4H 4MJID 3X14A 5ID0A 1FLRL 3QCUH 3L3IB 1C7SA 3CC5A 5EOCH 4G9FA 5ACLA 2D7NA 4XPBL 4CN1A 4M1DH 1TZHA 2IPUK 4RA3A 2JJWA 2IF7A 1NGWA 4KRLB 3CXHK 5L2KA 4PJEA 2WP3T 2Q76B 2FO1A 4PJDB 1I7UB 3AU1B 4G42A 3HUJB 4OZHF 4QRRA 4L8DA 3UJTL 3WCYA 5CINH 1KPRB 3S3SA 5C0AE 1T2QL 3CFKB 4X6EB 1S9XB 3CFBA 4HHAB 3V8OA 3ZHDA 1XGRB 5GGUA 4XWGH 2X2YA 4NCC2 5TFSL 5F7HA 4TUJB 4GJTB 1KLGA 5DHYA 5AYQA 3FZUC 3ARUA 4D9RE 2FECI 4H1LH 4OGAC 4L29B 1BM3L 4QTIH 1N8ZB 5EBGA 4W6XB 1QVOB 1FNEA 4I5BA 4JGMA 3OKYA 5DMKB 3BZEB 1RZKC 4N5EA 3C9NB 4HMEA 5ALCH 3O4LB 3CSYB 4S1RL 5F6HI 4X6CF 1HQ4B 3LDBB 4JKWA 4TRPL 4UV4H 3GSUA 3U82B 5AG8A 5FHAH 3PJSB 3MA9H 4TUOB 3BO8A 3I50L 2E7LE 3FQUA 5FEBA 4BKLA 4XNUL 4OSUL 3O6FC 3MR9B 3IU3B 2BSTB 3ESUF 5E6ZA 2XG5A 5DDHB 1P4IH 2OL3L 4Z77A 1FVCB 4KJQC 2P5WE 4H1LA 3JWNC 2EDJA 2XNAA 3OAZH 3F7QA 4XP4H 4PS4L 5IVXF 4P23C 5C0AB 5CZKA 5AZ2H 5GSVB 3AGVA 5C0JB 3D9AL 4LPVA 5HHPA 1YNTA 1G9MH 1KJVB 2R1XA 1Z9OA 1EO8L 3T2PA 1NC4A 1HHKA 3QDJA 4QOKE 4R6UA 4XNXH 4MD0B 2NMSA 2FHFA 2EDKA 2W0KA 5ITFB 1J8HD 4KK6D 3W81A 3D3VE 2HA1A 4HWBH 2AGJL 2GI7A 3QNZB 4MHHI 4RWHA 4AM0B 3O41A 4Y16C 2W07A 4OCMC 1RZJH 2HT3C 2BC4A 5E6YA 5DHVH 4G3YL 4TPRH 5DJZB 5ID1A 4NYLA 1UKQA 4AT6B 4R8WL 4HIIB 4HXBH 3MLXH 5IQ7L 2AJSH 2DQDL 4EI5A 4V2BA 3RKPA 4Z0XB 3S4SG 3WE6A 2J8UF 1BECA 4KROD 5MERB 2CRIA 5KVEL 1PEZA 5I8CA 4BA8A 3K2UL 1A22B 4PJHE 1NQBA 3CSPA 4ZNCD 3IU4H 3NVQA 1AGFB 4UIKH 4FQCH 3PABB 2FX9L 3QUZD 3IJSB 3QIBA 1BD2D 3FB8A 1UXWA 3X3FL 2V5RA 1E0OB 5CWSB 1AJ7L 2HRLA 2Y6SD 3WSQH 2DIAA 4QOKB 3W39B 1DE4A 2ARJB 2HKFL 4KQ4L 1FCCA 1YPZE 3L3DA 2E9BA 5E8NB 5DHVA 5CSZB 4XHQA 3INUL 1AI1L 5I1EL 3D3VB 1QG3A 4HK0B 1HINL 2YWYA 4P2QE 5CILH 1LILA 3NIDE 2ADGB 3TBTA 1TETH 1E6JL 3PXJA 1A14L 3NAAL 2BSRA 2B20A 3KHOA 1K85A 1JZ2A 3L3IA 4ZAKC 4RRPG 1M71B 3HE6B 2BNUB 3RVXC 1UM5H 5SWQB 2OTWB 1WT5C 2Q76A 1I7UA 3AU1A 3HUJA 4D9LH 1E27B 2AV1B 1XF4B 4Y0GA 4KJWC 4LCWD 1A7NL 7FABL 2BOCB 4S10A 4XNZC 1AGEB 1ROWA 4PJHB 2DQGH 5KOVC 1S9XA 3U36B 1DDHB 1XGRA 2Q8AH 1HEZB 4JKLA 4LSQH 3MRLB 4GG6B 4TUJA 1I9JH 4YIQB 1EIBA 4PJFE 3D0LB 1NUFA 3M17B 4ONHB 3TH3T 4C56E 2VE6B 1N8ZA 1IC4L 3WLWC 4HS8L 2E9IA 3T1FA 5GRJH 3UC0L 5AWNH 4XB7A 1YPZB 2E27L 3K81A 5DMKA 5DRWA 3BZEA 4WWKA 1ZGLM 1QBAA 4WU7B 1A6AB 2B0SL 1HQ4A 1DBBL 1NBQA 4PJCE 2QQLL 4FFEX 1E4KA 1MF2H 5F3BA 4LRIA 1OAXH 2PW2B 2ZCHH 5DRXB 4Y8AA 3MRJA 3GMMA 3WS3B 5IB1A 3KDMB 4XH2B 2ZUXA 4TUOA 2IFGA 4R7NA 2R2HA 2P5WD 4UUJB 1BFVL 2H2PD 3ELAT 3VDBA 3MR9A 3IU3A 1MJUH 2BSTA 3ILQC 4K2UH 5B39G 4N0CC 2IPKB 4MB3A 1MIEL 4J3OC 4K7PH 5DDHA 3SQOH 4LF3A 1NGQL 2Q87A 4BUHA 1YEKH 5E7FA 3RVVD 3MRHA 2KQMA 1I3UA 4G8FB 5C0AA 5GSVA 1KG0B 2DJSA 1CGSL 5C0JA 4PDCE 1BQLL 4JO3H 4RZCA 5CGTA 4M3KB 4HCRH 5J1AB 2O5ZL 5F3HB 1PKOA 2CO7B 1MAJA 4KXZH 4KQ3L 4XCNB 1FNAA 1PKQE 3S5LG 4U0QB 2A6KA 4MD0A 5DUBA 1MELA 5HI3D 3BUYB 4QTHA 1RK0B 3UTTE 5ITFA 4Q9QH 1UT9A 1VGKB 2XY1A 3QNZA 1ITCA 1UB5B 4KJPC 4YR6B 3VH8G 3RNKA 1NAKL 5DC9B 4RGMC 4M8VA 2AK4E 5F44A 5MHSE 3CFJB 4PJCB 5DJZA 4J4PD 3GSRB 4EI6A 5SV4A 4AT6A 3MTRA 3T0EC 2ZG3A 3LIZH 3QHFH 4YUEH 3VWKD 5DD5H 5E0QA 3V6OE 2FD6L 4M43H 1T3FB 1ADQH 2R0WL 4WI3A 2G2RB 4PGBB 2J8HA 4Z0XA 2CIKA 3OG4B 5MERA 4LU5L 4GT7A 4LSRL 1N0LA 3ZE2E 1IGCL 4G6AD 3GRWL 1GZPB 3K8LA 5B38G 4F9LA 3PABA 3IJSA 5ANMA 1CD0A 2X1WL 2CPCA 5HGHB 4P2QD 4U1NA 4IS6B 5CWSA 4DVRL 3REWB 1ZK9A 4Q74A 2EC9U 4QOKA 2ARJA 1KGCE 3TA3B 3RIAF 1PKQB 3FFDB 3EYFA 1EHLH 1MFEH 5I0DA 5CSZA 3UTTB 4X5WB 1F3JA 4P4RB 3PWPD 4HK0A 3RPKA 5EUOA 3JXAA 2JIXB 3RAJL 3UAJC 3S37X 1N0XL 1F2QA 2GQHA 4X80H 2AK4B 2NY3D 4MAYA 4LDEB 2VH5L 4LVHC 3B9AA 4ZUUB 5DR5H 3QXTA 1GHFH 1M71A 1S5HB 3SDCB 1S9VB 1WC7B 2E9WA 3HE6A 3P30L 4Q0XH 4Z5RB 5JHLH 3GB7B 4H8WL 1FDLH 2BRRH 3I3EA 2BNUA 5C08E 5KSBF 5TQ0H 1WQVT 4WCYH 2OTWA 1ND0B 3O2VH 1INDH 3VD7A 1XGQA 1E27A 2AV1A 4JCMA 3U9UB 1XF4A 5D96B 4C56D 2XXMB 2BOCA 4DKEL 1QLEL 1AGEA 3WIHL 2DD8L 1GJIA 4U1KB 5DD0H 4LK4A 3KVQA 5LBSL 4URTB 4WTWA 3IDXL 4GG6A 4NKMB 2D9QB 3TC9A 1C7TA 3D0LA 1T1YA 4YNYB 4ONHA 4I4WB 4NQCD 2VE6A 1K2DA 2DLFL 3RNQA 4APQC 2W65A 4KRMB 4AEFA 2H2SC 2VABB 3IKCB 5FV2A 2DKUA 3TM6A 5MI0C 1YPZA 2VXUH 2DI8A 3QJFB 2DLIA 4X6FB 3RY6A 3FL7A 2EZ0C 4MB4A 4TQEL 3WDIA 3H0TB 4WU7A 3QEHB 4OCXH 1A6AA 4FFYH 3RWEB 4Z7UA 1ORQB 3EZ8A 3TBSB 2VDKL 1MWAB 2R2CA 1RHHB 2PW2A 4QNPF 2QTEA 5DRXA 3SGDI 5CEXB 4HJGB 2CGRH 3BI9X 5AYUH 3KDMA 4XH2A 4YPGB 5GRUH 1F4YL 4GBXC 3CU1A 3KPQA 1HHGB 3LKNB 4PG2A 3RX5A 15C8L 4UUJA 3MZGB 3OZ9H 3EYOA 1YEGH 5D7IE 4TVPD 2M2DA 5C08B 2A0LD 3OJDB 2YPVL 4MD4A 1Q94B 1YNLH 2IPKA 4NHUA 4ODVH 4B7LA 2FJFA 4JPVL 5K59F 1CD1A 3SO3B 4G8GD 2VAAB 1WFUA 5BRZD 1NDGA 4TN9A 1JPFB 2FX7L 3BDYH 1CXLA 4XPHH 3GUTB 1KG0A 4R3SB 4ODXA 1KBGL 2YOCA 1BREA 4KRNA 4JFFA 4PGCB 2VZUA 5J1AA 3ULUF 1OM3H 4XCNA 1A8JH 2XN9A 3HI6L 3C08L 4OCNC 1H5BB 4Z95H 2J88H 2MJWA 2WBKA 4O5LH 5FA3B 2IBBA 4KI5C 1VGKA 4TVPH 4XBGB 4YR6A 3DIFB 1EGJA 1X5AA 1RZ8A 3BYYA 1LK3H 4X99B 2CKBA 2UWEE 3QP3A 5D2NE 2OR9L 1IFHL 1J12A 4PLJC 4PJGF 3CFJA 4PJCA 3AM8C 2FBJH 3GSRA 3L3HB 4IEFB 4KDWA 3BP6B 5E8DH 3D0VA 2G2RA 4HC1L 3QR2A 3C5SB 4OGAD 5FM5M 5D7IB 4M62L 1NSNH 1FJ1B 5EWIL 2O5XH 4BK5A 3U7YL 4YHZL 1WAAA 5IB3B 1A64A 3HI1B 4WGWB 2PYFA 3SDXE 4XP5L 4L3AA 3RY5A 2HAZA 4YHMH 5IFHL 2AVGA 2OQJB 3I6LE 4OB5L 5HGHA 4QRPE 3HZVB 3OF6A 4IS6A 1J87A 3REWA 4IOFC 1EUTA 4KUZH 2EYRA 3N85H 5F96H 3TA3A 1PKQA 4XX1G 3SCMB 4OCYH 4NWUL 5IHZB 1LP9F 3O6FD 4P4RA 2AS5M 2V9TA 1NGPH 2NXZC 5HYSG 4DKFH 5B21A 5IROC 2JIXA 3QQ9C 4LRNH 2RR3A 1A02N 5F8RC 1BPVA 2DQCL 4UTAH 4DW2L 2UWEB 1YA5A 2IG2H 3FQXA 4OF5A 5D2NB 4ZAKB 1RZKH 4KJQD 3MV7D 4W4OC 4ZUUA 4P23D 3VFVB 3SDCA 3LRGA 3PDOB 4Z5RA 4P59H 2A74A 4DJMA 1BQHG 4UT6L 3QEUB 3V6OA 3T1WA 4X4XB 1MWAH 1LHZA 1ND0A 1FYTD 5GGQL 1L0XA 4QHNB 1X5KA 2CLRB 4P57B 1Y6NR 2E3VA 3TT1L 1FNSL 2VDPH 4KPHH 3AXLB 4JCLA 5E6IB 4WI6A 3ZYJA 4X8JB 2AEPH 5C0IB 3RJQB 4U1KA 4Y16D 5HTSA 2AXGB 3SDXB 2HT3D 4NO3A 1KJ2B 4NKMA 5FO8B 5ITBH 5SWSB 4YNYA 1BIHA 4I4WA 4QRPB 1NEZG 2IAMC 3QZWB 5CMAA 1QRNE 2HKHH 3JV6A 4F15B 5C7XH 1F00I 2E5EA 2VABA 3IKCA 4IIQC 4K55A 4MJ4A 2VXQL 2OR7A 3OBAA 4PFEA 3MBEC 2FATL 3QJFA 4X6FA 3TJHA 2XZZA 4PJ8A 4MZ2A 2P44B 1PGRB 3H9HB 3H0TA 3QEHA 3QAZC 1K4CA 2JF1A 1ORQA 1HYSC 1RULL 1MWAA 5C0NC 1RHHA 5HGGS 1B0RB 3PWUA 4HJGA 2JJUA 4YPGA 3FHAA 4Q7DA 4YXLL 2DM2A 3L1OL 1R3JA 3LKNA 2JB5L 2ICEA 4MS8C 4OV6F 4OLEA 2NPLX 3W5NA 5EN2B 3DX6B 1SM3L 3HMWL 2N1KA 2XRAL 1QLFB 1V3KA 5C08A 3WFZA 4YQXL 2W0FA 1Q94A 1WEJH 5T3XD 2D7QA 1INEH 2F8OA 3IS0X 4JB9L 3O0RL 2VAAA 5CSGA 2WIIA 1Q1JH 1JPFA 4JQVA 4UOW1 5IT2L 2WP3O 4JQIL 1VACA 2HFTA 3GUTA 3MUGB 5JA9A 4R3SA 1D5IH 4KTYA 5C09D 1X7QB 1OD7A 1I1RA 4PGCA 5L2JA 3QWQB 1J18A 4ELME 3TT3L 3QIBC 3B5TA 1V7ML 2PXYB 5I71C 1QRNB 1AGBA 5FA3A 2W1NA 3MRBB 2DWDB 3RVXD 1CFNB 3G5ZB 4XBGA 1SBSH 4N5UA 4RMRA 4WV1A 3G5YB 3PGFL 4X99A 1L6XA 1OAZH 4R7DB 1CICC 4KJWD 5EIQA 1BEYH 2DKSA 4HIJB 1NL0L 4HH8A 5J1TC 4UV7H 4YBLB 2D03H 5BW7C 2C4XA 4NP4H 4JHZA 1WZKA 4YGAB 3U9PH 4H5SB 3BP6A 5GGSB 3D25B 3BPNB 2AK1H 3CSBA 1ZA6B 5CEYA 4EKXA 5D7IA 1K3ZA 3WLWD 1YEFH 1JGVL 4YZFF 4QLRA 1H3PL 1FJ1A 4KK9D 3PL6A 4KU1A 1I9RL 4EDWH 1F02I 4AIXA 2QQNL 4HJ0D 3LS5H 5IB3A 4NWTH 1U58A 1QFHA 1F4AA 4DK3A 2BY1A 2OQJA 4Y4FB 1DBMH 2ITCB 3HZVA 5DUMH 5F88A 3CD4A 1A7BA 3X11B 1EX0A 1LO4L 1SY6L 1OAKH 4BZ2L 3KR3H 4ELMB 3MJ7B 3SCMA 2CK2A 1MPAL 1ORSB 3JTTA 5HBBA 5IHZA 3GIZH 1JRHL 3ILQD 3ZMRA 4AQ1B 4YHLL 4NZUL 2HJFB 4N0CD 5IMOB 3MJ8B 4M6OH 3SGJA 3P9LB 4HKXB 1NGXA 4QXTB 2UWEA 4PGDA 1NUNB 4HX1B 5D2NA 3VGAB 1RUMH 1IBGL 4WWKC 1G7JB 3VFVA 5ETUB 3PDOA 4ONFL 4UNTA 1B90A 1OARL 4MA1C 4XAKE 3SBWA 4QHNA 3P9MB 1RD6A 4Z76A 4P57A 4OIAA 3JV0A 5DO2C 3SY0A 2H3NB 3ZHLA 4G80B 3AXLA 4U1JA 3OX8B 4X8JA 4KJPD 5C0IA 4GSDH 3HRZA 5IHBA 5IB4A 1EHXA 4MCZA 3U2SB 1NFKA 1I8KB 1CS6A 4HG4J 5HHXL 1KJ2A 4XVTH 5FO8A 5DEFA 1A6WH 3WKMH 5SWSA 3VA6A 4QRPA 3SGKC 2V2XB 4OLXL 3TJEL 5DWUL 1O7SA 3QZWA 3T0ED 4F7PB 1EDQA 5MI0B 4YHKH 3EDJA 3CFEB 2C1OA 2XACC 4I0PB 3GK8L 3LVEA 3H9HA 1T0NB 4HXAH 3WMSA 1WGOA 4HKJB 1P5VA 5TE7L 3ULVL 3MRMB 1B0RA 1S78C 3C5ZB 3UTPD 2Q20A 3L9RB 4ZXBB 2ZCKH 4MVBC 2CK0H 1I3GL 1CN4A 4EIGB 1BVLB 2VLJE 1R3HA 2DWEA 5LQBL 2XT1B 3FT2A 1URLA 3DVFA 3VXTB 5EN2A 2RIKA 5KN5A 2P1YA 3EYSH 4D2NA 4M7KH 1QLFA 1YY9C 3VU2A 1VFOA 5J12B 3ZLQC 1A7PL 1OAYH 1L7IH 3NH7L 3O45B 3DO3A 1JZ6A 4CBPA 3R8BB 1H15A 1ZLVH 3MUGA 3UAJD 1IL1B 4KVNL 1X7QA 4MQ7B 5B4MC 4FP8H 3JZ7A 2FIKB 3EUUA 3WJJC 3QG7L 3JTSB 2BOBB 4F9LC 1M05B 1T04B 3T3MF 5EFIA 1DZBA 1RFDL 4NPYA 1F90H 1MSPA 4LCIL 1JRHI 4EEEA 3MRBA 1HYRC 2DWDA 3MJ9H 1CFNA 3G5ZA 1KCVL 3VFNB 5FYKE 1MLCB 2CUMA 4MA3A 2SEBB 2A77L 1CDJA 4R7DA 3ESVF 5T1KD 3SJVA 4OD1H 5D7JB 1Q9LB 4CDHA 4HIJA 4MJ5B 4DVBB 5HDQL 3KAAA 4XPTH 2MFNA 4L8SA 1MHPL 3CIQA 4H5SA 1A2YA 2VLJB 5GGSA 3D25A 1ACYH 3ARDA 1Y0LB 4ZYKA 1UACH 1ZA6A 1UWGL 3RP1A 1SEQH 1DQLH 3BJ91 5HVHC 1IMHC 4APQD 4HK3N 2H2SD 4OCRL 4POYA 4OCSH 1FFPA 5EOQH 5F1SA 2EZ0D 4JFYB 5C8JB 4IOSD 4Y4FA 1JHLH 1WBYA 4TULL 3ARFA 3DYPA 3DMMC 2L7JA 1F42A 1IEBB 5LVEA 1AH1A 5F7YC 4GBXD 2AKRB 5KVGL 3O2WL 4ELMA 4P5TC 3MJ7A 5GGTH 1I85A 2VDLL 3P4NB 4ZTOH 1Q9OB 2UY7A 3B3IB 1ZMYA 5JW4N 2HJFA 4GG8B 5HHMD 4LLMB 3MJ8A 2YUZA 4PBVC 4OZHE 2CRZA 4QXTA 2VDOL 4U1MB 1KB5B 1WWAX 1FG9C 4HX1A 2WBJC 3OAUL 3L3GB 1A21A 3VGGA 1IT9L 3S35H 1G7JA 5CEZL 4ZFGH 3TESA 4Y2OA 4JHAH 2LAAA 4ZODA 3JWOC 5A2IH 3P9MA 1LEIB 3C8DA 5IMKA 1PG7W 2DKMA 5EORL 2VJXA 5I8OL 1GC1C 1DBJL 2H3NA 4KI5D 3OKNB 3UTZA 3UJJH 3IF1B 3OX8A 5F9JB 4XMPH 4RMSA 1UG9A 2EIDA 1I8KA 3QO0B 2AEIT 5HHOD 1U2HA 3WHXA 4PLJD 2G5BB 4JFED 4K94L 4RCAA 5IOPB 1F6LL 4M6AA 4PB9H 2DRUA 4P9MH 4F7PA 3LOWA 2VMFA 5HPOA 3ILPB 3EOAB 3GHEH 3DXAD 3A6BL 1XZ0B 4O02L 5E8OB 2GITB 4PTTA 3CFEA 3KYKL 4Z7WE 4HUXB 4I0PA 5IFAH 4LHJB 3RZCC 5FUCE 4G9FD 4CNIB 4WFHE 1R3IH 4HUNB 5BXFB 3MGOB 1T0NA 1Q9KB 1MCOH 1KCGC 4PRID 4U49A 4OZHB 1TZGL 3MRMA 3C5ZA 1PSKL 3HC4L 5L7XH 5E8EB 3A6CH 4ZXBA 5E2WH 1IGMH 1NAMB 3U0WH 2QKIB 4Z78B 4J12A 5IVXE 5C0BE 3UROR 4NBXB 1OTSC 4JVPA 1J0ZA 5JW4Q 3TPUE 3O3DB 4HPYL 2HN7B 4HUWA 4K3DH 4WTZG 2FX8H 4IOFD 1FZKA 4XC3H 4HDIA 4FQQA 5C07E 2ICCA 3O45A 4IMLA 3KPOB 5H37G 2BVYA 3DHMA 5FDWB 2NXZD 2D7OA 1LE5B 2R29L 3QQ9D 4JKPL 3GM0A 2MQ0A 4NT6A 1IL1A 3BKJL 2X4UB 1KENL 1FCGA 4FQ1L 4MQ7A 3AMLA 5IKCB 4HG4K 3MLUH 4JFQB 5FGRA 3JTSA 2BOBA 4LBEA 1MY5A 3H3PL 5I71B 1M05A 1T04A 2KZWA 4N5ED 5CJQL 3SDDA 1JHTA 2C26A 3LKRB 4UQ2A 2PR4H 4EN3B 3VFUB 4HBCH 2DB8A 1FSKB 1B4JL 1BX2B 4BELD 1F58L 2SEBA 2DQJH 3DVGA 4L3EE 1Q9LA 4S1SL 5BS0E 1L0YA 2YK1L 4MJ5A 2R23A 4DVBA 2PTTA 1UB6B 3ZKNC 4WUKH 4V1DD 4OLYH 2XKNB 3U4AA 5AAWA 1MEXH 5IVXB 5C0BB 1Y0LA 5D9SA 3OXRA 1KB5H 4JN1H 3V5DB 1H3VA 2IAMD 3TPUB 5EU5B 4G6KH 5FYJU 2AJZB 4FMFA 3MBED 5C07B 5CCKH 3QDJD 4P4KB 4JFYA 2Y36H 3VFGL 3PF2A 3STLA 4D3CH 1NLBH 1HYSD 5C0ND 2NZIA 3EO0A 3ARSA 3V0VB 3ORJA 1BHGA 3O3UN 2VTFA 4PBXA 4XCCL 2AKRA 4XPFL 5CD3B 1FVEA 1QFOA 1QR1B 3P4NA 1AO7E 3DSNA 1Q9OA 3B3IA 2NCMA 1V3JA 5F1KC 1MJJB 1YN6A 1YN7A 4GG8A 4NQUA 3T4AB 4MA7H 4LLMA 1TJIL 4L3EB 1KB5A 1RZGB 4PJ8C 4LCCC 5BS0B 3GKWL 3CLEH 1QA9B 4MQTB 4NHCH 4I9WE 4XP6H 1A1MB 3QQNA 3ERYA 2W9EH 5F9DC 3MRRB 1TQCB 1NKOA 1J0IA 2FJHB 2L4OA 3KYNA 1NAMH 1FV1B 2J3SA 3QIBD 1ZHNA 2J4WH 5HXMA 1N6QH 3G6JA 1XF3B 3OKNA 1TMCB 2I60L 3MLSL 3IF1A 5I8EB 5F9JA 4YHYB 3B8SA 2QJDA 1OW0A 3QO0A 3PP3K 3GSXB 2ZJSH 1CICD 3KS0H 2OYPA 4F7CB 4PJ9C 1MFNA 4O2CA 4OQTL 1CIDA 3UPRB 3EBAA 4UOJA 5IOPA 4QXUH 3VW3H 3ILPA 3EOAA 4HV8B 5ALBL 4OCWL 2GITA 5BCAA 5JIKA 1QR4A 5T3ZL 3NBNA 3V4PL 4M7JL 2C1PB 3V2AR 1AO7B 5HGAB 3VMOA 3RU8L 4L9LB 5BXFA 3MGOA 1Q9KA 2FYYA 1GGBL 4K23L 4L4JA 1J0JA 4E5XB 3MOBL 2P47B 4OZHA 2XWTB 2GUOB 3MJGX 3QULB 3V52L 4CKVX 4WV1C 3PWNA 2C9AA 1NAMA 2QKIA 4CVUA 4Z78A 4U6HB 3VRLE 1YQ2A 2EDRA 1KB9K 1YJDC 4JM2C 1P5UA 1E4XI 4PJ7E 3RWGB 2V5SA 3O3DA 2HN7A 4NQTA 3WHE1 3DYMA 2FGWL 4RA0C 3SE9L 3KPOA 3VDAA 1X5GA 3UYRL 1IM9D 2J6EA 4GAFB 3VXMB 4EBQH 4EDXB 5FDWA 1LE5A 3PWVA 3MMEA 3DLQR 2CIIA 3PL6C 1FVDB 4ZS7H 1DBAL 2X4UA 4NUJB 1DANT 1Z0NA 5IKCA 4X6CA 1MCEA 3H6JA 4WWKD 2VSDA 4XMLH 4XRCB 3LKRA 5FCSH 4P5KA 1KJ3H 4OLWL 2OZ4A 4EN3A 2I27N 3VWJA 1XF2B 1XH3B 4HS3B 4K8RH 1MJ8L 2CR3A 4JRYE 1DLHB 5DO2D 3BZDA 2ED9A 2FRGP 3AS1A 5TJWK 1A3QA 2DQFB 5TGBA 1UB6A 3OPZH 3T0DA 1ZANH 1U8QA 4EVNB 4PUBH 1CBVH 1A6ZB 1LO3H 4NZRL 3T08A 5JNYB 5F97E 1GGCL 4JR9H 4CMMB 2X1PA 3ZKSD 4N8PA 5IVXA 1OSZB 5JQ6L 2DQIL 5CHNB 3RUGF 3V5DA 2Z91A 1YMMA 5I6XC 5DQJB 1II4E 1J1OL 3TPUA 5DLML 5EU5A 5LWYL 3WN5B 2G60H 2I5YL 4YE4L 3ZYZA 4HMCA 2IANE 5C07A 2DQEH 5EOCL 1ZVYA 2X05A 3ZDYF 4FZ8H 1VDGA 1BZQK 5F1IA 3DMMB 4PLKC 1S78D 5JXEA 1MRCL 4MVBD 1RMFL 4FFWC 4P5TB 3VJ6B 3CZJA 1QR1A 3X13B 2ZCLL 1GSMA 1LDSA 2QSVA 5KSBE 1TTGA 3HPJA 3T4AA 5E99H 4JRYB 2OK0H 1BQUA 2J8UA 3ZTJH 5EU4B 3RPIB 5I1KH 4L3EA 1G6RB 5K9JL 1JGUL 1RZGA 2PYEE 1C5BL 2LU4A 4CU6A 1FGNH 1QFWH 4KZEL 2FL5B 2BNQE 5E08H 3RWHB 4JRXD 4LMQI 3Q1SH 5B4MD 1OAQH 3VFPA 4BFIA 1K8IB 4J1UA 2ZUUA 8FABA 1TLKA 2EE2A 5EIIB 3O3EB 4OTXL 4F2MB 1FV1A 3MXVH 3CAFA 2NTSP 3CGTA 3B9EA 2W9LA 1XF3A 2VDMH 4UV4L 5I8EA 2XTLA 5FYJL 2IANB 3MA9L 2EYSB 5F7UA 1JN6B 5D6DC 1B6DA 3GSXA 2NNAB 4XHJC 1ZGLP 3PV6A 3UPRA 4ZFFA 3H9SA 3MODH 1JTTA 5EOCJ 4QNPE 2IPTH 4JFPB 1P4LB 4R4FL 1F4XL 1ZLUH 4DKAA 4YC2C 4ORGA 2Y7QA 1L4IA 3RZCB 5I18H 3V6ZB 5IEKA 2C1PA 1NMAH 1AO7A 5HGAA 5GZNC 5KSBB 4H20L 4L9LA 1BFOB 4K7PX 4LASH 1CTNA 1G9ML 1IM3B 4J8RA 4EJ1C 1MIMH 4OD2A 2XA3A 2GUOA 3QULA 4HUKB 4KKBD 1AD0A 4EZMA 4ZO9A 2PYEB 5C9KA 3O6LL 4YWGH 5CJXA 2BNQB 2D7MA 2X4PB 5F71A 3UYOD 3IFLH 1ETZB 3RWGA 4GS7C 1S5IH 1A9EB 4L8SC 3ULUE 4NO0D 3ZTJG 3U79A 1EZVX 5TH2B 4U6XB 2NW2B 5KZCB 2HFEA 4TPRL 1S3KL 4JFHE 3VXMA 3NCEB 4IDJH 3R4DA 4V2CB 1QSFE 4HXBL 2BXZA 3MLXL 1FVDA 2AJSL 1TDQA 1R6VA 2N7BA 4M3JA 1D6VL 2WBJD 1CFVL 4K7PY 3RWFB 4GRLC 4LP5A 2ZSWB 3WD5H 5HYJE 4XRCA 1IGFL 2GAZB 2D2OA 5DJCB 2Q86B 4FQCL 3UZQA 4TTDC 2BXYA 3H3BC 1G9NC 4JO4H 5I16B 1DEEA 4BSVB 4P2YA 4OFYD 2YD1A 4NGHL 4CJ0A 4WI4A 1I1AC 4EVNA 1A6ZA 4HIHB 5JNYA 1EZVY 4CMMA 1IKNC 4GO6B 2AI0H 5KSUA 3VGDA 1VEPA 1WZ1H 3QFJA 3QEQE 1JNNL 1MAMH 2EKJA 1G6RH 4G7YH 5CHNA 5DK2A 5CJOH 5DQJA 5TE4L 4UTBH 3NCFB 1JYVA 5GPRA 4LAJH 3RDTA 1IGIL 4JFFD 1ZT7B 1ULVA 5I1HL 3MGAA 4OKVB 1LP9E 3RZCD 1EFXB 1HH9B 43C9A 1GC1H 5ADOH 1A4JB 2JELH 4FQLH 1MCWW 1QSFB 1AHWB 1DCLA 1QSEE 2IQ9H 3WYRA 3MREB 5ESAB 2BP3A 4N8VB 5BV7B 4DN4H 4NCDA 2BNRE 1T7WA 1CK0L 2BFVH 2XOTA 4N9OB 3OGCB 3QHTC 2PYED 3X13A 1OTSD 4Z0BH 3KGRA 5DJ8B 3QXDB 4HWZB 5HDOA 4JY6B 5FB8B 4LSQL 5IBTL 5DS8B 1CF8H 2Z4QB 1JPGA 4JRYA 2JK5B 3MRPB 3ARRA 2PKDA 3RPIA 1G6RA 3PHSA 5DGRA 2WLZA 3SOBH 3BH9B 1QACA 3B9KC 4ZO7A 1FIGL 1N4XL 2FL5A 1JGEA 5AWNL 3RWHA 2R69H 3V7AE 1ZV5A 1K8IA 5K33A 3QEQB 1V8HA 1RUPH 2FR4B 1A9BB 1OLZA 4X7SH 2AJXH 4HLZH 2QSCH 2ZCHL 4ZOCA 4ZG1A 1EVUA 4LIQL 1CGUA 5JHDE 1FL6A 3SKMA 2ZUQB 3MA7B 2EYSA 1LP9B 1JN6A 2AQ3A 2WWKO 4PJ9B 4IJ3B 2NNAA 1AQKH 5E5RB 4PIRF 1MJUL 1QSEB 3ZKND 5T1LB 1FZOA 1CT8B 2PF6A 4K7PL 1G7QB 1CL7H 2BNRB 4B41A 4MGXA 4Q9RH 1BBDL 1MFBH 3KXFA 4Y5XB 4RFNB 2DLEA 5E2TL 3T4YB 2BSSB 2DM4A 1QLRA 4LLAA 5KSBA 1QBLH 3SDDC 3BXNB 4GRMB 3E2HC 1ZOXA 4ODWB 4PB0L 1A3RL 5GRXG 1IM3A 1RIVL 2R15A 2AABH 5E9DD 2Z35A 2GJ6D 1ES0B 5E5MB 2MPAL 1CGXA 1UH3A 2F5AH 1RVFH 4JFHD 3BGAA 2NW3B 2EDOA 3IS1X 5I9QC 1N64L 2BNQA 2YPLE 2X4PA 3KPRE 2EECA 2B5IB 1YEJL 4XPAH 1S9YB 4DQOL 3HRPA 3QJHA 4LLDA 3RWCB 4LDOB 3CSGA 5F1OB 5TH2A 4KK8C 3C5JB 5CGYC 3LD8C 2LABA 4LARL 4WY7H 3WFDH 5HYJD 1MREH 3GGWA 3MLVH 4QGYA 4ZPTB 5DD5L 5JHDB 2H32B 4M43L 1LO0H 3ULUH 3UYPA 1JWSB 4MXWH 3AB0C 4PJ8D 1CGVA 2VN4A 4HLZG 5IVOA 1IGJB 2LVEA 2R4RL 4DGVL 4AK1A 1FYHB 4UNUA 1ZHKA 4RMTA 1T1ZB 2Q86A 5DJCA 3B6SB 2E9JA 2XZCH 2YC1A 4S0SD 4BSVA 5EU6A 4C83B 5ESVB 4NM8L 5JMRA 3UPCA 5DEZA 4UAOC 1FQ9C 3W2DL 4JVWA 3GNMH 4PRAB 1FZJB 3SE3A 2YZ1A 2VLRA 1T1WA 5C86A 3L5IA 4GW1B 2P4AB 5IM7B 1F6AA 2UZIH 1JWUA 2PCPB 1MFEL 3T0XA 1JYWA 5AD0B 3GZKA 4S1QH 1IAIL 1WF5A 1SHMA 2YPLB 4PRHA 3KPRB 3MBXL 5D7KE 4WEBH 4HULB 5J56B 5SWZD 2MKLC 2EDBA 1Z0MA 1ZT7A 2DBLL 3BX7C 3S36H 2EH8H 3BN9C 1T5WB 4Q0XL 5DJ6B 1FDLL 5B22A 3OSKA 5BVJB 5TQ0L 2LTQB 1INDL 5ESAA 1TJGL 2DQTL 5DJ0A 4PJGA 5GISL 2FWOB 3OGCA 4PV9A 5F9AC 3VXUA 5B8CA 4JM2D 5JOPD 3QXDA 2OTPA 3BDBA 5DD0L 5KSVB 4CMHB 5L88L 3TYFA 3KJ4C 1OWRM 4YDKL 5DS8A 1DEDA 2Z4QA 4K3JH 3MRKB 1RJCA 2JK5A 3MRPA 2B4CC 3VXQB 1JPSH 1I3VA 4P3WA 4UT7H 5IGXH 4J3WA 4X4MA 4MDIB 2R8SL 2IH1B 2XPGB 3PL6D 2I07A 4JZOB 5IIEA 1FNGA 2ZUTA 3VRJB 4R4NC 1X5XA 1XCQA 5DHXB 3LY6A 3QEQA 3SEPA 5IJKA 4FFYL 2FR4A 2EDEA 4WI9A 3NPSB 3OR6B 1P7HL 1YJDH 5IVZA 2R0KH 1DFBL 4NQDA 2CGRL 1EGJL 5J13C 3MA7A 4NN7C 1LP9A 2CKBL 2D4FA 1LDPH 1RJZB 2F5BH 1VCAA 4GKSA 4AENB 5E1AB 4ODVL 1CT8A 2AEQL 1NCAH 4UDTA 4YHIB 5JPMB 1G7QA 2O5YL 2HT4D 3RX8A 1JWMB 4JJ5B 4Y5XA 3ZDZF 2VC2H 1KCSH 4ZOEA 1SBBA 1CLOL 4N1EA 3KLAA 4GRMA 5C0DA 2G75B 3S7GA 43CAB 5JW4R 4X4YA 4PRNB 5KTEH 2WINB 5I66B 4PJDF 3RIFF 4Z95L 4O5LL 4R26L 4OLVH 3RIFK 3Q6FA 2IEPA 1TCRB 1OP3H 4PLKD 4KHTH 1X6LA 4GS7B 1DQDL 1NC2D 3LN5B 5GGRB 1CG9B 1ACZA 3M1BB 4FFWD 3WFCL 5CD5C 2AW2A 2D7PA 3T3ME 1C1EH 1EV2E 2X6MA 2Z0BA 3UJIH 4L8CB 1MI5A 4MSWB 2V5MA 3EYUH 5JOFB 4ZPTA 1AKJB 2H32A 1QYGH 5FAAA 5E8DL 4ZD3L 2W59A 3MX0A 3SO5A 3LSOA 1MUJB 2ZNXA 3BVNB 1M4KA 2UVEA 4BSWB 1RUAL 3P77A 1WIUA 3QWRA 1N3NB 3WL9B 4I3SH 2YSSB 1NGZB 3MLZH 3WFHA 4TNWF 4HFUL 1Q0YH 1T1ZA 3DUHA 5GXBB 3B6SA 3DGGB 2IGFL 2ESVD 2VAJA 4TNWK 4XXCC 4GRWE 3L5WB 4Q97A 4DKDC 3HZYB 3Q5TA 1DLFH 2OXGA 1G0DA 5GJTL 4XAWH 2VQ1B 4C83A 4F57H 3QWOB 3AREA 4S1DC 4YO0B 4OLUH 4PRAA 1AIFA 1FZJA 1LD9B 1YQVL 4N90D 2H8PB 3ULSB 2DDQH 3RGVB 3N85L 3Q6GL 4GW1A 5IM7A 2PCPA 5EO0B 4XHJD 3EOTH 2KZ1B 4H25B 2X7LB 3KPRA 4LRNL 4XMKH 3TYGL 4UTAL 2M26A 3P73B 4FQXC 4U6YA 1U8LB 2XZQH 5GZND 1T5WA 4UT9H 4OT1H 4XNYH 5DJ6A 4LAQH 5E1HB 1N5AB 5BVJA 1MWAL 4DWHA 1ONQB 2ORBH 1PDKA 1EAJA 3QDMA 3SJVD 3IDJA 4NUGL 5DURD 2VUOA 2Z31C 4KDTC 4LSPH 2C7UB 3MUZ1 4F37F 4GRWB 3MRKA 5ITBL 3DECA 4UILL 3VXQA 1NH6A 3ARDD 4F37K 3B9KB 1DBKH 2YD4A 1U42A 3MYZA 4RFOH 2HKHL 2E6PA 5C7XL 1GCFA 3TF7C 2XPGA 3GEWB 5T1DH 3DUUB 4I13B 5IHLB 2KL6A 4WHTA 1IJ9A 3CU7A 1JPTH 4ERSH 1KC5L 2Y07H 2DIJA 4OGZA 1I9IL 4GRLD 4RMVA 5IMLB 3CH8A 4U2YA 3WIHA 1PYWB 2X42A 4DTGL 5KANG 3ARFD 5DGQA 1MRDH 2EEDA 4U1SA 4TTDD 1IAIM 1K3IA 3DYOA 4FQ2L 2MOVA 3IXAB 3U0PB 1RJZA 3MQIA 4K9EL 1U3HC 1KN4L 4CN6A 1I1AD 3UBXB 3QXVA 4K7FB 4YHIA 5JPMA 2YD7A 1HHHA 1MCJA 4JJ5A 1FC2D 2IMMA 3MNVB 4WTXA 1TQBC 1HDMA 5SX4H 1VPOH 2EH7H 3PWJB 5E70A 4G6FB 5C0RH 2Y23A 2F54E 1RY7B 4TSCL 1SYSB 4R0LA 4BM7A 5CZVH 4PRNA 5DFTA 2WINA 5I66A 3IAQA 4NRXA 2XTJD 1ZTXL 5HHNB 3WDJA 3IDUA 1DQMH 5B3JF 5IVNA 2X41A 5T5FH 5IESH 1AXIB 3DVNA 2FO4A 4HF5L 1TCRA 3AC0A 3GO1L 4JJHA 2P5EE 4LPUA 1L9NA 3LN5A 5GGRA 4WHYG 5BOZG 2KPNA 1CG9A 1OAZL 2EDYA 3FQRA 3BIBX 1BJ1J 1MAKA 1U36A 5BMFH 4NQED 4MSWA 4UV7L 1AE6L 5JOFA 1UEYA 1DSFH 3VE0A 4D0CB 1AKJA 3N1MC 3MNWB 3H42L 3X3GL 3DURB 5I17B 1U8JB 5I1LA 3NFSL 3AB0B 2AK1L 1NCTA 1MUJA 1F8TH 2NY0C 3BVNA 5BQ7B 3BW9A 3B9KD 1BGXH 1UM4H 1YEFL 5IR1B 2X4QB 4GKZB 4EDWL 5GGSY 3HLAB 1N3NA 4RX4D 3WL9A 2YSSA 1NGZA 3CK0L 3NZHL 1KYOK 3HFML 4QCIB 3DGGA 2Q3ZA 3ZT5A 4JG0L 1IARB 3PXHA 1U8PB 4XCFH 2RCSH 3MO1B 4XVSL 2VQ1A 2BVPA 3KNBB 5MENE 3CH1A 4NN5C 3QWOA 1CU4H 4YO0A 3ULSA 1LD9A 3I2CH 3RKDC 2H8PA 3FOLA 4KVCH 1OAKL 4F7EA 2ADJB 3BESR 3RGVA 1TFHA 1KJ2L 5EO0A 2HLFC 2NY4C 3QRGL 4GRWH 3W9DA 3K7UA 3KG5A 3GIZL 1S7XB 2BX5A 1HE7A 4NO2A 3SPVB 2P5EB 5KVDH 2IBZX 5EULV 3E6FB 2X4NB 4RBPH 3P73A 3GMOB 3V79C 5GGVY 4LDLB 2R4SH 1RUKL 3GI8H 3ARVA 1U8HB 4O9HL 4PJFF 4QWWC 1U8LA 4FTVD 1DR9A 4YEEA 5FDYA 2P7TA 3SDDD 3AY4C 2CDEB 2V2WB 3GSNB 3C2SA 1NMCC 4JREC 5D1XB 3C2AH 3HMXA 2V17H 2V7HB 3S35X 2NX5D 2A9NH 5D7LD 2GCYA 2F53E 1X4YA 5I0ZA 2EKSB 1INQB 4OAWB 4WHCA 5FUZH 1VGEH 4Z9KB 12E8H 2I24N 4KK8D 5CGYD 1A3LL 5I1GH 2W38A 2WNGA 2G9HB 1CXEA 1S7RB 3LKOA 4P99A 4I2XE 5HHQB 3DUUA 1NUDA 4P5MB 2BY0A 2NYYC 1MCRA 3MFFB 1CTOA 1FBIH 1KIQB 2XZAH 1UZ8B 3OJ2C 3TV3H 5JW3H 4U3HA 3BT2L 4M93C 3GMRB 5IFJB 2YUVA 1AP2B 1R3LB 5IMLA 2FZ3B 1PYWA 3CMOH 4Y5YB 3H8NA 4P2RE 5FYKU 3S98A 2ZCKL 5DMGC 5C3LD 5EOTB 3ARBC 1DVFB 1J0KA 2EEBA 1B2WL 1RV6X 4ZO6A 3IXAA 3U0PA 1UH2A 4BK4A 3K1KC 1T03H 3EYSL 3AUVA 3AMKA 1OP9A 2F54D 1EHAA 3WO4B 3MPCA 4UB0L 5CIPH 3BDXA 3GIVB 3IFOB 3D2UB 5A40E 2YEZB 3KPPB 4JHBA 3MNVA 1I7ZB 4X9GA 2F53B 3MLWL 4M7ZC 2CKNA 3PWJA 2CUIA 1KCRH 3A67H 1Q8MA 4Y2DB 3E8UH 1SYSA 4BSJA 3D39B 4Y19E 5DJAB 3U4BL 3BN9D 3ZDXF 2EE9A 3LH2H 4X8XA 4I2XB 2NLJB 3GSOA 3MJ9L 1CDCA 4QT5B 1FC1A 1J10A 1IZJA 1P6AB 2Y9RT 1TJHH 5FGCE 5E03A 1G9NL 3T3PF 5LCVL 5GS0L 3C8KB 4OD1L 4PJ5A 2EDWA 4LKXB 5I19L 5J89A 3LMJH 4XBPB 5GGVL 3O8XC 4LHQB 1FNLA 4P2RB 5EB9A 4D0CA 1FRGL 3MNWA 5I17A 2AXFB 5DQ9B 4L9DA 1UACL 1CFSB 2DTSA 4D0DB 5BQ7A 2LQRA 1DQLL 1BVKB 4U7MA 1A7RH 5E00B 3RL2A 5IR1A 5MEND 3ECBA 4GKZA 3HLAA 1X5ZA 3GSNH 4OCSL 5D1ZC 5EOQL 3EFDH 1BWWA 4QCIA 2ZPKH 3HC0B 3QCVH 3RUGE 5C9JA 1T66D 1QBML 1P4BL 3VRIB 1JHLL 5B8CC 1U8PA 4F7MB 3MO1A 3QUYB 3KNBA 3LN4B 1KXQE 5DYOB 1MCNA 2CDFB 4N1CA 4M4PA 4Y19B 3P40A 3THML 2ADJA 2JJSA 5GGTL 4P3CH 2BJML 3ZDYE 2HLAB 3TBWB 4N0UE 1KOAA 2CUHA 3V5HB 4Z7OF 2NXYC 5CS7A 3CFDB 4I8DA 3RBSA 1V7NH 5TDPB 2MQ3A 5ISZE 3BRDA 5FGCB 4X7CC 4AZ8A 1ODAA 3E6FA 2H9GB 4WRLA 1HILB 3JWDL 4UBDC 3GMOA 1K8DB 1KTKE 4NM4L 2DJUA 1U8HA 3S35L 3C60B 4ZFGL 5IW6A 3HC3H 5TF1H 5C2UB 1JZ7A 4HPOL 2HFGL 1A7QL 2CDEA 4WO4C 1FH5L 2VZTA 4ONGH 3BP5B 5D1XA 2H1PH 3VWJD 1SY6A 1GGIL 1FNHA 3I3DA 2V7HA 3DX8B 1J11A 4ZUVB 4NJAH 3G5VA 1W0YT 4JEGB 5K93A 5FYLE 3ET9F 3UJJL 5GHWL 2EKSA 3LRSB 1INQA 1JZ8A 1OSPL 4OAWA 4LSUL 3MUY1 2VWEE 1BIIB 3CXDH 5CD5D 2AQ1A 3BMWA 1NLDH 1P7QB 2AJVL 3X12B 2BMKA 1DUZB 3RUGB 1KLFA 4WENB 4JY5L 1F4WL 3RVUC 1S7RA 2P8MB 1YMMD 1M7XA 3NN8A 4LP4A 4LVNB 2E6JA 5HHQA 2BERA 5H94B 1SVCP 1UJ3A 4P5MA 4Y1AE 1KIQA 5J3HD 1BBJB 5IFAL 3FN0L 1NCDH 2EYTB 4N0UB 5IFJA 1AP2A 1G7HA 1MCOL 4HKBB 1R3LA 4OBRA 4JZJA 1MRFL 4Y5YA 5EO1B 1XIWC 5E2VH 5I1JH 2IPUG 5ERWB 1EBAA 5EOTA 5HYIA 2EE3A 4HWNA 4HEPG 3RFZC 1U3HB 1A0QH 4G6JL 4OZ4A 4S1DD 2FX8L 1UM6L 4JFDE 1Q0XH 1B0GB 3FO0H 3IFOA 4OIBA 1TQBB 1V5JA 2ADIA 2YEZA 3KPPA 4XVJL 1MCQA 3O4OB 4N8CH 3NCJL 1A4KB 2F53A 1A6TA 4HUVB 2C4FU 2G5RA 4Y2DA 2YUWA 5LG1A 5HYQB 4N0YL 5E95B 3BGMB 5IP4A 4RWYL 4L1DA 5TPWH 3D39A 4FQXD 1ZLSL 3TNMB 3AS2A 2O61A 3OHXA 4YXHL 1GOFA 3CJJA 4MX7B 1DN0B 3VXNA 3TN0C 1HI6B 1T5XB 2NLJA 4MNQE 4JHWH 4QT5A 1JTPA 1IEAB 4KKAC 2QV2A 4Y1AB 4HBCL 1TVHB 1YECH 1MY7A 3O2DH 2PW1A 4XTRC 4YK4B 3F6IA 3REVA 3SDXF 1CE6B 5KVFL 4LKXA 3TNNB 3H9SD 4XBPA 3U1SH 2N56A 4OFPA 3MCLL 2Z31D 4OLYL 4M8QB 4P2RA 1VKXB 1HHJB 5FYKL 1UQSB 5C0EB 1QBBA 3H2WA 2HRPL 3W82A 2A9ML 3QUXA 5DQ9A 4JN1L 1CFSA 1KB5L 1YEDB 5DMJB 5LXGH 3D6GA 4D0DA 1ZGLB 3OGOE 5IHUL 2QLVB 1BVKA 1MQKL 2WW8A 1I9EA 3FO2B 3QCTH 4JFDB 5ENWB 3ZTNH 5CCKL 3DI2B 4RGOL 3GSWB 3WXWL 3KYOB 3BHBB 3ARQA 4TSBH 2APFA 3FOMB 3VRIA 4GLRH 3LN4A 3RTQB 5ISZD 2CDFA 1UKTA 4ZO8A 2YRPA 3CVHB 4Y19A 1J1PL 2YMXH 1D6EB 2V6HA 2NY4B 1TCMA 1AY1H 2HLAA 1SMAA 3KPSE 3PHOB 3TBWA 1JGLH 4MNQB 2KBGA 3HI5L 3MV8D 3S34H 4CVWA 3UZVB 5GZOC 4H8WC 3D18B 4MA7L 5TDPA 4HAFA 1LEKB 5DFVC 1AQDB 4GMTH 1L8JA 1N5YL 1HILA 3QHZH 5A1AA 1K8DA 3VG0L 1F3RB 4NKDB 1E6OL 3C60A 2RFXA 4IRSB 4IRZH 4NHCL 2VDQL 3EYVB 4D9QE 3GMQB 1HXYB 4MJ6B 4XP6L 3FB7A 3SDAA 1HKLH 3DX8A 3D85B 1NAML 5F7KC 4WUUA 3HPLB 4ZTPH 2J4WL 4OJFL 1N6QL 4NJ9H 5C6PB 4XT1C 3ROOB 3QIWB 3T0WA 4IOIB 4UDUB 3LRSA 1RJLB 1U8OB 3Q2CA 2NY1C 1E4WL 4L4VE 3KPLA 3T65A 4AMKL 5DMIH 2ZJSL 5DMYA 1T1XB 3IDYC 1DUZA 3RUGA 3F5WB 3IT8D 2A1WH 3QFJD 2J6EL 2P8MA 3X17A 2FLBT 3DSFL 5D72H 3V6BR 5H94A 1ZLVK 3HAEH 3QBTB 3RDTD 4JFXB 5DF0A 4PP8C 2ZOKB 2NY0D 1OGAE 3G5XB 5AUMB 3AVEA 2EYTA 3KPSB 3LEVL 1F3DH 3NZ8B 2P8LA 2VXTH 4X5LA 3UDWA 4HKBA 5E2UH 2GT9B 1UH4A 5EO1A 2OZ4L 2OL3B 3PWLB 5ERWA 3F58L 3DARA 3QDGD 5F8QC 3LQZB 2MCPH 2H6PB 3OKLB 5DXWA 3SKJH 3BSZL 2QQKH 4AG4H 2VUYA 3RKDD 2Q1EA 5C6TL 4H88H 1B0GA 3B8YA 4GAYA 2HLFD 1V05A 4LLQB 1U0QA 1BZ9B 2YD6A 1ED3B 4D8PB 1A4KA 3JVGC 3VFTA 2HVKB 4HUVA 3QQ3B 4ZS7L 5I2IA 3WNOA 4O2EB 4L5FH 4L4VB 2GK0B 5HYQA 2UVFA 1JFMA 3BGMA 5DUPH 4JG1H 3G6AB 4GOSA 5FECB 3BQUB 3SN6N 4QWWD 1JHKH 4XMLL 4MX7A 2H2PC 1DN0A 4KRPC 3KPTA 2BDNL 1IEAA 4QHLB 1TVHA 1D9KB 1OGAB 3ARXA 4U4BA 3CVHH 5LKNA 5CLTA 1MCPH 4JFZL 4NN6C 3OKMA 1CE6A 4XPBH 3KPMA 5D1QA 2R0LH 2Y1VA 2I9LB 2WY3A 2IFFH 4BQCA 2YPKB 4M48L 4M8QA 4PJAF 3TZVC 1VKXA 3T2QA 2EDXA 3M8OL 1UQSA 3KXFD 5I1IL 1YEDA 3MNZA 3PIQB 3ISWA 3UJTH 1IVLA 1P69B 4Q2ZB 2R2EB 4NO5B 1T2QH 3AFLA 4JFDA 2VLKD 5ENWA 2NYYD 3HNVL 5MP6H 5JIHA 1TPXC 2VL5B 4MJIE 1RK1A 5FA4B 3GBMH 3F12B 3GSWA 3KYOA 3MV01 5E8PB 3BHBA 5E7BA 1OP5H 5F7NC 2YD5A 3FOMA 1BM3H 4P46A 4XNMA 1KNOB 3HS0B 3WFEH 2X70B 1CFBA 5DMGD 5EA0L 3CVHA 3IDGA 3ARBD 4GAJL 1I8LA 1T22B 1W72A 3PGCB 2PO6B 3PHOA 3BKCL 4S1RH 1UKSA 4MNQA 3H7BB 4TRPH 1T83C 1QPPA 1IC5H 3D18A 5E99L 2LE9A 3QI9B 4I18B 1AQDA 3ARGC 3ZKMC 5IBLC 5I1KL 3I6GB 3EO9L 4N1HB 1GOHA 4DFHA 3I50H 2NY2B 4NNPL 4XNUH 2DYPD 4OSUH 1QFUL 4LEOB 4IRSA 3UTSD 3EYVA 4KI5F 4Y4KB 1HXYA 3MV11 4Y5VB 5EC1A 4P3DA 2OJEB 3V9FA 2C3VB 2OL3H 3LKPB 1YYML 3F8UB 3D85A 1HWHB 2F19H 4V3EB 3HPLA 4UINH 1IRAY 3MXVL 5IQ9B 4I77H 1AGDB 2IQAB 3L5XH 5EU6D 5KSAC 3QIWA 3FKUS 4F7TB 3D9AH 4IOIA 4UDUA 1N26A 1RJLA 2VLRD 4MJIB 2NY3C 1EO8H 2QEJA 3BD5A 3F5WA 5KJRL 4N9GB 2P8PB 3MXWH 4PRHD 3O8XD 2IPTL 5BZDB 2JJTA 2AGJH 1PG7L 1JCKA 1QNZL 4P2OA 4JFXA 4JPWL 5ICXB 2ZOKA 4M7LT 3S4SB 3G5XA 5AUMA 1NMAL 3KYMB 3KPSA 1MNUH 4G6MH 3NZ8A 1IGYB 4Y4HA 3V7MA 5DZLA 3BPOB 5KBNC 3S6CA 2GT9A 5D1ZD 5ICYB 5IQ7H 3BN3B 3ZDZE 5A2JH 2DQDH 4ZPVB 3PWLA 5I73B 3TVMC 1PY4A 4MNHA 3LQZA 2DAVA 3NFPB 4LLWB 4XP1L 3VXUD 5KVEH 5DJYB 1YDPA 1J8HE 4OM0L 3IFLL 1Q9WB 1K9TA 4KY1L 3N1QC 5JPNB 1I1YB 4BFEA 4CVZA 2E8ZA 4P9HL 3SE8L 2FX9H 1BZ9A 1ED3A 3X3FH 4D8PA 1MHHB 2ZKHH 2NXYD 4PP2A 1G7LB 3W0WA 2ZUVA 3QQ3A 2R1WB 3LV3B 1AJ7H 3G6DH 3R06A 4O2EA 4L4VA 2GK0A 1I7TB 1I1CA 4UBDD 25C8L 2HKFH 4KQ4H 3C6LA 1IKFH 4XZUB 4FQHB 5FECA 1U3YA 2CSPA 3BQUA 2XQYK 3INUH 3DNKA 3EIFA 2LV4A 1AI1H 2MQCA 3WNLA 2YBRA 5I1EH 2B1HL 4NOBA 1G84A 1HINH 4WO4D 1FO0A 4U1GC 4NQDD 4QHLA 1XGUB 4QRSA 1E6JH 1A14H 1D9KA 3NAAH 5IB2B 2YS4A 3GBNH 4JO4L 1IGTA 2JJSC 1BD2E 4KAQL 3VMNA 4G5ZH 1PW3A 1BFTA 2OI9B 3GJFB 1YC8A 2I9LA 4X0KB 4M61A 4K3GA 2AI0L 4WU5A 5EUKB 4OGYH 1MAML 3VI4F 3WJLC 1G6RL 1L0QA 4FMKA 1J8HB 3PIQA 3RVUD 3VXOB 1A7NH 5CJOL 5F6HJ 4Q2ZA 2R2EA 3U7WL 4NO5A 1QUNA 2PTVA 1RU9L 3QUMA 3L7EB 5GS1C 1JUFB 1P84K 4GXUM 4FQJL 5FGBA 5FA4A 1HIMH 4W68A 1IQWH 1HKFA 3F12A 4GAGL 1AD9B 5E8PA 2FNBA 4FQLL 3VFWA 4YHPA 2IQ9L 1IC4H 4HS8H 1KNOA 3HS0A 4C54A 1XIWD 3S36X 4X9FA 4Q9BA 4R2GC 2E27H 2GTWB 2BFVL 2UUDH 4KROB 5DRZB 2VDRL 3L3KA 4Z0BL 3PGCA 4LCWE 1MI5D 2ITDB 2B0SH 1WUNT 4MXQA 5B39B 1I75A 2QQLH 2O26U 3S3JA 3R0MA 5C0CD 1UJ3C 3QI9A 4I18A 2VKXA 5EU7C 3QUZB 3BKYL 4J3SA 1BD2B 3I6GA 5F9OL 4E41D 1U2CA 3SOBL 1WFTA 2RAMA 1BFVH 3WLBB 4ZUSA 4LEOA 4Y4KA 2DQUL 2R69L 4NZDA 4Y5VA 1EMTL 1AC6A 3DPBA 5KW9L 1MIEH 1W8NA 3LKPA 3S5LB 4Z7WF 1GH7A 2QSCL 1UC6A 2DL2A 4KMQA 3TN0D 2IQAA 4F7TA 3ZKXC 3ARED 4KKAD 5HY9A 3VH8B 1LNUB 5TE6L 4ZOAA 1CR9H 4MJIA 3IDYB 1W0VB 1Z6JT 1D5XB 4KQ3H 4XTRD 4ETYA 2KH2B 2GSIB 1YEHL 1FFOA 4LCUA 4N9GA 1WLHA 3S97C 1UA6L 4Z7QE 3EAKA 4WW2C 5BZDA 2HP4A 1ZS8B 3ULVC 1CL7L 5D7SL 1NAKH 2XY2A 5ICXA 3BE1H 1NKRA 4LCWB 3S4SA 3KYMA 1FFQA 1CCZA 1IGYA 4X98B 3SGDH 1H0DB 5B38B 3IJYB 2FD6H 1AR2A 3WHE0 1U8NB 1MFAH 2R0WH 4ZPVA 5AEAA 3QDMD 5F93C 3NFPA 3OKEB 3QDHA 4LLWA 5EZOL 1JNHB 4LU5H 2FJGB 1M7IB 4HIXL 4LSRH 4DEPB 3B2VL 1Q9WA 4H26B 1ZVHA 3GJFH 3GRWH 4XPAL 3LZFH 4Q6IB 3LB6C 3ZHKA 5JPNA 3U30B 1I1YA 5I1AB 1FL5A 4JDZB 3IETA 5B3JE 1T0MB 2AV7B 5F6IB 3WFDL 1MHHA 1MREL 3MLVL 4NFBA 4ZUTB 4DGYH 5GZOD 1G7LA 2A6DB 3LV3A 3ULUL 4LNRB 5DFVD 2DLHA 4HD9A 1I7TA 3R8QA 3QSKB 2JJVA 2P5WB 2O93L 4XZUA 1FORH 1JMZA 1RIHL 4RRPA 5I74C 5DD6B 3WS6C 3LQAH 4HWBA 1C5CL 1EERB 1YEIL 2VDNL 3RAJH 2JCCE 1XGUA 1EXUB 1N0XH 3IXTB 2Q6WB 1M7DB 5BV7L 5IB2A 2VH5H 1A6VL 3CDFA 1UWEL 5IG7B 3S96A 4AEIL 5SV3A 2XZCL 2EXWC 4KMTL 4QRUB 1XCTB 2OJZL 3DO7A 2OI9A 3TZVB 1BJ8A 1FGVL 4X0KA 3PHQB 1XGPB 2NY1D 3BJLA 4K3HA 2XG4A 1A1NB 5I75C 3BKMH 5EUKA 1FE8H 3WV0A 1HCVA 3MOAL 5F9WB 1HZHL 3PWPE 3VXOA 2PTUA 4DKEH 1QLEH 2ZWLT 2R0ZL 3JBG7 5IEHB 3QFDB 4JKKA 4LCYB 4PJDA 5LBSH 4F58L 1JUFA 1Z9SA 4FHBD 3IDXH 4KHXL 2ERJB 4X4ZA 4OUOA 2EH8L 1H3UA 5DI8B 3D69B 5JR1L 1AD9A 4UU9B 5JZ7C 1FP5A 1KPRA 2DLFH 2AJYH 3CFKA 1MCBA 3VWKB 5KS9F 1HQRB