2HJLA

Crystal structure of hla-b5703 and hiv-1 peptide
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIIQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen B-57
publication title Strong TCR Conservation and Altered T Cell Cross-Reactivity Characterize a B*57-Restricted Immune Response in HIV-1 Infection.
pubmed rcsb
molecule tags Immune system
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2hjlA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2hjlA01
3PHSA 2CDEB 1BX2B 4HQQH 3RDTD 4K71B 3LS5L 5E6IA 3TH3T 1Q9WB 3T1FA 5D1ZD 3S96A 3MACL 4XBPA 3C6LA 4PLKD 1DEEB 3NFPB 2W92A 3MJ7A 1PQZB 2NY0B 5EU6E 5FO7A 5JLZA 1BLNA 5IVOA 2UZIH 3VDBA 4ALAL 1S7UA 4ZS7L 5KS9F 3MMEA 2GI7A 5F7LB 4O02H 2VDOH 5GS3A 1ZHNB 3FO9A 5JHLL 5IK3B 1JWSB 5TH2A 5DURD 1CFQA 3RGVD 4IRSD 4JZNA 4L3EE 3C5JB 2FRGP 2EXWD 2KZWA 2LQRA 1KJMA 4ZOBA 2H6PA 2ED9A 4NQVB 5T1DL 4HIHA 4YHIB 5ANMB 4PJFA 3BGFB 2FGWL 3DYOA 5HYSA 4EBQL 1QSEE 2C3HA 4HKZB 4YDVB 3U0WH 1FSKB 2FJGA 5D7IF 5ALCL 5E9DB 1LO5A 3UTPE 4U7SA 1CD1B 3EYVB 3C2AL 5E7BA 3KNBB 5FYJH 3ZO0A 4QLRA 3CAFA 2IPKA 1C7SA 4NQDA 1TJHH 1CXIA 1J5OH 4GBXD 5DJXB 4E41E 3C5SA 3HZKB 3LIZL 2Y7QA 5IJKA 4P57B 4OKVA 4EOWH 4RMVA 3O41B 2VITA 3REVA 4PB9L 4AQ1B 1F4AA 2X9XA 4U1KA 4P2OC 4PD4K 5GHWL 3MR9A 1DBAH 2IADA 4ZFOL 4BH8A 4D2NA 2DQFB 2GJ6A 2ZOKA 1U8LA 4U7KA 4FTVB 2GEEA 5IFAL 3C87A 4OJFL 4XCNA 3DECA 1WUNT 1DQMH 4Z0BL 4DAGH 3U0TB 3MV8D 4Y7MA 4TSCL 1LEKB 4D3CH 1M6OB 4AEEA 2QEJA 4JM2D 1UC6A 5TJWK 4GH7B 3DX8A 3SDAD 3TWCL 1FFRA 5DGQA 4PRHA 2M1KA 5H94A 4H8WL 1ACYL 2Y5EA 1DBBL 5I8CA 4Z7UB 4QHUA 3M8OH 3ZL4L 1CVRA 4PGEB 1NBVL 2BVOA 2AJZA 4YX2L 1QSFA 4LARH 5FYJD 1QEWA 3EO1B 3D9AH 3L3DA 4Z8FL 1GPOL 1MREH 1SQ2N 3UTTD 4Y1AB 5I1KL 2DQHL 5HPOA 2Y5TA 4HJJL 5F3HB 5C07A 3VXPA 3C5ZD 4OM0H 3GMNB 3DUUA 1XGTA 5IFJB 2AV1B 5E5UB 1JRHL 3CLEH 3RY6A 4MXQA 1NC4B 3VG0H 4WTZA 1OT2A 2NXYC 2X4TA 4PLJC 1G7JB 2IC2A 1S7QA 1ZHKB 3BMWA 4P2OB 3O6LH 1FRGL 2Y23A 4MQXD 2XZAL 2NZIA 1MY5A 1I1AC 3MLYH 4EUPG 2LABA 2W65A 1ZSDB 4JFXB 3WBDA 1IGML 1JGLL 1HNGA 3FQRB 4MJ5A 1LP9B 4PJDA 1FZKB 2AJVL 5EC1B 1TIUA 2R0WL 3ULVE 1FYTB 2YD7A 2C7UB 3TA3D 3GJFK 1KJ3L 4JAMA 1SYVB 1KN2H 1S78C 3W9EB 3I02B 3GSOB 3MSPA 3O11B 4MYWB 3ZLQC 2CUHA 1T5WB 2EO9A 4GKZB 1N3NB 1W8NA 2YA1A 2VC2L 5C7XL 4P2QD 5I8KH 3E3QE 4HX1A 5C0GB 3PWUA 3TLRA 2VWEC 3GZKA 4OF0A 3G04A 1JNLL 5FUZL 4ZFOA 4FQXC 3AAZA 3B3IB 2NY2C 3FRUA 1T0NA 2YS4A 2B1AH 1RMFH 5H2BB 2F5AH 5IMMB 2ID5A 1G9MH 2FDBP 2B0SL 3WO4C 4EQ3A 2NXYB 3O3AB 4C56B 3MRDA 1J11A 1F4YL 4NHCL 1OAXL 2HLFC 5ICZA 3HUJB 5KG9A 4ORGB 1JFQH 2KBGA 5CZXC 3PV6B 5FDWA 2XA8L 4P23C 2X70B 4U05A 1I9IH 3B2UC 3RJDA 1I1AB 4YHML 1AIFA 3MV11 4KAQL 4M8VA 1WCBB 3WFBH 4IOFD 4K9EC 3WS3A 1EZVY 4D94A 3O45B 1A4KB 1FBIH 1ZA6A 2X10A 5F7FA 3NPSC 2PUQT 3HFML 4M6AA 1OD7A 1R3HB 5FAAA 2HWZH 3VFWB 2GK0B 3T3PE 3AUVA 4FQPA 2AV7A 4P5MA 2AABL 3QXTA 1WGOA 1MHPL 1N2RA 3CUPB 4UIMB 3QCTL 1H3VA 1GGUA 5C0FB 4R2GD 2ZUTA 3UCRA 4XPFL 3K8LA 5F21B 5C9JA 1T1YA 2VN7A 3QUKB 5I2IA 2LAGB 1WFOA 1X7QB 5SWSD 3QHTC 1MFAL 4K7PY 1P69B 2R2BA 2DQJH 5IM7A 1Y6KR 5C0CB 2J4WH 2P49B 1ND0B 1RZJC 2VABA 3CVHL 4FQXB 5F7HA 1OP5H 2NY2B 2R2EB 1OTSD 5FECA 5GGSA 1B2WL 5DA4A 4R6UA 1VGKA 2QSCH 3V2AR 2XPGA 5JQHC 3WO4B 3ULVF 4UDTB 1OQOA 4I0CC 4PRID 3LKQB 4OGYL 4DW2H 2E7LA 4OFDA 4I9WE 1NCBH 4HUWA 3QG6A 2R8SH 1F4XH 1RIUH 2BCKB 1MCWW 2DL9A 4JFPB 4LMQE 2EH7H 1DLFL 3TN0C 1GGCH 4P23B 2N56A 2PTTB 4X4YB 1IKNC 4G8FB 4KK8C 4N90E 3LQAL 2VZ1A 3OJDA 2BVPB 4AENA 4OZGE 2H9GA 5DFWH 4BK5A 5DGRA 4U6HB 1MH5B 4LCWA 4H88H 2UVEA 1MFEH 3MRLA 4EDWH 3PE9A 1WICA 3NPSB 4GOSA 4KQ4L 1I3RB 1HKFA 3TJEH 3V5HB 2D7PA 3SCMD 3UP1A 1JMXA 3RVXD 2XYCA 3QIBC 5BZDB 1UKQA 2VSCA 2MKWA 1KNOB 2YXFA 4RX4D 5DRXB 4PY7A 2PYFA 2MQCA 2ZKHL 1EGJL 4XVJL 3O6FC 4JRYD 2Y1VA 3KJ6L 3STLA 1PG7W 3O6MH 4GO6B 5FCUH 3ZSSA 2AQ2A 4GAJH 5IROC 1YY8B 5E8EA 3NIDE 1J8KA 3DX9A 4CBPA 1NBZA 2EYTA 2VSDA 1FHGA 9CGTA 4XHJD 5J6GB 1X3DA 4OGAD 3P9LA 3NCBB 5GGTA 4KJWC 5D71H 1EA9C 1MLCB 4M1CD 4A6YH 1GAFL 1A14H 1NFDA 1K8IB 3RAJH 1W72L 3H7BB 4PYGA 3T3PF 5I1HL 3HRZB 2GW5A 1A64A 1BFVL 2WAHA 4RGNE 4JRXB 4S0TD 3H9SA 4M61B 5DJ6A 1OP5K 5FGSA 3Q1SH 1TFHA 3S4SG 3TN0B 4BFIA 3VE0B 3AS3A 4MNGE 4TVPL 4RNRB 2HVJA 3CMOL 3F7YB 1MQ8A 4DGYL 1I85A 3L3IB 3GSWB 4WHCA 3EDFA 4WJ5B 4UINH 4CDGC 3MRNB 4JHWL 1F6AA 2WW8A 3NIGE 4KHXH 3VXRE 3E0GA 3MGAA 3WLWC 1P7KA 3UXFA 5E2JA 1Z0MA 2IPTL 2HTLD 4DEPB 2KUTA 2B4CC 3SBWA 1UB6B 1QLEL 3N9GH 2PXYA 2FHFA 5F70A 3QIBB 4HC1H 3MRHA 3PJSB 5C0JA 3CVHA 3FN0H 3NH7H 5TE7H 2R29L 3EYFA 3O6FB 2FGZA 5HXMA 1OHQA 3VD7A 4K7PH 3GDBA 3LKPA 4FS0A 3FQWA 2X6MA 3IXTB 3WIIL 1IC5H 2YEZB 2JCCA 2G2RA 32C2A 3UTOA 4Z0XA 2GY7B 4OKDA 3WE6B 1FFPA 4DN4H 4OZGF 2HJLA 4TUOA 5DA0B 5DZLA 3VI4E 3V8OA 4WHTB 3IGAA 3VFSA 3VXUE 3T2NH 5AYUH 1I8IA 2CXKA 4EN3B 4ZFFB 2EDWA 1NEZA 2MQ0A 4ZYKB 3DV4A 3QI9A 4X8JB 3F7QA 5GGUB 1EERB 4JR9L 5JQ6H 2VZOA 2QHRL 1OY3B 2VDNH 4QF1A 1ZGLP 4J4PD 4UILL 4S1DC 5BCAA 1Q94A 3VXQB 1S7WB 4Q7DA 3NIDF 1XR9B 8CGTA 2JKXA 4AL8H 4WU7A 4L9LA 5EU7C 3WN5A 3FN9A 4UT6L 3KYOA 3GEWB 4NFCA 3V6OA 1NC2D 4N0YL 1ZA3B 4X6CE 1QLFA 1A6PA 4QRPB 5SWZB 2P44B 2I07B 4HFWA 4I48B 3O4OC 3LQZB 5LBSH 4C4KT 4K07A 5C0AA 1TJGH 1F3JB 3FZUD 5T1LB 2IAMA 4Y5YC 5DJ0B 4I3GA 4J2XA 1K8DB 1G7LB 4U7MA 5T1KA 2P48B 3IFOB 5CILL 1LO0H 4G9FA 2JJTC 1I8MA 1NLDL 2VAJA 1R3LA 3D87B 2E6QA 1HYSD 2ESVE 3NIGF 3VXSD 1NGZB 2BRRH 3IDXL 4YHLL 3U1SL 1A7PL 3OHXB 3MXVH 4GAYB 4Y5XC 2WUBH 3BIAX 3ZE0F 1OGAE 1R3IL 2BHYA 2ITDB 3IJHB 4ETQA 3FB8A 3IDYC 4KPHH 3QUMB 3ROOB 1TVBA 3SO5A 2VDPL 4OLZL 1CDUA 3T8XA 4HLZG 3RZWA 4AEFA 3FT2B 2V7NB 2Y06H 5ETUA 5AAMA 4CVZB 1I1RA 3IS1X 2GJZA 3GSUB 2FX9H 4NHUB 2R1WB 4LEOA 2AJXH 2BVTA 1GIGL 2DWEB 3K4DA 5DHYB 2X09A 4ZO9A 35C8L 3VI4F 3VGEA 3W82A 4Z76A 3WO3B 5DD0H 3UJIH 1HILA 4HJGA 1J1PL 2PF6A 1PZ5B 1OD9A 3T3MF 5IHLB 3REWB 4IOSD 1A21A 2AXHA 4Y5YB 4N8VG 3KYNB 1M7IA 3W0WB 3ZTNL 5GSVA 4MD0A 3MA9H 4LCCA 1Q38A 4PJIB 1R5VB 1SM3H 3UJTH 1PY9A 2BY0A 1FPTH 4E5XB 5IESL 2F53B 4UV4H 4OUUB 4NQEB 4PV9A 1RZ8A 2VJXA 3QXDB 1LWRA 1K4CA 4JPVL 2Z4QB 1R0AH 1XIWC 5C92A 4UIKH 4Z7VE 4BH7A 4NQCA 5FV1L 4MLIA 4X98A 4Y5XB 4M4PA 4Z7OE 4JPWL 4JFZH 1WZMA 2DJSA 3Q6GL 2VLJA 4NO5A 3IDYB 4LCYB 4Q97A 2XTJD 5DVKA 1P2CA 4F7TB 3LPGA 4ZD3L 3WXWL 3I2CH 4G6AC 4PB0H 4GKOA 4G5ZH 3IAQA 3GIZL 4GRWE 3RNQB 3UTQA 3WIHH 1ETZA 5KSVB 5AZEH 3C2SA 4KGLA 3U0PA 3IFPB 1S7VA 3QXAB 1F58H 4JO4L 1OAYL 5F96H 1JRHI 5FM8A 1P7QD 2BVQB 2Y6SC 4XI5C 1DBJH 3FO2A 5BVJB 3V79C 3KPLA 3KLDA 3PHQB 3WFCL 3B9VA 4PRDA 5E5MA 5TDNA 1ZS8A 4PJFE 3LH2L 3CFCL 1CXFA 1I9RH 4TNWK 5C0BA 4ZPTA 3TEUA 3UO1L 5DHVA 4J23A 2OMNA 4LRIC 3VRIA 4IRJC 5J11C 3EOYG 3WFDL 3GMRB 4AM0A 4BQ6A 4L3CA 4JFDD 4OAWB 3WV0A 4NZTH 4HZAA 3S3PA 1MRCL 1DQDL 2AJUH 3EJZD 4QYOB 1CCZA 1XIWB 1A1OB 4I0KA 4RAUA 4PLOB 4I2XB 2Z31C 4G7VH 4HK3J 3H3PL 3VFVA 4MAYC 4X0KA 4RFOH 4MCZB 1JF5A 3G5VB 5GRVL 2YOCA 4XWOC 1AXSA 1RU9H 3UBXA 5GQBA 1SBSH 1UKSA 4IIQC 2BNQA 3GKWH 4NCDA 2GJ6E 5HGAB 4NGHH 1FL3A 2DDQH 1CWVA 4I0PC 5MEQB 2ZWLT 3C9NB 4I77H 1CGSH 3OJMB 4HXAH 1XCTA 3RWEA 3HR6A 1OF2B 4F7MB 2NXZC 2FYYB 3EIFA 4NM4L 2A9NL 3QB7C 1LO4H 5IG7B 5TDOB 3T65A 2PW2A 5HHQA 2FHCA 2V9QA 3BDYH 4Z7VF 4P4KD 1JF1B 2I25N 3AU1A 4PRHE 2M2DA 1F42A 4BSWB 1MFDL 5TPWL 3WHE0 4Z7OF 3D2UA 4KROC 4O2EB 5I66A 4I3RH 3RX5A 4KRPC 1XF4A 3WL9B 1QRNA 3H2WA 4ZS6D 4M7ZB 3I3BA 3PGFL 2FD6L 4OIAA 5E00B 3DJ9A 4FQCH 4IRJB 5J11B 1WBXB 3WNOA 3MLTB 3X3GH 4Y2OA 3GK8L 1JZ2A 3NMEA 5C07E 4PJCF 3FB6B 1DUYA 1LQSR 1J1OH 3OQ3B 3AY4C 1IFHL 2DRUA 5DD3H 1P5VA 2W07A 3U4BH 4N0CA 3SGKC 2H32A 4FZ8L 4MAYB 4OZFH 4XC3H 4D0BB 4F33A 4HULB 1MCLA 3WJLC 5DUMH 4QTIL 1CDCA 2D7TH 3K1KC 1EUTA 4IIQB 3L3HB 4PJFF 4GRWH 3QEGL 1FP5A 3MRCB 1MOEA 4I0PB 2BNRB 2FIKA 3TJHD 3PHOA 2NR6D 2V2WA 3QUYC 2R0ZH 3OXSA 4KK5C 4PG2C 2NMSA 1RIVH 2NXZB 1BZQK 1IC7L 5CS7A 1P4IL 2UZYB 3DOSA 4OGXH 5E8NA 2XQYG 1H8OA 1NGYB 4JFQA 1OOAA 5DC9B 2YMXL 5FYJU 2Z0BA 4N5ED 5DWUH 4KROB 4KRPB 1YQVH 3T77A 3BH9A 1HH6B 2XG5A 4Z95L 4OTXL 1FAKT 2G9HB 3H0TB 2QV2A 5DK3A 1GL4B 3WFHB 4HT1L 2ZSVA 2A1WL 1GZPB 1QOKA 3GUTB 1QQDB 2D03H 3RVWC 2ADGB 4Q9QL 3FL7A 3K74B 5D7SH 5IB5B 4HF5H 3HG1A 3MRIA 5IOPB 1S7TB 4GMSH 5LVEA 4O9HH 1CGXA 5CBEB 3DBXA 3MODL 3MLPA 5FO8A 5E6ID 5J12C 3RUGA 1JGUH 4LDLB 2NY3C 5DI8B 4OQTL 1IGCL 5I1LA 4C83B 3GBML 4AEHH 4G43A 3Q3GB 2DWDB 4TPRH 1L7IH 2N7BA 5CJOL 4HIEB 1OCWL 1UWXH 3VGHA 4LGPB 3D6GA 4HCRL 2VYRE 4Z5RA 3DVIA 4OIBA 4XP1L 5D7JC 1JNNH 5DUPH 3QUYB 1U3HA 5F89B 3VA2C 1L7TH 3H9ZA 1KIQA 3L7FB 1KF9B 3I75B 5GISL 2IQAB 4N68A 2NPLX 4OBRA 2N4IA 3FFCA 4NUJB 3BQUC 5JORB 4PJGB 4XWGL 3HE7C 3NFNA 1HHIB 3ZKMC 3RZCA 1FDLL 2ZJSH 1NGPL 4U3HA 5F1IA 4WV1A 3ROLA 3LPFA 2V9RA 3D48R 1TZGL 3CFIC 4NQDD 3LS5H 5F7DA 5IMOB 3VD4A 3LCYA 3U2SB 2YK1L 3MACH 4R97B 2GSGA 1I4FA 3BKJL 4K7FA 5JMRA 3T2OA 1V8HA 2I60L 1QR1B 4XPTL 5J12B 2WY3A 4ALAH 1WV7T 2FEDC 4ZS7H 3EDKA 2GT9B 2NY3B 3DMMA 5GGSY 3VD3A 2E7LE 2JJVA 1NMCC 3EYOA 5JHLH 1DZBA 5EIVA 5JXEA 1NDGA 5LQBL 2AQ3A 3LKNA 5IP4A 5ABDE 3R8QA 1CK0L 4CW1B 1TCRB 1HEZA 3MLSL 1X4XA 5BQ7B 3FO0H 5I1AA 1JPFA 4FHBD 4CADB 1JHKL 5T1DH 5C3TA 2FGWH 3G6JB 3MLUL 5HPMA 4EBQH 5GPRA 4LCWE 2BSRB 4UQ3B 3PWNB 4J1UB 5D7JB 1W8OA 4GW4B 5ALCH 1JTOA 4DVBB 4R4BB 2HG5A 3C2AH 3G9VA 5BJTA 4OF6A 4Y88A 2GYSA 4OI8A 5GS2H 1KIRB 4KJPC 1UWXK 5C6TL 3QH3B 4QRRB 1QSFD 3BEWB 3LIZH 4V1DA 1TTUA 3MBEC 5DQJB 1AHWA 3EYUL 5FFLA 3HE7B 4KK9D 1YNTA 3ELAT 4XCYB 4WU5A 5F8RC 1F13A 5ICYB 1O7VA 4PB9H 3RWIA 3G08B 4OQTA 5GGVL 5GHWH 4PTUA 1AP2B 2RFXA 2LVEA 4MXQD 1JGEA 2FHBA 5T3XE 4XZUB 5IFAH 1A6TB 2CXGA 4OJFH 5IEKB 2A83B 1XZ0A 4D0CA 1NFDE 4HCRA 5GRJL 1A2YB 4Z0BH 1JTTA 4QXTA 4LLQB 4TSCH 4TQEL 4JFFD 1T21A 2VLKB 1NMCB 1G6RL 3X14A 4L9DA 4URTB 3H9SE 3TWCH 3QIWD 3RP1A 4OV5B 2A6KA 1WFNA 4H8WH 2E7MA 3RNKB 4N0UB 1ACYH 5EFIB 5GXBB 4NYLB 1DBBH 2XY1A 2VISB 2D7MA 3ZL4H 4LU5L 1HHGB 1NBVH 3RDTC 4YPJA 4YX2H 3Q5TA 4NQSA 5D1ZC 3EGSA 5L2KD 4YGVA 5HYJB 5GS2D 4Z8FH 1GPOH 5I1KH 4PLKC 2DQHH 3KPSD 5E7FA 3LN4A 5HJ3B 4HJJH 4HWNA 5DHXB 4H5SB 1U93A 1JRHH 3MBEB 5HDQL 1HXMB 5DRZB 5IMKB 2BNUA 2E7BA 4KVCL 2GKIA 4X5WB 3V6BR 3RGVC 1EO5A 2JCCE 4IRSC 2EXWC 1KFAL 5BRZA 3V5DB 2QL1A 1FRGH 3I50L 2V5YA 5A2FA 2XZAH 4Y8AA 3RY4A 5BV7L 2Q86A 5EB9A 4BM7A 3VFPB 1IM9B 4BQ8A 3KLSA 4S10A 5AUMA 1IGMH 1JGLH 5I9QC 3O4LB 1RJLB 2AJVH 1ONQB 3GMMB 2R0WH 1MCOH 5EUOA 1HQ4B 4GBXC 1BVLA 3ABZA 1TMCA 3L3GB 1KJ3H 1Q0XL 3D39A 3MUZ1 4ODHL 1PD6A 4LK4A 2P5WB 2E7CA 3RDTB 3JSSA 3GB7A 3S5LB 1CD0A 5C7XH 2VC2H 5D1ZB 5FOBA 2CH8A 3VCLB 2J8OA 1ITBB 2IPUK 1U8KA 3ES6A 5DQ9A 3V6OE 1NCWL 5JNYB 3NOIA 1JNLH 4NRYB 1PX4A 2OR7A 5IW6B 3GM8A 2J8HA 2ILLA 3TIEA 1EHLL 2GJJA 5C0AE 1DBML 5KANG 1LE5A 3TVMD 2B0SH 1F8TL 3DUSA 3EUUA 4JM2C 3SDAC 5DURB 3RGVB 1F4YH 2HFEB 4IRSB 4NHCH 1KENL 1OAXH 4G9FE 4YDLC 4X6DB 2XA8H 1M4KA 4Y2DA 4OZIA 2O61A 1FNSL 4YHMH 4TVPE 4KAQH 3QJHA 1ES0A 2DLTA 2AJ3A 4HAFA 4L4TA 2VR5A 4ZXBA 3HFMH 3FO1A 1S9WA 4HS3B 4S1RL 5M7QA 2WANA 3GSVB 43CAA 3IVKB 3C5ZC 4GBXB 2AABH 5C2UB 3VXNA 3UEZA 5CEYA 1MHPH 1X4ZA 3QCTH 4IJ3C 4U6XB 3FQTA 1U0QA 3MLWL 4WHYG 4PJ7A 1XF5B 2WK2A 1S8DA 4XPFH 2JCCF 2WV3A 4PRPD 1RZFL 2ZZUT 3QXUA 1IARB 3UTZB 5D72L 1MFAH 4MQXC 4X6EB 4OV6F 4M8QA 1ZWIA 5EIIA 4UOW0 3CVHH 5D2LA 3MRQB 4NBYB 5EBMA 4IDLA 4YHNB 5ACZB 4JCLA 2YR3A 3OB8A 2EKSA 4NQXB 1LK3L 1B2WH 4IMKC 1G0XA 3MV8B 4UBDD 3P4NA 5HGBB 4IDJL 2X4NA 4JM2B 5E8PA 3SDAB 3FRPA 4OGYH 5DMKA 5EUKB 4JO3H 1OAKL 5EZIL 1AD9A 4YDLB 1DQQA 4W4NA 1DLFH 4JO2L 2V7HA 1JNJA 5ERWB 3LQAH 3DROA 3F7VA 1YMMA 4JDTL 4M48L 3UTTB 4NQCE 4KQ4H 2MJWA 1EEUA 3ORJA 4NKMB 4HWZB 5B39G 3C5ZB 4OD1L 2J12B 2VLJE 3IF1A 5FUCE 4XCEA 2X4QA 2ZKHH 4IJ3B 1EGJH 4XVJH 4RMWA 3KJ6H 1DANU 1HSAB 2P7TA 1A7QH 1K3ZA 3TO4D 3BP7A 2PXYD 4MDIA 2E8ZA 2VXQL 2KPNA 1DQJA 5LKNA 4FQHA 5IW1A 2ZUUA 4LDOB 2BJML 1SY6L 2ADIB 4IOFC 1TVHB 5J8OA 4WTXA 1GAFH 4KDTA 1TNMA 5CCKL 1W72H 2EDDA 1RJCA 5CJXA 5I1HH 3FOMA 1Z5LA 3KLAB 4Y19A 1BFVH 4JPKL 2PO6D 3MLRL 5IB1B 1B4JL 2VAAA 3HZMA 5MENA 2YC1B 4G3YL 2VZTA 4TVPH 2NY5L 1CG9B 1BF8A 3RVUD 2AGJL 3RGHA 4DGYH 2XKNA 4HUKB 2CLZB 3DYMA 4P2QB 3CFDB 4JHWH 1ZT7A 1I1YB 2EE6A 2IPTH 1QLEH 3FAWA 1J0YA 1V7NL 1G9MC 1VACA 1OTSC 1MI5A 3W9DB 2FZ3B 4GUPB 2DQUL 4F7EB 2JK5A 2BNQE 3PP3H 2CO7B 1B0RB 5F3BA 5BXFA 4FABL 3UPRB 3WIIH 3MRRA 3F6IA 5EU6B 5C0DB 4JDVA 5INDA 2O5XL 1UXWB 2BY1A 4OF8A 3N1QC 3BX7C 1XFPA 5CGTA 1YPZA 1YNKL 4WUKL 1LDSA 1Y0LA 3UTSD 3R4DA 2XWJB 2IAMD 4ZFGL 3R1GH 1IGTB 4QXWA 3EO9L 3GMOA 4KUCF 3GSXB 4PJ8D 4HG4J 3OXRB 3SCMC 4U2ZA 1QRNE 4U1NB 3RVXC 4LGRB 2X9YA 1I75A 4JR9H 4TVPD 1JWMB 2QHRH 2APWA 3DVNB 1NCDL 4PYHA 3M1BA 4UILH 5F88B 2OTWB 3D0VA 4LASL 3P30L 3P9MA 1MIML 2V6HA 5SWSB 2KKQA 5HDOA 3OTTA 3PQYA 4HW6A 4E41B 5TE6L 4UT6H 4XHJC 4OGAC 1KLUB 4N0YH 4JY6A 4DKAA 2F74A 4IMLA 4D9RE 4M1CC 4XNMB 1CZ8L 1SY6A 5JOEA 5J1AA 3JUYA 3RWFA 2DTSA 5HSFA 1JK8A 3QZWA 2Z35A 5KOMC 2CIIB 3FB5A 1C16B 4PRIB 1KLGA 2DQEL 3T0WA 4JJ5B 4MD5A 3ZKND 5J1SC 1ZGLM 5D93C 1A9BA 5JW3H 3ZDXE 5TFSL 5CILH 1JYXA 1NKRA 4FXKB 4G8EA 5EOTA 4HJ0D 4ODTL 1N8ZB 3PP3K 4X9BA 2IEPA 1RZGA 1AO7A 4O51A 3QNXB 3CNKA 4GSDL 4PR5A 4GRLD 3IDXH 4YHLH 3U1SH 4YDIL 3SCMB 4LVNC 4W6XB 2GTWB 1GGIL 3FQNA 1R3JB 3U6RA 4HUUB 4XNQB 1R3IH 3GMPB 4HIIA 4JRYB 3OKKB 4PJEB 1HKLL 2FNBA 2VDPH 4OLZH 4QRSA 4F2MB 4HH9B 3DWTA 2H1PL 2COQA 2R1XA 2YN3A 3HG1E 4KQ3L 2XN9D 4BKLB 1MJJB 5T5FL 4LP5A 1GIGH 3WHXA 3TIDA 5CAYB 3WYRA 2Z93A 1S7XA 2FL5B 4X4ZA 35C8H 3RUGE 1CU4L 2VDLL 4JVWA 1J1PH 2A6DB 4MCYA 2VDML 4Q9RL 5JIHA 4U6TA 2VDKL 3G6AB 2CMRL 3C8KB 4RCAA 1YUHB 4XRCA 1L9MA 4XNXL 5DEGA 4BZ1L 4ONHB 4ZFZB 1CTOA 1E4WL 4P3DB 4XXDB 3ZTNH 2YPKA 5D93B 5FM5M 4Z78B 5DK0A 1LEGB 2MPAL 4X6BA 4J4PC 2NZ9D 1EEYA 2UYLB 4X6FA 5IESH 1IGYB 3DURB 2HH0L 4UB0H 4M7KL 1EFQA 1WC7B 4HD9A 5F7NC 5GRUL 1CYGA 5BW7C 3FFCE 5C0BD 4N9GB 4FOMA 4L8DB 2GTZB 3MA7B 3GJEB 4LVNB 3CSYA 4UUJB 4JPWH 3QWRA 4LOUD 1A47A 4WFGE 5T1MB 4N9OB 1A5FL 3S34L 4HWBA 3FZUC 2UVFA 4JFED 3IDNB 4ZD3H 3WXWH 2GQHA 1ZLUK 3ZDXF 3P4OA 1A6ZA 3GIZH 1SVZA 4LLVA 4K23L 5A2JH 4M7LT 5C6WH 5MHSD 1PAMA 1U8OA 2H32H 3B9DA 4A6YB 3JVGC 1ZT4B 5CWSB 3BZFB 1HYSC 5C9KA 3TCLB 4JO4H 1OAYH 4LSQL 4POUB 1UQSA 2CK0L 2C3VB 2HJKA 4Y4KA 4NT6B 4ZUWA 3WFCH 4HMDA 3PWPA 3WS6C 3L5WB 4ELME 1EAPA 3LH2H 3CFCH 4WTZG 4M9OA 1U58B 1S7RB 5D4QA 3UO1H 3MV7D 1YMHB 4YHOL 4CJ1A 2X4UA 1WIUA 4APQA 3WFDH 3ARBD 3D2UD 4N0FB 3JV6A 1G1YA 4D8PA 1QRND 3K4ZA 1MRCH 4JKLA 1DQDH 3FT4B 4HEPG 3RUGF 5E99L 2BX5A 4V1DE 5E70A 5I6XC 4XVUD 2E8YA 1BFOB 1CGVA 3H3PH 3AM8C 4A2LA 3X17A 5EU5B 2CLRB 3VH8B 3ALWA 4QXGL 1KXQE 4JGMA 3D85A 2BOCA 1JPST 5CGYD 2A9ML 4GAGL 3IDGB 5JR1L 1WWBX 1FN4B 1KCRL 1KEGL 5DF0A 1G7PA 3T1WA 1IJ9A 2RR3A 3FCTB 1A7RL 4AH2B 3HLAA 1EV2E 1YN7A 1KTDB 4U1JB 3O2VL 5E24E 3IJSA 5I8EA 1S9XB 5E2VL 5D6CA 4ZQKA 4NM4H 2A9NH 4RGNC 4BELD 5EN2B 4L8SA 2CRIA 1VENA 1B0WA 5TQ2L 4QY8A 4U1IA 1PFCA 5ITBL 1MFDH 1N5AB 5TPWH 1JPGA 5F9OL 5FYLE 5JW5B 3S35L 3QPQD 2WBJA 4QHKJ 5IVXA 2ICES 3OKLA 4RQQB 3PGFH 2XTJC 4Y5VA 2FD6H 4G6KL 2NW2B 3RL2B 1EEZA 2QQLL 2CIKB 1A02N 1UM5L 4K2UL 5EIQA 1DVFA 3GK8H 3RWJA 4OZ4A 2I26N 2VIRA 3QRFM 1KLFA 3SDCB 1I8LA 3WUWG 3QNYB 3CC5A 1FFQA 1IFHH 3OKOA 1HN1A 1QHPA 3C60C 4WRLA 1ADQL 2EIBA 1NGXA 1AGBA 2YBRB 3T0BA 4FZ8H 1A9EB 5FO9A 1KB5A 1T1ZB 5GRXG 4KKNA 4KJYA 1FGVL 4ELMF 4LHUB 5BRZE 4QTIH 1EPFA 3ARED 4QHLB 5E94B 3T4YB 1BD2A 3QEGH 3UYRH 2H26A 4R3SB 4YHPB 3EKCA 2J1KA 1E4KA 4DOHE 2XWBB 2HVKA 2DB8A 1VEOA 2N1KA 3MV9A 3L3KB 3ULUE 2ZOLA 5GRVK 1S5HA 3SE4C 3HB3D 4LL9A 4HGWB 1U8QB 4S11A 1IC7H 1P4IH 2R4SL 5EUOE 1C5DB 3EJZC 4RGNB 4NDMB 4YBQD 2YMXH 4W6YB 1FNGA 5CD3A 1BWMA 4MNGB 3C6SB 4UMGA 4Z95H 4OTXH 2AERT 1KJVB 2OTUB 4JHBA 5D1XA 4HT1H 4ZUTA 2A1WH 1J0KA 5B22A 3CCHA 3DXAA 2OQJA 3VXRB 4ZPVB 2YA2A 2ZNWA 1BZ7B 4Q9QH 2BC4B 5KSBA 1A1NA 3QEQA 4B0MM 4P99A 4E42A 1KSRA 2GITA 5SWQA 3I9GL 5GGVY 4GKNB 5IIEB 1FAIL 3MODH 5DMGC 3C60B 3FHAA 4EUPA 4JN2A 2CQVA 4TRPL 3QNZB 4OQTH 2RIKA 1IGCH 4P4KC 3VFRA 4ISVA 5SX5H 3GBMH 4WIQA 1Z0NA 1BEYL 4LCUB 2CGRH 43C9A 4ZS6C 4OZIE 1VFMA 4HHAB 1GGTA 5CJOH 3GO1L 1OCWH 3CZFB 5DD5L 4HCRH 3P3YA 1FVEA 1DUZA 4XP1H 1I8KB 5IJVA 3ULSB 4L4TE 4TULL 4JFDB 2EC9T 5GISH 1SYSB 4EXPX 1W0WB 3KWWB 4ONOA 3L5XL 5JO5B 1GC1L 4PJ7E 4XWGH 3MRBB 4JO1L 2FO1A 1FDLH 2IALA 1NGPH 3SJVA 3SKOB 1ADQA 5GGRA 4ENED 5HYFA 1FGNL 5JDSB 1JGDA 3N06B 1TZGH 1WZKA 4UU9A 5KSAD 2F9BT 3DO7A 1UEYA 4WDIB 4RWYL 2NNAB 2HN7A 2YK1H 3A0OA 5EG6C 2H2SD 4X6CB 4G6JL 2PCPA 5D2LE 4NO0A 4PJXE 3ULUF 1MVUB 1JVKA 3IU4L 3TJHC 3BKJH 3O3DB 2NR6C 3QO1A 4Y4HC 5C0EA 5JW4N 4XPTH 1OW0C 1D5BB 3HPLB 2LTQC 2OMBA 2OJEB 4W70A 4P4KB 2DLGA 1G9NL 4N5EC 5LQBH 5HGDB 4DZ8B 1PBYA 3N1MC 1CK0H 2CDGB 3DETD 2HFFB 3MLSH 4TNVF 2VDQL 2ZG1A 1JHKH 3RHWK 3MLUH 4JDZB 2ESVB 4XCCL 4KVNL 1WBZB 3MJ8B 4KZEL 4MJID 5SX5K 1CF8L 2P8LB 2C4FT 4LLMB 5DRNB 5I73C 4QHMA 1FLRL 5C6TH 2XY2A 2E9JA 2Y25A 4NCC1 4QEGA 1MJ7L 2Q7YB 5E6IC 3DI3B 3GMQA 3EYUH 5A2LH 3TBWB 1CFTB 2FJHA 3HR5A 2DQGL 4QT5B 1ZLVH 1WQVT 3IRZA 4HS8L 5J06A 2IH3A 3G5YA 1JUFA 4PRBB 5J13C 2HJFB 1ZANH 3BPCA 5GGVH 1HH9A 1K5NA 5F9JB 2CJUL 3IU3B 1JN6A 3IKCB 5F93C 3KDMA 1JI1A 1CFNA 3V5KA 2ZSWA 4HFUL 5D96C 3DX6A 3OZ9L 4Y4HB 5GRJH 1A7NL 1U91B 2FO4A 4WUUA 4MNQA 4MS8A 4TQEH 4Y19E 1WZ1L 4PJHF 2LTQB 1U3YA 4WI7A 1G6RH 3VXMA 3DIFA 1RUKL 2ZNXA 3AROA 5MENE 3VDAA 1I7UA 5ESAB 4S1QL 2RJMA 4BZYA 5D1QD 2APXA 4LU5H 3L5IA 3I6LE 3EYQD 3QULA 1KGCD 4HIJB 5HD8C 2GHWB 2MQ3A 4F3FA 3D39D 4NRXA 4PJXF 1X6LA 4X7DC 5FYKD 5I73B 3MNZB 1MI5E 4OLXL 4RA3A 4AT6B 4KKCD 1OLZA 5EZJB 4OZFB 5GS1C 5E6IB 3T1FB 3S96B 2EZ0D 4QTHA 5HDQH 3MRGB 2DM7A 1QA9A 3HNTL 2R23B 4KVCH 4EXKA 3C8HA 4GRWB 4ETYA 5FO7B 3A6CH 2APBA 4QHKI 1JBJA 5J13B 4HUNB 1KFAH 3P0YL 3L9RA 4ESKA 4L8CA 3KGRA 4GG6A 1YPZE 5HDBE 2ZPKL 3BP5B 4JFYA 4TNVK 5C0IA 4CL7A 3MMEB 5BV7H 5IBTL 1ZVSB 5TH2B 3VWKA 3AS2A 1D6EB 1O0VA 1KCKA 5IV2A 4JZNB 1BIIA 2DMCA 5D7LA 3G5XA 5J6HA 3CIQA 2H6PB 4NKDB 1V3MA 4M62L 5HYSB 3JTSB 5E8OA 4X7TB 2BRQA 3CX5J 5FKPB 4G8IA 2FJGB 3O9WA 2JJWA 1FFNA 1Q0XH 3V7AG 4HLJA 4WWKA 4KK9C 1TTFA 5BS0D 2CUIA 3S35X 4FNLL 4WGWB 4NQDB 1JYNA 3GIVA 5HYQA 3C5SB 5DEFB 2Y7QB 3ARFA 4PG9A 4XT1C 4JFOA 4MXQC 1AC0A 1NCWH 4U0RC 5LAXB 2VLRA 2X42A 1OB1A 2VITB 2AKRA 4U1SA 1KJ2H 2K1MA 1EHLH 1T89C 4U1KB 3K2MC 4ZSOA 3MR9B 1DBMH 2M8XA 1U8NB 1X6NA 3LAFA 2ZOKB 1F8TH 5I1JL 1KXTB 4Y1AD 3BPOC 3G9AB 4XCNB 1KENH 2EIDA 1T83A 3HHRB 3F7RA 3ZDYE 1FNLA 1JJUA 5D5MB 1EBPA 1NC4D 1U9KA 1FNSH 1I7TA 5HHMA 1AO7E 3DX8B 3DYPA 2I5YL 5IVZA 1IQDA 3H9YA 5CFHA 3LKSA 4PBXA 2EDLA 3K8KA 3PWVB 4Q74A 5CSZA 4BJLA 5I8CB 1IZKA 3BH8B 4S1RH 2IH1B 4XBEL 4QHUB 1J8HA 2BVOB 2IANA 5DJZB 2AJZB 3KYKL 1AC6A 1QSFB 1HI6A 1YMMD 3T0EA 3L3DB 4LIQH 2VERN 2PYED 3DRQB 2AK4A 3MLWH 5I16A 4FMKA 1WT5A 2Y5TB 1F11B 1RZFH 4X80L 3VXPB 1UENA 1FYTD 3PP4L 4BK4A 1NBQA 1YPZF 5HDBF 1FVDA 5D72H 4WO4A 4U0RB 3LEXA 4P46D 2FATL 4LDEB 5KZCD 4KI5E 1DFBL 1L6ZA 1J7VR 2XZQL 3QDME 3TC9A 5C8JA 2GCYA 1ZVYA 2X4TB 1EHXA 1LK3H 3UYPA 2APTA 5CEZE 3ARRA 3MJ9L 1M05B 1M71B 4X7SL 4JFFB 3MQIA 4IDJH 1GOHA 2BHUA 3BPOB 2OP4L 4H8WC 5JPMA 5DLML 4YR6A 4FFVD 1OAKH 1MFCL 5EZIH 3TT3L 2XICA 5AD0A 1QLRA 3UBXG 4MJ5B 4EVNA 4JO2H 1XF3A 4UI2A 4PJDB 5JW4Q 1RQ5A 2R2CA 1RVFL 1PGRB 2VUYA 4RMSA 4XP4L 1KTLA 4JDTH 5L2KB 1XGQA 4M48H 4D9QD 5MI0C 5I8OL 4UAOC 1MVFA 3V8CA 5I1DA 5JZ7D 5MERA 2XKUA 2YRLA 4IHOA 1T80A 4KTDL 1ZGLA 4OD1H 4YIQA 4HDIB 5INCA 1UH3A 3ARDA 4A2MA 4PRAB 1FFOA 4NJ9H 4HX1B 4ZAKA 3TVMC 2C26A 3BDBA 2IFFH 1A3RL 4NZJA 5FK9A 4ZFOB 5B38G 1KTKE 3KJ4B 1IZJA 5ACLA 3FRUB 3WNNA 3ZDYF 1T0NB 2ATPB 4FQQA 3KYAA 1R3KA 2NX5D 3OKNA 4HG4K 2BJMH 1SY6H 2ZP0T 4P2YA 4H0IA 1A6VL 1RHFA 1G0DA 4EI6A 5KG9B 3WMSA 5MEOB 4YWGL 3PWPE 5D8JL 5CCKH 3BXNB 4PLNC 4MD4A 5FDYA 4X4XA 1TZHB 2OTPA 2X4PB 1ZAGA 4JPKH 5IFHL 3MLRH 1B4JH 1CE6A 3WS3B 1D3CA 3L6FB 4HKBB 2F19L 3ARXA 4QO1A 5CMAB 3UAJD 1VPOL 4G3YH 2NY5H 2NY1C 2OX5A 2VMFA 1NEUA 1M7DA 5CHNA 2AGJH 2AV7B 4P5MB 5MI0B 2YKLL 1INQB 3VD5A 1N2RB 3HNVL 2DMKA 3JXAA 4Z7NF 4OB5L 4KI5F 1ORSA 2X41A 5DTFB 1T1YB 4WFHE 1V7NH 1U41A 2K9UA 2DQUH 1AI1L 1F2QA 4UBDC 5FUOL 2P46B 1T03H 2L7JA 2YPLD 3NAAL 3PQYD 3TVMB 4JN1L 3CFBA 5IM7B 3K8MA 5F6HJ 2VABB 3VD9A 2CDEA 1BX2A 1H3UA 3MUHL 3MOBH 1Q9WA 1MAKA 5GGSB 2O5XH 1VGKB 2XPGB 2OZ4L 1YNKH 4WUKH 1IAKA 2HYMA 2X9WA 1DEEA 1A7OL 1PQZA 2EDNA 4G9DB 3QAZC 4ZFGH 3I84A 4HUWB 3QG6B 3PABA 3EO9H 2VZUA 1YN6A 5K9OB 3G5ZA 1QHOA 5IK3A 5IVXE 4AENB 2H9GB 1I85C 1PKQE 4LCWB 3B8SA 4HXBL 3C5JA 3TBSA 3O0RL 4X8XA 3O3BB 1UZ6F 3MRLB 1NCDH 4KKAD 4NQVA 2X89A 1KPUB 4PRPB 1FJ1B 3V0VB 2NY1B 4LASH 3P30H 3SBWC 1BF2A 1TENA 3TO4C 1MIMH 1AFVH 2PXYC 4JRXD 1XMWA 3DLQR 1CD1A 1XGYL 2DTML 1HDMB 5TE6H 3STLB 3NN8A 1FYHB 4S0SD 1AGEB 4OIIL 5DJXA 2AXGA 1CZ8H 2AK1L 5E8EB 4PJBE 4P57A 3KPMB 1BD2E 5GSRA 2DQEH 1YEEL 3P9LB 5CSBA 3BVNA 1VADB 4QRQB 5TFSH 3LQAC 1GJIA 1NFDB 4CU6A 3QWQB 5DEZA 3O6FD 4ODTH 3QDAA 3RVUC 4GW1B 3QI9C 3QAZB 1A1MB 5DJ6B 4GSDH 2ICEB 1LEKA 1I3UA 5DJYB 4BSVB 3WNMA 4YDIH 4KI1A 4IS6A 4TUKL 2HVJB 1GGIH 5JOPE 5MEPA 2I9LA 2YD1A 2WINB 1EEQA 5K9QG 3S98A 2IMNA 3OSKA 5B3JE 5E95B 4X7FC 3WN5C 3VFNB 3DXAE 1G84A 1AGFA 1HKLH 1P7KB 4EN3D 4Z7UA 3TO4B 3MGOA 5I1GL 2H1PH 2PXYB 3QEQE 3T0DA 3MRHB 3EO1A 1PJ9A 3RL1B 5C0JB 3CVHB 4PJ9A 4Y8DC 5T5FH 1WEJL 2YWYA 3EYFB 1RUAL 3SE8L 4MB4A 3LKPB 1CU4H 2VDLH 2PNDA 2IAMC 1I9JL 2W59A 2OZ4A 3GMNA 4R96A 2JCCB 32C2B 2AV1A 5I75C 1AGCB 2VDMH 4Q9RH 1SEBB 4Z0XB 2VDKH 3WLWD 3AXLB 2CMRH 4QKXB 4Z77B 2DM4A 8FABB 3PL6D 1FFPB 3KPQB 5ECJE 1AR1D 2XFXA 4XNXH 4YNYB 5SWZD 1E4WH 2LV4A 3NIFE 4P2OA 5TE4L 2J5LC 3OJ2C 4Z7WA 3VFSB 1KULA 2MPAH 2APVA 4UTAL 4Y4KD 3GBLA 4OZHA 3QA3A 3D25A 1NEZB 1I3GL 4JFXA 2HH0H 2CKBL 1UA6L 3QI9B 3TNMA 4M7KH 4I18C 1ZLWK 5GRUH 5JHDA 3DUHA 1BZ9A 5A2IH 1H0DA 1BVKA 3VGGA 2UWEB 2W9LA 3D3VA 1LP9A 4JHAL 4L29A 5E1AA 1Q94B 2YRPA 4KTYA 4K3EL 1OGTA 4PJBF 1LEIB 1NANI 1CLZL 1SYVA 5L7XL 3WN5B 3ZHDA 1A5FH 1ZXQA 2A73B 3KPRE 1ORQB 3KYOB 3ULVL 1R5WA 1HQRA 1QLFB 1T5WA 2NW3A 4GKZA 2HKFL 3LB6D 5ICXA 4HFWB 1RURL 4RGOL 4HJ0C 3IYLW 2EDEA 5FHBH 5H35B 3SE3C 4LSTL 5EWIL 1D5ZA 5JW4M 2IAMB 1W72B 3HPJB 3B3IA 4LSQH 5T1KB 4PGDA 2CK0H 5I75B 1MRFL 4GRLC 5H2BA 5C08E 4G9FB 3T2QA 1I8MB 1T0PB 2D31B 5CIPA 4PPTA 4C56A 5HI4D 1R3LB 4JFHD 4LPTA 5F9AC 5B3JF 1NUFA 3VFOB 1JZ5A 2J5LB 2YA0A 1TZIA 4FQJL 3TYFA 4UT7L 1VEPA 3PV6A 4L4JA 4XNUL 5D7KE 4YHOH 3SDXF 1UJ3C 1EO8L 2XZCL 1Z9SA 1I1AA 4M4RA 2I27N 3F6LA 1QBML 3QUZA 1NGQL 3W0WD 3GI8L 5GZNC 3O45A 4YUEL 4ETQB 2R15A 2ENYA 3VFWA 2GK0A 5IF0B 1Q1JL 2F53D 4CN4A 5ETUB 4QXGH 1NJ9B 3CUPA 4UIMA 3STBA 3NA4A 2A9MH 4GAGH 5JR1H 2PR4L 5C0FA 4M6OL 1KCRH 3BUTA 4U1HB 1KEGH 5DYOB 4RISL 1C1EL 4QCIB 4Z76B 1UYWL 1X7QA 2C1OA 3BWAB 1RD6A 1A7RH 2IGFL 3CSBA 4EUPH 4WUUE 3EFFA 3O2VH 5B8CA 5C0CA 4FQXA 3HAEG 5E2VH 4MQSB 1N0LA 5FF6A 1N26A 1M7IB 1INDL 2FSEA 5I1EL 2R2EA 3VW3L 1VGEL 4ZUSA 3VXME 5EZOL 5IB2A 4LCCB 1B0GA 2CKBA 3WNPA 5TQ2H 3MV9D 5ITBH 2G75B 2XXMB 3CSPA 3U30C 4UDTA 5F9OH 3TZVD 1OSZB 2C4XA 3LKQA 3DRTA 3S35H 1RZ8B 2BCKA 3OB0H 5F6HI 4HKJB 3RJQB 4G6KH 3I6KA 4W68A 3BIKB 1UJ3B 4P23A 1UM6L 4LBEA 1UT9A 2QQLH 5C3LD 4X98B 2BVPA 4H26A 4XP5L 3TPUB 3DHMA 1UM5H 3QRGL 1MH5A 3MRJA 2XN9B 2JJUA 3UZQA 2VLJB 4NO5B 3MCKB 3A6OA 5D1XD 1UKTA 3QISA 4RMRA 1MQKL 1ADQH 1BOGA 1LO3H 4KRLB 4LSDA 1U42A 5BZDA 1GYAA 3UTQB 4YXHL 1WWWX 4B7LA 5D9SA 1FGVH 1JTPA 5F7YC 3P4MA 4XNZC 1S7VB 2PW1B 1WAAF 1U8MB 1HHJA 1S5IL 2ARJQ 5C2BL 1NUGA 3NZ8B 3FO2B 3CDCA 5D7LE 4LKCA 3KPLB 3ARBC 4PRDB 4UTBL 1VCAA 5CEXA 4DKFL 1ZS8B 3TT1L 5BOPA 3U36A 3V4UL 2R4SH 1MLCA 5F9WB 2CR6A 2XG4A 4R7DA 5C0BB 2EICA 4FQ2L 3U30B 3TFKA 3VRIB 3VXOA 2EH8L 3QHZL 4AM0B 5D6DC 3NCYS 1CXHA 2OL3L 1DLHA 3FRPG 1HK6A 4EI5A 4PBVC 5CGYC 2A38A 2Y6SD 3KXFA 3TN0A 3DTXA 1IKNA 3F7YA 2B2XL 3ECBB 4N1HB 4N0CC 3AB0C 3K46A 3L3IA 4WJ5A 2VLRE 1B6UA 2B5IC 3MRNA 3SJVD 2OJZL 4ZTOL 3I9GH 4R9HA 3OB0K 2XTLA 1FAIH 3BKYL 2L4OA 3QIBA 5EU4A 1FL3B 5DS8A 4TRPH 2AXJA 1IL1A 3BIBX 3PIQB 1YYLL 1BBDL 3D0LB 1XCTB 1CGTA 4XNZB 2H3NA 1BVZA 1HHKA 3QPQC 4YFEA 4H20L 2AAVA 2HRPL 2D0FA 3IXTA 4WW2F 2YEZA 3GO1H 5ADOL 5HHME 5IROA 1LILA 5DD5H 1U8PA 2PW2B 3P73A 2FR4A 1XGPB 3MV7B 3SKMA 3BJLA 1GVIA 3AU1B 3D5OF 2QADD 3D2UB 4TULH 5F7KC 5I66B 5DUBA 1XF4B 4BQBA 3DO3A 1QRNB 1J8HE 3KS0J 1Q9LB 4WHTA 2MCPL 2OXGA 3PWLB 3RU8L 4K8RL 3T0EE 1MCIA 2VKWA 3L5XH 5CP7A 3CSGA 1TXKA 1GC1H 3O81A 2AK4E 4L3AA 2NXZD 4JO1H 3LVEA 1FE8L 3TYGL 5B21A 2VN4A 4HBCL 5GGUA 3C8DA 4JRWA 1FGNH 1DUYB 5GS0L 1WITA 4RWYH 3VXQA 1MCRA 3JWOL 1MCEA 4MA1C 3AB0B 4G6JH 1XR9A 2H32B 2B5IB 3WFEL 4F33B 1ZVHA 4KHTL 4FFWD 3P77A 3IU4H 4XPGL 3HB3C 1Y6MR 4ZOCA 4QRPA 3DV6B 2W0FB 3WFZA 4I48A 4YBQC 3LQZA 1BQHG 1G9NH 3VGAB 2FIKB 4MGXA 1U3HC 3OXSB 1HOCA 5T1LA 2VDQH 4C58B 4LLYA 4V2BA 4MNQD 1G7LA 1XAUA 5E8NB 4E0RA 3IFOA 1K2DB 2XOTA 4JFQB 4XCCH 4KVNH 4LVEA 2OL3A 4FQ1L 5IR1A 4KZEH 2D0HA 3QQ3A 5I0DA 1MLBA 1ROWA 5IWLC 1JV5B 3VMNA 1CF8H 3NGBC 1MHHA 3T77B 1QBBA 3BH9B 2EDXA 4H1LG 5HHOD 3MNVA 4I5BB 2X4OB 2EDKA 1MJ7H 2ADJA 4NQTA 4B53A 4RFEA 1JZ4A 2DQGH 3LSOA 2ITDA 3IJHA 3HG1B 3MRIB 4HS8H 4CRPA 1AKJD 2F15A 3W11D 1MJ8L 3DBXB 3JTCA 1EIBA 4F80A 5FO8B 4JZOA 2V7NA 4MA1B 2CJUH 2P8MB 3RUGB 4CVZA 2DBLL 2ADFL 4NHUA 4OLWL 2R1WA 5J57B 4JPIA 5JXEC 5I1LB 2YUXA 4HFUH 5DHYA 2BVEA 5TF0A 3OZ9H 1A7NH 3MLXL 2ZG2A 4WCYL 7FABL 1YEFL 1WZ1H 3VGDA 2E27L 1MCKA 3UPCA 2YN5A 2C1PB 2J88L 1J0HA 1RUKH 4Z5RB 3IDJB 3REWA 3K0WA 1U3HB 3VFTA 4YAQB 1NANH 2ZCHL 1KIQB 5D7LD 4Q0XL 3RIFF 1CXKA 1LDPL 4KMTL 4S1QH 3THML 4XPHH 4OCRL 4ENEC 4PJIA 1R5VA 3DPBA 2JJTA 1B6DA 3FFCB 3O9WD 2H2SC 3HMXL 1AHWC 1TNNA 3NGBB 5DVOA 3RWCA 3NFNB 5DK2A 4WWKD 4MB3A 1OARL 3BKML 5F1IB 3QDJA 4WEMB 1FL6A 4OLXH 1G7IB 5D7JD 5E0QA 3CDFA 4P9HL 5F7DB 4V3DB 5CJBA 4Y5XA 5D2NC 3PDOA 3HNTH 1CDHA 1BFSA 5C09D 2GSGB 1FIEA 4LCYA 5DD1L 3E2HA 2ATKB 2VLRD 3DETC 1U8JB 4K7FB 2XRAL 3P0YH 1YDPB 3M17A 1X5GA 2ZPKH 3DNKA 3CH8A 3EYOB 2Q8AL 5IBTH 1NDGB 3LKNB 5AWNL 5KSVA 4QGTA 1CFBA 3SY0B 1EXUB 3VFMA 3IFPA 1KIPB 4LLAA 1IGIL 4M62H 2BVQA 3VA6A 5EBGA 5BVJA 4XAKD 2IMMA 1DL7L 3VWJA 1VFBB 4XTRC 4OFYD 3B6SA 1TTGA 5L8KB 4OCNC 3K4AA 2XZZA 4FNLH 4HLZH 1J8HD 4PJ5A 4M03A 2IAND 2J6EL 2RB8A 1V7ML 1AHWB 1J88A 4F7PA 1QTYT 1A0QH 1YNTB 1DSFL 4WU5B 4XPAL 5TDPA 3P11L 4XGZB 1XIWA 4WFEE 4MMZC 1D7FA 1A1OA 4UV7L 3RWIB 5FB8A 4I2XA 1E6OL 1QFOA 5D2NB 4PTUB 4RA0C 2FJFA 5I1JH 1JGEB 2R0LL 3G5VA 1FO0L 4KJPD 1J12A 3HC3L 1XZ0B 4D0CB 2F8XC 5HGAA 1S7SB 4ODVL 4QWWD 4QXTB 5D1QC 1MPAL 1T21B 3RIFK 3U83A 1J0ZA 5MEQA 3X14B 3EYQC 3E6FA 4ODXB 1WLHA 2I5YH 2ITCA 4OLVL 4MB5A 4XB7A 4CJ0A 2A6KB 4WEBL 4L4VD 1OF2A 4F7MA 3HZVA 3MYJA 4XHQA 4XBEH 5EO9A 1LNUB 3HMXA 4KKCC 4OFIA 4PIRF 4X9GA 3KYKH 4O2FA 4G7YL 4NQSB 3EGSB 2EZ0C 4YGVB 5T3ZD 3WL9A 3O4LD 3B43A 4Z7UE 4AIXA 4UOW1 5KVGH 5DJ2A 4RBPH 3LN4B 5I19L 4KDVA 4X80H 4LRIA 3PP4H 4IRJA 1LQVA 3IS0X 5ENWA 3ARDD 4P2RA 3MLTA 3O2WL 2YXMA 1JFMA 3N1GC 3OGOE 2BNUB 4GS7C 2FATH 2O5YL 1UZ8A 3FB6A 1DFBH 5T5NG 2HT3C 2WLZA 2XZQH 3BKCL 3T0AA 4R4ND 4BFEA 1GCFA 4NNYA 5ILTL 5BRZB 2Z31A 5DR5L 2RHEA 3MJ9H 3IDMA 1WBYB 4N8CL 4X7SH 4G42A 4D0BA 2OP4H 5DLMH 1H15B 3GI9H 4Z7WE 5E8DL 4RAHA 2EIEA 1MFCH 4PJCA 2EXYC 3TT3H 4S2SB 4WFFE 1Z9MA 4OZHE 5D1QB 4IRZL 4YC2C 1RVFH 3MUJA 5EUOB 2BNRA 4XP4H 5JHDE 4EKXA 1TMCB 3KPNB 2BFVL 5I8OH 5IBLC 3D3VE 3D39B 1LP9E 1FNEA 4ODUB 5DD6B 1JNHA 2J6EA 3EO0B 1EUUA 1VA9A 1G6VK 2P1YA 4KTDH 4MVBD 5HVWA 5IHZB 3NACH 5FOBB 3MRKA 1HH6A 1GOFA 1A3RH 4KH2A 2G9HA 2LU4A 1MEXL 2EIZB 2DM3A 4ZO6A 1GZPA 5FOJA 3MOQA 5HHNA 4P49A 5BV7C 4P4RA 3TIEB 5DO2D 1FO0A 3VGFA 1BWWA 4LMQI 4ODSL 2ADGA 4DQOL 5IB5A 4GS7B 2VXSL 5IOPA 3MO1A 3F12B 4ZUUA 4RBPK 3HCVA 5KN5B 1A6VH 1A6AB 1G6RB 2XNAA 5KANI 4YWGH 5D8JH 4RMTA 4OZIB 2O61B 4C56E 1MFBL 4UQ2B 2WQ8A 3GJFH 4C83A 5I17A 1K4DB 5IFHH 3MRPA 3QJHB 1ES0B 2ORBL 4Z7UF 3SPVB 1AQDB 2XT1B 2AJ3B 4L4TB 5EZLB 4UOJA 2F19H 5BS0B 3FTGA 1S9WB 1VPOH 1T3FB 5A16A 4YC2B 5KVEL 5BVPL 3SKJH 4LSRH 4MNHB 5DMIL 2WIIA 5K9KA 2ED8A 5E2WL 3VXNB 2YKLH 3HNVH 3CZJA 4U6VL 4P46C 1L4IA 4OB5H 4PJ7B 3BISA 5LGKA 2IQAA 1S8DB 3TV3L 3MOAL 4FMFA 3SKNA 1J1XL 4TSAL 4NUJA 1AI1H 1T7YA 5FUOH 3NA9L 4JM4L 4P3CL 1CQYA 3NAAH 1HHIA 1CS6A 4JN1H 4CMMB 3PF2A 1ZWIB 5EIIB 4PP2B 2Z91A 5D2LB 4Z7WF 5EBMB 1EMTL 4FFVC 4LVHC 4Z18A 3RVVD 5BV7B 3NCCB 5IMOA 5K33A 2B20A 4OZHF 5JIIA 2VWEE 3U79A 4WFED 5C0CE 12E8L 3P4NB 3WIFA 5HGHB 4G8GD 4F57L 2OZ4H 5EBLB 2X4NB 4XMPL 4OCMC 5E8PB 1A7OH 5GGQL 5DMKB 1LP9F 2NCMA 3V0WH 1EHNA 2DICA 5JZ7C 4DGIL 1AD9B 2PTVA 2GT9A 1MCNA 4KK6D 4DWHA 2V7HB 4MWFB 2CPCA 3IJYA 4UNTA 5L88L 3DROB 3F7VB 4CW1A 1YMMB 4LPUA 1X5FA 3LRGA 4K3GA 4HXBH 1FG2A 2VLMD 5BQ7A 5IGXL 1N6VA 3TCXA 2PYEB 5AZ2L 4NBXB 4I3SL 4CADA 5DXWA 1CLCA 1OWWA 1OLLA 2OS7A 1NSNL 2UUDH 4B5EA 1F45A 2JJSA 4J1UA 1TJIL 4HIXL 3IF1B 4GW4A 4DVBA 2B7DT 4R4BA 1T2QL 5KVFL 3HMWL 4XCEB 1XGYH 1BAFL 2DTMH 4K94L 1KJ2B 4P46B 4R7NA 2Z9TA 3PGCA 2H8PB 5KZCB 3QEUA 3R8BB 3MCLL 3QH3A 1T20A 4OIIH 5ISZA 4QRRA 3BP7B 3BQUA 2AK1H 2A6JA 4MDIB 1F02I 2VXVL 3HE7A 1YEKL 4FQHB 3HUJF 4F9PC 1YEEH 3QFJA 4LVHB 1D5MB 3QCUL 3UAJC 3CH1A 5FV2A 2DLEA 3FOMB 1Z5LB 3HI6L 4XZUA 1A6TA 1J86A 3KPOB 1XF1A 4DJMA 4FXLA 1A2YA 1T0MB 5F97E 5CIPH 5EU6D 4U1LA 4Y4FD 4NC2B 5GGTL 2MFNA 1MAML 4YXKL 5T3XL 1A22B 2VLKA 1OAUL 5FCSH 4TUKH 3WUWA 2XKNB 3TPKA 3KXFE 5F6IC 4NYLA 2SEBA 1Z6JT 4L3ED 2AEQL 3MTRA 3ESUF 3D3VD 2VISA 2XQYK 4EIGB 2EKJA 4Q6YA 1QFWM 2P5EA 1LHZA 5I1GH 3OPZL 2EC8A 4OF7A 1CFVL 1VACB 4OCSL 3LRSB 1NCCL 1QSED 3P4LA 3M45A 5HYJA 3T2PA 1WEJH 2NX5B 3SE8H 1RUAH 3UTPD 3CJJA 3V6ZB 1LD9B 4U4BA 5BXFB 4HUVB 1I9JH 4V3EB 3MRRB 4MX7A 3VFUA 2UUDK 1WIOA 4NM8L 4Q6IA 5IBUG 2A6IA 3SGEI 4H5SA 1HXMA 2FECL 5IMKA 4E41D 2W38A 4P5TA 4RDQG 2Q87A 4X5WA 1MCQA 3RRQA 3U7WL 1V05A 2NY5C 5TE4H 3V5DA 3KAAA 4KKAC 2V2TA 3GMOB 3X11B 3S6CA 2VQ1A 2NY6D 3GHBL 4UTAH 5L2JB 4LCIL 4WWID 3VFPA 1I3GH 1A8JH 1IM9A 3LEVL 2CKBH 1UA6H 5EO0A 2AS5M 1EFXA 5F9DC 3QDGA 4KKBD 5J4MA 4JHAH 4NZDA 1ONQA 1QFHA 3V9FA 4BFBD 1HQ4A 1RSFA 4K3EH 4M02A 1QYGL 3L3GA 2R69L 4ZNEA 1CLZH 5F6IB 3MRFA 2YPLB 3PQYB 3WKML 5L7XH 1U92A 4BSJA 3T04D 2CSPA 3ULVH 4DEPC 3CXDL 4F37F 3TNNB 2P5WA 4JY6B 2UZXB 3RDTA 3S5LA 4HMCA 5A3ID 2HKFH 1E27B 2BY3A 3MGTA 1J05A 2KQNA 2XKSA 1BJ1J 1T2JA 1RURH 3AS1A 1HYRC 4RGOH 1D5XA 3QO0B 1JK8B 3QZWB 2Z35B 4QRPE 2QLVB 3FB5B 4NSKB 1GRWA 4LSTH 5EWIH 1T22B 4FN0A 2YPVL 1XEDA 4MD5B 4ONGL 1MRFH 5EBWA 3OX8A 3UDWC 4G8EB 1E6JH 4PGZA 1ZKAA 3OAZH 4H0GA 4PP1C 4IRSA 3BDXA 1DQML 4G6FD 3H9HB 4Q9BA 3V6FA 5MP6L 4FQJH 4X6DA 4DAGL 4UT7H 4PR5B 1U95B 4XNUH 5DJCB 5FGRA 4EN3C 1EO8H 4KMQA 5C70A 2XZCH 5CD5D 1UWGL 5EULV 3K7UA 1QBMH 1BM3L 1NGQH 2H45A 3FQNB 5I30L 3GI8H 3RX7A 2GFBA 2EECA 4YUEH 1KUMA 3V4VL 3P0VL 3KS0H 4GBXA 3ARQA 1WSST 3GKZA 3ULVD 3IFLL 3Q5OA 5EC2B 4U6XA 4P48A 3PL6C 2PR4H 3WHXB 4M6OH 1XF5A 2Z93B 4RFNC 1S7XB 1AR1C 3LV3B 1C1EH 4M1GL 3RFZC 3K2UL 4NHUE 5EU7E 1UYWH 2OSLB 3ZE0E 2IGFH 3CLEL 1L8JA 4YPGA 4Y4KC 4ZUVA 1S9VA 3MRQA 4XRCB 5DEGB 2Q7NA 4NBZB 1INDH 5I1EH 3VW3H 1VGEH 4MXWL 4NQUA 1QKZH 3MUGB 4X99A 5EZOH 1GGBL 5DK0B 1Q9OA 4X6BB 5HGBA 1OL0A 3O3EB 1KCSH 3MLYL 4HMEA 4X6FB 1JPTL 4GXVL 3LKRB 5J89A 5TF1L 4PJIE 4HK3N 4O5LL 4NQEE 3T3ME 5EOCL 4ZDHA 4DTGL 3TFKD 4XP5H 1H8NA 1EVTC 4F37K 5FA4B 3EOBA 3EOAB 3QRGH 3LB6C 4XPBL 3OAZK 1TLKA 3QDJE 4LPVA 2NY7L 3UTTA 1KN2L 4EI5D 1KCUL 2XXCB 4M3JA 2OK0L 4NKMA 4TUJA 1MQKH 4LNRB 1EX0A 3C5ZA 1X5JA 3L3JB 1IC4L 1B90A 4D0DB 4YXHH 3OKDA 3WD5L 2DI7A 1F00I 1BQLL 3PL6B 4NOFA 5B3NA 5EA0L 4RFNB 2FX7L 3S88H 5HI4C 4AG4H 1HHHA 1S5IH 1OAZL 1A7BA 1FVCA 1UQSB 5C2BH 4OI9A 4DZBA 2QJDA 5DSCB 4O2CA 4NKOB 4Y4KB 4K3DL 3PWPB 4UTBH 4LQFL 4DKFH 2APFA 2P24B 3TT1H 3LY6A 1EAPB 1TVHA 4U1GC 2WBJC 3V4UH 1TVDA 5F44A 4IMKA 3PNWB 4Y5VC 4FQ2H 4CN1A 4M5YH 2X4UB 2EH8H 3QHZH 4OGZA 3CK0L 5IHBA 3TA3A 5KVMC 5KSUA 2JB6A 3J7HA 2N7AA 4D8PB 2OL3H 2AXFB 4WHYH 3IRPX 4PJ5E 4I9WD 4XXCC 1HXYA 2DKSA 1WWAX 4GLRI 2ICWA 2QTEA 1ED3B 2W0KA 2J8UB 2B2XH 4KV5E 4XC1L 3ZKXC 2GAZB 2CLZA 4GJTB 4N90D 1C12B 4OSUL 2V5MA 4JZJC 1UADC 2XA3A 2OJZH 4JG0L 4RIRB 3BYYA 4ZTOH 1Q9KB 3QJFB 1I1YA 1IC1A 4I2XE 2IQ9L 3BKYH 5EDXA 1G7PB 2BSSB 5DJAA 4LF3B 3W9DA 4XNYH 2FZ3A 2VLLA 1E4KC 2JB5L 3SDCD 1YEGL 3HLAB 1YN7B 3OG6B 3B8YA 3TZVC 1YYLH 1BBDH 3IJSB 5I8EB 1F97A 4PJIF 4H20H 3NZHL 3UPRA 2W9DL 1U36A 3QHFL 5ADOH 3KHQA 1QNZL 2PETA 4U1IB 4LHUD 4XH2A 1OSPL 3IAGC 2NQCA 1BGXL 4U1GB 2WBJB 5IVXB 2MCPH 3HE6D 3PXHA 3DARA 1A6WL 4Y5VB 5D1XC 3RU8H 3GSXA 2W1NA 4K8RH 3U4EA 2ICWJ 1EEZB 3OXRA 1DE4B 4U1NA 2D7OA 4LLWA 1FE8H 1U2CA 4RZCB 3TYGH 4HBCH 1K85A 1KBGH 3BZ4A 4RGND 1KCLA 1OTTD 4P2RE 5GS0H 3KLHD 3OKOB 2OTWA 3TJEL 3JWOH 1NGXB 1ZHBA 3WSQL 3ZKXB 3FOLA 3JBG7 3WFEH 5FO9B 3ALXA 1H9VA 2KQMA 4JZJB 2VR9A 4KHTH 4HGKC 4JKKA 4CVXA 1KLUA 3VXRD 3ZE1E 1BD2B 2H26B 1A6UL 3LDBC 4NWTL 3JWDL 3MV9B 3S3JA 2HMID 1WCQA 4PJCE 4GG8A 3TZVB 1S5HB 1C16A 4PRIA 3C60D 5F7UA 3MFGB 5EOCJ 4DVRL 2ARJA 2BNRE 4FXKA 4FQ1H 4NKIL 1G7HB 1FNGB 4KV5F 3RWHB 2FIRT 4U33A 2WWMD 4M7ZC 4K8RD 3FT3A 3CDGA 4JQXA 1UB5A 5D1XB 3IDIA 2PTUA 4NC1C 3VXUD 3DXAB 2OQJB 3SCMA 1R3JA 3SGEH 5H8DA 3ZHLA 3CDYA 1DANT 1A1NB 2V2XB 3QIUD 4C55A 4JRYA 4PJEA 2GITB 4RRPG 5KSBB 4FFEX 1NL0L 1AXTL 2WLYA 1MJ8H 3DGGB 2IFGA 4EUPB 4JN2B 2DBLH 4HV8A 2ADFH 4OLWH 2FB4L 1VHPA 1MJJA 3VFRB 1NCAL 4XCFL 2QADC 3MLXH 4W4OC 5IKCA 1FV1B 2AEPL 4WCYH 43C9B 7FABH 4PGBA 1YEFH 4LRNL 2E27H 2F5BL 2A6DA 3LDBB 2FLRT 4HBQA 2ERJC 3EYSL 1DUZB 5IJVB 4H25A 3C8KA 3EJYD 1YUHA 3BSZL 5DMGD 3EW3B 4YJZL 2ZCHH 4Q0XH 4P3DA 1LDPH 1XCQA 1HNFA 4KMTH 4XXDA 2LAAA 3THMH 3PDGA 4OCRH 1E4XL 1QPPA 1EJOL 4HUXB 2B39A 5I18L 3RTQD 3DX7A 5JIPA 2YD4A 3VWJD 2UYLA 3F65A 1IGYA 3HMXH 5B38A 4XP9L 2X5PA 5JTWA 2L0DA 4YH6A 2IALB 1OARH 2CDFA 1WC7A 4FFWC 3SJVB 3BKMH 1R5IB 5LGHL 4UT9L 1X44A 4N9GA 2ESVD 1JGDB 2VDNL 3ZE1F 2B1HL 3MA7A 3GJEA 4KRMB 4P9HH 3DO7B 2HN7B 4UUJA 1NCTA 1BQUA 1VEMA 2G5BA 4O4YL 4NO0B 5DD1H 1OGAD 2GUOA 2NTFB 2XRAH 3QO1B 2X44D 3ZYIA 4MXVF 3STZA 3ISWA 3O8XD 1QG3A 5F1NB 3KPPB 2Q8AH 1T5XB 5CP3A 5AWNH 2QADB 5GJTL 4A6YA 1ZT4A 5CWSA 1DDHA 3OKMA 5BZWB 1IGIH 3B4NA 2I9TA 1GC1C 3QSKB 2ERJB 1DL7H 5I74C 4FFYL 3INUL 3FQXB 4Y4HD 4JGJA 5HYEA 2E9BA 5GZOD 1YECL 4MA3A 2EDBA 4QHMB 1YMHA 4J4PA 3NFSL 3T4AB 3W11C 1BMGA 1C5CL 4WI8A 1X5KA 1F3DJ 1V7MH 1TETL 2LFGA 2LE9A 3CXHK 1WVZA 1GXEA 2FJHB 3ARYA 1DSFH 3ARPA 2X1PA 4XPAH 2VO5A 4QRRE 3P11H 2DQDL 1F4WL 1HSBB 5BW7A 5ISZE 1CR9H 4PREB 4Q2ZA 4EDXB 1Y18A 1NC2A 4UV7H 5DFTA 1C7TA 3HI1A 2BSTB 3BPCB 1E6OH 3QCVL 1G9NC 3QXWA 4Y0GA 2R56L 5GIRA 4NOBA 4R97C 5EU5A 2C9AA 4POYA 1JN6B 4GAFB 4GFTB 2R0LH 1PYWA 3QFJE 1FO0H 3U9PL 5BOZG 3OF6A 1CFNB 2HKHL 2YD2A 1IEHA 3VWKC 1FN4A 3DX6B 2X2YA 2YD5A 3HC3H 3TESA 4WUUB 5ID0A 4MNQB 4ODVH 3TBVB 4F9LA 1CT8A 4JLRB 3ZYJA 3FCTA 2D9QB 4JQVA 1MPAH 3BW9A 3C6LD 1Q0YL 4OLYL 5F1OB 1JZ6A 4OLVH 3DVGA 3JVGA 1QFWL 3O9WC 3BGAA 4OCWL 4NC0B 3U4AA 4WWKC 2VLKE 4NNPL 3VXSA 5HHOB 4Y89A 5DRWB 4RWHA 4NPYA 5EN2A 1MCWM 5I74B 3WS6A 4G7YH 1HIML 4N0UE 1H5BA 4PFEA 5JW5A 4KY1L 3ARFC 5JUEL 5IEHA 3NCYP 1UXSB 2BOBB 4NRXB 2P5EE 3HZYB 4DN3L 5I19H 1AKJB 3RL2A 5FYLL 5HYJE 5JDJA 1FNHA 4YQXL 3O2WH 4HK0B 2RCSL 2F54A 1HE7A 1VKXB 2O5YH 2VTFA 3BKCH 3QNYA 2P4AB 2YD6A 1JWUA 2E5EA 5ILTH 5DR5H 4L8CB 5HD8D 3FMGL 2YBRA 4GG6B 5DJDA 3N50A 3OR7B 4N8CH 5C0IB 4JFYB 2ICWI 1T1ZA 3IB4A 3CFEA 3H42L 3RKDD 2WP3T 1FG9C 3VWKB 2BDNL 1X5AA 3S4SB 1EHAA 5E8DH 5IV2B 1I7ZA 3G6JF 1BIIB 4IOIB 1OWRM 5D7LB 1KCGC 3G5XB 4AIZB 1WWCA 4R3SA 4YHPA 5A43C 4IRZH 3GGWB 4F58L 2GJ6D 5L0QC 4YXLL 1QP1A 4GLRH 1NFKA 2BFVH 3QDGE 4G8IB 4HGWA 2WWKO 3O9WB 4C57C 3OAUL 3T0EC 4ELMA 1IQWL 4WWKB 1A4JA 1MHCA 1C5DA 3ULUL 2VZSA 4NDMA 1WT5C 5IQ7L 4R8WL 2CKNA 3BPNC 4HZLB 4ZNEE 1D9KA 5E2TL 5F8QC 3MLZL 1FL5A 3KG5A 5HYQB 1FZOB 4BQCA 5GJSL 4PRHD 3UZEA 3ARFB 3C6SA 1CE1L 4PG9B 5C09B 2P5WE 3SQBA 3GSNL 1MEXH 2AJUL 3VFGL 2VLRB 1OB1B 2WBWB 3NTCL 1KB9J 4U1SB 4BFGA 2GK2A 4G7VL 4QWWC 2W60A 4ZSOB 1KCVL 4ODSH 5DC0A 4DQOH 3LN9A 4RFOL 1IEBA 1JHTA 2VXSH 3JV4A 4OLEA 3QPXL 1GHFL 1SJHB 4GKNA 5C07D 1BECA 1BBJB 5KAQF 1RK1B 3RPIA 2DOCA 3AMKA 4I8DA 1P7QA 4DUWA 3SQOL 1FC1A 4U6YB 1TCMA 1I7TB 3T0XA 1NMAL 2AQ1A 1CD8A 2XWTA 5IVZB 1FNFA 5GRYA 1IQDB 4X6DE 2ORBH 1ZTXL 5DFVD 3UC0L 4HHAA 3LKSB 2DAVA 3CZFA 2V17L 5L0QB 4CN6A 5KVEH 1J8HB 2Q20A 5BVPH 4N0RA 1QFPA 5DMIH 2IANB 3JV5A 3ULSA 1XGUB 3SE4A 3LEYL 3ARDC 5E2WH 1NGWA 1DCLA 1HI6B 4JFDA 1FZMA 3T0EB 3AC0A 2D4DA 3GBNL 4U6VH 1ZK9A 4FQLL 3TV3H 3MOAH 4B7IA 4R4NC 3KWWA 3BPNB 1J1XH 4TSAH 1QD0A 4YO0A 4FQCL 5JW4R 3LQMA 1CXEA 2FBJL 4JM4H 3FQUB 4P3CH 2AW2A 4KUZL 1MAJA 3LEXB 1CDGA 3D69A 4R0LC 1DTUA 5JDSA 3JUZA 1EMTH 3MV01 3SGDI 1KV3A 4Y16A 4JANA 3WIHA 4WDIA 2NNAA 2Z8VC 2GY5A 25C8L 12E8H 3GMLB 4F57H 4PGCA 4XMPH 4HS6A 5JPMB 4MSWA 1RHHA 3UROR 5GGQH 3CFJB 5K59E 1BJ1H 3MV8E 4FQIL 1RZ7L 3QFJD 4L4VB 4MAUL 4XBGA 4GKSA 2E3VA 1CICA 1CIDA 2HLAA 4EVNB 3HTLX 1XF3B 4P4KA 4MVBC 3D18A 5HGDA 5L88H 6CGTA 1MRDL 1NQBA 1KTLB 1XGQB 5IGXH 1SJEB 6FABL 4X5XA 5AZ2H 5JPNA 3UBXI 4I3SH 5I1DB 3QWOB 5FYJE 1B4RA 1NSNH 1ZGLB 1WBZA 1TJIH 3MPCA 3GSNA 5DO2C 5INCB 4K3JL 3UTTE 3ARDB 2HFGL 4HIXH 4L5FL 5KVFH 1T2QH 3HMWH 1BAFH 4ZAKB 4K94H 5DRNA 1PEWA 2BZDA 5JOFA 1GH7A 1T04A 1IAMA 4I4WA 5FGBC 2Q3AA 1QVOA 2X4SA 3TBWA 3BD5A 2VXVH 3HAEA 1CFTA 4N8VB 2DYPA 4CU8A 1YEKH 4ELKB 5FUZH 4R0LB 2HRLA 4GMSL 4X6DF 4YHYB 1IGJB 3FFDA 4BQ9A 4J8RB 4PRBA 3BUYA 2HJFA 3QCUH 1U8IA 3MXWL 1IM3A 3QQ9C 3HI6H 3C09C 4G59A 1CE6B 5CSGA 2WUCL 4YLQT 3SO3C 1OW0A 5GGTH 5T3XH 1MAMH 3FONB 3LHPL 1QSVA 3MNWB 4N5EA 1M7DB 5CHNB 2QKIB 4F7CA 3SGJA 3U46B 1T1WB 1EFXD 1MJUL 2AEQH 5IUSA 2VL5B 2R0KL 3RVVC 4WY7L 3JTTA 3OPZH 4PJHA 1CFVH 4OCSH 1NCCH 4LCWD 2VNCA 1WJ3A 1N59A 1DN2A 3CFBB 3IT8D 3MNZA 2NY1D 5K59F 4AT6A 5EZJA 3MRMB 3L5JA 1IAOB 4OZFA 4TSBL 3CLFL 5FGCB 1UEMA 4NM8H 1KYOJ 4JM2F 3TM6A 3MRGA 1II4E 1RJYB 5SX4I 1GZQA 1X9QA 4KK6C 2R23A 1MWAL 1P1ZA 1RUPL 1IAKB 3BE1L 4PJXA 1P9MA 3U7WH 3V7AE 3PABB 3B9AA 3GHBH 3BP5A 3ZDZE 1YN6B 4OD2A 5IB3A 4LCIH 3G5ZB 1ZVSA 3C09B 3W39A 3LEVH 3U9UB 1D6EA 4G80A 5T3XD 1MIEL 3WDIA 1S9YA 3TBSB 3SO3B 3FO0L 1ZMYA 2JTDA 4NKDA 1K3IA 2MHAB 3JTSA 4X7TA 4X5LA 2ICCA 5KS9B 1QYGH 5FKPA 2R69H 3H9SD 4PJ9C 4WW1A 3WKMH 1E4XI 1MSPA 4J3UA 3CXDH 2YRZA 3NN8B 5SWSE 2A0LD 3NBNA 4WI5A 2AXGB 5DEFA 2RBLA 1ZOXA 4G8GB 1RAMA 4PJAA 5LAXA 5D7IB 4OCLC 4ODWB 5GSRB 2YPVH 3BVNB 4IBLT 4ONGH 5GS1A 1YYML 3GJFB 4Y4FC 1YEHL 4PRIE 1U8NA 1QO3A 1B3JA 2XI9A 3LRHA 2Z92A 4QNPE 1AY1L 3EHBD 1JYWA 5MP6H 1P53A 2G60L 5D5MA 3ZKSD 1UWGH 4DCQB 4IS6B 2QR0A 4N5UA 3V0AC 1BIHA 1IEAA 4YFLI 5MEPB 1BM3H 5I30H 2I9LB 2ZG3A 2YHGA 5HVHC 2EDRA 5DJ8A 1LMKA 3PWVA 1AGFB 3BH8A 5IB4B 2IH1A 3V4VH 2EYSB 3CMOH 3P0VH 5DJZA 3MGOB 3QI9D 5K9QI 4JRYE 4PJEE 5HI5D 2BMKB 4WNQA 3IFLH 4PJ9B 3SEPA 4GW5A 3DRQA 4NN6C 2LU3A 4M1GH 1F11A 1MHEB 1BQHA 1TQCC 1MCJA 2BVUA 3K2UH 1IAIM 1NUNB 1MWAA 4R96B 3F5WB 3ZDZF 1NAML 2NY6C 2R29H 5L6YL 1DBKL 3BRFA 5CUSL 4UNVA 2XFXB 1LE9A 2VE6A 3MC0A 4MXWH 1T89A 4KKBC 4Y4FB 1M05A 1GGBH 1M71A 4NUGL 4Z7WB 4JFFA 5C0AD 4HKXB 5HHPB 4H1LA 4OZHB 1WISA 1KELL 2WM0A 3QIWA 3QA3B 1JPTH 3D25B 4GXVH 5LGJB 3QUZC 5TF1H 3TNMB 5CEZL 1T1XB 5JHDB 1BZ9B 1E28A 5T1KD 1WF5A 3R06B 5DZNA 1H0DB 4L3EB 1BVKB 3D3VB 2YZ8A 4G9FD 4L29B 4O5LH 4O58L 4GRMB 5E1AB 5EOCH 4DTGH 3QYCA 1MCOL 1RZKL 4JE4B 2QSTA 1YZZA 5C0ND 1QFWI 5A3IC 5L2KA 1QSEB 1OGTB 4XPBH 1AD0B 1FCGA 2NY7H 4JJHA 1T7ZA 5HVHB 1NDMA 1KCUH 2CK2A 3E8UL 2OK0H 1ZHLB 3KPSA 3WXVL 1R5WB 1HQRB 1HINL 2NW3B 3L3OA 4HDIA 1IC4H 4FXGA 5ICXB 3WD5H 4PRAA 1R24A 1BQLH 4NN6B 5EA0H 5B8CC 4QRTA 1EH9A 2FX7H 4QNPF 3BGMB 1D5ZB 1TQCB 4P59L 4HWBL 2YUWA 2ATPA 1OAZH 3L1OL 4PGDB 4MZ3A 2NY6B 1IT9L 5CKAA 5CD5C 5CBAB 4K3DH 4W81A 4LQFH 5CIPB 3SOBL 4OFVA 4U1MA 4CAGA 5MEOA 1TZIB 3TYFB 3BXNA 1TZHA 1NLDH 2X4PA 2GIYA 3CK0H 4PJEF 4HUMB 3QUZB 3ULVC 1X5LA 1CGUA 3L6FA 4MJ6A 4HKBA 2X7LA 5CMAA 3BAEL 3MBXL 1ZLUH 1A7PH 4EIZC 3BI9X 1M1SA 5ADPL 5DHVH 3SGDH 4XC1H 4PDCE 4OSUH 2P8PA 1INQA 1RZIA 1C08B 4JG0H 3DSFL 4NKQB 1IMHC 5TGBA 3E3QC 2IQ9H 4OCXL 3LD8C 1NAMA 4NQCD 5DTFA 4KUCD 1V5JA 3EOTL 3TBTB 2C1OB 5GZND 2JB5H 2VLJD 3HNSL 2EDFA 1YEGH 3TVMA 1X5YA 4X83A 5ID1A 4HPYL 4DGVL 3EFFB 5B8CB 2VQTA 1YEDA 2VL4A 3DI2B 3NZHH 5FF6B 4XMKL 2W9DH 4NO3A 2FSEB 3QHFH 3OWEA 4G6FB 3QDMA 4ZUSB 2MWCA 3NCEB 5IB2B 1QNZH 1B0GB 2CKBB 1MCPL 1KPRA 5ESQA 2LU7A 3TFKC 3IKKA 2BHZA 4HGMA 1OSPH 3VXSE 2HA1A 1OP3H 4TTGA 3DRTB 4G9DA 1BGXH 2QQNL 4JO3L 4LLUA 3TH2T 1MNUL 4EI5C 1A6WH 3I6KB 4FFZL 5K9OA 1VSCA 4LBEB 1CBVL 4H26B 3L95B 3MRJB 4JPVH 5FEBA 1JGVL 1AXIB 3O3BA 3BD3A 1PG7L 2QHLA 1MF2L 4XX1G 1KPUA 4PRPA 1FJ1A 3V0VA 2F54E 1UACL 1BOGB 5IHUL 3WSQH 3GSQB 3Q6GH 4HSQA 2GSIA 5D9SB 1JHLL 1HDMA 4YEFA 1F3DH 2EEDA 1Z9LA 5TQ0L 5C0RL 3LD8B 3P4MB 4HEME 5DVLA 1AGEA 1A7QL 4CVUA 2YSSA 1A6UH 3CVIL 1MUJA 1HHJB 4NWTH 4DUXA 1CFSA 1W2KT 3JWDH 3SDDA 4LKCB 1KB5L 3KPMA 5CEXB 2BNQD 4DFHA 4DVRH 3OG4B 4PRNB 5CP3H 1VADA 3U36B 2W0LA 1XH3B 4QRQA 2CO6B 2AP2A 5AYQA 3RWGA 4R7DB 1H3WM 3BYTA 2NY4D 4NKIH 2WNGA 2HFTA 2WP3O 3VXOB 4GW1A 4NP4L 1N64L 3CU1A 5KTEL 1A1MA 3BP4A 3QFDA 1AGDB 1DLHB 5IT2L 4EI5B 2OI9A 3MUY1 2ICEA 3KXFB 5DJYA 4BSVA 3DTXB 4MQ7B 1UG9A 3BEVA 4NWUL 15C8L 3QQ4B 2XTJE 1OP3K 1T4KA 2WINA 3AFLA 5SX4H 3SDCC 3Q5YA 3VFNA 1L0QA 1NL0H 4CKVX 1AXTH 4J3SA 3X13A 3TO4A 4JB9L 2DKUA 4LPCA 4QXUL 1KXVC 1KN4L 3RL1A 1U8HB 2FB4H 5EU4B 5DS8B 1IL1B 1D6VL 1NCAH 4XCFH 2X1QA 2AEPH 2H3NB 1HHKB 4LRNH 4N0CD 2F5BH 3HE6C 2HT4C 1U8PB 4F8QA 1AGCA 3P73B <