2HJLA

Crystal structure of hla-b5703 and hiv-1 peptide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strong TCR Conservation and Altered T Cell Cross-Reactivity Characterize a B*57-Restricted Immune Response in HIV-1 Infection.
pubmed rcsb
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen B-57
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hjlA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2hjlA01
4P2OD 4IRSC 1IGYB 1FSKC 1YC8A 1GGCL 1PAMA 3QZWG 1JE6A 4R2GB 2ITCA 5J6GB 4WWID 3KPRE 1JHLH 3BH9A 3K1KC 2PW2A 2N56A 5JUEL 1QFUL 1IAOA 4ELKB 5C70A 3ZKQD 5I1CL 3FTGA 4FOMA 2PTTB 3DLQR 3BW9A 3TA3D 2HTLC 4QRSB 2WBJB 4GAJH 4YC2C 3HUJA 1U93B 4XX1E 4IDLA 1Z5LA 5CSGA 3NTCL 2PXYD 4IDJL 5F70A 3RI5F 1CZ8L 1IM9D 4PG9B 3ARGC 1SJHB 4TPRH 4GRLA 2YD1A 3DROA 5C9JB 3NCJH 1RUPH 1URLA 5CP3A 5DVOA 4E41E 4Q0XH 1CGUA 4X4XA 4YHOL 4YXHH 2DBJA 3QJHB 4EVNA 3KPNA 2A6IB 4UV4H 2I25N 4JFFA 4YEFA 4LKCB 3RPIA 1BIHA 1LMKA 4Z77A 3I6GB 2O5XL 2MKLC 1XGRB 1TCRA 4WHDA 2EH8L 2X4NB 4XNZB 5E00A 2DQUH 4X6BA 1OAUH 1WZLA 2YPVL 3QEGH 3TBSB 2FB4H 4JRXB 3HFML 3Q48A 3WLWD 2EDWA 3C2SA 5HTSA 4G3YH 4LBEA 1IRAY 4ELMB 4LEOA 5DJXB 1TTUA 1OT2A 2VDOL 3AXLB 4PRBB 3IDXL 4O9HL 4TVPH 3WHE0 1XF3A 4C56D 4Z9KB 3ZTNH 3Q5TA 2FJFB 3L6FA 1DEEB 3AB0C 3LCYA 1XF4B 1ZA6A 3MRPA 3EOBB 3OXSB 3V4VH 3UYRL 3QUKB 4APQC 4Y2DA 5EZIL 2ESVE 1YNTB 4LLQB 5C0IA 4N1CA 4LMQE 1KELL 4FABL 1CLZL 5TDOB 5DJAB 2J3SA 3IU4L 4WWKD 3OXSA 4F58L 3FAXA 1AD9B 3EDKA 1KYOJ 1Z3GH 3L6FB 1VFBA 2ZG1A 1MHHA 5FUCE 4P46B 3VE0A 4XCNA 1WWBX 3KXFD 2YC1A 4UTBH 4X8JB 2QADD 3MGOB 4EN3C 4I0PD 5ISZA 4AL8H 1XH3A 3HN3A 1FO0A 5SWSA 3TA3B 3VW3H 1S7QA 1MCOH 4ETYA 2Q76A 1JFMA 1NLDH 2EDQA 3O6LH 1BP3B 3FQNB 5M95B 1SY6A 2VZSA 1RHFA 5C07A 4Z7UB 5HDQH 3MR9B 3B9DA 2DL2A 4OM0H 2PO6D 4J8RB 4B5EA 1C5DB 4DGIL 1RIUH 4JFEB 2EYRB 4NKMB 5F7FA 2P5EA 4KUZH 5CEZD 5D6CA 4KDVA 4PJAA 4S1SH 3U48A 3DX8A 5DC0A 4HS6B 5FHAH 1AGBB 2JLLA 2HT4D 3BHBB 5CZXD 4PJDB 5H8DA 3OX8A 1IC5L 4WTXA 4CMMA 3BRFA 3CSBA 1S9XA 4DTGH 2HH0L 2PYEE 4CVUA 1YEDA 4HFUH 1JNNL 5D96B 5DLMH 4NUJA 4RIRA 1UM4H 3L3JB 4WO4D 4HGWB 4DZBB 3AC0A 3N9GH 2EH7L 4PJGB 1LEGA 4F9PC 3VXUE 1HHIB 1IC7L 4NKOA 4OD2B 4JDZA 2NY2C 3RWJB 1WK0A 2HWZL 3WFBH 4AM0A 3CMOH 1S3KH 1AXSB 1RJLA 5E2VH 1D5ZA 4P5MA 1HOCA 2VDLH 5T5NG 2Z31B 1U42A 5I1IH 4KC3B 1YPZE 5J7CC 2QQLL 3WNPA 2P5ED 5IROA 1MFDH 2ICWJ 3B9VA 1F3DJ 2DQFB 1FNGB 3WS3A 5ICYB 4XNQB 1RZJH 5GS1C 4CNIB 1KFAL 4M1CC 3ZYOA 1S7UB 3TPUE 3REWB 2APBA 2JCCF 3CZJA 3RUGF 3GNMH 5MP6L 4YNYA 3F8UB 3TBVB 4APQD 3CXHJ 4E9LA 3OF6A 2BK8A 4QXTB 4RGOL 1AY1L 4CL7A 1MFCH 5E8NB 2RIKA 4NO0A 2VZUA 4YBQD 3C8KA 4XC1H 3MCG1 4P3CH 4WO4A 1A6ZB 5JLZB 1A5FL 2FWOA 3RWDA 4YUEL 1T21B 5EOTA 4PLJC 1PLGH 5FEBA 3EO9L 1HYSC 1F6LL 4M1CD 4NKIL 4U3CA 3ARDA 1ITBB 4FFVD 3O4LB 3BT2H 4MGXA 2F8VA 1DLFH 1QYGL 2V2WA 2VSDA 4JLRB 1YJDL 4Y4FC 4OIIL 2O5ZH 3HC0A 2CDGA 3IS0X 5FB8A 1JMXA 1R0AH 1KLGB 4XGZB 4Z6AT 4I5BB 4HUXB 4GG6B 3VFGL 4GUPA 2CRYA 1VPOL 4PRHA 3JTSA 4Y5VC 1T7VA 1D6EB 4Y19A 1WWWX 3OBAA 1NGQH 1OWRM 3JWDH 3WNKA 2E7LA 3LY6A 3LS5H 5IQ9A 2PETA 5D1ZB 2Y06H 4X0KA 4GKOA 4KI1A 3PF2A 4W81A 5L2KE 3L1OH 3VFPB 3PDOA 1MQ8A 4XPFL 4WJ5B 1F58H 3GIZH 1FBIH 2Z4QA 3W9EB 1BF2A 1EO5A 4WWKB 3JV4A 1A02N 3LRGA 1JWMA 3BE1H 1A7QL 1AI1H 4KQ4L 1QLEL 5BV7B 3BPCB 3PXJA 4CDHA 1U2HA 3KNBA 4PRAB 1KEMH 5IHUH 5B8CA 4M3JA 1DDHA 4PJ9A 2BFVH 1I7TB 4I0KA 5ETUA 1KJ2H 1MEXL 12E8L 2FSEB 4N90E 5F7EH 2ESVD 3CH1B 4UV7H 1JL8A 3MV7A 1QFUH 1IZKA 1I7RB 4AG4H 1BFSA 1MCOL 4XNYL 3TO2A 3WNLA 32C2A 2XN9B 4RX4D 1MHEA 4MXWL 4S2SB 3C9NB 3DECA 5DJXA 5E6YA 4WW2C 1YYLH 5ENWB 4HJ0D 1RJYA 1V5JA 2AGJL 2E6QA 4NUGH 4Q2ZB 3UEZA 5IT2H 3EO1A 1DL7L 5FYJD 1YMHB 3O9WC 2ATKB 3B8YA 5FO8B 1CZ8H 1SYSB 2JK5A 3KJ4C 4KAQH 1W2KT 4M5ZH 2RQ8A 2VITA 5AG9A 1FFOB 1TMCA 5ALBH 4FQXC 1S78D 3PGFL 5D7JA 4H25A 4JPKH 3OPZH 2CLRB 3CVIL 1LO2H 5GZNC 5T1DH 2W65A 3DGGA 1G7PB 5AZ2L 5GJSL 3QI9D 2GTZA 4MD0B 3U9UA 1RZ8B 3VGEA 4JCLA 5CS7A 3KYNB 5F7LB 3TZVB 4OFKA 5E2WL 5D7LE 2BC4A 4PLNC 3NBNA 2VAAB 3MNZA 3MRCB 5C09E 2XZAH 3L3HA 3QG6A 4XNXH 1P5UA 4XPTL 2DWEA 3TVMC 1F3DH 3MBXH 4XTRC 5DD1L 5GGRB 4WGVB 3GIVB 3C6SB 3TT1H 1U8PA 4FFYL 4X99A 4HJJH 4HPOL 3GZKA 2IH1B 1C12A 4X80H 4EQ2A 8FABA 5F8QC 1JGUL 3OJDB 4JDTH 3OKYA 4UQ2A 3G9AB 2X89D 3FB7B 1YEEH 4QLRA 1U95A 4NOBA 1S7UA 1PG7W 2JB6A 4PBVC 4F7CB 5C8JB 5SX4I 4G7VL 5DS8A 5C0AB 4ZDHB 5EZJA 5DRZB 1QA9A 3HZYA 4HXBH 4X4ME 2NY4D 3RKDC 4DGVL 5E0QA 2FZ3B 3KLAA 2YBRB 4KK8D 3QEQA 1BQLL 1TTFA 1Q0YH 3P11H 4RMUA 3RUGA 1WWCA 4RWYL 1KCRH 2XZCL 1Q94A 5JHLL 2DWEB 4PJ8D 5DURB 1JHTB 1JGLL 4HIEB 2HVJB 3HPLB 5KAQG 2WANA 5IMOB 2CIIA 5C08D 4L8DA 3CMGA 3GJFK 4KQ3H 4GMSL 2VXQH 2QQQA 3S37H 2NMSA 3CC5B 3I75B 1YMMA 3ZE0E 3DX9A 1D6VL 3ZKMD 4QHKJ 3GSQB 1J1OH 4J4PD 3PV6B 3UJTH 4FQHA 4X6DA 3SKOB 1NMAH 1NGYA 3J8F7 2CRMA 2AKRA 2QR0B 5CJ5A 1QQDB 3GKZA 1BQSA 3RVVD 3U2SA 3RUGE 1OM3L 2JCCE 3BRDA 3FB8A 4ODTH 1IKFL 5MEND 3KPTA 3JTCA 1ZLVK 4KVCH 3QXUA 3RU8H 3O6MH 5ADPL 3KPRA 4X4MA 4D0CA 4N68A 1CS6A 4EI5A 1MIML 1NFDB 3CK0L 4YQXH 1MRCL 4AJ0A 4L8CB 4GW1B 3PIQB 5FYKU 5ALCL 4U1GB 5TGBA 5GGRY 4POYA 1EO8L 1IC7H 4JFHE 5CJ8A 1G6VK 2VLMD 3V4UL 4S1DD 3KXFA 5IB5B 2DQUL 1VGKA 3QIWD 3NA9L 3I02A 2P43B 1MQKH 1CCZA 3C5ZD 2X9XA 4QHNA 4OV5A 4OLUH 4WGWB 4R26L 4PV8A 2AXFB 3WFCH 2PW1A 3WNOA 5F6IB 3H7BB 3V6BR 2X6MA 3KJ6L 3ARFB 1QSVA 3GM8A 1R3HA 1EJOL 5FYLD 5J13B 1NBVL 5ESAB 2CLVA 3RWEB 5F9OL 5DHVB 3HG1B 1S5IH 2FDBP 3DETD 5FA4B 1FC2D 5F1IA 2DLHA 4O51B 4CADA 1HSBB 1RURH 4YHNB 4I13B 5TH2B 3FTGB 4WVRA 2DKMA 4YBQC 5DO2D 4O2FB 3RWGB 5F7YC 2W92A 5IQ7H 2ZCHH 1RZ7L 4E5XA 4S1QH 3VXRE 1FZJA 4M4PA 4FRWA 3RZCA 3ETBF 5GGSA 1GC1C 4P2RA 4P4RB 3MNZB 1Y0LA 3H9ZA 4V2CB 5L2JB 2X70A 3WD5L 2VR4A 3ZTJG 2GSIB 3R4DA 4XBEL 4ZNEE 3DRQA 1G7JA 4AMKL 5FYJU 1RUML 3HMXA 4QEGA 1JIBA 2H9GB 5C86A 1N6QL 2PTUA 3KVQA 4I9WD 3L7EB 3NABH 3QUYC 4XCCL 4TULL 3KYMB 1LK3L 3IAPA 5GS0L 4QF1A 1KJ3L 4HBQA 1A1MA 3V8CA 1RUQH 1QSEA 1IKNC 4HIJB 2Y25A 2FH6A 2JJSA 2WP3O 3WJLA 4C4KT 3OAYH 2BP3A 4M48L 2VQTA 3R8BB 5DXWA 1DQTA 2EYTB 1QR1B 4WEUD 4K55A 4NRZB 4QWWD 3UAJC 4BFIB 3AS2A 3ISWA 1HINL 4F33A 3W0WE 3H9HB 2R56H 5ICZB 1UACH 1BGXH 5K9KB 4YX2L 2W1NA 5D1XB 4HXBL 1RMFH 2YUZA 1OPGH 1INQB 3RJDA 3GSRA 4LCIL 5JIIA 5HHPB 4NQUA 4ZUWB 4RGND 3W9DB 5F3HB 2OR8A 2OJEB 3ARDD 4PG2A 1TVBB 4G9FD 4ZOEA 3TO4B 1T20A 3CSPA 2VLME 2I60L 2KPNA 5EUOB 4Z7WB 1UWXH 4M1GL 3TYGH 4HKZA 3OKNA 3FQWA 5B39B 4OZIF 2J7LA 5GGRA 5DQ9A 1MRFL 3WSQH 1P4LB 3S37L 2D7MA 3NAAH 3VXMB 1Y6KR 2XFXA 3WN5C 5FOBA 1VFMA 3IRPX 3QIUD 5D2LA 5E8PA 4G43B 5EH1A 3LD8B 4WI2A 3D0VA 5IVXF 4K94L 4I1NB 3IJHA 4QYOB 1I75A 1HNFA 1YNLL 2CK2A 4JFDE 4OB5H 3GK8H 1C7TA 4GQPH 2YK1H 1S7VA 2AI0H 5T3XE 3OPZL 4K3JL 4QRRB 1LK2B 5SX4H 4FP8H 3FT2A 1KXVC 4ZPTA 1S5HB 3MV8B 5E1AB 5DRWB 2OXGA 1OSZA 3LIZH 2FX8L 4QRPD 1NCAL 3RX8A 5HI3C 1QLFA 4HUUB 2Y9RT 3PP3K 5J1TC 1I9JL 1HQRA 1U8KA 2OL3B 5EFIB 5IMKB 4LF3A 1KIUA 1FNLA 3WUWB 4XPTH 1OAZH 5E8EA 3LD8C 1OP3K 2R1YA 4U1NA 4QRTA 3TF7A 1NBYB 2APVA 4HIHA 1A4KB 2XN9A 4H5SB 4UT7L 4JZOB 1YEHL 5LAXA 3KPQB 1CD1A 1CR9H 1RJZA 3QUXB 3V4PL 3OZ9H 1OHQA 3ZDXF 2AJYH 2NY5L 4G6KH 5IEHA 1G9MH 2YUXA 5I71C 2X10A 3SE3C 5FKAA 4UIMA 3U7YL 1KT2A 4HWBH 5GGVY 3U0TB 4EDXB 3TV3L 5C0BD 1IZJA 1DBMH 1NCTA 5DA0B 2EIDA 4N5ED 1CXEA 3QWRA 3QUMH 5EC2A 2ARWA 4XPAL 4GSDH 1BQLH 3JXAA 3NGBC 5KS9B 1TJHL 4K7PL 4D3CL 4PP8C 1JPFA 2FLBT 4PJXB 5IIEB 5D1ZA 1DJSA 5ITBH 4PJAE 4BZ1H 1MWAA 4QXUH 3NPSB 1A7RL 1KEML 3Q1SL 4OD2A 4C59B 5IHUL 1KB5L 1ZT4B 2AQ1A 2R1WA 4ZUSA 4JM4L 1JGVH 3MUGA 4LLVA 3MX0A 4LLMA 4XCYB 4JM2C 3FRUA 3QUMA 3STLB 3ZKSD 1TENA 12E8H 3QUYD 1JRHI 2E9BA 4MS8D 1D6VH 4RGNE 1Q9KA 1M05B 1BIIA 1IM3A 2FD6L 4LSTH 3QDGE 2BVPA 1T03H 3QIBC 4X6CF 3MA9H 2X4PA 1IC4L 1T04B 1FL5A 2AEPH 4IMKC 2R2CA 4MDIB 5ERWB 1MNUL 4F80A 1NCBL 3H0TA 4DKDC 4GQ9H 2YMXL 2E8YA 3C8KB 1HILB 3QCTH 3D69B 1K4CA 2K9UA 2NLJB 5GJSH 4PYGA 3G6AA 2V5YA 2E6JA 3RAJL 1XF5A 4JFQB 2X4QB 3U0WL 2D7TL 1L0YA 5E6ID 4X83A 3P4MB 3QJFA 3CDYA 3OKMA 3GSRB 1S7XA 4DQOL 2P8MA 4RMTA 2H1PH 2XV6B 1BVLB 1P53A 2ZUSA 3FQRA 4JZNB 4WV1C 5C0EB 5BV7C 2V9QA 4BZ2H 1H9VA 4ZD3H 5IFJA 5F88A 2FJHA 1MLBB 2VXSH 1OGAA 1YN7A 4RGMB 1JFQL 3A67H 3Q6GH 4NKDB 3RL2A 5C3LD 1FRGL 2YHGA 5K9QI 1R3KB 3ROLA 5BW7A 5HDQL 1WCBB 1P2CB 3WIIL 1UA6L 4X5XB 1N8ZB 1FG2B 2D4DA 4BKLA 3N1GC 1ED3B 1OQXA 1ZHLB 2P48B 4W6WB 5I1GH 5KN5B 3ROLB 2OM5A 4N0RA 3AGVA 3QHFL 4K3GA 4BSWB 3MV7B 4OF7A 4OCMC 1T7WA 5EWIH 4FQIL 5BVPL 5IJVB 3G04B 5FDYA 4FP8L 4YDIH 5C08B 2Y5EA 4WDIA 5CJXC 3T0VA 1JGEB 3KLDA 4U3XA 1U3HC 2A1WL 1I1AC 3R06B 4NWUL 2XA8H 4QTHA 4C56E 5A2FA 1XGYH 5KSBF 3ZHLA 1EK3A 2FO1A 4ZS6C 1FCCA 3HI6L 5DTFA 4NKMA 1WFNA 1ORQA 4WI6A 1U8HA 4MD5B 5T3XH 1OGTB 1QLRB 1PSKL 3T1FA 2HLAA 4OZGE 4PJ7B 4KJYA 5HI5D 5I0DA 2L0DA 4QCIA 5L9DH 4MX7A 5LWYH 2WINB 4KTYA 3V79C 4JZJA 1J1OL 3GMOB 3C5ZA 1MI5A 3MZGB 4MAYD 5C0RH 1K2DB 4N5EC 2PUQT 2UYLA 5HYJB 5MI0C 2V7NB 4D9LL 1FZOB 1OM3H 4UT6L 3SOBH 3FO9B 2ICWB 5L6YL 3EJZC 4DOHE 5EN2A 1KN4H 2D2OA 5I19L 5TFSL 4HMCA 1KEGL 1VFOA 4HLZH 2P47B 1FYTB 4DN3L 1Q72L 3TV3H 4AEFA 5GGQH 2EKSA 4OUUA 3IKKA 1BZ7B 3WIFA 4OAWB 2BCKB 5ADOL 3U7WH 4PRDA 3CFBA 1FVEA 1ORQB 4KRPB 1F02I 3GBLA 3TBWA 3PL6D 1C5BH 5C08E 1OAYL 4LEOB 4MJIA 2I07B 3UCRA 3QHZH 4MX7B 4KPHL 3ERYA 1MOEA 1CFBA 2H2PD 1GRWA 1NEZG 3KWWA 3MMEB 4M03A 1A9EA 3IF1A 5KSBE 1KGCE 1GGYA 3ARRA 2HJKA 3FN0H 4PGDB 2FBJL 3RGHA 1NFIA 2OL3L 2N4IA 5DVMA 4L4VA 5FKAB 4CN1A 4PRPD 4X4YA 3WKML 1T5XB 4KH2A 2OR9L 2X9YA 1J8HA 3LDBC 4WHYG 3QNYB 2DDQL 2MSPA 3L3OB 4KK5C 5KVGH 1INDH 1JYVA 3TLRA 5JW5A 3QIUC 1U8LA 5MENB 3I75A 1RUPL 2WWMC 4NCC2 4JZOA 2K7QA 4OJFH 3BEVA 3SCMD 4ZFFA 4X9FA 1F4XL 4PJGA 4AEIH 4WI8A 2HVJA 4UV4L 1I8IB 4CVXB 5IMOA 3SN6N 4CJ1A 1DBAL 2VUOA 2ZJSL 4J3UA 2ZWLT 2BNRB 4YDKL 4UDTA 1JN6B 1JHTA 4JANB 1EVTC 2X4TB 4LIQL 1BOYA 1WIPA 1QLEH 1NGPL 1ZMYA 3BEWA 1AGCB 1JYNA 1IGTA 3PP4L 3OX8B 3ZZ1A 1ZGLA 2I07A 4UU9B 5C09D 1MCQA 4X6DF 3VFWA 1PY9A 2G5BB 4J4PA 4ELME 1QVOB 4OGZA 3D39B 1MFEH 4NJ9L 1IAIH 4JREC 3C60A 1J8HD 4GAGH 4R4FH 1OAQL 3VJ6A 1S7VB 5C7XL 4NPYB 3DO7A 3VA6A 3F58L 3IKCA 4YHLL 5KAQF 5IBUB 3BPOC 1FFPB 2NY4C 1N64H 1KJVB 1YY9C 4N8CL 3QUMB 1SJEB 4X98A 2VH5L 3SDAC 1MSPA 2YA0A 4ZTPH 4NO3A 5ALBL 2ORBH 1JN6A 1CG9A 4PJEA 4R4ND 4P23A 3TN0D 4XC3L 3DRTA 3GHEH 4TNVF 4RNRA 3QA3B 4Z7UF 3LQAC 1J12A 1U8IA 4U1HB 2PN5A 5IEKA 5C2UB 1AFVL 5TE6L 4I18C 5EO0B 2ADGB 4L9DA 2X05A 2DQIH 4RFNC 3RTQC 2FD6H 4QRPB 2YEZA 2I60H 4BQBA 4KKCC 4LDEB 5ACZA 5KJRL 5J12C 1B0WA 3QZWB 4R7DA 2BNRE 4MJ5A 3RHWF 3DI3B 3MBXL 5DD1H 3PGCA 3GSUB 1QR1A 5EC1B 5HGBA 4YHKL 2E7MA 3UTTE 5ITFA 4HG4J 1H8OA 5C6WH 2F54E 1KTDA 2OI9C 5CIPA 2GY7B 4YHNA 5C0BE 4OZHA 1BFVL 3R1GL 2PR4H 5K9QG 2JF1A 4NM8L 5HPMA 4MJ6A 4POZC 2IWGA 2IJ0C 3MRQA 2JB5H 4XVTL 3QXWA 4NDMA 3MSPA 2XNAB 1YEJH 4YJZL 2CKBB 2H3NA 4X5LA 4LHJB 3GSXA 3PABA 4YXKH 2LU3A 5D7IE 2R2EA 2WBKA 5TPWL 1ZLWH 5EORL 1OSZB 1K5NA 1NAMB 1UM4L 1RV6X 5DRWA 3WMSA 2YRLA 4AEHH 1RFDH 4WU7A 3SGDH 3F12A 4Y5XA 3VWJC 3CFEB 5D7KD 1A0QH 1XAUA 4UB0L 1TJGH 4QY8A 1ZVYA 4NQCB 5E2VL 5ACZB 4NZUL 3IVKA 4ORGB 4LSVL 3B9KA 4WJ5A 3ULSA 4NSKB 3NFNB 4OZGF 1KENH 4GBXA 2IC2A 3B8SA 4FQXB 5I1IL 1FH5H 2VN4A 3D0VB 3DTXB 4KQ3L 3RGVB 4WFHD 2AVGA 5DD3L 2IMMA 1N3NA 1P84K 3VFTA 1LP9E 1CLOH 3C2AL 4PRNB 1NCWL 3VFNA 4DEPB 3QHFH 5ESQA 2OP4L 1FAKT 5IK3A 3OJVC 1QLFB 5KBNC 3IYLW 5DQ9B 2DMKA 4DZ8B 3BP6B 3DVFA 4WFFD 3R0MA 3QDJE 2AXFA 1QO3A 3HKFA 1K3ZA 4FG6C 2BC4B 3MV8D 3HI6H 1DUYA 5I73C 3BN9C 5ADPH 3KLSA 2CGRH 3B2UC 5EULV 2VLJB 2W9LA 5JR1L 1M7DB 2RCSH 5KZCD 3MLPA 4OZIE 1X3DA 3D1MC 1DLFL 5CKAA 1Y6MR 2G60H 4DVRL 4MDJA 1EIBA 1EO8H 2X40A 4YBHA 3VXQB 1A3LL 1A6ZA 5T5FL 3OL2A 1HZHL 4NO0B 4KTDH 3U30C 5B39A 1A4JA 4Z7QE 1DBBL 3W5NA 4WUUB 2MMXA 3B2UD 4KV5E 1FFNA 3HLAB 2HKHL 3VRIB 1G7HA 3WFCL 5L8LB 5INCA 4PJ8B 4EN3B 3LRSB 1QFWI 2F58L 4JN1H 5HI5C 3WFHA 3FFCD 4ODXA 1UG9A 3L7FA 2PO6B 1JPFB 3NACL 1IEAB 2W9DH 4P5TC 5A16A 1GAFH 4WW1B 4I4WB 3CVHB 1HHHA 1LO5A 1U8LB 4PLOB 3T8XB 2VSCA 3T08A 2CIKB 3BKMH 3WCYA 1S5IL 4K3DL 4FQJH 3BSZH 1DFBL 1LO3L 3UTZA 3I2CL 3QFJB 4UNTA 4PS4H 3PHQB 3G6DL 1FC1A 4LPYA 1KIRB 4J23A 3HCVA 4EOWL 1NCCH 3CDGB 5DRNA 4JRYA 3G6AB 3L3JA 4UILL 4JM2F 2OTWB 1AH1A 2JELL 5DZLA 3GSWB 4O2EA 1W72L 5TH2A 2LTQB 1MHCA 4JHBA 3OKLB 5B39G 5D7IA 5CKGA 4PJ5D 3TH2T 4NC1E 1KXTB 1S9YB 5FO9B 3BZEA 4BUHA 5F1SA 5F8RC 3VJ6B 4DN4H 2ICEA 4LLYA 1G0YR 1AR1D 4LLWA 3QPQC 1E4XH 2J88H 5IWLC 4RAVB 2XRAL 5BRZD 4YHKH 1BIIB 3MUJA 3FOMB 3MYZA 3RX7A 5ID1A 1H0DA 2V2TA 2CDGB 4OFPA 4J1UA 4Y8AA 1EHLH 4OKDA 5FGRA 3WO4C 3BEWB 3GJFB 1IGFL 1OW0C 5FA3A 4CADB 3FKUS 1UEMA 2FO4B 5D1ZD 4BH8A 4K7PX 3MUGB 4LLVB 7CGTA 2BOBA 2QKIB 3GGWA 3GSNA 1DBJL 1MWAB 1Z9OA 2WWKO 4PJHA 1TVHA 2CR3A 4QOKD 6FABL 4YX2H 4D0DA 5I1JH 1T1XA 4YXKL 2YC1B 1JPGB 2VWEC 1J9CT 2DBLL 5DUML 4V1DD 5EORH 1Y18B 1OPGL 5EIQA 2VLRB 3ABZA 2FR4B 3ULUE 3MV9B 1AO7B 2DB8A 1MJJA 4Q7DA 4D0CB 1MFBL 4Z7WA 1E4KC 3STZB 3U1SH 3UTSB 2FBOJ 1G7LB 4P99A 3IU3A 4HS8L 1OGTA 1QLRA 1JV5B 2P46B 4RZCA 3KNBB 4PRAA 1WIUA 1H3PL 4Y4FD 5DD0H 5BO1H 3D85B 4YHLH 2L4OA 3QULB 4LQFH 5T1LB 4Q58C 3MRMB 2FL5A 2FR4A 4NZJA 1YEGH 3O8XD 5HDLA 5IFJB 4LU5L 4OFVA 5D5MF 4N0CA 3I3DA 4LCWA 4X7DC 1T6VN 3REVB 2R1YB 4DEPC 2Z93A 1KTLB 2NY0B 5LVEA 1GCFA 1FNSH 3HE6C 1HH6A 1CQYA 5E7FA 5KOMC 2GUOA 1DVFD 4ZXBA 3BQUA 2PXYA 3DVNA 3HPLA 5C6PB 1A22B 3EZ8A 1AGDA 4UT9H 3UMTA 2FX8H 4BELD 1WCBA 4U1SB 2QSCH 1TCRB 2NPLX 1IGJB 1SEBB 1V7ML 3SO3B 5C0CE 2EKSB 1EUUA 2R0KL 5EZJB 4MDJB 2NR6C 4Y16B 4QRRA 4HHAB 2IQAA 1PG7X 4XPBH 2AS5M 2VXQL 4B50A 4M7JH 4H1LH 4L3AA 4N5UA 1MUJB 5EZLB 1LO4H 3QUZC 3MO1B 4XMKH 4Y7MA 1CICC 4G6JL 1UWEH 4MA7H 5D2LB 5EPMA 1GGBL 3BUYA 2QSQA 2UV3A 1I3GH 2X4OA 4LPCA 1K8DA 4LDLB 3O45A 3Q5OA 2HJLA 1CFNB 3AREA 4NQED 5CFHA 5T3ZD 4R90L 4XVTH 1CDBA 5BS0E 2NY7H 2E7CA 2LVCA 4LSRL 3D18A 2E9JA 3ESVF 1INDL 5E6IC 5I1KH 2VZTA 4U49A 3CSGA 4O9HH 4TVPL 2ATPA 1MCPH 5TQ2L 4OLZL 1WIOA 4BQCA 5IB3B 1Q9OB 5F3HA 3RBGA 5FB8B 4PDCE 5KSBA 5IW1B 1XIWB 4PJXA 2MPAH 5DFVD 4HK0B 3IJSB 3BUTA 3MRCA 4OQTH 4M8QB 1I8LA 4FQJL 2M2DA 4GW4B 4JHAH 1AGEB 4PR5B 2ED8A 2HG5A 4CVZA 4O02L 1Y6NR 4HHAA 3IETB 1CD0A 1B2WL 4Q97A 3V0VB 3D3VA 1S7RB 4U1MA 4FTVA 2NY1B 2AEIT 3JWNC 4NT6A 3B5HA 4KROC 1IAIL 3HG1D 1HK6A 4I77H 1N6UA 2FJFA 1IEBA 5F1NA 2IEPA 5JO5A 3KYKH 4GT7A 4OLVH 1ZT4A 4U1MB 1CXLA 4X7FC 1CIUA 2CKBL 5KVDH 3CFCL 1UJ3B 4IS6A 4DVBA 5MENA 4MJ6B 3H8NA 4WRLA 1UM5L 1T1YA 2DM3A 1QFOA 4XPGL 3DV4B 1GH7A 5J6HA 4RMRA 4ZTPL 3RDTC 3TH3T 1FL6A 1EJ6A 3H9SD 3QUZB 4MMXC 1P4IL 3ZYJA 2ZPKH 3GMNA 4PJCA 3KGRA 2Z8VC 3B6SB 5IESH 5IM7A 3WS6C 3FONA 1IL1B 5FV1L 1JPSH 1UWGH 2PO6C 1ZAGA 5FA4A 1RJZB 1CL7L 15C8H 1T0NB 2ZUQC 5D72H 4BFGA 1UJ3C 5HGAB 4PJ8C 3JWOH 4TUOA 2GK2A 2FEEL 1JZ3A 4U1HA 1I7RA 3OR6B 4GKSA 1MFBH 5C09B 1KJ3H 4LDOB 1KJ2A 3SE9H 3GBMH 4GBXD 1ZTXH 5L8JB 3QRGH 1T0NA 4LF3B 4JVWA 4MQXC 4F7TA 4JJ5A 2G2RB 4KDWA 3BPNB 3QPXH 3P0VL 4F57H 1NSNH 4HC1A 5IBTH 2AEQH 3QEQB 4F15B 5EZIH 1B3JA 4QHNB 2ADJB 4HWNA 3RTQB 4XVSL 2IMNA 3BVNA 1UWXK 3T2NL 4LPTA 3O2VL 4XNMA 4PR5A 5DUBA 3LKNA 3I2CH 3AU1A 4M7KL 1AKJA 3GJFH 1QBAA 3D39E 3HE7C 3D39A 1XF3B 4HC1H 1HHJA 1R5WA 1RMFL 4L3EE 4E0RA 2ED7A 4DGYH 1S9KC 1OGAE 3MRQB 4WFGD 1PZ5A 3GM0A 4D9RE 1LD9B 4D94A 3G5YB 1ZGLB 1D5BA 4I48B 2V2XA 5E2TL 4LCWB 1FV1B 1CVSC 2D7PA 1NKOA 4GUPB 3TBVA 4GKZB 1AGCA 3TBSA 4LRNH 3T09A 4UB0H 4U33A 3P77B 4NO5B 3O2DA 1F8TL 2J2ZA 3T2QA 2XI9A 2X4NA 4MCYB 3ZYIA 1I1AA 4KMTH 5C92A 4CW1A 4ZUWA 3VMOA 4R0LA 1A47A 2BJML 1TPXC 4UDUB 1XGTB 5JW3L 2FATL 1KCLA 5DVLA 4X80L 3DSFL 3OKDA 1LO5B 4LFHG 2DQHL 5FF6B 4M5YL 5HYJE 1MCHA 2Z31A 5AZEL 3B83A 3X17A 4MCYA 2AAVA 3P4OB 5GHWL 1X5GA 5F6HI 3QA3A 1AR1C 2EEBA 2DKSA 1IC5H 1KB9J 1U93A 4PJCE 1S7XB 3MLRH 2JK5B 3S7GA 1UT9A 5I1JL 4C58B 4HSQA 1E0OB 4PLKC 3U4EA 4N5EA 3ULVE 2NY0C 5D6DA 3G5YA 4LFHD 5D7LD 3MLXL 4JCMA 1QZ1A 5ADOH 3C6LC 4TUKL 4NCC1 2W9EL 4CMMB 2DIBA 3QJHA 5T5FH 1AI1L 3G5ZA 3N06B 5DJ0B 1R3HB 5F21B 1ZS8A 2EYSB 4ISVB 2HFEA 4LL9A 3RGVD 1WITA 4PRIA 1XIWA 5J11B 2YKLH 1MVUB 5C07D 3L3DB 1C5DA 3K0WA 1CL7I 5J8OA 3QJFB 4G8IA 2AJYL 1UH4A 2KL6A 3SE8L 4DZBA 4FTVE 4RFEB 1U8PB 3D3VE 4HLZG 4X99B 5GS2H 4TOYH 1NMBL 4U6XA 1CFNA 3GIVA 5BRZE 2NY3C 3TA3A 1VFAA 4L8BB 2OI9B 4N0YL 1JRHH 4Z7UA 3WNMA 4JM2D 4U0QB 2VAAA 3O3AA 1YY8A 4KJQD 3UTPE 4WW2F 5D8JH 3FJTA 2VZOA 1DFBH 1LO3H 2ITCB 4K8RC 1X5LA 1NFDA 3MZTA 4KK8C 4PJ5E 1GVIA 2NY1C 1C8PA 1QHOA 1F00I 1A7RH 5JQHC 3D2UA 4MSWA 2VQ1B 3C5JA 1BJ8A 4F9LA 5KTEL 5DJAA 4DFHA 2MOVA 1FZMA 1WEJL 2F8XC 2HRPL 5KVMC 2YZ1A 1I8MB 1QYGH 4H8WL 3MOBL 1YC7A 4X7EC 1K4DA 4NN5C 1S7TB 4WFFE 1FDLL 5T33L 3L3KB 1DEEA 2D0FA 4MNGE 5C0JB 3BXNA 5EU5B 4JFEE 1MWAH 3O4LA 2VO5A 4XNXL 1RZKH 2GI7A 4YK4B 5ESVA 3NIGF 2E9IA 1ERNA 3L3IA 1OSPL 3P9LA 1T21A 3FO0L 5EOTB 5GZND 5SWZB 5F7HA 4L8DB 1U8JA 4NGHL 4XHQA 4P9HC 3DHMA 4PJDE 3HRZB 4HJJL 3QNZA 1SJVA 2IPTH 4OLZH 4ZPVA 4GQ9L 3QPXL 4N0CD 3ULUC 5AAWA 4HUWA 5HHOB 5FFLA 3L1OL 3ARWA 5LQBH 2EE9A 5CZKA 2B4CC 3CX2A 1U8KB 5K59E 3QSKB 3D3VB 4QNPE 4NO0D 4HUVA 2XZQL 4X4XB 3U2SB 4DKFL 2ICWI 5JORB 1F4WH 1HI6A 1WBXA 2H1PL 3O2WH 4DGVH 3S35X 4G6FB 4P5TB 1LDPL 4U2YA 5CBAA 3DX9B 1IJ9A 5EZOL 4FHBD 1NBYA 5I30H 4ZAKA 3WIHH 3SDAA 4P4KB 3OR6A 3L9RB 3MJ8B 2W0FA 3VFOB 4K8RH 2PTTA 1LEGB 4PRHB 2VMFA 2D31A 4BQ6A 3HE6B 1OQOA 2DI7A 2QQNL 5LXGL 3CSYB 4JN2A 5D1QD 3ECBA 1FIEA 2D0GA 4GG6A 2A6DA 4I18A 4K9EL 5I1HL 1HILA 2GKIA 5E8DL 3STBA 1H3VA 2DIAA 2VWEE 3RTQA 1KPVA 1RUQL 5F9JA 3WFZA 3CVHH 2SEBA 1MCBA 4YBLC 2OJEA 4LSUH 5DK2B 1BD2E 1GC1L 3EJYD 5HHOA 3MXWL 5L7XH 1P7KA 2IQ9L 4N1HB 2HFGL 3DVIA 3NCFB 1NGWA 4F7MB 1IEHA 4Q9RL 2IAMD 4NQSB 3QDJD 1XCQB 3CZFA 1N59A 4LASH 1UWGL 3Q6FA 2A77H 3SDCD 1G1YA 1NDGB 1FORL 3EW3B 4ZOAA 5JHDD 1DQQB 4NFCA 2DLFL 1YPZF 2YD7A 4PJ9D 4ZNEA 1IFHH 3X11B 4P2RE 2Y7QB 3WFDH 3HR5A 4MQ7B 3GMMA 5IR1B 5FM5M 3I85A 5ENWA 2WUCH 5ID0B 1A6AB 4JG1H 3O4OB 1GL4B 4FFYH 3IFLH 3PGDB 1QOKA 4PGEA 1CDYA 1IGML 3VD3A 3O3DA 2R2BB 2A9NH 3QQ3A 1S7WA 2IAMB 4G9DA 3BKCH 3WSQL 2NY4B 2MJWA 2VDPH 3R8QA 3V9FA 4Y5XC 4EKXA 1CD9B 3KPOB 1SY6L 3WJJC 1P7KB 3HS0A 3K2UH 3FRPG 3GUTB 4V3DB 2YD4A 3L5HA 4M6AA 2EDBA 4JRYE 3QQ3B 4ZUUA 1MFAH 3O3AB 4OB5L 2AK1H 5L2JA 2BOCA 4L4VD 3UPAA 4L8SC 4I8DA 1H5BA 3UTSE 2YPLB 4QGYA 1F90H 1BPVA 2BHUA 1MJUL 4LLQA 3D18B 2VDKH 3VWKA 5KVFL 1FFQA 2D03H 1G7MA 4ENED 1FP5A 4NHCH 2Z91A 5FYKE 4HGMA 1KCRL 3EKCA 4X0KB 5H35B 3UROR 1JGLH 3QHTC 3CLFL 3DYMA 3KXFE 3LKPA 4HG4K 2OSLA 2BRRL 4KI5D 4JFDD 3TESA 1FYTD 3LH2L 4YHYC 1IGCH 5I8CB 5JMOC 4PRIB 4OV6F 5FHBH 3RZCC 3W39B 5DS8B 5C0AA 5I71B 2EIEA 4KPHH 1EAJA 4X6CA 4XP9H 5FGCB 2FYYB 3B5GA 6CGTA 1I7TA 3WXVL 4XBEH 5F7DA 5HYIA 4XPHH 1YEHH 3TIDB 5IW6A 2APWA 2P5WB 5CLWA 3OJDA 4UAOC 3HNTH 4FXGA 4ALAH 5AZEH 2H41A 3FQNA 1R3LB 5HY9A 1MCJA 1NC4D 4O51A 5HYEA 1J1XH 5EO1A 3FO9A 4NRYA 4OZIA 1IKNA 1SJHA 1GOFA 3D25A 1U3HD 2DIJA 1A9BB 2WQ8A 1CGSL 2F53E 3TYFB 4QNPF 3GMRB 3OKLA 4MA1B 5EBGA 1N0LA 2BY2A 4P9HH 2FHBA 2NXYB 1BFOB 1JPST 1T5WB 2HJFA 1IBGL 3HUJB 4LSPL 2X42A 1LNUA 4HJGA 5ALCH 5CSZB 3PWVB 3JTSB 3QEHA 1BAFL 5FO7A 3QFJE 4JRYB 4PJDF 3C8HA 3QNYA 4P5TA 1LEKB 1XGUB 1CIDA 4KRPC 1A6VL 4OGAD 2AJSH 1CL7H 3B6SA 1NCCL 2RFXA 3QAZC 5LGJA 4HUWB 3GRWL 3CFKB 1K4DB 1TNMA 3RNKB 1HSAB 5FK9A 2VKXA 1KBGL 4HH9B 1CK0H 3WN5B 1YEKH 4HWEH 3UO1L 4H5SA 5I6XB 4YHZL 1JZ6A 3O0RL 3DV4A 3RIFF 2EO9A 1HHIA 2C4FT 2AJXL 5F7NC 4JM2B 3WN5A 4A6YA 2P49B 5I8EA 2CIIB 2NNAA 5EFIA 4OGXL 4G8GD 2ZG3A 3RWFA 4ZNCD 4GG8B 4OAWA 1IMHC 4TPRL 3ARGA 2J12B 3WE6B 4OCLC 4WUKH 1ACYL 3I6GA 4RZCB 5CEXB 1YEFL 3CD4A 4DGYL 5I1LA 1HIMH 5DR5H 3Q6FB 5D1XC 4EQ3A 2R0LH 4YE4L 5AWNH 4P46D 2HFGH 1LO0L 1CXHA 4O00A 1XCTA 3BZDA 4QRPA 5L0QC 5IWLA 4M62L 2O61A 4R3SA 4P2OB 3ZDYF 5E2TH 3MGTA 3SDXE 4OGYH 1JPTL 2YD6A 4H1LG 1FDLH 5C09A 2HFEB 1U6AH 5D7LA 1DQDL 4XP4H 4ZO7A 2DLFH 2DI9A 5C71A 4PD4J 4ZO9A 4OZFH 3TFKA 3RKPA 4G6AC 1XF5B 4JFQA 4LP5A 3OGCA 5T3ZL 1GIGH 5DMJB 5H94A 3QDMB 1S3KL 1Q38A 3KLHC 3RRQA 1JNJA 3BI9X 1IGMH 1VERA 3K8MA 5HI3D 3J7HA 1H0DB 1FVCA 1FO0H 1JHKL 4Y2DC 4OZFA 1KTRL 2CLVB 2CRIA 4HAGA 3ULVF 1QSFD 3R0NA 3WIIH 1E4KA 1EMTH 3ALWA 2BVEA 4OF3A 5DFVC 1N7MH 4F7EB 2OCFD 1RAMA 4P46A 1BJMA 3IU4H 3KG5A 1F6AA 3OKDB 5L2KB 1OF2A 4PJEE 4RGMC 5DSCB 3UBXI 4X4ZA 2D3VA 2LVEA 3ZHKA 4O58L 5BVPH 1WISA 4N0CC 5CIPH 2MCPH 5DRXB 4YO0B 4AIOA 1IGJA 1SEBA 3IFPA 2AK4D 5ECJE 3F7YA 2AXGA 1AY1H 4Y2DD 4V2BA 1BX2B 4H1LA 4MHHI 2QSCL 4GXVL 4BZ1L 1P2CA 2Y72A 3BD3A 4XBGA 4WEMB 3BQUC 3QXDB 1UEYA 2B0SL 4OT1L 4KI5F 3T0EA 3P9LB 4G6ML 4ELMA 3BX7C 1JHLL 1YA5A 5JIHA 1CLOL 3S36L 2A6JA 3RVWD 3TO4C 2NQCA 4I4WA 3QUXD 4KKAD 2GY5A 3D85A 5LJYH 2P8MB 1QR4A 1MVFA 4XNMB 5GRWA 3OG6B 1YECH 3BKJH 4M6MH 2ERJC 2DQGH 3EO1B 1U3HB 4U1KB 4PJGE 4R4BA 3JWDL 2C1PB 1RJYB 5E4IA 5SWZD 3UYOD 2HH0H 2H26B 4NJAH 4RBPH 2EDEA 4LCUB 4LIQE 1OAKL 5D2NE 5KSVB 3SBWA 3SJVD 1FV1A 3ZKXC 3MA7B 3ZKND 4ODWB 3VXSA 4XPFH 1G7IA 1DR9A 1LGVA 1K2DA 2WM0A 3HMXH 4L4VE 3UTSD 2W0LA 3ARSA 1Q94B 1VB9A 2UZIH 3LB6C 1T3FA 3IGAA 1HQRB 2OL3A 3BYYA 3W81A 3LEYH 2IQAB 4HUUA 4UINL 4UZGA 3D0LB 1R3JA 2G75A 2IGFL 3FB5A 4WV1A 1G6RH 2P5WA 4KKCD 4HQQH 4NN7B 1BHGA 5DMKB 4J8RA 1G6RB 4ZO6A 5K9JL 3FOMA 5GQBA 3LKOA 5GS1A 4HDIA 4JLRA 4BA8A 2DLTA 3O4OC 1CE1H 4OI7A 2OL3H 2Z31D 1P7QD 4KUCD 1SM3H 4OFIA 3ZKMC 2Q76B 1RU9H 4X9HA 3VFTB 5F93C 2D03L 1KCVH 4UQ2B 5E5MA 5F3BA 4D3CH 4GKSB 2H8PB 4EI5B 3DTXA 3CCHA 1YQVL 3SJVA 1P4LA 3QDGD 4KAQL 4M5ZL 1PLGL 1Z3GL 4UILH 1I7UA 1KCKA 5EWIL 3EDJA 1LQSR 1LDPH 4PD4K 2R0LL 4YE4H 5AWNL 5IMMA 4YDIL 4TQEH 3PGCB 5T1DL 4Z7OF 1G9MC 4P49A 4PJBB 3RZCD 1DZBA 2H2SC 1XGPA 2MQCA 2Q7NA 2QR0A 3PHQA 4ONGH 2W38A 1JMZA 1W8NA 4FNLH 1BD2D 4ENEC 2AQ3A 3OHXB 2PYEA 3ARFC 2UZYB 4PP1C 4WDIB 3SKOA 3T65A 5INDB 3U6RB 3EOBA 1EAPB 3V5DB 1EH9A 3Q2CA 5A3IC 3P0YH 4K7PY 1RZGA 1XZ0A 3VFGH 4QTIL 2D0HA 3WS6A 1TLKA 1HHHB 2EDOA 3BGMB 1WSST 4MNQB 2CUHA 1ZHLA 5KN5A 4L9LC 4HK0A 4QRTB 1MNUH 5EOQL 4N9OB 3LRSA 1GHFL 1HXYA 4JB9H 4M9PA 1RIUL 1RZIB 4ODXB 3CVHL 4P3DB 3M17A 1WFOA 2FO4A 2P5EE 4PLKD 4GS7C 5C0RL 2GW5A 4JDTL 2H32H 4X8XA 4X98B 1LWRA 1LE5B 3LQAH 4JPWH 5EIIA 4D9LH 1U3YA 3QT2A 3T2NH 1ZHKA 3P9MB 4FZ8H 2ZKHH 3U0WH 4G7VH 4MB5A 3VFSA 2DM4A 1G9NC 5GJTH 4OI9A 1ZK9A 3IT8D 1LDSA 4EXPX 3FQUB 1M7DA 4YFEA 2OX5A 4NQSA 5B8CC 4L4TA 4KV5F 4XAWL 4GRWF 5FO9A 2AV7B 3DRQB 1F4YL 2MCPL 1MEXH 1R24A 3FT3B 5B4MC 1Q9OA 4LPXA 2IANB 3N1MC 4LAJH 4OUUB 4RWYH 1V7NL 2EYRA 2CR6A 3CMOL 1C12B 4XWOC 3ZKXB 4LSSH 5EG6C 3EJZD 1KPVB 3D69A 1RK0B 4TN9A 1P4BL 2UY6A 1GOGA 2HJLB 3AREB 3HNSL 2BY3A 3MRJB 3QCUL 2DQDL 3AAZB 4JQVA 1ZLSL 3DYPA 5HI4D 1MCWM 2V2XB 1SY6H 5IT2L 3EOTL 5C6TL 1BEYH 3ILPB 4Y89A 2N7BA 5T1MB 1CI5A 2OYPA 1FO0B 5FYJH 4ZAKB 4FQ1L 4NPYA 1ZWIA 1DQJB 3QAZB 4M7LH 2EYSA 1AKJB 4ISVA 1J8KA 5E8OA 4Y5YA 4RX4A 5KS9F 1HI6B 1WBXB 5GHWH 5T1LD 4WWKC 3MRMA 5JHDB 2DQGL 2XKNB 2ID5A 3VFWB 4PV8B 1TMCB 5E94A 3RNQB 1IGTB 3WXWH 5TDOA 5FO8A 1FZKB 4LLMB 3STLA 2BRRH 2XZAL 1VGKB 3KPSB 5DDHB 5F7UA 3SDAD 4JFOA 3FZUD 3N85H 3MACH 3QG7H 4HIJA 4IIQA 4WY7L 3G04A 3VDCA 2A9MH 5I18L 4BSWA 5BMFL 5MERA 4B7LA 5GRUH 1BBJB 2MQ3A 5I66B 4U0RB 2ZSWA 3VG9B 5IGXH 1ZXQA 1PKQA 2VABB 2YKLL 1WBYA 2NXZB 5I74C 1JHKH 1OP9A 4X5WB 1V3KA 4OLUL 4Z7VE 2HMIC 2GSIA 1A7NH 5EC1A 3BRGC 1YDPB 5JUEH 5GGSB 1CGSH 3HZVA 1MCPL 5TQ2H 3RL2B 3GSUA 4YHYB 3SGJA 1FZJB 3RFZC 5BRZB 2Y06L 4R9HA 1EEUA 1MLBA 5I76A 3QUZD 1U3JA 5ILTL 3IU3B 1CD1B 3NZ8B 3WEXA 1WFTA 3VRJB 1B4RA 1RU9L 4EVNB 4LSPH 4PRBA 4Q6YA 1LK2A 3MROB 2ZUTA 4FQ2H 4OLWL 3U7WL 4NP4H 4PJ5B 5HGDB 1L6ZA 1BFOA 1T5WA 2DD8L 2IH3B 3BDYL 2BNUB 3TA3C 4Q0XL 2BDNH 1FNAA 2HT4C 3QIWB 5ICXA 3S5LA 1JTTA 4OQ1A 2KQMA 3EOAA 5H37G 1CG9B 2YUVA 3MOBH 4MWFB 4P2QE 4UQ3B 5FCSH 2DTMH 3O8XC 3U0PB 4IJ3C 4ONGL 3DARA 3HAEA 3O45B 3MRLA 2EH8H 3MJ9H 5A2KH 1NMAL 1SBSH 1TPXB 4ZPTB 4RFEA 2G75B 4AMKH 3BP5B 3QWOB 3NH7H 3SJVE 1FLTX 4ZYKB 5I1AA 4PJIF 4OGXH 3O9WB 4M9OA 4ONOA 4S1DC 5J56B 1TZGL 4H0GA 3I50L 4ODWA 3VXSB 4MMZC 4C54A 5JDSA 3KS0J 5JOEA 5E95B 3BW9B 1ED3A 2LABA 1MRCH 1OAKH 5EUOA 1LO2L 3HMWH 3WFEL 3BWUC 5DD6B 1G7HB 4ZQKB 1DBAH 4BSJA 4OZGB 2Q7YB 3KYAA 5BJTB 4LIQH 1YEJL 4WUUA 3KPLA 1FL3A 5CBEB 4XMLH 3MRDA 5GS0D 4FTVD 1WT5C 2HVKA 3I6LE 3H9YA 3U4AA 3T8XA 3WS3B 3MCKA 3NCBB 35C8L 2R8SL 1XGQA 4HMDA 3GHBL 1AQDA 1WJ3A 4N0UB 2E6PA 1CFVL 3ZSTA 3L5JA 4JE4B 1VEPA 4ZSOE 5F97E 3IDMA 2D9QB 1HYSD 3L3OA 4MB3A 4Y4HB 1J11A 3U9PL 3HI1A 4JDZB 3RWJA 1GGIL 2A73B 3BO8A 1ZHBB 2B4CH 4X4YB 3KR3H 4WI3A 3BP6A 2VLRA 4YC2B 3GMQA 3V7AG 3MMEA 4MQ7A 1M6OA 3HLAA 2B2XH 1TETH 1DUZB 3MODL 3DIFB 4KJPC 5MEQA 1S7SA 3LS4H 4I48A 4RBPK 1JZ7A 4MHHG 5FCUH 1CGYA 1QA9B 1AGEA 4IRSB 3OAYK 5TE6H 2DLGA 1KCSL 4X6BB 5DQJB 2OR7A 4EDWH 2C4FU 2YZ8A 4HPYH 4OCRH 4U6HA 1QVOA 3ULSB 2PCPA 5AG8A 3K3QA 1QBBA 3H7BA 2WY3A 4UU9A 5FGBA 1G7LA 4K94C 2HT2C 1U9KA 4OV5B 2XYCA 2G2RA 1C16A 5EN2B 4PRNA 3X14B 2F8OA 4XP1L 3PWJA 1F4HA 3UJTL 2R1WB 4ZUSB 1I1YA 1DQLL 5HHVL 1ZVHA 1JPGA 4ZFOL 1U2CA 3W11C 4XCFL 4UTAL 2DQHH 2PR4L 2KKQA 2B1HL 4G7YL 5C0CD 1NJ9B 1Q1JL 5D7IF 4G8GA 1D5XB 1WLHA 3MREB 4L8CA 3N1PC 3PWJB 1TIUA 4NN5B 1MF2H 3KDMA 3SPVA 2K1MA 2EXYD 4CMHB 2XKNA 3DWTA 2ZCLL 1HEZA 3LN4A 4NJAL 1DBML 4OCXH 4OGAC 5MP6H 1T89C 5ID1B 1HHGA 4M02A 3WJJA 4QKXB 5KVFH 5KSUA 4E41D 3LN9A 3QZWA 5EA0L 4TUKH 4OFYA 3KAAA 4BSVA 1V05A 2DKUA 2J5LC 1TJGL 1B4JH 3V4UH 4PG2C 1H5BC 5LAXB 4AQ1B 3NMEA 3IXAB 5HPMB 1AP2B 2DM2A 2F19L 4W4OA 3BN3B 3DXAD 1FFRA 1CGVA 4RA3A 4XPBL 2CKBA 1ZLSH 5DFWH 2YRZA 4HWBA 2FECL 1BEYL 2R0WH 2VR9A 1FVEB 3WXVH 2VDQH 4OZHB 4U6VH 5MHSE 4GFTB 1QSZA 2GT9B 2O5ZL 4HWUA 3GK8L 3PWPE 4GAJL 2VR5A 4YXLH 2MNUA 5BV7L 1EVUA 2AEPL 4TSBL 3L5XH 2MWCA 3NTCH 2XRAH 3LIZL 2CPCA 1EHAA 1UCTA 4LLDB 5IQ7L 2RBLA 5AD0B 1U92B 2KZ1B 5C0EA 4G43A 2L7UA 4UMGA 3OAUL 1MHPH 4JFPB 1O7SA 3DMMC 1A6AA 4QRQB 1FBIL 3DXAA 5GIRA 4E5XB 2WINA 2XN9D 2ZSVB 3EAKA 3OKNB 4MXVE 1I9IH 1FFNB 4N0FA 2FCBA 4KTDL 1VENA 4Y88A 4X6DE 4TVPD 1X7QB 4U6XB 3GRWH 3MNVA 5DHVA 1NDGA 5C0BB 3BAEL 3QXAB 4MYWB 2XG5A 2BMKA 3I9GH 2C9AA 3TNMB 4C83B 2DICA 3QG6B 5CGTA 4PJIB 5HYFA 4IOSD 4HFWB 1HQ4B 1KCUH 3QO0A 3MRRB 3MRHA 2XKUA 1NLBL 3KYKL 5FYKD 3QI9C 4HBCL 5K9KA 4PRID 5FDWA 4JGMA 3U7AA 1QTYT 4IOFD 1IVLA 1MAMH 2GTZB 5DJ0A 3U9UB 2IH1A 4N9GB 8FABB 4MJ4A 4FQ2L 4OLWH 5H35A 5CINH 5CEXA 2HMID 1RULH 4JKMA 5CILH 5GGTL 4AIZB 4PS4L 4PTTA 5IHBA 1S8DB 1TQCB 4EZMA 1U8QB 1YMHA 4CN4A 3BEVB 4JM2A 4A6YB 4QF1B 4H0IA 4X6CE 3EBAA 1EZVX 4P57A 1CGXA 4CNIA 5I30L 2CLZB 1QRNE 5EU6B 5IIEA 4CVXA 4DCQB 4XVUD 3BGMA 5DHYA 3DGGB 4KY1H 4XNUH 1T66D 3TIEB 2VLLA 1IEAA 5F96H 1BVLA 1EEQA 1UKQA 3BPNC 4PRDB 3VI3E 1RUKL 4KK9D 1NAML 3K1DA 1NMCB 5DVKA 1YDPA 4L1HA 3V0WL 1CICA 3B3IA 1F3JA 3QDJB 4GXUM 5CD5D 1GGBH 1EHLL 1JGUH 2NY3B 2NY1D 3D48R 5E9DA 5DHXB 2AEQL 3W82A 3IF1B 1MHEB 1TVDA 4L4TE 5CSZA 2VLJE 3MBEB 2DRUA 1UM6H 3KWWB 4R7NA 3KPQA 3LZFH 2N1KA 4A2LA 5L6YH 5E6IA 4MJIB 4MAYB 3EYQC 2Z0BA 3M8OH 5ERWA 3VFMA 6FABH 1JWSA 5F9WB 5GRJL 1KUMA 3LB6D 5D9SA 1FL5B 2R23A 5DFTA 4NRYB 1SEQL 4LHUA 3GJFA 3BP4A 4RFOL 1KSRA 1RVFH 5GGTA 5TDNA 5J1AA 5FA3B 35C8H 2R8SH 4QCIB 3UZEA 4WNQB 1OAZL 3CX5J 4JO4H 4P46C 2V2TB 1VADB 4Z77B 4LARH 4JQIL 3C09B 1HEZB 2IAMC 3LN4B 5JDJA 3GI8L 2A38A 3ZT5A 5J06A 2HKFH 3C08L 4PJFB 4ZFZB 4G80B 1HYRC 1OAYH 3BIAX 2VDPL 4JY6B 2ICWA 4KMTL 2G9HA 2NY5H 4G6KL 3HG1A 5SV4A 4ZAKD 3S98A 3L9RA 5AAMA 4PIRF 1FNEB 5DJCB 4WFED 1MH5A 1Q9WB 4YDVA 4P0DA 3AMLA 4FQQB 1F4AA 5DJZA 3MBEA 4DUVA 1UQSA 1A6WL 2VC2L 1N8ZA 1BLNA 1MFCL 2P42B 3BIKA 4GG6E 5IM7B 4X7SL 5L2KA 4Z78B 3MXVL 4FA8A 3RDTA 1SBBA 1R6VA 2V7HB 5HHNA 3PWLA 3UTZB 3KXFB 3F7RA 4PPTA 5IJVA 3CK0H 4ODBD 2EZ0C 2ZPKL 3HRPA 5T3XD 5IVOA 3MLXH 3ZTJH 3LPWA 5I75B 4LGPB 5FM8A 4RMSA 4JRWA 5BQ7B 1A21A 1FE8L 3O3DB 2AJVH 2PO6A 2XKSA 3FB6A 3G5XB 4P59L 1GPOH 1UZ8A 1NFIB 1MLCA 3H3PH 2EYTA 4ZODA 5DEGB 1UJ3A 1INEL 4KGLA 2APXA 4WTWA 2JCCB 1J5OL 4JFPA 4P2YA 1X5XA 3X11A 5KW9H 4ZUVA 3SOBL 4X5XA 1UZ8B 2MQ0A 2Z35A 3FQXB 1JK8A 4NO2A 3IDIB 1T22B 3VXQA 1NL0L 1QRNA 3ZLQC 4DN3H 4HBCH 4KKBC 5DWUL 3NFPA 4Y4HD 2YEZB 4LPWA 5JW4N 1CT8B 3VGAB 1IBGH 3S4SG 3PWLB 4ONFH 3FRPA 3IJHB 1KCVL 1L9NA 1J8HB 3UJIH 3MV9E 2WMPA 3RVXC 5EBWA 4KQ4H 1B4JL 1QO3B 4NQVA 2BVPB 3U79A 3VGDA 1NANI 2P4AB 3BDXA 3VXMA 1KIPB 1S9VB 4MNGA 1VFAB 4L8BA 1RZ7H 3VI3F 3U0PA 5EU7C 5AYUH 1WUNT 4QHUA 3CAFA 3QHZL 1A1NA 2Q7YA 4ZD3L 4BZ2L 4CN6A 1CFVH 4N0FB 2V17L 5ESQB 3ZKNC 3TJHA 3H7LA 2EO1A 2VKWA 4LRNL 2VDQL 3DUSA 2IF7A 3EO0B 2DQIL 1A3RL 3ESUF 4YHZH 3S37X 5HHPA 4KY1L 2IH3A 4JR9H 5BOPA 1INQA 1ZGLM 2VUYA 4P9ML 2WV3A 4PJAB 4PJ5A 5HGDA 4FQXA 1KJMA 3S6CA 1ZS8B 5AD0A 2AJXH 3B9KB 1Q9LB 1WTGT 5I16A 1TJIH 4MNQE 4MCZB 2W65B 4KJWC 3LKNB 4GBXB 2JB6B 3EYUH 2EDFA 5GS1B 3MLVL 3GSOB 1SQ2N 3WEXB 3ULVL 4EI6A 3FQTA 4F33B 5C0GB 5BRZA 3DXAE 4R6UA 1WV7T 2QSTA 1QSFE 3CDCA 1K5NB 4G9FE 3CPLB 2O5YH 4M48H 2J4WL 4KRLB 4HKJA 3C5SB 2ZOKA 4OGYL 2XY1A 1RZIA 3MGOA 3IDJA 1IGIH 1A9BA 4O2CB 2Q6WA 5FM5O 1FQ9C 5EO1B 1MJ7L 3ARBB 4YDJB 2WBJC 4LVNB 2XWBA 3ARBD 4OD1L 4NC1C 1IL1A 2GSGB 2I9LA 3OV6A 3OHXA 4J4PC 3KPRB 3T65B 4GRMA 3VXOA 4NJ9H 5JXEC 4ODHH 4IOIB 3QFDA 2ADFL 1P5VA 1Y0LB 2CDFA 2PCPB 4JQIH 2H2SD 4Z76B 2FNBA 1RIVL 1NLDL 2NW2B 2OXHA 4NZDA 3GFUA 2FGWH 5C0DA 5IBLD 5E94B 1U91A 1XIWC 3QRFM 4PP1D 5MEOB 1WZMA 3ARZA 2AXJA 4BFEA 2QHRL 1Q1JH 2R1XB 4WI7A 4Q9QH 1FNFA 4IOIA 3RWGA 3PV6A 3PWPD 3MRNB 5CINL 3RVTD 1MJJB 3TJEH 4P5MB 1LNUB 1MIEL 4HJGB 1DE4A 4LCWD 5EBLB 3QUXA 1ZHNB 1PZ5B 4TOYL 25C8H 4G8GB 3RWIB 3GMPB 2AI0L 2FHCA 3AUVA 4M7LL 4OCXL 4P23C 5F72S 5GSRA 1QEWA 4KU1A 4K3JH 5JO5B 2YPLE 5F1OB 4ZXBD 3AU1B 4MXQC 5D70H 4BH8B 2ESVA 4QHMA 4YFLI 1KLGA 1GGTA 5IVXE 3WIFB 1C16B 1ULVA 4G9FB 3TO4D 4PBXA 2R2HA 2H32B 4MQTB 1C5BL 4JKPH 3P2TA 4LP4A 4DAGL 5DA4A 1FJ1B 1UCBH 2W60B 3HZKA 5IW3A 1YNKH 4GLRI 3MRRA 3ARDB 1KJ2B 5D93C 2E7BA 3T0XA 4HLJA 5HVWA 1RZFH 1BMGA 1UB6B 3C60B 1A3QA 5C0FB 1T83C 4R97C 1GYAA 4S10A 3BZEB 3V7AE 3LKPB 5D7IB 2X09A 4HKZB 3WLBB 1CLYH 1OP5H 3QQ9C 3DBXA 1BWMA 3AS1A 1RZJL 4TSAH 1B0GB 3SDDC 2OTWA 4JANA 2VL4A 3ZTNL 1T4KA 4QO1A 2XA3A 1CDGA 2M26A 3GNML 5GS0C 1RZKC 5CD5C 3H0TB 3NIDF 3MLZL 3P4OA 3H9SB 1WZ1H 2EC9U 1Q8MA 5GRYA 2R4SL 4BH7A 3HUJE 2R2HB 1L0XA 4JO2L 7FABH 2F5AL 2VLRE 1JWUA 1KB5H 2FX9L 4I18B 5GGVL 4R0LB 3VFSB 1FH5L 4HIIA 5KSAD 3CSYA 4JN2B 1UZ6E 5E5UB 2Z92B 3SDCB 4Y4KD 1FG2A 4BKLB 4XZUA 1R5IB 3PDDA 1UVQB 2JIXB 3FRUB 5F9DC 5LGHH 5BJTA 4PBWD 3Q3GA 4HT1H 5HDOA 1CE1L 3P40A 3DPBA 3SDAB 5LGKA 4KZEL 1R0AL 2HYMA 5JMRA 3IETA 4M00A 4NKDA 4OTXL 1VPOH 3IXAA 1OGAB 1UH2A 1TJIL 3PHOA 3MQIA 5DJ8A 5D5MB 4NM4L 3CZFB 5CILL 3HZVB 4J3XA 1FSKB 4R2GC 1W0WA 3NCJL 2B5IC 4LSUL 1SMOA 2NY6B 5D1QB 4HDIB 1YN6A 4XC3H 5DUBB 2NW3B 5DZNA 1CF8L 4PJ9B 1KPUB 2PW1B 1BZ7A 4NQDE 3STZA 3UTSA 3B9AA 3FFCE 5CEYA 3CFDA 2O5XH 4XB8A 3QDMA 3V5KA 1BBJA 1XF2A 5CP3H 1A7QH 1K4CB 4HXAL 2BHZA 4UQ3A 4HEME 3SY0B 4K3HA 1JGDA 4HD9A 1MJ7H 3RVWC 3DJ9A 3F6IA 3NABL 5HHXH 1KLUB 4U1LB 4N0UE 5EIVA 2GK0A 2BVTA 1A6PA 5EOQH 5JQ6L 4JZJB 1OTSD 1YEKL 1MI5B 4GJTB 4ORZC 3IFLL 2IPTL 4P2QA 2A83A 5F7WC 5C0GA 2VOTA 2A9NL 3V4VL 2XOTA 1BJ1H 4H25B 4NQCA 1NQBA 1Z2KA 2R4RL 1E4WH 3V6OE 4RFNB 3C5JB 4WI4A 5BS0A 1UA6H 3QH3B 5DMKA 4NUGL 3BSZL 4R8WL 1PVHA 5DTFB 3VI4E 2XACC 3VD5A 1UACL 4K3EH 4PJIE 3DYOA 5FUOL 1AKJD 3DV6A 1HN1A 3O2WL 3MLTA 3BMVA 4JPKL 2APFA 3H6JA 4JFDB 3U30B 2WIMA 3HRZA 1BD2A 1ZOXA 1I9RH 2COQA 2OTUA 4KK6D 4GW1A 1TTGA 5T3ZE 4JO1H 4LVHC 3TPUB 5HHME 3PJSA 5J57B 2DQCH 3B2VL 3LOWA 5F1NB 1RPQA 3UXFA 5DO2C 1MCSA 4H20H 4HIXH 4Z7VA 4YNYB 3MRFB 3THML 3O4LD 1JNHA 1TVBA 3FT3A 3MV9D 3RY5A 2P8LA 4MZ3A 1IAKB 5IVZA 3GUTA 1UADC 1QBMH 4CGTA 2NX5E 3PWVA 1YN7B 2PYED 3H3BC 5ICYA 2Y4SA 4Q9BA 1A1OA 1IAIM 3MNWB 1WGOA 3SO5A 1UH3A 2HJFB 4WW1A 5L7XL 1ZHKB 4M8QA 5AYQA 3H2WA 2VC2H 5EIIB 4PJHB 2NZ9C 4G42B 4MA8H 1EMTL 1K8IA 1Z6JT 5FYJE 3KPLB 3ILPA 1CDIA 1I7ZB 4TSAL 4XHJC 4NQXB 5CEZL 2VLKB 3NZHH 3VRIA 3B43A 3BD5A 4P3DA 1MCLA 2I27N 4P3WA 4LCCB 1N2RA 4K07A 4HIEA 3RVUD 5SWQB 4GAFB 1A4JB 3AROA 1E4JA 2GFBB 3C09C 3X3FL 3N9GL 4C57C 3CX5K 2ENYA 3EUUA 1BF8A 4JFFB 1QKZL 4EJ1C 3LDBB 4JY5L 1EGJA 4J7RA 2V2WB 4JO2H 7FABL 4K2UH 3VFVA 1AJ7L 1INEH 1UXWB 3CU1A 4JG0L 2EDYA 1NMCC 3MYJB 1RZJC 2C26A 4HWZA 2B5IB 3MUHL 3VGAC 2VLKD 3P4NA 5FYLH 4B53A 1NEZB 1I1RA 2JTDA 2D7OA 2CSPA 4LLUA 4HT1L 4Y19D 4HWBL 3QPQD 5KVEL 5DWUH 1LE5A 3DBXB 3HE6A 4NQCE 5HXMA 2HN7B 3W11D 2GJ6A 3WKMH 1V3LA 2PW2B 1YECL 4I3SH 5I8OL 2X4TA 1OTUD 3M1BB 4LLAA 4NQXA 2KZWA 1V8HA 3SDXB 4JKWA 3G6DH 1QFWH 1HXMA 1DBKL 5D7SH 3CLFH 3M45A 1MY7A 5FUZL 3EO9H 4WUKL 5D7LB 3O6FD 3NZ8A 5D1XA 4X9IA 1VFBB 1BBDL 4KVNL 1UCBL 1AC6A 3D6GA 4H0HB 2VDML 2DJ4A 5CWSA 3O6FB 1MCCA 4Z0XA 5DHVH 1AD9A 4XCEB 1X5KA 4WU7B 4LKXB 4HXAH 3QDME 1YJDH 5GISL 1MFNA 1NGPH 4W70A 4NQDA 4WEBL 3RP1A 1UZ6F 5MHSD 1WBYB 3SDYL 3DMMA 2IGFH 2YUWA 1XF4A 1DQQA 1ZA6B 3MRPB 2GJZB 4K7FB 1DTUA 3HE6D 1J87A 2Z8RA 4NDMB 5T3ZH 2YPKB 1DE4B 2IADB 1NFDF 2F5BH 2ZUYA 4DUXA 1T1ZA 1MRDH 2A74A 4KKLC 4Z0BL 3PWNA 1M71B 3QO1B 5HYJD 2GQHA 5EU5A 2DJSA 4JRXA 3EYSH 5D6CB 4PY8I 3WFEH 2NW3A 5I1EL 5D93B 4P2RB 3BPLB 4ZS7L 2BNRD 1MCFA 1RULL 4ODUB 3F62A 5GGTH 3QI9A 3QIUB 3BWAB 4AY0A 4QHLA 2ORBL 4WIQA 4PRPE 3UX9B 3ECBB 4KTEL 4WFHE 1P6AB 1FYTA 1KLFA 4WHYH 4PUBL 3D2UB 4MQSB 5F7EL 1AFVH 2VYRE 3TWCL 1AHWA 1I1FB 1Q0YL 3HNVH 2MHAA 2Q6WB 4CDGC 5LGHL 2CMRL 5EU3B 5HDBE 1I8KA 3SKNA 1NDMB 4KWUA 1EPFA 4HIXL 1CDCA 5BO1L 3VE0B 2J6EA 5HGAA 4FTVB 1UB5A 4MAUL 1X4ZA 4XXDA 4XBPB 4ACPA 4TULH 1FLRH 5HY9B 3S4SA 1G9NL 2BJMH 2X4UA 4F2MB 1U3HA 4U1KA 3UBXB 3GDBA 1H5BB 4AIXA 1KACB 4KFZC 3HB3C 3DSFH 4K71C 2BVUA 4ZOBA 1YNTA 5C0IB 2OLDA 3KPPB 3O3EB 5MEPB 4U6HB 1KG0B 3WHXA 5IESL 1T80A 5CP7B 1A14L 4U0RC 4E41B 3UBXA 3NZHL 1BGXL 2OSLB 1J18A 1NAKH 1T1YB 2BSTA 4YWGH 3OGCB 4HZAA 4PJ8A 3MUZ1 5TF0A 4ONHA 1B6UA 4UIKL 4PV9A 4WTZG 2GCYA 3VCLA 2H2PC 2E27H 5E2UH 4QXGL 1UYWH 3O11B 2J5LB 4PGBB 4OF6A 3OGOE 1ADQH 4JY4A 3RA7L 4HWZB 2DQFA 3U4BL 1XFPA 2YPLA 4IHOA 1IQWL 3SKJL 3P0VH 2J8UB 1MUJA 5EZLA 3REWA 5FF6A 3HI1B 3UJJL 2EE2A 4XCFH 4PJFE 4P5KB 4NBXB 1NBZA 4G7YH 3WLWC 3ARPA 1C5CH 5FYKL 5DT1L 2Q86B 3AMKA 1E6JL 4IHOB 5I19H 1AO7E 1XGQB 4PJGF 3KJ6H 4K3EL 4J2XA 3E6FA 1Z5LB 4YGVA 3DX6A 4KKLD 1J0JA 2YXFA 5GGQL 4X7TA 3RWCB 1WQVT 1FL3B 5CBEA 1I7UB 2Q8AL 1N5AB 2AJZB 1WICA 4XXCA 1I7ZA 3QB7C 4DKEL 4LRIA 4IDJH 2BERA 3WV0A 3OKEB 1BJ1J 1KJVA 2W0PA 1F97A 5E6ZA 2EIZB 3MBEC 3IRZA 3MRNA 2ZCHL 1B6DA 3K81A 4KI5E 4GKNB 1FPTH 2YSSA 2H6PA 2NY5C 1W72B 4G6MH 1JF1B 1UB6A 3IS1X 5LBSL 4OUOA 1F6FB 4JFYA 2V9TA 2DMCA 1QP1A 2G5BA 3E3QA 3QQ4B 3NFSH 4IRJC 1E28B 3JZ7A 1P6FA 4P2OA 2ADJA 4QY8B 1A7BA 1G7QA 3BESR 2R9HD 3HC4L 5JORA 2FEDC 2FB4L 1IT9H 1IM3B 1J5OH 1UM5H 2VZVA 4G9FA 2BX5A 1D5XA 4XCCH 2GITA 3WHE1 4PJEF 5H2BB 1NC4A 1MREH 2J8UE 1KPRA 1OP5K 3SDXA 5HI4C 1KB5B 4FFZL 1BVKA 3CFJA 1QEWB 5HJ3B 3GI9H 3X14A 4WO4B 3ILQD 3RVVC 5DI8A 4YQXL 4ESKA 5D6DC 5C0NC 3QBTB 3NN8B 5E8NA 1P7HL 1O5DT 1IM9A 4TTDC 1XGTA 4QXWA 4JQXA 5B3JE 5HYSB 4XAKD 1UXSA 1FYHB 3T0BA 4EI6B 4EUPA 5IBLC 3LEVH 1RHHA 3OB0K 4JG0H 2VTFA 5D2NC 4OM1L 3AVEA 3IFOB 3A6BL 4MJ5B 3FOLB 3WKNA 2B1AL 5C0ND 3QIBB 1AR2A 3CXHK 5FUCC 5T1KB 3QEHB 4WI9A 1S7SB 3MV9A 3DROB 3HB3D 2ZSWB 3O8XB 1M7IB 4P9MH 1G7MB 5GS2D 1VDGA 2GJZA 4K7FA 2XTJB 4NOFA 3PL6B 4HEPG 4XVSH 5E5RB 2I9TA 4PYHA 4YFLF 3TJHC 1CQKA 4N8CH 3JVGA 2NY0D 1RIHL 2DI8A 3LN5B 4UI2A 4V3EB 3BZFB 1E27A 4M6OH 3SGEH 3MRBA 2IFGA 3O41B 1SJEA 1FZKA 2EXYC 2V5MA 2WWKT 1N0XL 3K4AA 4Y5YC 3PNWA 4F9LC 2ED9A 1CU4L 1CT8A 5IB2A 3S88L 4TQEL 2HRPH 2D4FA 2FZ3A 3KLAB 4WWKA 4NKQB 5DJ8B 5DRZA 4MJID 1Q0XL 4JO1L 2A0LC 2BNQA 2OJZH 3OMZA 4PJBF 4PGEB 3EDDA 1N6VA 4EUPG 1LP9F 2PYFB 4M7ZC 4U1IB 5J0BA 4PB0L 4WU5A 3QIWC 1OCWL 3FFDA 3NPSC 4AM0B 3FB7A 4XZUB 4PRPA 2ATPB 3ZSSA 3FO0H 3GKWH 3MR9A 2X4RA 1AIFA 2ADFH 1BVZA 3FONB 2DWDA 1MY5A 2UWEE 2YXMA 4NQEE 4M8VA 4RQQA 4UNVA 2QSVA 3T1FB 5E4EC 2ITDB 1H3PH 1RK0A 3N1QC 5DD0L 4CBPA 4JRXE 4S11A 3BH8A 4Q9QL 3LMJH 3MLTB 5KANI 1CD8A 1ZEAL 3LAFA 5D2NB 5IBUG 5FYKH 5JPMA 4XCNB 4DKFH 3TT3H 1CE6B 4JFFD 1DQML 3HG1E 3SGJC 1BQUA 2AK1L 1MI5E 1I4FB 5DK3A 1G7PA 2ESVB 4MWFA 5ICZA 1HKLL 4XXDB 1BQHA 5GSVB 5ELIA 4HAFA 3AS3A 2D31B 3TBTB 2W9EH 4P3CL 5J9PA 2PXYB 5MI0B 1AJ7H 5BXFA 3Q1SH 1P84J 2Q8BL 2ZUWA 4PV9B 1DVFB 1F3RB 3M17B 1TQCC 1PSKH 4Y5VB 4C56A 3SCMB 2VDRH 4K23L 4OF8A 1X5IA 4NSKA 5L9DL 4Q6IC 3SE8H 1CTNA 1A1OB 4CAGA 2AEWA 5B38A 4DGIH 3C2AH 4G6JH 3MCLH 3LKRB 4Y1AE 5DEFA 3NFSL 1F13A 4IRJB 4F7MA 3VFRA 2YK1L 3OAZK 3SKUD 2VLJA 4N0YH 5KSBB 2PYEB 1G9EA 3BZ4B 1NUGA 2P8LB 3ARYA 4LHUB 1F5WA 4UT6H 4BZYA 2AW2A 5CGYD 4TTDD 4AEEA 5IG7B 1I1AB 5DURD 3W0WD 1F2QA 2LU4A 2AQ2A 4PGCA 4NFDA 5BZDB 4HGWA 1T83A 3ULUD 5TFSH 4LHUD 1KEGH 4FQCL 4ERSH 1NCBH 5DEFB 4YDJA 4G8FA 1NC2A 1XT5A 3PDOB 3RWIA 4NNYB 5FUZH 5SWZA 1HHKA 2ZUUA 3EFDH 5HSFA 2DOCA 2LAAA 2JJTC 5FV2A 2R0ZL 3F7VB 4G8EA 4PJFF 4HCRA 1TCMA 1M4KA 1K9TA 1MCWW 2WBWB 4TSCL 3WUWG 3V0AC 1JF6A 3ZE2E 5BXFB 1D5MA 3T3PF 5K9OA 5TQ0L 4XVUC 5E08H 4NBYB 3SDCA 1U58A 1YYML 1CR9L 4FXGB 1WC7A 1X5ZA 4U3HA 5JHDA 2HKHH 5KW9L 4XH2A 3LKQB 1ZT7A 3BKYH 4L5FH 4Y5YB 2B1AH 4GRWH 5HHQB 1RSFA 3I6KB 4I0CC 4BYHA 4JAMB 4Z5RA 2F5BL 4YZFF 3TCLB 4HWEL 1NL0H 3A67L 5K9OB 1II4E 4WI5A 3U9PH 4PB9L 4YHIA 4L8SA 4GRLB 4GS7B 3VXUD 2HFFA 5I15L 3KPSD 3GSNL 4TSBH 3DO3A 4LVEA 4MAYA 2DDQH 1OL0A 3L5XL 1CLZH 1F11A 1PDKA 5KVGL 3GSWA 2EEDA 4XC1L 3VXPA 5ITBL 3KHQA 4LCUA 1A5FH 5B4MD 4M43L 3MRKB 1X6NA 1H3UA 4N8PA 1W0VB 2P24A 5K33A 4NN6C 1QBLL 1ROWA 3HCVB 1CTOA 1CGTA 3MYJA 4ZUUB 1TDQA 3F65A 4AL8L 1W72H 5HDBF 1JPSL 1A3RH 1LP9A 4EUPH 2BSSA 4NZTL 1T03L 5D72L 3TNMA 1U3ZA 1H15B 5T3XL 5LXGH 3JWOL 1F42A 1NKRA 4DN4L 2C7UA 3O4LE 3BJ91 1KIQB 4FXKB 4ALAL 5JW4Q 3MV7D 3I9GL 5DVNA 5E8DH 4FFVC 1ORSB 3ULVH 1ONQB 4OZ4B 4LK4A 5JQ6H 2QKIA 3GSNB 2MFNA 3GGWB 3G08B 4JDVB 5DMGC 1OAQH 1AC0A 3GMMB 3P4MA 5IR1A 5K59F 1T0PB 4U05A 1TITA 2GJ6B 4P4KC 4R96B 3RBSA 2B1HH 3QEUB 2M1KA 3V6ZB 1YEEL 1J05A 3PWPA 4H1LB 4IRZH 1WF5A 3X13A 4NWTL 3RAJH 2AP2A 2AXGB 5AEAA 2VE6A 5J4MA 5JXED 3KYOB 1NFDE 1S7RA 4AT6B 2YBRA 1P9MA 3FT2B 2XTJD 4G8IB 4N0UA 5FUOH 4R2GD 4UNUA 4LLYB 3S35L 2XN9E 4HS6A 1CWVA 1XGPB 4CW1B 1G7JB 2CJUL 5E2UL 3S34L 1DUYB 4F7CA 5C0DB 1I9RL 1AXTH 4LNVA 5C8JA 4YPJA 2Y36H 3AB0B 3QR2A 1YUHA 3ELAT 1FVDA 3SGEI 1O0VA 5IW1A 3PL6C 4N1EA 3FFCA 1FRGH 1OVZA 3ROOA 4H20L 3VXMD 4TVSa 4W4OC 3FT4B 4JKLA 2VN7A 3UTPD 2H8PA 5F96L 3TEUA 5HGHB 2B4CL 4ZUTA 5DJ6A 1YYLL 2HTLD 4KK5D 2BSED 3BQUB 5CGYC 1X5AA 4ZXBC 5DT1H 3W9DA 1XH3B 5SWSB 1TETL 3H3KA 3MODH 3DURB 3O3EA 5MEPA 2PYFA 4U1IA 3S9DB 2AJ3A 1YEFH 4H26B 3LSOA 1LEIA 3GSVB 3T4AA 1AD0B 3QH3A 3LPGA 5CUSH 3CVHA 4JFZL 2VDKL 3PWUB 5EC2B 3H9HA 1R3JB 1IKFH 2EICA 2FHFA 3EDFA 3S4SB 5D70L 1FIGH 1XGYL 2BVOB 5TDNB 5CEZH 1U8NB 4HZLA 2GAZB 1LHZA 2XWJA 4PB0H 3MJ7B 4OJFL 1CXFA 4NKIH 3HPJB 3EOAB 4XMPL 3GJEB 3IJYA 3SKNB 1D9KC 3X12A 2D7NA 4CU6A 2WW8A 3TFKC 3JWDC 2EKJA 4EIGB 5C0AD 2DLIA 4M1DH 4O5LH 4PJFA 4XP5L 4LSQH 2EC9T 3PQYE 1RD6A 5IFAH 5CAYB 2CUMA 1IQDB 4DFIA 5KSAA 1FN4B 2YWZA 5DJDA 2ARJA 1CLYL 5BVJB 3UTTD 4OZFG 1J0HA 4JVPA 1T66C 2X41A 2X1PA 4LSRH 3TFKD 2C3WA 3CFBB 4NQVB 5I1KL 1W0WB 3K8KA 4PJCF 5HYQB 3UBXG 5KVEH 5DYOA 4IRSA 1MPAH 2B8OT 5GRZA 3RIAK 5E4EB 2MPAL 4JHWH 1JRHL 4OF0A 5L0QB 4MS8C 5EU6A 3SCMA 5F1KC 5C9JA 4F7TB 1KGCD 4XBGB 5IV2B 1DUZA 3IDIA 2F5AH 4Z95H 4G6AD 4NRXA 5F71A 1J8HE 3S36X 1SHMA 1UJTA 1B2WH 5EO9A 4AIZA 5ANMA 1GZQA 4J3SA 3IFPB 4LKXA 1KJ2L 4HS3B 4JVUA 2ZOLB 1I1YB 1B0RA 2ZCKL 3WL9B 4HK3J 3L5IA 4JGUA 3RX5A 2J6EH 4FNLL 3CDGA 4GOSA 4HUXA 4OLVL 2FX7L 3QNXA 2FBJH 3QXVA 5DHYB 3BKJL 4G3YL 1CFTA 1QG3A 3MRIA 4M6ML 5EU4B 2VJXA 3IB4A 2VDOH 4PJAF 1EFXA 5C3TA 4LMQI 4LEXH 2UUDH 3G6JE 1D3CA 4P2QD 2HA1A 2C3VB 3N0PB 2XTJC 4I2XA 2UVEA 3OKEA 4DOHB 3SE4C 3SGDI 5DR5L 3PDGA 2FWOB 3RWDB 5BZWA 3E6HB 1LO0H 3DIFA 5EBMB 5MEQB 3MFFB 1UB5B 3WDJA 2XTLA 4QOKB 5ANMB 4MNGB 1RQ5A 1A7OH 1YJDC 2UUDK 4KK9C 3JWOC 4NRXB 1PX3A 1ZE3C 1D9KB 2UZIL 5HPOA 5E2WH 3BO8B 3TPKA 5F89B 3ALXA 4JY6A 4NNXB 5DJYB 3VXNA 4W6YB 3BAEH 2QEJA 1F4YH 2P8PA 5EZOH 5IHZB 3EFFB 2NXYD 3UTQA 2IBGA 1KYOK 3FQUA 2X1QA 3QQ9D 4IMLA 3OKOB 5E24E 2CMRH 4QHLB 2MTPA 2GFBA 5A2LH 3RQ3A 5IF0B 4NZUH 4G6FD 5DZOA 1MAKA 3HTLX 3TYGL 4HW6A 1SM3L 1SYVA 2ADIA 3HE7A 3DX7A 3DRTB 5JOFA 3PGDA 4U6TA 4JFHD 4MZ2A 1IILE 1SYSA 1ND0A 3GSNH 1NCUA 4U31A 4Y8DC 2JCCA 5E99L 5LCVL 2BNUA 4ETQB 4RCAA 3JV0A 3PWNB 3VFMB 1WBZA 4FQPA 2EDRA 1HXYB 1SYVB 4PREA 5FYJL 2DQJH 4JGJA 4S2SA 5KS9E 3MXWH 1H15A 4PJXE 3VRJA 1A6WH 1HKLH 1N3NB 4Q9RH 1EAPA 4KRPD 3RWHB 4Z7WF 4X7SH 1TFHA 3NCMA 2FSEA 3OR7A 4P48A 2VXTH 3EYOA 5B22A 4DUWA 4NZTH 1LE9B 3BIKB 2BVQB 2DBLH 3VXRB 5JR1H 5IVXB 3RVXD 2Y5TB 3ULUH 4NBZB 3F12B 4Y5XB 2OZ4A 3V52H 2E27L 4K23H 1QFHA 2XQBL 2Z31C 4DVRH 3QDHA 4G59A 3BP7A 2RGSA 2WUCL 1A3LH 1BD2B 1Q9WA 4OF5A 4YDVB 2LV4A 1GPOL 1I1AD 4LSQL 1I8KB 3W0WB 4DCQA 3QDAA 3GSXB 4V1DB 3LEXB 1REIA 3UZQA 4P57B 4GRWE 3VFNB 1NUFA 3LQZB 4YR6A 3WUWA 1HH6B 4F7PB 3BP7B 4YIQA 4ZFZA 5EDXA 2XQYK 1MFDL 1H3WM 4BSVB 5C0CA 1I3RA 2BXYA 3C5ZB 3GMOA 1C5CL 4FZ8L 4GMTL 3WBDA 1JF5A 5DC9B 1PZUB 3RJQB 3NACH 3CFIC 4ZFOB 2VL5A 2NXZD 5I8KH 4ORGA 1ITCA 2IALA 1SEQH 3MV8A 5E1AA 1F90L 5IROC 1R5VA 3V7MA 4YLQT 3QUML 5E8OB 1T1WA 4GSDL 2NW2A 4Y1AD 1FL6B 5GGUB 5JPNB 4U1LA 1JWSB 1GZQB 4LARL 5I1DB 3EO0A 4QXUL 5E8PB 5E08L 4RDQF 3GSQA 1YPZB 3BD4A