4PP8C

Crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
168
structure length
146
Chain Sequence
HSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINATEVKKCLTQPLKNLCQKLRNKVSNTYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NKG2-D type II integral membrane protein
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 146
sequence length 168
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pp8C00
5HGDA 3RL1A 4JFFA 1INQA 3P4OA 5E00A 1T1ZA 2UWEA 3L3KA 4F7CA 1A6ZA 1I7RA 1HHKA 2CLZA 3E6HA 5H94A 3RWCA 1AKJA 5D7LA 4LCCC 5EFIA 3D18A 1C16A 3MV9A 1EXUA 5D5MA 1A1MA 1T22A 3OXSA 5C0CA 1S9WA 2FYYA 4NHUE 3MRQA 1HOCA 4MNGA 1MWAH 1HSAA 3MA7A 3GMOA 3FOLA 3I6LD 2X4PA 4HV8A 5D2LA 3RZCA 1FG2A 4U1NA 5ENWA 4NO5A 2VAAA 4X6DA 1AGCA 3C9NA 1LEKA 2BSSA 1AGEA 2CLRA 3CC5A 3HUJA 1E27A 2CLVA 5EU4A 1S7VA 4WDIA 3VJ6A 4I48A 5EUOA 3RWEA 2A83A 2F74A 4UQ3A 4EUPA 3TZVC 5C0JA 3AU1A 2GTZA 4EN3C 1KPVA 4PJHA 3KPMA 1JGDA 3LN5A 1RJYA 4PRNA 1T1YA 4F7EA 1YPZA 4ONOA 3O4LA 1N3NA 4JFEA 4JFQA 3T1FA 3TJHA 3TN0A 5C0DA 3S6CA 4L9LC 3UTTA 3X14A 5J6HA 5E6IC 5EO0A 3UTQA 2WY3A 2VE6A 4O2FA 1FFPA 4PRPA 5F7DA 1GZQA 3HG1A 2AXGA 3QDMA 3GSNH 4PRHA 3FQTA 3VFSA 3P4NA 3TBWA 2OI9A 4G9FA 3O3EA 4IIQC 3VXRA 4WU5A 4JRYA 4L4TA 4FTVA 1WBYA 3MV7A 4NNYA 3L3GA 1JPGA 3MRKA 1QRNA 2VLJA 3TVMA 3O3BA 2AV7A 4PREA 1N59A 1MI5A 4U6XA 3FQUA 1JUFA 3BW9A 3VFNA 2BNRA 3PWVA 5MEQA 3GMLA 1XR8A 2GTWA 4F7MA 3MRNA 4HKJA 4JFOA 1GZPA 1A1NA 3FRUA 1T1WA 3GMNA 1T1XA 1JF1A 4U1IA 1T7XA 3ILPA 3JTCA 5E8PA 1BZ9A 1QR1A 2BVPA 1HYRC 5C07A 1RJZA 2GITA 3TIDA 1DUZA 1S7XA 1ZHLA 1UXSA 3L3DA 1G6RH 3MGTA 4L8BA 4G8IA 5L2JA 3L3HA 1I1FA 5IM7A 4G9DA 1SYSA 3KXFA 4NQEA 4PRBA 3GMQA 3MRLA 5EU5A 3KPRA 4EI5A 5FDWA 4PJAA 4PG9A 4XXCA 5GSRA 1A1OA 2BSTA 1BIIA 1QLFA 3MROA 2F53A 2X70A 5D7JC 4JQVA 3ARGA 2HLAA 4HWZA 4L3CA 3O8XA 4I4WA 4PV8A 1JE6A 1MHEA 4MJ5A 2VLLA 3UTSA 1UQSA 3BUYA 4IRSA 3M17A 1CE6A 4WW2C 3PWLA 2X4OA 4ZUUA 4F7TA 4PJXA 1IM3A 4Y4HA 3ERYA 2GAZA 3DBXA 4PP8C 1YN6A 4PGDA 1QO3A 4PJDA 3DMMA 5BJTA 5IB1A 3QQ4A 3VXMA 1N5AA 1JHTA 4PJ8A 3RGVC 3BH8A 4GKNA 3VFPA 4PGEA 5IB4A 1OF2A 4LNRA 2FWOA 2V2WA 3QFJA 3VXSA 1LD9A 4PR5A 4O2EA 4L3EA 3RWHA 5GSVA 3SDAA 3SDXA 3JTSA 5HYJA 3KPQA 1KCGC 3LKRA 3BZEA 2J8UA 3L3JA 2CIIA 5FA3A 3B6SA 1ED3A 5F1NA 5DDHA 3LV3A 4MNQA 1T7YA 5BRZA 5C0IA 5IEKA 4PJIA 4ELMA 3D25A 4L8SC 2D31A 2CKBH 4U1KA 3BHBA 1DDHA 4NQDA 5DEFA 2FZ3A 3X11A 1JFMA 4ZUVA 5IB3A 1HSBA 4L8DA 1KJ2H 1WBXA 1P1ZA 1ZVSA 1ZHKA 4PJGA 5HHQA 3VWJA 4U1MA 3TBVA 3GSXA 3MRFA 3QUZA 3RL2A 3LKPA 2BSRA 5IB5A 3CZFA 4NNXA 4F7PA 3HAEA 2HJKA 1FFOA 1BQHA 4GKSA 1MHCA 2GT9A 2CIKA 4ZAKA 3VFUA 3TA3A 4ZUTA 1YDPA 3GSRA 3KYOA 3BP7A 5DEGA 5FKPA 5C0FA 3MRPA 3FT2A 1T7ZA 3GSVA 1KJ3H 2VLKA 1IM9A 5ACZA 4GUPA 5EOTA 4NSKA 1T7VA 3B3IA 3QFDA 3X12A 1TMCA 3P9LA 1RK1A 4QRSA 3L3IA 1W72A 1VACA 4Y4KA 3BH9A 3QUYA 4JRXA 1P4LA 5C0EA 4NQXA 3FT4A 4FFEX 2BCKA 1EFXA 3GSWA 3U0PA 2BVOA 4HUXA 4U1HA 3AM8A 3GSOA 3TO2A 3WL9A 3MRMA 4PV9A 1Q94A 2XFXA 3OV6A 3MRDA 3SJVA 3DX6A 3FT3A 4LHUA 3SCMA 5FA4A 2AK4A 3P9MA 5C0AA 2BVQA 1W0WA 4QRQA 3I6KA 3ARBA 3RUGA 3KPPA 5HGBA 3FFCA 1X7QA 1KBGH 1HHGA 2PYEA 4MQ7A 2FIKA 3RWFA 3T8XA 3KPOA 3BO8A 3RWGA 3DXAA 3KWWA 3CCHA 3E2HA 2JCCA 3GMPA 1K5NA 3PWNA 5L2KA 1PQZA 2ZSVA 3TO4A 4D0CA 3MYJA 3H9SA 4U6YA 4NQCA 4PGBA 4Z77A 3BEWA 4UQ2A 1S7SA 3VXUA 5EO1A 1I4FA 3MREA 3TPUE 3TBSA 3ROOA 1B0GA 4JQXA 1LK2A 3D2UA 4PJ5A 3OXRA 4LCYA 4WO4A 3G08A 3H9HA 3VFOA 1P7QA 3KPLA 4MS8A 1UXWA 4PRAA 2VLRA 3AREA 1HHJA 3PABA 1TVHA 3M1BA 5C9JA 1CD1A 3BWAA 1R3HA 4HX1A 3QZWA 4MX7A 1TVBA 3I6GA 3KLAA 4LCWA 1M05A 5INDA 3WLBA 5EU3A 1G7QA 1XZ0A 2X4NA 4X6FA 3GIVA 1AGFA 1K8DA 3VCLA 3VFMA 1Z5LA 1ZS8A 3P4MA 5J1AA 4CVZA 3DTXA 4WJ5A 2XPGA 3ES6A 2GUOA 1QQDA 1RK0A 3E3QA 4CVXA 2ESVA 3QUXA 3LKSA 3P77A 1QVOA 3MV8A 2HN7A 3CDGA 1DUYA 5HHNA 2AKRA 3OX8A 4PJEA 3W39A 3HPJA 5E9DA 4HUWA 3SKOA 4Z76A 3BP4A 3WS6A 1T20A 3ILQC 5D2NA 3PWUA 1FFNA 3RTQA 4U1JA 4QRUA 5IB2A 2FO4A 3KPNA 1HHHA 2YPKA 4HS3A 4PRIA 4PDCE 5D7IA 1QSFA 3QEQA 3QDGA 3QUKA 3SDCA 1FZMA 3VFRA 3FQWA 5SWQA 1BD2A 1ZHNA 3QQ3A 5J6GA 3SKMA 1YN7A 1U58A 2OL3H 4PJ7A 4ZFZA 3VXPA 4PJCA 5MENA 5MEOA 3TFKA 1S8DA 4QRPA 3LN4A 4PJ9A 1OSZA 3HE6A 4WUUA 1FZKA 4QRRA 3IT8D 3ARDA 5E8OA 4L8CA 3TF7A 1AGBA 2X4RA 5D9SA 5SWZA 5B39A 2E7LE 3VFTA 1I7UA 3CPLA 3MGOA 4JFDA 4PG2A 3LKOA 1LEGA 4K7FA 2HJLA 1KJVA 3GJFA 4PRDA 1S7QA 5C08A 1A9EA 3JVGA 1LDPH 4MJIA 4Y16A 2ZOLA 4L4VA 3V5KA 5ISZA 5BS0A 1T0MA 3MRGA 3NFNA 5HHPA 1LQVA 2YPLA 1ZT7A 3SDDA 3VFWA 3BVNA 4N0CA 5HGHA 4U1LA 2YEZA 5B38A 1VADA 3GMMA 3IXAA 3O3DA 1G7PA 4S0UC 5HHMA 1VGKA 2X4SA 1EEYA 4QRTA 3VXNA 3TBTA 5IVXA 2RFXA 3E6FA 1KPRA 4MVBA 3FTGA 4U1SA 3SPVA 4APQA 4V3EB 1NANH 5C09A 3VXOA 4G8GA 5E8NA 1ZHBA 1ZSDA 3VRJA 4X6CA 3KYNA 2C7UA 5F1IA 2X4QA 5INCA 4L29A 3RWDA 5C0GA 1ZAGA 3VWKA 4WWKC 1JPFA 1QSEA 3GSUA 3MRRA 3P73A 2VABA 2H6PA 5HHOA 2PO6A 3JTTA 5HGAA 1I1YA 1E28A 4PGCA 1QEWA 3MRBA 3HCVA 3RWIA 4E0RA 5BXFA 1XR9A 3W0WA 2Q7YA 3PWJA 4IRJA 3QI9A 4G43A 4WU7A 3UPRA 3WUWA 3FONA 3FQRA 3FQNA 4NO0A 1N2RA 4O2CA 2P5WA 2X4TA 1ZT1A 5C0BA 1OGTA 3MR9A 5SWSA 5F9JA 3CH1A 3HLAA 3MRJA 4N5EA 4X6EA 1ONQA 3X13A 2NX5A 4E5XA 1FZJA 5AD0A 3UBXA 2X4UA 5EU6A 3D39A 4K71B 4HUVA 3MRHA 4JFPA 3REWA 1S7UA 3FQXA 4G59A 3V5HA 4QOKA 3FOMA 3WS3A 2NW3A 4PJBA 2F54A 1T80A 1KTLA 2H26A 3H7BA 5JHDA 1FO0H 4NO3A 3MRIA 3MRCA 1S9YA 3LKQA 4ZUSA 1CG9A 4NT6A 4PJFA 3LKNA 4ZUWA 1NAMH 1WBZA 4D0DA 1A9BA 3KPSA 1L8JA 3BZFA 4G42A 3GMRA 2DYPA 4IHOA 5MERA 3BEVA 1HHIA 1FZOA 2AV1A 3HE7A 1NEZA 1S9XA 3PQYA 3ARFA 3QULA 5MEPA 4V3DB 4HUUA 4N0FA 1KPUA 3C8KA 3TBYA 2AXFA 3BGMA 1W0VA 5IROA 1DE4A 1M6OA 2ZSWA 1I7TA 3CVHA 3VH8A 4D0BA 2MHAA 4CW1A 4NO2A 4MJ6A 3TIEA 3VFVA 3ECBA 2BNQA 3ROLA 3L9RA 4N0UA 4N8VA 1AGDA 1T0NA 1LP9A 3PWPA 1S7RA 1B0RA 3O9WA 1B3JA 1I1AA 3DX7A 1T7WA 1XH3A 3O3AA 4MXQA 2GJ6A 1JGEA 1OGAA 1SYVA 2ZOKA 3DX8A 3GSQA 4NQVA 3VRIA 1EEZA 2P5EA 3V5DA 3D3VA 4Y4FA 1S7TA 2V2XA 1AO7A 1ZT4A 5IEHA 3RWJA 3BXNA 4Y2DA 3QDJA 1KJMA 1T21A 4Z78A 1S7WA
chains in the Genus database with same CATH superfamily
5HGDA 3RL1A 4JFFA 1INQA 4JO8A 3P4OA 5E00A 1T1ZA 2UWEA 3L3KA 4F7CA 1A6ZA 1I7RA 1HHKA 2CLZA 3E6HA 5H94A 3RWCA 1AKJA 5D7LA 4LCCC 5EFIA 3D18A 1C16A 3MV9A 1EXUA 5D5MA 1A1MA 1T22A 3OXSA 5C0CA 1S9WA 2FYYA 4NHUE 3MRQA 1HOCA 4MNGA 1MWAH 1HSAA 3MA7A 3GMOA 3FOLA 3I6LD 2X4PA 4HV8A 5D2LA 3RZCA 1FG2A 4U1NA 5ENWA 4NO5A 2VAAA 4X6DA 1AGCA 3C9NA 1LEKA 2BSSA 1AGEA 2CLRA 3CC5A 3HUJA 1E27A 2CLVA 5EU4A 1S7VA 4WDIA 3VJ6A 4I48A 5EUOA 3RWEA 2A83A 2F74A 4UQ3A 4EUPA 3TZVC 5C0JA 3AU1A 2GTZA 4EN3C 1KPVA 4PJHA 3KPMA 1JGDA 3LN5A 1RJYA 4PRNA 1T1YA 4F7EA 1YPZA 4ONOA 3O4LA 1N3NA 4JFEA 4JFQA 3T1FA 3TJHA 3TN0A 5C0DA 3S6CA 4L9LC 3UTTA 3X14A 5J6HA 5E6IC 5EO0A 3UTQA 2WY3A 2VE6A 4O2FA 1FFPA 4PRPA 5F7DA 1GZQA 3HG1A 2AXGA 3QDMA 3GSNH 4PRHA 3FQTA 3VFSA 3P4NA 3TBWA 2OI9A 4G9FA 3O3EA 4IIQC 3VXRA 4WU5A 4JRYA 4L4TA 4FTVA 1WBYA 3MV7A 4NNYA 3L3GA 1JPGA 3MRKA 1QRNA 2VLJA 3TVMA 3O3BA 2AV7A 4PREA 1N59A 1MI5A 4U6XA 3FQUA 1JUFA 3BW9A 3VFNA 2BNRA 3PWVA 5MEQA 3GMLA 1XR8A 2GTWA 4F7MA 3MRNA 4HKJA 4JFOA 1GZPA 1A1NA 3FRUA 1T1WA 3GMNA 1T1XA 1JF1A 4U1IA 1T7XA 3ILPA 3JTCA 5E8PA 1BZ9A 1QR1A 2BVPA 3I0TA 1HYRC 5C07A 1RJZA 2GITA 3TIDA 1DUZA 1S7XA 1ZHLA 1UXSA 3L3DA 1G6RH 3MGTA 4L8BA 4G8IA 5L2JA 3L3HA 1I1FA 5IM7A 4G9DA 1SYSA 3KXFA 4NQEA 4PRBA 3GMQA 3MRLA 5EU5A 3KPRA 4EI5A 5FDWA 4PJAA 4PG9A 4XXCA 5GSRA 1A1OA 2BSTA 1BIIA 1QLFA 3MROA 2F53A 2X70A 5D7JC 4JQVA 3ARGA 2HLAA 4HWZA 4L3CA 3O8XA 4I4WA 4PV8A 1JE6A 1MHEA 4MJ5A 2VLLA 3UTSA 1UQSA 3BUYA 4IRSA 3M17A 1CE6A 4WW2C 3PWLA 2X4OA 4ZUUA 4F7TA 4PJXA 1IM3A 4Y4HA 3ERYA 2GAZA 3DBXA 4PP8C 1YN6A 4PGDA 1QO3A 4PJDA 3DMMA 5BJTA 5IB1A 3QQ4A 3VXMA 1N5AA 1JHTA 4PJ8A 3RGVC 3BH8A 4GKNA 3VFPA 4PGEA 5IB4A 1OF2A 4LNRA 2FWOA 2V2WA 3QFJA 3VXSA 1LD9A 4PR5A 4O2EA 4L3EA 3RWHA 5GSVA 3SDAA 3SDXA 3JTSA 5HYJA 3KPQA 1KCGC 3LKRA 3BZEA 2J8UA 3L3JA 2CIIA 2O5NA 5FA3A 3B6SA 1ED3A 5F1NA 5DDHA 3LV3A 4MNQA 1T7YA 5BRZA 5C0IA 5IEKA 4PJIA 4ELMA 3D25A 4L8SC 2D31A 2CKBH 4U1KA 3BHBA 1DDHA 4NQDA 5DEFA 2FZ3A 3X11A 1JFMA 4ZUVA 5IB3A 1HSBA 4L8DA 1KJ2H 1WBXA 1P1ZA 1ZVSA 1ZHKA 4PJGA 5HHQA 3VWJA 4U1MA 3TBVA 3GSXA 3MRFA 3QUZA 3RL2A 3LKPA 2BSRA 5IB5A 3CZFA 4NNXA 4F7PA 3HAEA 2HJKA 1FFOA 1BQHA 4GKSA 1MHCA 2GT9A 2CIKA 4ZAKA 3VFUA 3TA3A 4ZUTA 1YDPA 3GSRA 3KYOA 3BP7A 5DEGA 5FKPA 5C0FA 3MRPA 3FT2A 1T7ZA 3GSVA 1KJ3H 2VLKA 1IM9A 5ACZA 4GUPA 5EOTA 4NSKA 1T7VA 3B3IA 3QFDA 3X12A 1TMCA 3P9LA 1RK1A 4QRSA 3L3IA 1W72A 1VACA 4Y4KA 3BH9A 3QUYA 4JRXA 1P4LA 5C0EA 4NQXA 3FT4A 4FFEX 2BCKA 1EFXA 3GSWA 3U0PA 2BVOA 4HUXA 4U1HA 3AM8A 3GSOA 3TO2A 3WL9A 3MRMA 4PV9A 1Q94A 2XFXA 3OV6A 3MRDA 3SJVA 3DX6A 3FT3A 4LHUA 3SCMA 2NYKA 5FA4A 2AK4A 3P9MA 5C0AA 2BVQA 1W0WA 4QRQA 3I6KA 3ARBA 3RUGA 3KPPA 5HGBA 3FFCA 1X7QA 1KBGH 1HHGA 2PYEA 4MQ7A 2FIKA 3RWFA 3T8XA 3KPOA 3BO8A 3RWGA 3DXAA 3KWWA 3CCHA 3E2HA 2JCCA 3GMPA 1K5NA 3PWNA 5L2KA 1PQZA 2ZSVA 3TO4A 4D0CA 3MYJA 3H9SA 4U6YA 4NQCA 4PGBA 4Z77A 3BEWA 4UQ2A 1S7SA 3VXUA 5EO1A 1I4FA 3MREA 3TPUE 3TBSA 3ROOA 1B0GA 4JQXA 1LK2A 3D2UA 4PJ5A 3OXRA 4LCYA 4WO4A 3G08A 3H9HA 3VFOA 1P7QA 3KPLA 4MS8A 2IA1A 1UXWA 4PRAA 2VLRA 3AREA 1HHJA 3PABA 1TVHA 3M1BA 5C9JA 1CD1A 3BWAA 1R3HA 4HX1A 3QZWA 4MX7A 1TVBA 3I6GA 3KLAA 4LCWA 1M05A 5INDA 3WLBA 5EU3A 1G7QA 1XZ0A 2X4NA 4X6FA 3GIVA 1AGFA 1K8DA 3VCLA 3VFMA 1Z5LA 1ZS8A 3P4MA 5J1AA 4CVZA 3DTXA 4WJ5A 2XPGA 3ES6A 2GUOA 1QQDA 1RK0A 3E3QA 4CVXA 2ESVA 3QUXA 3LKSA 3P77A 1QVOA 3MV8A 2HN7A 3CDGA 1DUYA 5HHNA 2AKRA 3OX8A 4PJEA 3W39A 3HPJA 5E9DA 4HUWA 3SKOA 4Z76A 3BP4A 3WS6A 1T20A 3ILQC 5D2NA 3PWUA 1FFNA 3RTQA 4U1JA 4QRUA 5IB2A 2FO4A 3KPNA 1HHHA 2YPKA 4HS3A 4PRIA 4PDCE 5D7IA 1QSFA 3QEQA 3QDGA 3QUKA 3SDCA 1FZMA 3VFRA 3FQWA 5SWQA 1BD2A 1ZHNA 3QQ3A 5J6GA 3SKMA 1YN7A 1U58A 2OL3H 4PJ7A 4ZFZA 3VXPA 4PJCA 5MENA 5MEOA 3TFKA 1S8DA 4QRPA 3LN4A 4PJ9A 1OSZA 3HE6A 4WUUA 1FZKA 4QRRA 3IT8D 3ARDA 5E8OA 4L8CA 3TF7A 1AGBA 2X4RA 5D9SA 5SWZA 5B39A 2E7LE 3VFTA 1I7UA 3CPLA 3MGOA 4JFDA 4PG2A 3LKOA 1LEGA 4K7FA 2HJLA 1KJVA 3GJFA 4PRDA 1S7QA 5C08A 1A9EA 3JVGA 1LDPH 4MJIA 4Y16A 2ZOLA 4L4VA 3V5KA 5ISZA 5BS0A 1T0MA 3MRGA 3NFNA 5HHPA 1LQVA 2YPLA 1ZT7A 3SDDA 3VFWA 3BVNA 4N0CA 5HGHA 4U1LA 2YEZA 5B38A 1VADA 3GMMA 3IXAA 3O3DA 1G7PA 4S0UC 5HHMA 1VGKA 2X4SA 1EEYA 4QRTA 3VXNA 3TBTA 5IVXA 2RFXA 3E6FA 1KPRA 4MVBA 3FTGA 4U1SA 3SPVA 4APQA 4V3EB 1NANH 5C09A 3VXOA 4G8GA 5E8NA 1ZHBA 1ZSDA 3VRJA 4X6CA 3KYNA 2C7UA 5F1IA 2X4QA 5INCA 4L29A 3RWDA 5C0GA 1ZAGA 3VWKA 4WWKC 1JPFA 1QSEA 4G59C 3GSUA 3MRRA 3P73A 2VABA 2H6PA 5HHOA 2PO6A 3JTTA 5HGAA 1I1YA 1E28A 4PGCA 1QEWA 3MRBA 3HCVA 3RWIA 4E0RA 5BXFA 1XR9A 3W0WA 2Q7YA 3PWJA 4IRJA 3QI9A 4G43A 4WU7A 3UPRA 3WUWA 3FONA 3FQRA 3FQNA 4BKWA 4NO0A 1N2RA 4O2CA 2P5WA 2X4TA 1ZT1A 5C0BA 1OGTA 3MR9A 5SWSA 5F9JA 3CH1A 3HLAA 3MRJA 4N5EA 4X6EA 1ONQA 3X13A 2NX5A 4E5XA 1FZJA 5AD0A 3UBXA 2X4UA 5EU6A 3D39A 4K71B 4HUVA 3MRHA 4JFPA 3REWA 1S7UA 3FQXA 4G59A 3V5HA 4QOKA 3FOMA 3WS3A 2NW3A 4PJBA 2F54A 1T80A 1KTLA 2H26A 3H7BA 5JHDA 1FO0H 4NO3A 3MRIA 3MRCA 1S9YA 3LKQA 4ZUSA 1CG9A 4NT6A 4PJFA 3LKNA 4ZUWA 1NAMH 1WBZA 4D0DA 1A9BA 3KPSA 1L8JA 3BZFA 4G42A 3GMRA 2DYPA 4IHOA 5MERA 3BEVA 1HHIA 1FZOA 2AV1A 3HE7A 1NEZA 1S9XA 3PQYA 3ARFA 3QULA 5MEPA 4V3DB 4HUUA 4N0FA 1KPUA 3C8KA 3TBYA 2AXFA 3BGMA 1W0VA 5IROA 1DE4A 1M6OA 2ZSWA 1I7TA 3CVHA 3VH8A 4D0BA 2MHAA 4CW1A 4NO2A 4MJ6A 3TIEA 3VFVA 3ECBA 2BNQA 3ROLA 3L9RA 4N0UA 4N8VA 1AGDA 1T0NA 1LP9A 3PWPA 1S7RA 1B0RA 3O9WA 1B3JA 1I1AA 3DX7A 1T7WA 1XH3A 3O3AA 4MXQA 2GJ6A 1JGEA 1OGAA 1SYVA 2ZOKA 3DX8A 3GSQA 4NQVA 3VRIA 1EEZA 2P5EA 3V5DA 3D3VA 4Y4FA 1S7TA 2V2XA 1AO7A 1ZT4A 5IEHA 3RWJA 3BXNA 4Y2DA 3QDJA 1KJMA 1T21A 4Z78A 1S7WA
chains in the Genus database with same CATH topology
5HGDA 3RL1A 4JFFA 1INQA 3P4OA 5E00A 1T1ZA 2UWEA 3L3KA 4F7CA 1A6ZA 1I7RA 1HHKA 2CLZA 3E6HA 5H94A 3RWCA 1AKJA 5D7LA 4LCCC 5EFIA 3D18A 1C16A 3MV9A 1EXUA 5D5MA 1A1MA 1T22A 3OXSA 5C0CA 1S9WA 2FYYA 4NHUE 3MRQA 1HOCA 4MNGA 1MWAH 1HSAA 3MA7A 3GMOA 3FOLA 3I6LD 2X4PA 4HV8A 5D2LA 3RZCA 1FG2A 4U1NA 5ENWA 4NO5A 2VAAA 4X6DA 1AGCA 3C9NA 1LEKA 2BSSA 1AGEA 2CLRA 3CC5A 3HUJA 1E27A 2CLVA 5EU4A 1S7VA 4WDIA 3VJ6A 4I48A 5EUOA 3RWEA 2A83A 2F74A 4UQ3A 4EUPA 3TZVC 5C0JA 3AU1A 2GTZA 4EN3C 1KPVA 4PJHA 3KPMA 1JGDA 3LN5A 1RJYA 4PRNA 1T1YA 4F7EA 1YPZA 4ONOA 3O4LA 1N3NA 4JFEA 4JFQA 3T1FA 3TJHA 3TN0A 5C0DA 3S6CA 4L9LC 3UTTA 3X14A 5J6HA 5E6IC 5EO0A 3UTQA 2WY3A 2VE6A 4O2FA 1FFPA 4PRPA 5F7DA 1GZQA 3HG1A 2AXGA 3QDMA 3GSNH 4PRHA 3FQTA 3VFSA 3P4NA 3TBWA 2OI9A 4G9FA 3O3EA 4IIQC 3VXRA 4WU5A 4JRYA 4L4TA 4FTVA 1WBYA 3MV7A 4NNYA 3L3GA 1JPGA 3MRKA 1QRNA 2VLJA 3TVMA 3O3BA 2AV7A 4PREA 1N59A 1MI5A 4U6XA 3FQUA 1JUFA 3BW9A 3VFNA 2BNRA 3PWVA 5MEQA 3GMLA 1XR8A 2GTWA 4F7MA 3MRNA 4HKJA 4JFOA 1GZPA 1A1NA 3FRUA 1T1WA 3GMNA 1T1XA 1JF1A 4U1IA 1T7XA 3ILPA 3JTCA 5E8PA 1BZ9A 1QR1A 2BVPA 1HYRC 5C07A 1RJZA 2GITA 3TIDA 1DUZA 1S7XA 1ZHLA 1UXSA 3L3DA 1G6RH 3MGTA 4L8BA 4G8IA 5L2JA 3L3HA 1I1FA 5IM7A 4G9DA 1SYSA 3KXFA 4NQEA 4PRBA 3GMQA 3MRLA 5EU5A 3KPRA 4EI5A 5FDWA 4PJAA 4PG9A 4XXCA 5GSRA 1A1OA 2BSTA 1BIIA 1QLFA 3MROA 2F53A 2X70A 5D7JC 4JQVA 3ARGA 2HLAA 4HWZA 4L3CA 3O8XA 4I4WA 4PV8A 1JE6A 1MHEA 4MJ5A 2VLLA 3UTSA 1UQSA 3BUYA 4IRSA 3M17A 1CE6A 4WW2C 3PWLA 2X4OA 4ZUUA 4F7TA 4PJXA 1IM3A 4Y4HA 3ERYA 2GAZA 3DBXA 4PP8C 1YN6A 4PGDA 1QO3A 4PJDA 3DMMA 5BJTA 5IB1A 3QQ4A 3VXMA 1N5AA 1JHTA 4PJ8A 3RGVC 3BH8A 4GKNA 3VFPA 4PGEA 5IB4A 1OF2A 4LNRA 2FWOA 2V2WA 3QFJA 3VXSA 1LD9A 4PR5A 4O2EA 4L3EA 3RWHA 5GSVA 3SDAA 3SDXA 3JTSA 5HYJA 3KPQA 1KCGC 3LKRA 3BZEA 2J8UA 3L3JA 2CIIA 5FA3A 3B6SA 1ED3A 5F1NA 5DDHA 3LV3A 4MNQA 1T7YA 5BRZA 5C0IA 5IEKA 4PJIA 4ELMA 3D25A 4L8SC 2D31A 2CKBH 4U1KA 3BHBA 1DDHA 4NQDA 5DEFA 2FZ3A 3X11A 1JFMA 4ZUVA 5IB3A 1HSBA 4L8DA 1KJ2H 1WBXA 1P1ZA 1ZVSA 1ZHKA 4PJGA 5HHQA 3VWJA 4U1MA 3TBVA 3GSXA 3MRFA 3QUZA 3RL2A 3LKPA 2BSRA 5IB5A 3CZFA 4NNXA 4F7PA 3HAEA 2HJKA 1FFOA 1BQHA 4GKSA 1MHCA 2GT9A 2CIKA 4ZAKA 3VFUA 3TA3A 4ZUTA 1YDPA 3GSRA 3KYOA 3BP7A 5DEGA 5FKPA 5C0FA 3MRPA 3FT2A 1T7ZA 3GSVA 1KJ3H 2VLKA 1IM9A 5ACZA 4GUPA 5EOTA 4NSKA 1T7VA 3B3IA 3QFDA 3X12A 1TMCA 3P9LA 1RK1A 4QRSA 3L3IA 1W72A 1VACA 4Y4KA 3BH9A 3QUYA 4JRXA 1P4LA 5C0EA 4NQXA 3FT4A 4FFEX 2BCKA 1EFXA 3GSWA 3U0PA 2BVOA 4HUXA 4U1HA 3AM8A 3GSOA 3TO2A 3WL9A 3MRMA 4PV9A 1Q94A 2XFXA 3OV6A 3MRDA 3SJVA 3DX6A 3FT3A 4LHUA 3SCMA 5FA4A 2AK4A 3P9MA 5C0AA 2BVQA 1W0WA 4QRQA 3I6KA 3ARBA 3RUGA 3KPPA 5HGBA 3FFCA 1X7QA 1KBGH 1HHGA 2PYEA 4MQ7A 2FIKA 3RWFA 3T8XA 3KPOA 3BO8A 3RWGA 3DXAA 3KWWA 3CCHA 3E2HA 2JCCA 3GMPA 1K5NA 3PWNA 5L2KA 1PQZA 2ZSVA 3TO4A 4D0CA 3MYJA 3H9SA 4U6YA 4NQCA 4PGBA 4Z77A 3BEWA 4UQ2A 1S7SA 3VXUA 5EO1A 1I4FA 3MREA 3TPUE 3TBSA 3ROOA 1B0GA 4JQXA 1LK2A 3D2UA 4PJ5A 3OXRA 4LCYA 4WO4A 3G08A 3H9HA 3VFOA 1P7QA 3KPLA 4MS8A 1UXWA 4PRAA 2VLRA 3AREA 1HHJA 3PABA 1TVHA 3M1BA 5C9JA 1CD1A 3BWAA 1R3HA 4HX1A 3QZWA 4MX7A 1TVBA 3I6GA 3KLAA 4LCWA 1M05A 5INDA 3WLBA 5EU3A 1G7QA 1XZ0A 2X4NA 4X6FA 3GIVA 1AGFA 1K8DA 3VCLA 3VFMA 1Z5LA 1ZS8A 3P4MA 5J1AA 4CVZA 3DTXA 4WJ5A 2XPGA 3ES6A 2GUOA 1QQDA 1RK0A 3E3QA 4CVXA 2ESVA 3QUXA 3LKSA 3P77A 1QVOA 3MV8A 2HN7A 3CDGA 1DUYA 5HHNA 2AKRA 3OX8A 4PJEA 3W39A 3HPJA 5E9DA 4HUWA 3SKOA 4Z76A 3BP4A 3WS6A 1T20A 3ILQC 5D2NA 3PWUA 1FFNA 3RTQA 4U1JA 4QRUA 5IB2A 2FO4A 3KPNA 1HHHA 2YPKA 4HS3A 4PRIA 4PDCE 5D7IA 1QSFA 3QEQA 3QDGA 3QUKA 3SDCA 1FZMA 3VFRA 3FQWA 5SWQA 1BD2A 1ZHNA 3QQ3A 5J6GA 3SKMA 1YN7A 1U58A 2OL3H 4PJ7A 4ZFZA 3VXPA 4PJCA 5MENA 5MEOA 3TFKA 1S8DA 4QRPA 3LN4A 4PJ9A 1OSZA 3HE6A 4WUUA 1FZKA 4QRRA 3IT8D 3ARDA 5E8OA 4L8CA 3TF7A 1AGBA 2X4RA 5D9SA 5SWZA 5B39A 2E7LE 3VFTA 1I7UA 3CPLA 3MGOA 4JFDA 4PG2A 3LKOA 1LEGA 4K7FA 2HJLA 1KJVA 3GJFA 4PRDA 1S7QA 5C08A 1A9EA 3JVGA 1LDPH 4MJIA 4Y16A 2ZOLA 4L4VA 3V5KA 5ISZA 5BS0A 1T0MA 3MRGA 3NFNA 5HHPA 1LQVA 2YPLA 1ZT7A 3SDDA 3VFWA 3BVNA 4N0CA 5HGHA 4U1LA 2YEZA 5B38A 1VADA 3GMMA 3IXAA 3O3DA 1G7PA 4S0UC 5HHMA 1VGKA 2X4SA 1EEYA 4QRTA 3VXNA 3TBTA 5IVXA 2RFXA 3E6FA 1KPRA 4MVBA 3FTGA 4U1SA 3SPVA 4APQA 4V3EB 1NANH 5C09A 3VXOA 4G8GA 5E8NA 1ZHBA 1ZSDA 3VRJA 4X6CA 3KYNA 2C7UA 5F1IA 2X4QA 5INCA 4L29A 3RWDA 5C0GA 1ZAGA 3VWKA 4WWKC 1JPFA 1QSEA 3GSUA 3MRRA 3P73A 2VABA 2H6PA 5HHOA 2PO6A 3JTTA 5HGAA 1I1YA 1E28A 4PGCA 1QEWA 3MRBA 3HCVA 3RWIA 4E0RA 5BXFA 1XR9A 3W0WA 2Q7YA 3PWJA 4IRJA 3QI9A 4G43A 4WU7A 3UPRA 3WUWA 3FONA 3FQRA 3FQNA 4NO0A 1N2RA 4O2CA 2P5WA 2X4TA 1ZT1A 5C0BA 1OGTA 3MR9A 5SWSA 5F9JA 3CH1A 3HLAA 3MRJA 4N5EA 4X6EA 1ONQA 3X13A 2NX5A 4E5XA 1FZJA 5AD0A 3UBXA 2X4UA 5EU6A 3D39A 4K71B 4HUVA 3MRHA 4JFPA 3REWA 1S7UA 3FQXA 4G59A 3V5HA 4QOKA 3FOMA 3WS3A 2NW3A 4PJBA 2F54A 1T80A 1KTLA 2H26A 3H7BA 5JHDA 1FO0H 4NO3A 3MRIA 3MRCA 1S9YA 3LKQA 4ZUSA 1CG9A 4NT6A 4PJFA 3LKNA 4ZUWA 1NAMH 1WBZA 4D0DA 1A9BA 3KPSA 1L8JA 3BZFA 4G42A 3GMRA 2DYPA 4IHOA 5MERA 3BEVA 1HHIA 1FZOA 2AV1A 3HE7A 1NEZA 1S9XA 3PQYA 3ARFA 3QULA 5MEPA 4V3DB 4HUUA 4N0FA 1KPUA 3C8KA 3TBYA 2AXFA 3BGMA 1W0VA 5IROA 1DE4A 1M6OA 2ZSWA 1I7TA 3CVHA 3VH8A 4D0BA 2MHAA 4CW1A 4NO2A 4MJ6A 3TIEA 3VFVA 3ECBA 2BNQA 3ROLA 3L9RA 4N0UA 4N8VA 1AGDA 1T0NA 1LP9A 3PWPA 1S7RA 1B0RA 3O9WA 1B3JA 1I1AA 3DX7A 1T7WA 1XH3A 3O3AA 4MXQA 2GJ6A 1JGEA 1OGAA 1SYVA 2ZOKA 3DX8A 3GSQA 4NQVA 3VRIA 1EEZA 2P5EA 3V5DA 3D3VA 4Y4FA 1S7TA 2V2XA 1AO7A 1ZT4A 5IEHA 3RWJA 3BXNA 4Y2DA 3QDJA 1KJMA 1T21A 4Z78A 1S7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGD A;  3RL1 A;  4JFF A;  1INQ A;  3P4O A;  5E00 A;  1T1Z A;  2UWE A;  3L3K A;  4F7C A;  1A6Z A;  1I7R A;  1HHK A;  2CLZ A;  3E6H A;  5H94 A;  3RWC A;  1AKJ A;  5D7L A;  4LCC C;  5EFI A;  3D18 A;  1C16 A;  3MV9 A;  1EXU A;  5D5M A;  1A1M A;  1T22 A;  3OXS A;  5C0C A;  1S9W A;  2FYY A;  4NHU E;  3MRQ A;  1HOC A;  4MNG A;  1MWA H;  1HSA A;  3MA7 A;  3GMO A;  3FOL A;  3I6L D;  2X4P A;  4HV8 A;  5D2L A;  3RZC A;  1FG2 A;  4U1N A;  5ENW A;  4NO5 A;  2VAA A;  4X6D A;  1AGC A;  3C9N A;  1LEK A;  2BSS A;  1AGE A;  2CLR A;  3CC5 A;  3HUJ A;  1E27 A;  2CLV A;  5EU4 A;  1S7V A;  4WDI A;  3VJ6 A;  4I48 A;  5EUO A;  3RWE A;  2A83 A;  2F74 A;  4UQ3 A;  4EUP A;  3TZV C;  5C0J A;  3AU1 A;  2GTZ A;  4EN3 C;  1KPV A;  4PJH A;  3KPM A;  1JGD A;  3LN5 A;  1RJY A;  4PRN A;  1T1Y A;  4F7E A;  1YPZ A;  4ONO A;  3O4L A;  1N3N A;  4JFE A;  4JFQ A;  3T1F A;  3TJH A;  3TN0 A;  5C0D A;  3S6C A;  4L9L C;  3UTT A;  3X14 A;  5J6H A;  5E6I C;  5EO0 A;  3UTQ A;  2WY3 A;  2VE6 A;  4O2F A;  1FFP A;  4PRP A;  5F7D A;  1GZQ A;  3HG1 A;  2AXG A;  3QDM A;  3GSN H;  4PRH A;  3FQT A;  3VFS A;  3P4N A;  3TBW A;  2OI9 A;  4G9F A;  3O3E A;  4IIQ C;  3VXR A;  4WU5 A;  4JRY A;  4L4T A;  4FTV A;  1WBY A;  3MV7 A;  4NNY A;  3L3G A;  1JPG A;  3MRK A;  1QRN A;  2VLJ A;  3TVM A;  3O3B A;  2AV7 A;  4PRE A;  1N59 A;  1MI5 A;  4U6X A;  3FQU A;  1JUF A;  3BW9 A;  3VFN A;  2BNR A;  3PWV A;  5MEQ A;  3GML A;  1XR8 A;  2GTW A;  4F7M A;  3MRN A;  4HKJ A;  4JFO A;  1GZP A;  1A1N A;  3FRU A;  1T1W A;  3GMN A;  1T1X A;  1JF1 A;  4U1I A;  1T7X A;  3ILP A;  3JTC A;  5E8P A;  1BZ9 A;  1QR1 A;  2BVP A;  1HYR C;  5C07 A;  1RJZ A;  2GIT A;  3TID A;  1DUZ A;  1S7X A;  1ZHL A;  1UXS A;  3L3D A;  1G6R H;  3MGT A;  4L8B A;  4G8I A;  5L2J A;  3L3H A;  1I1F A;  5IM7 A;  4G9D A;  1SYS A;  3KXF A;  4NQE A;  4PRB A;  3GMQ A;  3MRL A;  5EU5 A;  3KPR A;  4EI5 A;  5FDW A;  4PJA A;  4PG9 A;  4XXC A;  5GSR A;  1A1O A;  2BST A;  1BII A;  1QLF A;  3MRO A;  2F53 A;  2X70 A;  5D7J C;  4JQV A;  3ARG A;  2HLA A;  4HWZ A;  4L3C A;  3O8X A;  4I4W A;  4PV8 A;  1JE6 A;  1MHE A;  4MJ5 A;  2VLL A;  3UTS A;  1UQS A;  3BUY A;  4IRS A;  3M17 A;  1CE6 A;  4WW2 C;  3PWL A;  2X4O A;  4ZUU A;  4F7T A;  4PJX A;  1IM3 A;  4Y4H A;  3ERY A;  2GAZ A;  3DBX A;  4PP8 C;  1YN6 A;  4PGD A;  1QO3 A;  4PJD A;  3DMM A;  5BJT A;  5IB1 A;  3QQ4 A;  3VXM A;  1N5A A;  1JHT A;  4PJ8 A;  3RGV C;  3BH8 A;  4GKN A;  3VFP A;  4PGE A;  5IB4 A;  1OF2 A;  4LNR A;  2FWO A;  2V2W A;  3QFJ A;  3VXS A;  1LD9 A;  4PR5 A;  4O2E A;  4L3E A;  3RWH A;  5GSV A;  3SDA A;  3SDX A;  3JTS A;  5HYJ A;  3KPQ A;  1KCG C;  3LKR A;  3BZE A;  2J8U A;  3L3J A;  2CII A;  5FA3 A;  3B6S A;  1ED3 A;  5F1N A;  5DDH A;  3LV3 A;  4MNQ A;  1T7Y A;  5BRZ A;  5C0I A;  5IEK A;  4PJI A;  4ELM A;  3D25 A;  4L8S C;  2D31 A;  2CKB H;  4U1K A;  3BHB A;  1DDH A;  4NQD A;  5DEF A;  2FZ3 A;  3X11 A;  1JFM A;  4ZUV A;  5IB3 A;  1HSB A;  4L8D A;  1KJ2 H;  1WBX A;  1P1Z A;  1ZVS A;  1ZHK A;  4PJG A;  5HHQ A;  3VWJ A;  4U1M A;  3TBV A;  3GSX A;  3MRF A;  3QUZ A;  3RL2 A;  3LKP A;  2BSR A;  5IB5 A;  3CZF A;  4NNX A;  4F7P A;  3HAE A;  2HJK A;  1FFO A;  1BQH A;  4GKS A;  1MHC A;  2GT9 A;  2CIK A;  4ZAK A;  3VFU A;  3TA3 A;  4ZUT A;  1YDP A;  3GSR A;  3KYO A;  3BP7 A;  5DEG A;  5FKP A;  5C0F A;  3MRP A;  3FT2 A;  1T7Z A;  3GSV A;  1KJ3 H;  2VLK A;  1IM9 A;  5ACZ A;  4GUP A;  5EOT A;  4NSK A;  1T7V A;  3B3I A;  3QFD A;  3X12 A;  1TMC A;  3P9L A;  1RK1 A;  4QRS A;  3L3I A;  1W72 A;  1VAC A;  4Y4K A;  3BH9 A;  3QUY A;  4JRX A;  1P4L A;  5C0E A;  4NQX A;  3FT4 A;  4FFE X;  2BCK A;  1EFX A;  3GSW A;  3U0P A;  2BVO A;  4HUX A;  4U1H A;  3AM8 A;  3GSO A;  3TO2 A;  3WL9 A;  3MRM A;  4PV9 A;  1Q94 A;  2XFX A;  3OV6 A;  3MRD A;  3SJV A;  3DX6 A;  3FT3 A;  4LHU A;  3SCM A;  5FA4 A;  2AK4 A;  3P9M A;  5C0A A;  2BVQ A;  1W0W A;  4QRQ A;  3I6K A;  3ARB A;  3RUG A;  3KPP A;  5HGB A;  3FFC A;  1X7Q A;  1KBG H;  1HHG A;  2PYE A;  4MQ7 A;  2FIK A;  3RWF A;  3T8X A;  3KPO A;  3BO8 A;  3RWG A;  3DXA A;  3KWW A;  3CCH A;  3E2H A;  2JCC A;  3GMP A;  1K5N A;  3PWN A;  5L2K A;  1PQZ A;  2ZSV A;  3TO4 A;  4D0C A;  3MYJ A;  3H9S A;  4U6Y A;  4NQC A;  4PGB A;  4Z77 A;  3BEW A;  4UQ2 A;  1S7S A;  3VXU A;  5EO1 A;  1I4F A;  3MRE A;  3TPU E;  3TBS A;  3ROO A;  1B0G A;  4JQX A;  1LK2 A;  3D2U A;  4PJ5 A;  3OXR A;  4LCY A;  4WO4 A;  3G08 A;  3H9H A;  3VFO A;  1P7Q A;  3KPL A;  4MS8 A;  1UXW A;  4PRA A;  2VLR A;  3ARE A;  1HHJ A;  3PAB A;  1TVH A;  3M1B A;  5C9J A;  1CD1 A;  3BWA A;  1R3H A;  4HX1 A;  3QZW A;  4MX7 A;  1TVB A;  3I6G A;  3KLA A;  4LCW A;  1M05 A;  5IND A;  3WLB A;  5EU3 A;  1G7Q A;  1XZ0 A;  2X4N A;  4X6F A;  3GIV A;  1AGF A;  1K8D A;  3VCL A;  3VFM A;  1Z5L A;  1ZS8 A;  3P4M A;  5J1A A;  4CVZ A;  3DTX A;  4WJ5 A;  2XPG A;  3ES6 A;  2GUO A;  1QQD A;  1RK0 A;  3E3Q A;  4CVX A;  2ESV A;  3QUX A;  3LKS A;  3P77 A;  1QVO A;  3MV8 A;  2HN7 A;  3CDG A;  1DUY A;  5HHN A;  2AKR A;  3OX8 A;  4PJE A;  3W39 A;  3HPJ A;  5E9D A;  4HUW A;  3SKO A;  4Z76 A;  3BP4 A;  3WS6 A;  1T20 A;  3ILQ C;  5D2N A;  3PWU A;  1FFN A;  3RTQ A;  4U1J A;  4QRU A;  5IB2 A;  2FO4 A;  3KPN A;  1HHH A;  2YPK A;  4HS3 A;  4PRI A;  4PDC E;  5D7I A;  1QSF A;  3QEQ A;  3QDG A;  3QUK A;  3SDC A;  1FZM A;  3VFR A;  3FQW A;  5SWQ A;  1BD2 A;  1ZHN A;  3QQ3 A;  5J6G A;  3SKM A;  1YN7 A;  1U58 A;  2OL3 H;  4PJ7 A;  4ZFZ A;  3VXP A;  4PJC A;  5MEN A;  5MEO A;  3TFK A;  1S8D A;  4QRP A;  3LN4 A;  4PJ9 A;  1OSZ A;  3HE6 A;  4WUU A;  1FZK A;  4QRR A;  3IT8 D;  3ARD A;  5E8O A;  4L8C A;  3TF7 A;  1AGB A;  2X4R A;  5D9S A;  5SWZ A;  5B39 A;  2E7L E;  3VFT A;  1I7U A;  3CPL A;  3MGO A;  4JFD A;  4PG2 A;  3LKO A;  1LEG A;  4K7F A;  2HJL A;  1KJV A;  3GJF A;  4PRD A;  1S7Q A;  5C08 A;  1A9E A;  3JVG A;  1LDP H;  4MJI A;  4Y16 A;  2ZOL A;  4L4V A;  3V5K A;  5ISZ A;  5BS0 A;  1T0M A;  3MRG A;  3NFN A;  5HHP A;  1LQV A;  2YPL A;  1ZT7 A;  3SDD A;  3VFW A;  3BVN A;  4N0C A;  5HGH A;  4U1L A;  2YEZ A;  5B38 A;  1VAD A;  3GMM A;  3IXA A;  3O3D A;  1G7P A;  4S0U C;  5HHM A;  1VGK A;  2X4S A;  1EEY A;  4QRT A;  3VXN A;  3TBT A;  5IVX A;  2RFX A;  3E6F A;  1KPR A;  4MVB A;  3FTG A;  4U1S A;  3SPV A;  4APQ A;  4V3E B;  1NAN H;  5C09 A;  3VXO A;  4G8G A;  5E8N A;  1ZHB A;  1ZSD A;  3VRJ A;  4X6C A;  3KYN A;  2C7U A;  5F1I A;  2X4Q A;  5INC A;  4L29 A;  3RWD A;  5C0G A;  1ZAG A;  3VWK A;  4WWK C;  1JPF A;  1QSE A;  3GSU A;  3MRR A;  3P73 A;  2VAB A;  2H6P A;  5HHO A;  2PO6 A;  3JTT A;  5HGA A;  1I1Y A;  1E28 A;  4PGC A;  1QEW A;  3MRB A;  3HCV A;  3RWI A;  4E0R A;  5BXF A;  1XR9 A;  3W0W A;  2Q7Y A;  3PWJ A;  4IRJ A;  3QI9 A;  4G43 A;  4WU7 A;  3UPR A;  3WUW A;  3FON A;  3FQR A;  3FQN A;  4NO0 A;  1N2R A;  4O2C A;  2P5W A;  2X4T A;  1ZT1 A;  5C0B A;  1OGT A;  3MR9 A;  5SWS A;  5F9J A;  3CH1 A;  3HLA A;  3MRJ A;  4N5E A;  4X6E A;  1ONQ A;  3X13 A;  2NX5 A;  4E5X A;  1FZJ A;  5AD0 A;  3UBX A;  2X4U A;  5EU6 A;  3D39 A;  4K71 B;  4HUV A;  3MRH A;  4JFP A;  3REW A;  1S7U A;  3FQX A;  4G59 A;  3V5H A;  4QOK A;  3FOM A;  3WS3 A;  2NW3 A;  4PJB A;  2F54 A;  1T80 A;  1KTL A;  2H26 A;  3H7B A;  5JHD A;  1FO0 H;  4NO3 A;  3MRI A;  3MRC A;  1S9Y A;  3LKQ A;  4ZUS A;  1CG9 A;  4NT6 A;  4PJF A;  3LKN A;  4ZUW A;  1NAM H;  1WBZ A;  4D0D A;  1A9B A;  3KPS A;  1L8J A;  3BZF A;  4G42 A;  3GMR A;  2DYP A;  4IHO A;  5MER A;  3BEV A;  1HHI A;  1FZO A;  2AV1 A;  3HE7 A;  1NEZ A;  1S9X A;  3PQY A;  3ARF A;  3QUL A;  5MEP A;  4V3D B;  4HUU A;  4N0F A;  1KPU A;  3C8K A;  3TBY A;  2AXF A;  3BGM A;  1W0V A;  5IRO A;  1DE4 A;  1M6O A;  2ZSW A;  1I7T A;  3CVH A;  3VH8 A;  4D0B A;  2MHA A;  4CW1 A;  4NO2 A;  4MJ6 A;  3TIE A;  3VFV A;  3ECB A;  2BNQ A;  3ROL A;  3L9R A;  4N0U A;  4N8V A;  1AGD A;  1T0N A;  1LP9 A;  3PWP A;  1S7R A;  1B0R A;  3O9W A;  1B3J A;  1I1A A;  3DX7 A;  1T7W A;  1XH3 A;  3O3A A;  4MXQ A;  2GJ6 A;  1JGE A;  1OGA A;  1SYV A;  2ZOK A;  3DX8 A;  3GSQ A;  4NQV A;  3VRI A;  1EEZ A;  2P5E A;  3V5D A;  3D3V A;  4Y4F A;  1S7T A;  2V2X A;  1AO7 A;  1ZT4 A;  5IEH A;  3RWJ A;  3BXN A;  4Y2D A;  3QDJ A;  1KJM A;  1T21 A;  4Z78 A;  1S7W A; 
#chains in the Genus database with same CATH topology
 5HGD A;  3RL1 A;  4JFF A;  1INQ A;  4JO8 A;  3P4O A;  5E00 A;  1T1Z A;  2UWE A;  3L3K A;  4F7C A;  1A6Z A;  1I7R A;  1HHK A;  2CLZ A;  3E6H A;  5H94 A;  3RWC A;  1AKJ A;  5D7L A;  4LCC C;  5EFI A;  3D18 A;  1C16 A;  3MV9 A;  1EXU A;  5D5M A;  1A1M A;  1T22 A;  3OXS A;  5C0C A;  1S9W A;  2FYY A;  4NHU E;  3MRQ A;  1HOC A;  4MNG A;  1MWA H;  1HSA A;  3MA7 A;  3GMO A;  3FOL A;  3I6L D;  2X4P A;  4HV8 A;  5D2L A;  3RZC A;  1FG2 A;  4U1N A;  5ENW A;  4NO5 A;  2VAA A;  4X6D A;  1AGC A;  3C9N A;  1LEK A;  2BSS A;  1AGE A;  2CLR A;  3CC5 A;  3HUJ A;  1E27 A;  2CLV A;  5EU4 A;  1S7V A;  4WDI A;  3VJ6 A;  4I48 A;  5EUO A;  3RWE A;  2A83 A;  2F74 A;  4UQ3 A;  4EUP A;  3TZV C;  5C0J A;  3AU1 A;  2GTZ A;  4EN3 C;  1KPV A;  4PJH A;  3KPM A;  1JGD A;  3LN5 A;  1RJY A;  4PRN A;  1T1Y A;  4F7E A;  1YPZ A;  4ONO A;  3O4L A;  1N3N A;  4JFE A;  4JFQ A;  3T1F A;  3TJH A;  3TN0 A;  5C0D A;  3S6C A;  4L9L C;  3UTT A;  3X14 A;  5J6H A;  5E6I C;  5EO0 A;  3UTQ A;  2WY3 A;  2VE6 A;  4O2F A;  1FFP A;  4PRP A;  5F7D A;  1GZQ A;  3HG1 A;  2AXG A;  3QDM A;  3GSN H;  4PRH A;  3FQT A;  3VFS A;  3P4N A;  3TBW A;  2OI9 A;  4G9F A;  3O3E A;  4IIQ C;  3VXR A;  4WU5 A;  4JRY A;  4L4T A;  4FTV A;  1WBY A;  3MV7 A;  4NNY A;  3L3G A;  1JPG A;  3MRK A;  1QRN A;  2VLJ A;  3TVM A;  3O3B A;  2AV7 A;  4PRE A;  1N59 A;  1MI5 A;  4U6X A;  3FQU A;  1JUF A;  3BW9 A;  3VFN A;  2BNR A;  3PWV A;  5MEQ A;  3GML A;  1XR8 A;  2GTW A;  4F7M A;  3MRN A;  4HKJ A;  4JFO A;  1GZP A;  1A1N A;  3FRU A;  1T1W A;  3GMN A;  1T1X A;  1JF1 A;  4U1I A;  1T7X A;  3ILP A;  3JTC A;  5E8P A;  1BZ9 A;  1QR1 A;  2BVP A;  3I0T A;  1HYR C;  5C07 A;  1RJZ A;  2GIT A;  3TID A;  1DUZ A;  1S7X A;  1ZHL A;  1UXS A;  3L3D A;  1G6R H;  3MGT A;  4L8B A;  4G8I A;  5L2J A;  3L3H A;  1I1F A;  5IM7 A;  4G9D A;  1SYS A;  3KXF A;  4NQE A;  4PRB A;  3GMQ A;  3MRL A;  5EU5 A;  3KPR A;  4EI5 A;  5FDW A;  4PJA A;  4PG9 A;  4XXC A;  5GSR A;  1A1O A;  2BST A;  1BII A;  1QLF A;  3MRO A;  2F53 A;  2X70 A;  5D7J C;  4JQV A;  3ARG A;  2HLA A;  4HWZ A;  4L3C A;  3O8X A;  4I4W A;  4PV8 A;  1JE6 A;  1MHE A;  4MJ5 A;  2VLL A;  3UTS A;  1UQS A;  3BUY A;  4IRS A;  3M17 A;  1CE6 A;  4WW2 C;  3PWL A;  2X4O A;  4ZUU A;  4F7T A;  4PJX A;  1IM3 A;  4Y4H A;  3ERY A;  2GAZ A;  3DBX A;  4PP8 C;  1YN6 A;  4PGD A;  1QO3 A;  4PJD A;  3DMM A;  5BJT A;  5IB1 A;  3QQ4 A;  3VXM A;  1N5A A;  1JHT A;  4PJ8 A;  3RGV C;  3BH8 A;  4GKN A;  3VFP A;  4PGE A;  5IB4 A;  1OF2 A;  4LNR A;  2FWO A;  2V2W A;  3QFJ A;  3VXS A;  1LD9 A;  4PR5 A;  4O2E A;  4L3E A;  3RWH A;  5GSV A;  3SDA A;  3SDX A;  3JTS A;  5HYJ A;  3KPQ A;  1KCG C;  3LKR A;  3BZE A;  2J8U A;  3L3J A;  2CII A;  2O5N A;  5FA3 A;  3B6S A;  1ED3 A;  5F1N A;  5DDH A;  3LV3 A;  4MNQ A;  1T7Y A;  5BRZ A;  5C0I A;  5IEK A;  4PJI A;  4ELM A;  3D25 A;  4L8S C;  2D31 A;  2CKB H;  4U1K A;  3BHB A;  1DDH A;  4NQD A;  5DEF A;  2FZ3 A;  3X11 A;  1JFM A;  4ZUV A;  5IB3 A;  1HSB A;  4L8D A;  1KJ2 H;  1WBX A;  1P1Z A;  1ZVS A;  1ZHK A;  4PJG A;  5HHQ A;  3VWJ A;  4U1M A;  3TBV A;  3GSX A;  3MRF A;  3QUZ A;  3RL2 A;  3LKP A;  2BSR A;  5IB5 A;  3CZF A;  4NNX A;  4F7P A;  3HAE A;  2HJK A;  1FFO A;  1BQH A;  4GKS A;  1MHC A;  2GT9 A;  2CIK A;  4ZAK A;  3VFU A;  3TA3 A;  4ZUT A;  1YDP A;  3GSR A;  3KYO A;  3BP7 A;  5DEG A;  5FKP A;  5C0F A;  3MRP A;  3FT2 A;  1T7Z A;  3GSV A;  1KJ3 H;  2VLK A;  1IM9 A;  5ACZ A;  4GUP A;  5EOT A;  4NSK A;  1T7V A;  3B3I A;  3QFD A;  3X12 A;  1TMC A;  3P9L A;  1RK1 A;  4QRS A;  3L3I A;  1W72 A;  1VAC A;  4Y4K A;  3BH9 A;  3QUY A;  4JRX A;  1P4L A;  5C0E A;  4NQX A;  3FT4 A;  4FFE X;  2BCK A;  1EFX A;  3GSW A;  3U0P A;  2BVO A;  4HUX A;  4U1H A;  3AM8 A;  3GSO A;  3TO2 A;  3WL9 A;  3MRM A;  4PV9 A;  1Q94 A;  2XFX A;  3OV6 A;  3MRD A;  3SJV A;  3DX6 A;  3FT3 A;  4LHU A;  3SCM A;  2NYK A;  5FA4 A;  2AK4 A;  3P9M A;  5C0A A;  2BVQ A;  1W0W A;  4QRQ A;  3I6K A;  3ARB A;  3RUG A;  3KPP A;  5HGB A;  3FFC A;  1X7Q A;  1KBG H;  1HHG A;  2PYE A;  4MQ7 A;  2FIK A;  3RWF A;  3T8X A;  3KPO A;  3BO8 A;  3RWG A;  3DXA A;  3KWW A;  3CCH A;  3E2H A;  2JCC A;  3GMP A;  1K5N A;  3PWN A;  5L2K A;  1PQZ A;  2ZSV A;  3TO4 A;  4D0C A;  3MYJ A;  3H9S A;  4U6Y A;  4NQC A;  4PGB A;  4Z77 A;  3BEW A;  4UQ2 A;  1S7S A;  3VXU A;  5EO1 A;  1I4F A;  3MRE A;  3TPU E;  3TBS A;  3ROO A;  1B0G A;  4JQX A;  1LK2 A;  3D2U A;  4PJ5 A;  3OXR A;  4LCY A;  4WO4 A;  3G08 A;  3H9H A;  3VFO A;  1P7Q A;  3KPL A;  4MS8 A;  2IA1 A;  1UXW A;  4PRA A;  2VLR A;  3ARE A;  1HHJ A;  3PAB A;  1TVH A;  3M1B A;  5C9J A;  1CD1 A;  3BWA A;  1R3H A;  4HX1 A;  3QZW A;  4MX7 A;  1TVB A;  3I6G A;  3KLA A;  4LCW A;  1M05 A;  5IND A;  3WLB A;  5EU3 A;  1G7Q A;  1XZ0 A;  2X4N A;  4X6F A;  3GIV A;  1AGF A;  1K8D A;  3VCL A;  3VFM A;  1Z5L A;  1ZS8 A;  3P4M A;  5J1A A;  4CVZ A;  3DTX A;  4WJ5 A;  2XPG A;  3ES6 A;  2GUO A;  1QQD A;  1RK0 A;  3E3Q A;  4CVX A;  2ESV A;  3QUX A;  3LKS A;  3P77 A;  1QVO A;  3MV8 A;  2HN7 A;  3CDG A;  1DUY A;  5HHN A;  2AKR A;  3OX8 A;  4PJE A;  3W39 A;  3HPJ A;  5E9D A;  4HUW A;  3SKO A;  4Z76 A;  3BP4 A;  3WS6 A;  1T20 A;  3ILQ C;  5D2N A;  3PWU A;  1FFN A;  3RTQ A;  4U1J A;  4QRU A;  5IB2 A;  2FO4 A;  3KPN A;  1HHH A;  2YPK A;  4HS3 A;  4PRI A;  4PDC E;  5D7I A;  1QSF A;  3QEQ A;  3QDG A;  3QUK A;  3SDC A;  1FZM A;  3VFR A;  3FQW A;  5SWQ A;  1BD2 A;  1ZHN A;  3QQ3 A;  5J6G A;  3SKM A;  1YN7 A;  1U58 A;  2OL3 H;  4PJ7 A;  4ZFZ A;  3VXP A;  4PJC A;  5MEN A;  5MEO A;  3TFK A;  1S8D A;  4QRP A;  3LN4 A;  4PJ9 A;  1OSZ A;  3HE6 A;  4WUU A;  1FZK A;  4QRR A;  3IT8 D;  3ARD A;  5E8O A;  4L8C A;  3TF7 A;  1AGB A;  2X4R A;  5D9S A;  5SWZ A;  5B39 A;  2E7L E;  3VFT A;  1I7U A;  3CPL A;  3MGO A;  4JFD A;  4PG2 A;  3LKO A;  1LEG A;  4K7F A;  2HJL A;  1KJV A;  3GJF A;  4PRD A;  1S7Q A;  5C08 A;  1A9E A;  3JVG A;  1LDP H;  4MJI A;  4Y16 A;  2ZOL A;  4L4V A;  3V5K A;  5ISZ A;  5BS0 A;  1T0M A;  3MRG A;  3NFN A;  5HHP A;  1LQV A;  2YPL A;  1ZT7 A;  3SDD A;  3VFW A;  3BVN A;  4N0C A;  5HGH A;  4U1L A;  2YEZ A;  5B38 A;  1VAD A;  3GMM A;  3IXA A;  3O3D A;  1G7P A;  4S0U C;  5HHM A;  1VGK A;  2X4S A;  1EEY A;  4QRT A;  3VXN A;  3TBT A;  5IVX A;  2RFX A;  3E6F A;  1KPR A;  4MVB A;  3FTG A;  4U1S A;  3SPV A;  4APQ A;  4V3E B;  1NAN H;  5C09 A;  3VXO A;  4G8G A;  5E8N A;  1ZHB A;  1ZSD A;  3VRJ A;  4X6C A;  3KYN A;  2C7U A;  5F1I A;  2X4Q A;  5INC A;  4L29 A;  3RWD A;  5C0G A;  1ZAG A;  3VWK A;  4WWK C;  1JPF A;  1QSE A;  4G59 C;  3GSU A;  3MRR A;  3P73 A;  2VAB A;  2H6P A;  5HHO A;  2PO6 A;  3JTT A;  5HGA A;  1I1Y A;  1E28 A;  4PGC A;  1QEW A;  3MRB A;  3HCV A;  3RWI A;  4E0R A;  5BXF A;  1XR9 A;  3W0W A;  2Q7Y A;  3PWJ A;  4IRJ A;  3QI9 A;  4G43 A;  4WU7 A;  3UPR A;  3WUW A;  3FON A;  3FQR A;  3FQN A;  4BKW A;  4NO0 A;  1N2R A;  4O2C A;  2P5W A;  2X4T A;  1ZT1 A;  5C0B A;  1OGT A;  3MR9 A;  5SWS A;  5F9J A;  3CH1 A;  3HLA A;  3MRJ A;  4N5E A;  4X6E A;  1ONQ A;  3X13 A;  2NX5 A;  4E5X A;  1FZJ A;  5AD0 A;  3UBX A;  2X4U A;  5EU6 A;  3D39 A;  4K71 B;  4HUV A;  3MRH A;  4JFP A;  3REW A;  1S7U A;  3FQX A;  4G59 A;  3V5H A;  4QOK A;  3FOM A;  3WS3 A;  2NW3 A;  4PJB A;  2F54 A;  1T80 A;  1KTL A;  2H26 A;  3H7B A;  5JHD A;  1FO0 H;  4NO3 A;  3MRI A;  3MRC A;  1S9Y A;  3LKQ A;  4ZUS A;  1CG9 A;  4NT6 A;  4PJF A;  3LKN A;  4ZUW A;  1NAM H;  1WBZ A;  4D0D A;  1A9B A;  3KPS A;  1L8J A;  3BZF A;  4G42 A;  3GMR A;  2DYP A;  4IHO A;  5MER A;  3BEV A;  1HHI A;  1FZO A;  2AV1 A;  3HE7 A;  1NEZ A;  1S9X A;  3PQY A;  3ARF A;  3QUL A;  5MEP A;  4V3D B;  4HUU A;  4N0F A;  1KPU A;  3C8K A;  3TBY A;  2AXF A;  3BGM A;  1W0V A;  5IRO A;  1DE4 A;  1M6O A;  2ZSW A;  1I7T A;  3CVH A;  3VH8 A;  4D0B A;  2MHA A;  4CW1 A;  4NO2 A;  4MJ6 A;  3TIE A;  3VFV A;  3ECB A;  2BNQ A;  3ROL A;  3L9R A;  4N0U A;  4N8V A;  1AGD A;  1T0N A;  1LP9 A;  3PWP A;  1S7R A;  1B0R A;  3O9W A;  1B3J A;  1I1A A;  3DX7 A;  1T7W A;  1XH3 A;  3O3A A;  4MXQ A;  2GJ6 A;  1JGE A;  1OGA A;  1SYV A;  2ZOK A;  3DX8 A;  3GSQ A;  4NQV A;  3VRI A;  1EEZ A;  2P5E A;  3V5D A;  3D3V A;  4Y4F A;  1S7T A;  2V2X A;  1AO7 A;  1ZT4 A;  5IEH A;  3RWJ A;  3BXN A;  4Y2D A;  3QDJ A;  1KJM A;  1T21 A;  4Z78 A;  1S7W A; 
#chains in the Genus database with same CATH homology
 5HGD A;  3RL1 A;  4JFF A;  1INQ A;  3P4O A;  5E00 A;  1T1Z A;  2UWE A;  3L3K A;  4F7C A;  1A6Z A;  1I7R A;  1HHK A;  2CLZ A;  3E6H A;  5H94 A;  3RWC A;  1AKJ A;  5D7L A;  4LCC C;  5EFI A;  3D18 A;  1C16 A;  3MV9 A;  1EXU A;  5D5M A;  1A1M A;  1T22 A;  3OXS A;  5C0C A;  1S9W A;  2FYY A;  4NHU E;  3MRQ A;  1HOC A;  4MNG A;  1MWA H;  1HSA A;  3MA7 A;  3GMO A;  3FOL A;  3I6L D;  2X4P A;  4HV8 A;  5D2L A;  3RZC A;  1FG2 A;  4U1N A;  5ENW A;  4NO5 A;  2VAA A;  4X6D A;  1AGC A;  3C9N A;  1LEK A;  2BSS A;  1AGE A;  2CLR A;  3CC5 A;  3HUJ A;  1E27 A;  2CLV A;  5EU4 A;  1S7V A;  4WDI A;  3VJ6 A;  4I48 A;  5EUO A;  3RWE A;  2A83 A;  2F74 A;  4UQ3 A;  4EUP A;  3TZV C;  5C0J A;  3AU1 A;  2GTZ A;  4EN3 C;  1KPV A;  4PJH A;  3KPM A;  1JGD A;  3LN5 A;  1RJY A;  4PRN A;  1T1Y A;  4F7E A;  1YPZ A;  4ONO A;  3O4L A;  1N3N A;  4JFE A;  4JFQ A;  3T1F A;  3TJH A;  3TN0 A;  5C0D A;  3S6C A;  4L9L C;  3UTT A;  3X14 A;  5J6H A;  5E6I C;  5EO0 A;  3UTQ A;  2WY3 A;  2VE6 A;  4O2F A;  1FFP A;  4PRP A;  5F7D A;  1GZQ A;  3HG1 A;  2AXG A;  3QDM A;  3GSN H;  4PRH A;  3FQT A;  3VFS A;  3P4N A;  3TBW A;  2OI9 A;  4G9F A;  3O3E A;  4IIQ C;  3VXR A;  4WU5 A;  4JRY A;  4L4T A;  4FTV A;  1WBY A;  3MV7 A;  4NNY A;  3L3G A;  1JPG A;  3MRK A;  1QRN A;  2VLJ A;  3TVM A;  3O3B A;  2AV7 A;  4PRE A;  1N59 A;  1MI5 A;  4U6X A;  3FQU A;  1JUF A;  3BW9 A;  3VFN A;  2BNR A;  3PWV A;  5MEQ A;  3GML A;  1XR8 A;  2GTW A;  4F7M A;  3MRN A;  4HKJ A;  4JFO A;  1GZP A;  1A1N A;  3FRU A;  1T1W A;  3GMN A;  1T1X A;  1JF1 A;  4U1I A;  1T7X A;  3ILP A;  3JTC A;  5E8P A;  1BZ9 A;  1QR1 A;  2BVP A;  1HYR C;  5C07 A;  1RJZ A;  2GIT A;  3TID A;  1DUZ A;  1S7X A;  1ZHL A;  1UXS A;  3L3D A;  1G6R H;  3MGT A;  4L8B A;  4G8I A;  5L2J A;  3L3H A;  1I1F A;  5IM7 A;  4G9D A;  1SYS A;  3KXF A;  4NQE A;  4PRB A;  3GMQ A;  3MRL A;  5EU5 A;  3KPR A;  4EI5 A;  5FDW A;  4PJA A;  4PG9 A;  4XXC A;  5GSR A;  1A1O A;  2BST A;  1BII A;  1QLF A;  3MRO A;  2F53 A;  2X70 A;  5D7J C;  4JQV A;  3ARG A;  2HLA A;  4HWZ A;  4L3C A;  3O8X A;  4I4W A;  4PV8 A;  1JE6 A;  1MHE A;  4MJ5 A;  2VLL A;  3UTS A;  1UQS A;  3BUY A;  4IRS A;  3M17 A;  1CE6 A;  4WW2 C;  3PWL A;  2X4O A;  4ZUU A;  4F7T A;  4PJX A;  1IM3 A;  4Y4H A;  3ERY A;  2GAZ A;  3DBX A;  4PP8 C;  1YN6 A;  4PGD A;  1QO3 A;  4PJD A;  3DMM A;  5BJT A;  5IB1 A;  3QQ4 A;  3VXM A;  1N5A A;  1JHT A;  4PJ8 A;  3RGV C;  3BH8 A;  4GKN A;  3VFP A;  4PGE A;  5IB4 A;  1OF2 A;  4LNR A;  2FWO A;  2V2W A;  3QFJ A;  3VXS A;  1LD9 A;  4PR5 A;  4O2E A;  4L3E A;  3RWH A;  5GSV A;  3SDA A;  3SDX A;  3JTS A;  5HYJ A;  3KPQ A;  1KCG C;  3LKR A;  3BZE A;  2J8U A;  3L3J A;  2CII A;  5FA3 A;  3B6S A;  1ED3 A;  5F1N A;  5DDH A;  3LV3 A;  4MNQ A;  1T7Y A;  5BRZ A;  5C0I A;  5IEK A;  4PJI A;  4ELM A;  3D25 A;  4L8S C;  2D31 A;  2CKB H;  4U1K A;  3BHB A;  1DDH A;  4NQD A;  5DEF A;  2FZ3 A;  3X11 A;  1JFM A;  4ZUV A;  5IB3 A;  1HSB A;  4L8D A;  1KJ2 H;  1WBX A;  1P1Z A;  1ZVS A;  1ZHK A;  4PJG A;  5HHQ A;  3VWJ A;  4U1M A;  3TBV A;  3GSX A;  3MRF A;  3QUZ A;  3RL2 A;  3LKP A;  2BSR A;  5IB5 A;  3CZF A;  4NNX A;  4F7P A;  3HAE A;  2HJK A;  1FFO A;  1BQH A;  4GKS A;  1MHC A;  2GT9 A;  2CIK A;  4ZAK A;  3VFU A;  3TA3 A;  4ZUT A;  1YDP A;  3GSR A;  3KYO A;  3BP7 A;  5DEG A;  5FKP A;  5C0F A;  3MRP A;  3FT2 A;  1T7Z A;  3GSV A;  1KJ3 H;  2VLK A;  1IM9 A;  5ACZ A;  4GUP A;  5EOT A;  4NSK A;  1T7V A;  3B3I A;  3QFD A;  3X12 A;  1TMC A;  3P9L A;  1RK1 A;  4QRS A;  3L3I A;  1W72 A;  1VAC A;  4Y4K A;  3BH9 A;  3QUY A;  4JRX A;  1P4L A;  5C0E A;  4NQX A;  3FT4 A;  4FFE X;  2BCK A;  1EFX A;  3GSW A;  3U0P A;  2BVO A;  4HUX A;  4U1H A;  3AM8 A;  3GSO A;  3TO2 A;  3WL9 A;  3MRM A;  4PV9 A;  1Q94 A;  2XFX A;  3OV6 A;  3MRD A;  3SJV A;  3DX6 A;  3FT3 A;  4LHU A;  3SCM A;  5FA4 A;  2AK4 A;  3P9M A;  5C0A A;  2BVQ A;  1W0W A;  4QRQ A;  3I6K A;  3ARB A;  3RUG A;  3KPP A;  5HGB A;  3FFC A;  1X7Q A;  1KBG H;  1HHG A;  2PYE A;  4MQ7 A;  2FIK A;  3RWF A;  3T8X A;  3KPO A;  3BO8 A;  3RWG A;  3DXA A;  3KWW A;  3CCH A;  3E2H A;  2JCC A;  3GMP A;  1K5N A;  3PWN A;  5L2K A;  1PQZ A;  2ZSV A;  3TO4 A;  4D0C A;  3MYJ A;  3H9S A;  4U6Y A;  4NQC A;  4PGB A;  4Z77 A;  3BEW A;  4UQ2 A;  1S7S A;  3VXU A;  5EO1 A;  1I4F A;  3MRE A;  3TPU E;  3TBS A;  3ROO A;  1B0G A;  4JQX A;  1LK2 A;  3D2U A;  4PJ5 A;  3OXR A;  4LCY A;  4WO4 A;  3G08 A;  3H9H A;  3VFO A;  1P7Q A;  3KPL A;  4MS8 A;  1UXW A;  4PRA A;  2VLR A;  3ARE A;  1HHJ A;  3PAB A;  1TVH A;  3M1B A;  5C9J A;  1CD1 A;  3BWA A;  1R3H A;  4HX1 A;  3QZW A;  4MX7 A;  1TVB A;  3I6G A;  3KLA A;  4LCW A;  1M05 A;  5IND A;  3WLB A;  5EU3 A;  1G7Q A;  1XZ0 A;  2X4N A;  4X6F A;  3GIV A;  1AGF A;  1K8D A;  3VCL A;  3VFM A;  1Z5L A;  1ZS8 A;  3P4M A;  5J1A A;  4CVZ A;  3DTX A;  4WJ5 A;  2XPG A;  3ES6 A;  2GUO A;  1QQD A;  1RK0 A;  3E3Q A;  4CVX A;  2ESV A;  3QUX A;  3LKS A;  3P77 A;  1QVO A;  3MV8 A;  2HN7 A;  3CDG A;  1DUY A;  5HHN A;  2AKR A;  3OX8 A;  4PJE A;  3W39 A;  3HPJ A;  5E9D A;  4HUW A;  3SKO A;  4Z76 A;  3BP4 A;  3WS6 A;  1T20 A;  3ILQ C;  5D2N A;  3PWU A;  1FFN A;  3RTQ A;  4U1J A;  4QRU A;  5IB2 A;  2FO4 A;  3KPN A;  1HHH A;  2YPK A;  4HS3 A;  4PRI A;  4PDC E;  5D7I A;  1QSF A;  3QEQ A;  3QDG A;  3QUK A;  3SDC A;  1FZM A;  3VFR A;  3FQW A;  5SWQ A;  1BD2 A;  1ZHN A;  3QQ3 A;  5J6G A;  3SKM A;  1YN7 A;  1U58 A;  2OL3 H;  4PJ7 A;  4ZFZ A;  3VXP A;  4PJC A;  5MEN A;  5MEO A;  3TFK A;  1S8D A;  4QRP A;  3LN4 A;  4PJ9 A;  1OSZ A;  3HE6 A;  4WUU A;  1FZK A;  4QRR A;  3IT8 D;  3ARD A;  5E8O A;  4L8C A;  3TF7 A;  1AGB A;  2X4R A;  5D9S A;  5SWZ A;  5B39 A;  2E7L E;  3VFT A;  1I7U A;  3CPL A;  3MGO A;  4JFD A;  4PG2 A;  3LKO A;  1LEG A;  4K7F A;  2HJL A;  1KJV A;  3GJF A;  4PRD A;  1S7Q A;  5C08 A;  1A9E A;  3JVG A;  1LDP H;  4MJI A;  4Y16 A;  2ZOL A;  4L4V A;  3V5K A;  5ISZ A;  5BS0 A;  1T0M A;  3MRG A;  3NFN A;  5HHP A;  1LQV A;  2YPL A;  1ZT7 A;  3SDD A;  3VFW A;  3BVN A;  4N0C A;  5HGH A;  4U1L A;  2YEZ A;  5B38 A;  1VAD A;  3GMM A;  3IXA A;  3O3D A;  1G7P A;  4S0U C;  5HHM A;  1VGK A;  2X4S A;  1EEY A;  4QRT A;  3VXN A;  3TBT A;  5IVX A;  2RFX A;  3E6F A;  1KPR A;  4MVB A;  3FTG A;  4U1S A;  3SPV A;  4APQ A;  4V3E B;  1NAN H;  5C09 A;  3VXO A;  4G8G A;  5E8N A;  1ZHB A;  1ZSD A;  3VRJ A;  4X6C A;  3KYN A;  2C7U A;  5F1I A;  2X4Q A;  5INC A;  4L29 A;  3RWD A;  5C0G A;  1ZAG A;  3VWK A;  4WWK C;  1JPF A;  1QSE A;  3GSU A;  3MRR A;  3P73 A;  2VAB A;  2H6P A;  5HHO A;  2PO6 A;  3JTT A;  5HGA A;  1I1Y A;  1E28 A;  4PGC A;  1QEW A;  3MRB A;  3HCV A;  3RWI A;  4E0R A;  5BXF A;  1XR9 A;  3W0W A;  2Q7Y A;  3PWJ A;  4IRJ A;  3QI9 A;  4G43 A;  4WU7 A;  3UPR A;  3WUW A;  3FON A;  3FQR A;  3FQN A;  4NO0 A;  1N2R A;  4O2C A;  2P5W A;  2X4T A;  1ZT1 A;  5C0B A;  1OGT A;  3MR9 A;  5SWS A;  5F9J A;  3CH1 A;  3HLA A;  3MRJ A;  4N5E A;  4X6E A;  1ONQ A;  3X13 A;  2NX5 A;  4E5X A;  1FZJ A;  5AD0 A;  3UBX A;  2X4U A;  5EU6 A;  3D39 A;  4K71 B;  4HUV A;  3MRH A;  4JFP A;  3REW A;  1S7U A;  3FQX A;  4G59 A;  3V5H A;  4QOK A;  3FOM A;  3WS3 A;  2NW3 A;  4PJB A;  2F54 A;  1T80 A;  1KTL A;  2H26 A;  3H7B A;  5JHD A;  1FO0 H;  4NO3 A;  3MRI A;  3MRC A;  1S9Y A;  3LKQ A;  4ZUS A;  1CG9 A;  4NT6 A;  4PJF A;  3LKN A;  4ZUW A;  1NAM H;  1WBZ A;  4D0D A;  1A9B A;  3KPS A;  1L8J A;  3BZF A;  4G42 A;  3GMR A;  2DYP A;  4IHO A;  5MER A;  3BEV A;  1HHI A;  1FZO A;  2AV1 A;  3HE7 A;  1NEZ A;  1S9X A;  3PQY A;  3ARF A;  3QUL A;  5MEP A;  4V3D B;  4HUU A;  4N0F A;  1KPU A;  3C8K A;  3TBY A;  2AXF A;  3BGM A;  1W0V A;  5IRO A;  1DE4 A;  1M6O A;  2ZSW A;  1I7T A;  3CVH A;  3VH8 A;  4D0B A;  2MHA A;  4CW1 A;  4NO2 A;  4MJ6 A;  3TIE A;  3VFV A;  3ECB A;  2BNQ A;  3ROL A;  3L9R A;  4N0U A;  4N8V A;  1AGD A;  1T0N A;  1LP9 A;  3PWP A;  1S7R A;  1B0R A;  3O9W A;  1B3J A;  1I1A A;  3DX7 A;  1T7W A;  1XH3 A;  3O3A A;  4MXQ A;  2GJ6 A;  1JGE A;  1OGA A;  1SYV A;  2ZOK A;  3DX8 A;  3GSQ A;  4NQV A;  3VRI A;  1EEZ A;  2P5E A;  3V5D A;  3D3V A;  4Y4F A;  1S7T A;  2V2X A;  1AO7 A;  1ZT4 A;  5IEH A;  3RWJ A;  3BXN A;  4Y2D A;  3QDJ A;  1KJM A;  1T21 A;  4Z78 A;  1S7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...