4PP8C

Crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
168
structure length
146
Chain Sequence
HSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINATEVKKCLTQPLKNLCQKLRNKVSNTYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords NKG2-D type II integral membrane protein
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed rcsb
source organism Mus musculus
total genus 42
structure length 146
sequence length 168
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pp8C00
1KPVA 3RWIA 3AM8A 3QFDA 5BJTA 4EUPA 5F7DA 4ZUUA 1DUYA 2HJKA 2GUOA 3PWLA 1JPFA 4U1SA 4Y16A 4WO4A 5HHNA 3GMPA 4ZUSA 2VE6A 1A6ZA 5MEPA 1CD1A 3NFNA 1KPUA 3JVGA 3MGTA 3W0WA 1XR8A 5GSRA 5J6GA 1W72A 3ARDA 3VXSA 3ARGA 4UQ2A 3PQYA 4LHUA 5EUOA 3DBXA 3QDJA 1FFPA 3VRIA 2V2WA 3VFMA 3TIEA 3GSQA 2HLAA 1RJYA 4N5EA 3CCHA 3VFNA 4E5XA 2F54A 2X4TA 4HUWA 2BSTA 1HHKA 1NANH 2HN7A 1TVBA 4GKSA 4WW2C 3BH9A 1KCGC 2CLRA 3ARFA 3O4LA 3H9SA 4L8CA 1B3JA 1ED3A 1B0RA 3BZEA 3L3IA 4JFQA 4U1MA 4X6CA 1XH3A 1BIIA 1LK2A 3MRQA 5C0GA 1T1YA 3P4OA 4Z78A 3IT8D 2NW3A 4F7PA 3M17A 2X4UA 4JRYA 2AV1A 5C0BA 1FFOA 1QLFA 4JFOA 5FA4A 3L3JA 2Q7YA 3QUYA 4G8IA 4PJ7A 3FQRA 4E0RA 3ES6A 4NNXA 1QSFA 2J8UA 4G9FA 1AGFA 1ZS8A 4X6EA 3TBVA 4L3EA 4ZUTA 3FQWA 4WU5A 1BQHA 4N0CA 4PG9A 1P7QA 3UTTA 5MERA 1T80A 1ZT1A 5C08A 3X12A 1ZT4A 1X7QA 4U1KA 5DEGA 3FQXA 3TBYA 3MRLA 3GSOA 4CVXA 2BNRA 3D3VA 5IB2A 1VACA 4G59A 5EU5A 4F7MA 1S7VA 4PJ8A 2YPLA 3VWKA 4MJ6A 3WS6A 3G08A 4HKJA 3QZWA 2H6PA 3VCLA 3SKOA 5FDWA 3QULA 3HUJA 3O9WA 1UXWA 2CKBH 1BZ9A 1W0WA 2AKRA 2OI9A 4PV8A 1G7QA 1B0GA 3TJHA 1OGAA 3I6LD 1T1WA 4JFDA 2VLLA 4O2FA 1ZAGA 4HV8A 3VJ6A 4U1IA 1UQSA 1ONQA 4L4TA 4K71B 3D25A 1KJ3H 4QRUA 3CVHA 1A1MA 3BGMA 1WBYA 4QRTA 4Y2DA 4NQDA 4X6DA 3BHBA 1S7RA 1DDHA 3MV7A 5E9DA 5F1IA 3VFVA 3E6HA 5J1AA 1P4LA 2GAZA 3PWNA 3W39A 2YEZA 3FQUA 1W0VA 2CIIA 4HWZA 1S9YA 4PJGA 4PDCE 4UQ3A 1YN7A 3TO4A 1K8DA 2BVQA 5HGAA 5AD0A 3FONA 3T1FA 3GSUA 1FZMA 4WDIA 3ECBA 1S7TA 3VFPA 4L4VA 4PJCA 1VGKA 1C16A 5C0CA 4ZAKA 3UTQA 1JPGA 4PJ5A 3BEVA 3DX8A 3WL9A 1N2RA 5C07A 1FG2A 1GZQA 1T7WA 4ONOA 3SKMA 3RZCA 3QEQA 1T1ZA 3DX7A 1INQA 1ZHBA 3PWUA 4N0UA 4Y4HA 1AGBA 3FT4A 3MR9A 5FA3A 2VABA 4L3CA 4QRQA 3MGOA 3MRNA 1JFMA 1N59A 1HHHA 3GMOA 5D7LA 1LD9A 5E6IC 3TBSA 5B39A 3KPSA 4PG2A 1KPRA 1JHTA 2ZSVA 1R3HA 5EU3A 4IRSA 2FWOA 3UBXA 4PJIA 4QOKA 1HHIA 3AREA 1SYVA 4PJFA 1G7PA 2V2XA 5JHDA 3VXMA 3BO8A 4MNGA 3L3GA 3H7BA 1A9BA 5D2NA 2HJLA 5ISZA 5C0AA 3MYJA 3GMLA 3P4NA 1I1YA 2FZ3A 2P5WA 4PJBA 4IRJA 3TN0A 4PJDA 1S7SA 1TMCA 4F7CA 3MRBA 1TVHA 3I6KA 3TVMA 3RWFA 1WBZA 4PGBA 5C0DA 1T20A 3KYOA 1A9EA 1VADA 3RWJA 1CE6A 2PO6A 4GUPA 3TBWA 3VXOA 2VLKA 4LCYA 3KPNA 4IIQC 3VXRA 1FZKA 4U1JA 3X11A 3QUKA 4JRXA 2FYYA 3B6SA 2OL3H 4FTVA 4O2EA 4G8GA 4NSKA 1QRNA 4G43A 5L2KA 2CIKA 2FO4A 4X6FA 3MROA 1EEZA 1HYRC 1QO3A 1S9WA 3LKPA 1LP9A 1XR9A 2JCCA 1ZHNA 1AO7A 2YPKA 2BSRA 4HX1A 1EEYA 2F74A 4HUUA 3PWJA 1K5NA 5C0IA 3P9MA 3HE7A 3PWPA 1HSBA 3O3EA 3PWVA 3TBTA 3BH8A 1NAMH 1BD2A 3RWCA 3GSVA 3KPQA 4D0CA 3KPRA 4LCCC 4L8SC 5MEQA 3CH1A 3KYNA 1XZ0A 2ZOLA 3CDGA 4PJ9A 3BWAA 2DYPA 1LEGA 4IHOA 3FRUA 3MRHA 3GMMA 3X14A 4U1NA 3VFSA 4NNYA 2D31A 3MRJA 4HS3A 2BCKA 3VXUA 4WWKC 4D0DA 5ACZA 1T22A 5D7JC 3SDAA 3V5KA 3VH8A 3KLAA 5EU6A 3LKRA 2X4RA 4N0FA 1ZT7A 3KPPA 3MREA 3KXFA 4PP8C 5FKPA 3SDDA 3BXNA 3OXSA 1T7XA 3CC5A 5C0EA 1YPZA 1QEWA 3MRKA 4MVBA 3L9RA 4NO0A 3ERYA 4F7EA 1EFXA 3QUXA 3TPUE 5C0FA 2E7LE 4U6XA 1YN6A 3BZFA 1JGDA 1ZHKA 2CLZA 1UXSA 4QRPA 2H26A 5IM7A 1I4FA 3P4MA 1U58A 2X70A 5J6HA 3E3QA 1KJVA 1IM9A 4NQEA 4ZUWA 4EI5A 1KBGH 3QQ4A 1T7YA 3GSXA 3WS3A 4GKNA 1E27A 4WJ5A 4PGDA 3MRMA 3LKOA 1ZSDA 4QRRA 1FZJA 1LQVA 1FO0H 4Z77A 5SWQA 4MX7A 4WUUA 2GJ6A 1T7VA 1S9XA 4ZUVA 4PRBA 3LKNA 1JE6A 2BSSA 2WY3A 1S7XA 5SWZA 3P77A 2GT9A 5C0JA 4EN3C 4U6YA 1I7TA 4JQXA 3DXAA 4LCWA 1RJZA 1LEKA 5C09A 3SDCA 3RWEA 3LN4A 4PRDA 4V3DB 4MNQA 5IB4A 3BP7A 5IVXA 3VFWA 3FFCA 1S7WA 4PJEA 4PV9A 4S0UC 3BW9A 4PR5A 3HLAA 4PREA 3LV3A 3VXPA 2UWEA 3KPOA 3MRGA 4APQA 3SCMA 4ZFZA 3RGVC 1I1FA 1JF1A 1OSZA 2ZSWA 2A83A 4I4WA 4XXCA 5IEHA 3QQ3A 1I7RA 3LKQA 3O3BA 5ENWA 3RWDA 4QRSA 3REWA 1RK1A 1KJ2H 1ZVSA 3E6FA 4PRPA 5MENA 3FQTA 1P1ZA 3KPMA 1I1AA 3DMMA 2ESVA 4NQCA 2X4NA 3QFJA 5H94A 3VWJA 1Q94A 5D2LA 1Z5LA 3JTCA 1OGTA 3O8XA 3WUWA 5E00A 1LDPH 3CZFA 3FOMA 1MWAH 4I48A 3SJVA 1GZPA 4JFEA 5E8NA 3GMRA 4MQ7A 1CG9A 3VFTA 3L3KA 3KWWA 5BRZA 3OX8A 4Y4KA 5IB3A 1A1NA 3TZVC 1S8DA 4MJ5A 3UTSA 3DX6A 5BXFA 4PGEA 5D5MA 3MV9A 3JTSA 3P73A 5D7IA 3T8XA 1OF2A 3LN5A 1AGEA 4JQVA 3TF7A 3BEWA 1M05A 3U0PA 4PJXA 2VLJA 4MJIA 3WLBA 2X4OA 4LNRA 1JGEA 5IB1A 3VRJA 1IM3A 1RK0A 3MRDA 3MRPA 3RWHA 2X4SA 1L8JA 4JFFA 5EFIA 3H9HA 4NHUE 3MRRA 4MXQA 4NT6A 1T7ZA 1ZHLA 1T21A 1WBXA 2XFXA 3ILPA 2VAAA 2P5EA 3GSNH 3MA7A 2BNQA 3TIDA 5INDA 3ILQC 3VXNA 4HUVA 2GTWA 4G9DA 5DDHA 5EOTA 3RL2A 3RTQA 3FTGA 5IEKA 5SWSA 4NO5A 4NO3A 1PQZA 4L8DA 2AXFA 3MRCA 3V5HA 1S7UA 1QVOA 1SYSA 4HUXA 1MI5A 4V3EB 3M1BA 4PRNA 2AK4A 2X4PA 1S7QA 5HYJA 1FZOA 2CLVA 5INCA 5HHOA 4FFEX 5IROA 4CW1A 3VFOA 3O3AA 1QQDA 2MHAA 1MHCA 4NO2A 5E8PA 3SPVA 3TO2A 1I7UA 3HPJA 3ROLA 1T1XA 4WU7A 3FT3A 4Z76A 3I6GA 3MRIA 2FIKA 3QI9A 1MHEA 3PABA 2AV7A 2BVPA 3GJFA 3UPRA 4Y4FA 4O2CA 1KTLA 1T0MA 2NX5A 3GMNA 5C9JA 4JFPA 2X4QA 2GTZA 3KPLA 4MS8A 4PGCA 4L9LC 4PRHA 5EO1A 3LKSA 5B38A 2GITA 1AKJA 4L8BA 4PRIA 3GMQA 3BUYA 1AGCA 3GSWA 3X13A 4K7FA 3D39A 4PJAA 1M6OA 3SDXA 3FQNA 2VLRA 5HHQA 5HGBA 3BP4A 1YDPA 2ZOKA 3GIVA 5E8OA 4CVZA 3IXAA 3RWGA 2AXGA 3L3HA 4PJHA 1QR1A 5HGDA 5F9JA 3QUZA 3P9LA 4U1HA 1EXUA 1HHJA 3D2UA 3HE6A 5HGHA 1DE4A 3RUGA 5MEOA 3MV8A 3CPLA 3E2HA 3L3DA 1N5AA 4NQVA 1N3NA 3B3IA 4PRAA 5IB5A 3TFKA 2F53A 3HCVA 5EO0A 4ELMA 3QDMA 3V5DA 3VFUA 3O3DA 4N8VA 3FOLA 3C9NA 5EU4A 5F1NA 1A1OA 3D18A 1HHGA 3OV6A 3DTXA 1AGDA 1HOCA 2XPGA 3HAEA 5L2JA 5HHMA 3OXRA 4NQXA 1QSEA 3MRFA 1FFNA 3GSRA 3HG1A 3RL1A 3AU1A 3S6CA 4F7TA 1DUZA 1E28A 3ROOA 1NEZA 4U1LA 3QDGA 5GSVA 2C7UA 3TA3A 1KJMA 4G42A 3C8KA 4L29A 1T0NA 5HHPA 1JUFA 1G6RH 2RFXA 3JTTA 5D9SA 5DEFA 3VFRA 3FT2A 4D0BA 5BS0A 2BVOA 3BVNA 1HSAA 3ARBA 2PYEA
chains in the Genus database with same CATH superfamily
1KPVA 3RWIA 3AM8A 3QFDA 5BJTA 4EUPA 5F7DA 4ZUUA 1DUYA 2HJKA 2GUOA 3PWLA 1JPFA 4U1SA 4Y16A 4WO4A 5HHNA 3GMPA 4ZUSA 2VE6A 1A6ZA 5MEPA 1CD1A 3NFNA 1KPUA 3JVGA 3MGTA 3W0WA 1XR8A 5GSRA 5J6GA 1W72A 3ARDA 3VXSA 3ARGA 4UQ2A 3PQYA 4LHUA 5EUOA 3DBXA 2IA1A 1FFPA 3QDJA 2V2WA 3VRIA 3VFMA 3TIEA 3GSQA 2HLAA 1RJYA 4N5EA 3CCHA 3VFNA 4E5XA 2F54A 2X4TA 4HUWA 2BSTA 1HHKA 1NANH 2HN7A 1TVBA 4GKSA 4WW2C 3BH9A 1KCGC 2CLRA 3ARFA 3O4LA 3H9SA 4L8CA 1B3JA 1ED3A 1B0RA 3BZEA 3L3IA 4JFQA 4U1MA 4X6CA 1XH3A 1BIIA 1LK2A 3MRQA 5C0GA 1T1YA 3P4OA 4Z78A 3IT8D 2NW3A 4F7PA 3M17A 2X4UA 4JRYA 2AV1A 5C0BA 1FFOA 1QLFA 4JFOA 5FA4A 3L3JA 2Q7YA 3QUYA 4G8IA 4PJ7A 3FQRA 4E0RA 3ES6A 4NNXA 1QSFA 2J8UA 4G9FA 1AGFA 1ZS8A 4X6EA 3TBVA 4L3EA 4ZUTA 3FQWA 4WU5A 1BQHA 4N0CA 4PG9A 1P7QA 3UTTA 5MERA 1T80A 1ZT1A 5C08A 3X12A 1ZT4A 1X7QA 4U1KA 5DEGA 3FQXA 3TBYA 3MRLA 3GSOA 4CVXA 2BNRA 3D3VA 5IB2A 1VACA 4G59A 5EU5A 4F7MA 1S7VA 4PJ8A 2YPLA 3VWKA 4MJ6A 3WS6A 3G08A 4HKJA 3QZWA 2H6PA 3VCLA 3SKOA 5FDWA 3QULA 3HUJA 3O9WA 1UXWA 2CKBH 1BZ9A 1W0WA 2AKRA 2OI9A 4PV8A 1G7QA 1B0GA 3TJHA 1OGAA 3I6LD 1T1WA 4JFDA 2VLLA 4O2FA 1ZAGA 4HV8A 3VJ6A 4U1IA 1UQSA 1ONQA 4L4TA 4K71B 3D25A 1KJ3H 4QRUA 3CVHA 1A1MA 3BGMA 1WBYA 4QRTA 4Y2DA 4NQDA 4X6DA 3BHBA 1S7RA 1DDHA 3MV7A 5E9DA 5F1IA 3VFVA 3E6HA 5J1AA 1P4LA 2GAZA 3PWNA 3W39A 2YEZA 3FQUA 1W0VA 2CIIA 4HWZA 1S9YA 4PJGA 4PDCE 4UQ3A 1YN7A 3TO4A 1K8DA 2BVQA 5HGAA 5AD0A 3FONA 3T1FA 3GSUA 1FZMA 4WDIA 3ECBA 1S7TA 3VFPA 4L4VA 4PJCA 1VGKA 1C16A 5C0CA 4ZAKA 3UTQA 1JPGA 4PJ5A 3BEVA 3DX8A 3WL9A 1N2RA 5C07A 1FG2A 1GZQA 1T7WA 4ONOA 3SKMA 3RZCA 3QEQA 1T1ZA 3DX7A 1INQA 1ZHBA 3PWUA 4N0UA 4Y4HA 1AGBA 3FT4A 3MR9A 5FA3A 2VABA 4L3CA 4QRQA 3MGOA 3MRNA 1JFMA 1N59A 1HHHA 3GMOA 5D7LA 1LD9A 5E6IC 3TBSA 5B39A 3KPSA 4PG2A 1KPRA 1JHTA 2ZSVA 1R3HA 5EU3A 4IRSA 2FWOA 3UBXA 4PJIA 4QOKA 1HHIA 3AREA 1SYVA 4PJFA 1G7PA 2V2XA 5JHDA 3VXMA 3BO8A 4MNGA 3L3GA 3H7BA 1A9BA 5D2NA 2HJLA 5ISZA 2NYKA 5C0AA 3MYJA 3GMLA 3P4NA 1I1YA 2FZ3A 2P5WA 4PJBA 4IRJA 3TN0A 4PJDA 1S7SA 1TMCA 4F7CA 3MRBA 1TVHA 3I6KA 3TVMA 3RWFA 1WBZA 4PGBA 5C0DA 1T20A 3KYOA 1A9EA 1VADA 3RWJA 1CE6A 2PO6A 4GUPA 3TBWA 3VXOA 2VLKA 4LCYA 3KPNA 4IIQC 3VXRA 1FZKA 4U1JA 3X11A 3QUKA 4JRXA 2FYYA 3B6SA 2OL3H 4FTVA 4O2EA 4G8GA 4NSKA 1QRNA 4G43A 5L2KA 2CIKA 2FO4A 4X6FA 3MROA 1EEZA 1HYRC 1QO3A 1S9WA 3LKPA 1LP9A 1XR9A 2JCCA 1ZHNA 1AO7A 2YPKA 2BSRA 4HX1A 1EEYA 2F74A 4HUUA 3PWJA 1K5NA 5C0IA 3P9MA 3HE7A 3PWPA 1HSBA 3O3EA 3PWVA 3TBTA 3BH8A 1NAMH 1BD2A 3RWCA 3GSVA 3KPQA 4D0CA 3KPRA 4LCCC 4L8SC 5MEQA 3CH1A 3KYNA 1XZ0A 2ZOLA 3CDGA 4PJ9A 3BWAA 2DYPA 1LEGA 4IHOA 3FRUA 3MRHA 3GMMA 3X14A 4U1NA 3VFSA 4NNYA 2D31A 3MRJA 4HS3A 2BCKA 3VXUA 4WWKC 4D0DA 5ACZA 1T22A 5D7JC 3SDAA 3V5KA 3VH8A 3KLAA 5EU6A 3LKRA 2X4RA 4N0FA 1ZT7A 3KPPA 3MREA 3KXFA 4PP8C 5FKPA 3SDDA 3BXNA 3OXSA 1T7XA 3CC5A 5C0EA 1YPZA 1QEWA 3MRKA 4MVBA 3L9RA 4NO0A 3ERYA 4F7EA 1EFXA 3QUXA 3TPUE 5C0FA 2E7LE 4U6XA 1YN6A 3BZFA 1JGDA 1ZHKA 2CLZA 1UXSA 4QRPA 2H26A 5IM7A 1I4FA 3P4MA 1U58A 2X70A 5J6HA 3E3QA 1KJVA 1IM9A 4NQEA 4ZUWA 4EI5A 1KBGH 3QQ4A 1T7YA 3GSXA 3WS3A 4GKNA 1E27A 4WJ5A 4PGDA 3MRMA 3LKOA 1ZSDA 4QRRA 1FZJA 1LQVA 1FO0H 4Z77A 5SWQA 4MX7A 4WUUA 2GJ6A 1T7VA 1S9XA 4ZUVA 4PRBA 3LKNA 1JE6A 2BSSA 2WY3A 1S7XA 5SWZA 3P77A 2GT9A 5C0JA 4EN3C 4U6YA 1I7TA 4JQXA 3DXAA 2O5NA 4LCWA 1RJZA 1LEKA 5C09A 3SDCA 3RWEA 3LN4A 4PRDA 4V3DB 4MNQA 5IB4A 3BP7A 5IVXA 3VFWA 3FFCA 1S7WA 4PJEA 4PV9A 4S0UC 3BW9A 4PR5A 3HLAA 4PREA 3LV3A 3VXPA 2UWEA 3KPOA 3MRGA 4APQA 3SCMA 4ZFZA 3RGVC 1I1FA 1JF1A 1OSZA 2ZSWA 2A83A 4I4WA 4XXCA 5IEHA 3QQ3A 1I7RA 3LKQA 3O3BA 5ENWA 3RWDA 4QRSA 3REWA 1RK1A 1KJ2H 1ZVSA 3E6FA 4PRPA 5MENA 3FQTA 1P1ZA 3KPMA 1I1AA 3DMMA 2ESVA 4NQCA 2X4NA 3QFJA 5H94A 3VWJA 1Q94A 5D2LA 1Z5LA 3JTCA 1OGTA 3O8XA 3WUWA 5E00A 1LDPH 3CZFA 3FOMA 1MWAH 4I48A 3SJVA 1GZPA 4JFEA 5E8NA 3GMRA 4MQ7A 1CG9A 3VFTA 3L3KA 3KWWA 5BRZA 3OX8A 4Y4KA 5IB3A 1A1NA 3TZVC 1S8DA 4MJ5A 3UTSA 3DX6A 5BXFA 4PGEA 5D5MA 3MV9A 3JTSA 3P73A 5D7IA 3T8XA 1OF2A 3LN5A 1AGEA 4JQVA 3TF7A 3BEWA 1M05A 3U0PA 4PJXA 2VLJA 4MJIA 3WLBA 2X4OA 4LNRA 1JGEA 5IB1A 3VRJA 1IM3A 1RK0A 3MRDA 3MRPA 3RWHA 2X4SA 1L8JA 4JFFA 5EFIA 3H9HA 4NHUE 3MRRA 4MXQA 4NT6A 1T7ZA 1ZHLA 1T21A 1WBXA 2XFXA 3ILPA 2VAAA 2P5EA 3GSNH 3MA7A 2BNQA 3TIDA 5INDA 3ILQC 3VXNA 4HUVA 2GTWA 4G9DA 5DDHA 5EOTA 3RL2A 3RTQA 3FTGA 5IEKA 5SWSA 4NO5A 4NO3A 1PQZA 4L8DA 2AXFA 3MRCA 3V5HA 1S7UA 1QVOA 1SYSA 4HUXA 1MI5A 4V3EB 3M1BA 4PRNA 2AK4A 2X4PA 1S7QA 5HYJA 1FZOA 2CLVA 5INCA 5HHOA 4FFEX 5IROA 4CW1A 3VFOA 3O3AA 1QQDA 2MHAA 1MHCA 4NO2A 5E8PA 3SPVA 3TO2A 1I7UA 3HPJA 3ROLA 1T1XA 4WU7A 3FT3A 4Z76A 3I6GA 3MRIA 2FIKA 3QI9A 1MHEA 3PABA 2AV7A 2BVPA 3GJFA 3UPRA 4Y4FA 4O2CA 1KTLA 1T0MA 2NX5A 3GMNA 5C9JA 4G59C 4JFPA 2X4QA 2GTZA 3KPLA 4MS8A 4PGCA 4L9LC 4PRHA 5EO1A 3LKSA 5B38A 2GITA 1AKJA 4L8BA 4PRIA 3GMQA 3BUYA 1AGCA 4BKWA 3GSWA 3X13A 4K7FA 3D39A 4PJAA 1M6OA 3SDXA 3FQNA 2VLRA 5HHQA 5HGBA 3BP4A 1YDPA 2ZOKA 3GIVA 5E8OA 4CVZA 3IXAA 3RWGA 2AXGA 3L3HA 4PJHA 1QR1A 5HGDA 5F9JA 3QUZA 3P9LA 4JO8A 4U1HA 1EXUA 1HHJA 3D2UA 3HE6A 5HGHA 1DE4A 3RUGA 5MEOA 3MV8A 3CPLA 3E2HA 3L3DA 1N5AA 4NQVA 1N3NA 3B3IA 4PRAA 5IB5A 3TFKA 2F53A 3HCVA 5EO0A 4ELMA 3QDMA 3V5DA 3VFUA 3O3DA 4N8VA 3FOLA 3C9NA 5EU4A 5F1NA 1A1OA 3D18A 1HHGA 3OV6A 3DTXA 1AGDA 1HOCA 2XPGA 3HAEA 5L2JA 3I0TA 5HHMA 3OXRA 4NQXA 1QSEA 3MRFA 1FFNA 3GSRA 3HG1A 3RL1A 3AU1A 3S6CA 4F7TA 1DUZA 1E28A 3ROOA 1NEZA 4U1LA 3QDGA 5GSVA 2C7UA 3TA3A 1KJMA 4G42A 3C8KA 4L29A 1T0NA 5HHPA 1JUFA 1G6RH 2RFXA 3JTTA 5D9SA 5DEFA 3VFRA 3FT2A 4D0BA 5BS0A 2BVOA 3BVNA 1HSAA 3ARBA 2PYEA
chains in the Genus database with same CATH topology
1KPVA 3RWIA 3AM8A 3QFDA 5BJTA 4EUPA 5F7DA 4ZUUA 1DUYA 2HJKA 2GUOA 3PWLA 1JPFA 4U1SA 4Y16A 4WO4A 5HHNA 3GMPA 4ZUSA 2VE6A 1A6ZA 5MEPA 1CD1A 3NFNA 1KPUA 3JVGA 3MGTA 3W0WA 1XR8A 5GSRA 5J6GA 1W72A 3ARDA 3VXSA 3ARGA 4UQ2A 3PQYA 4LHUA 5EUOA 3DBXA 3QDJA 1FFPA 3VRIA 2V2WA 3VFMA 3TIEA 3GSQA 2HLAA 1RJYA 4N5EA 3CCHA 3VFNA 4E5XA 2F54A 2X4TA 4HUWA 2BSTA 1HHKA 1NANH 2HN7A 1TVBA 4GKSA 4WW2C 3BH9A 1KCGC 2CLRA 3ARFA 3O4LA 3H9SA 4L8CA 1B3JA 1ED3A 1B0RA 3BZEA 3L3IA 4JFQA 4U1MA 4X6CA 1XH3A 1BIIA 1LK2A 3MRQA 5C0GA 1T1YA 3P4OA 4Z78A 3IT8D 2NW3A 4F7PA 3M17A 2X4UA 4JRYA 2AV1A 5C0BA 1FFOA 1QLFA 4JFOA 5FA4A 3L3JA 2Q7YA 3QUYA 4G8IA 4PJ7A 3FQRA 4E0RA 3ES6A 4NNXA 1QSFA 2J8UA 4G9FA 1AGFA 1ZS8A 4X6EA 3TBVA 4L3EA 4ZUTA 3FQWA 4WU5A 1BQHA 4N0CA 4PG9A 1P7QA 3UTTA 5MERA 1T80A 1ZT1A 5C08A 3X12A 1ZT4A 1X7QA 4U1KA 5DEGA 3FQXA 3TBYA 3MRLA 3GSOA 4CVXA 2BNRA 3D3VA 5IB2A 1VACA 4G59A 5EU5A 4F7MA 1S7VA 4PJ8A 2YPLA 3VWKA 4MJ6A 3WS6A 3G08A 4HKJA 3QZWA 2H6PA 3VCLA 3SKOA 5FDWA 3QULA 3HUJA 3O9WA 1UXWA 2CKBH 1BZ9A 1W0WA 2AKRA 2OI9A 4PV8A 1G7QA 1B0GA 3TJHA 1OGAA 3I6LD 1T1WA 4JFDA 2VLLA 4O2FA 1ZAGA 4HV8A 3VJ6A 4U1IA 1UQSA 1ONQA 4L4TA 4K71B 3D25A 1KJ3H 4QRUA 3CVHA 1A1MA 3BGMA 1WBYA 4QRTA 4Y2DA 4NQDA 4X6DA 3BHBA 1S7RA 1DDHA 3MV7A 5E9DA 5F1IA 3VFVA 3E6HA 5J1AA 1P4LA 2GAZA 3PWNA 3W39A 2YEZA 3FQUA 1W0VA 2CIIA 4HWZA 1S9YA 4PJGA 4PDCE 4UQ3A 1YN7A 3TO4A 1K8DA 2BVQA 5HGAA 5AD0A 3FONA 3T1FA 3GSUA 1FZMA 4WDIA 3ECBA 1S7TA 3VFPA 4L4VA 4PJCA 1VGKA 1C16A 5C0CA 4ZAKA 3UTQA 1JPGA 4PJ5A 3BEVA 3DX8A 3WL9A 1N2RA 5C07A 1FG2A 1GZQA 1T7WA 4ONOA 3SKMA 3RZCA 3QEQA 1T1ZA 3DX7A 1INQA 1ZHBA 3PWUA 4N0UA 4Y4HA 1AGBA 3FT4A 3MR9A 5FA3A 2VABA 4L3CA 4QRQA 3MGOA 3MRNA 1JFMA 1N59A 1HHHA 3GMOA 5D7LA 1LD9A 5E6IC 3TBSA 5B39A 3KPSA 4PG2A 1KPRA 1JHTA 2ZSVA 1R3HA 5EU3A 4IRSA 2FWOA 3UBXA 4PJIA 4QOKA 1HHIA 3AREA 1SYVA 4PJFA 1G7PA 2V2XA 5JHDA 3VXMA 3BO8A 4MNGA 3L3GA 3H7BA 1A9BA 5D2NA 2HJLA 5ISZA 5C0AA 3MYJA 3GMLA 3P4NA 1I1YA 2FZ3A 2P5WA 4PJBA 4IRJA 3TN0A 4PJDA 1S7SA 1TMCA 4F7CA 3MRBA 1TVHA 3I6KA 3TVMA 3RWFA 1WBZA 4PGBA 5C0DA 1T20A 3KYOA 1A9EA 1VADA 3RWJA 1CE6A 2PO6A 4GUPA 3TBWA 3VXOA 2VLKA 4LCYA 3KPNA 4IIQC 3VXRA 1FZKA 4U1JA 3X11A 3QUKA 4JRXA 2FYYA 3B6SA 2OL3H 4FTVA 4O2EA 4G8GA 4NSKA 1QRNA 4G43A 5L2KA 2CIKA 2FO4A 4X6FA 3MROA 1EEZA 1HYRC 1QO3A 1S9WA 3LKPA 1LP9A 1XR9A 2JCCA 1ZHNA 1AO7A 2YPKA 2BSRA 4HX1A 1EEYA 2F74A 4HUUA 3PWJA 1K5NA 5C0IA 3P9MA 3HE7A 3PWPA 1HSBA 3O3EA 3PWVA 3TBTA 3BH8A 1NAMH 1BD2A 3RWCA 3GSVA 3KPQA 4D0CA 3KPRA 4LCCC 4L8SC 5MEQA 3CH1A 3KYNA 1XZ0A 2ZOLA 3CDGA 4PJ9A 3BWAA 2DYPA 1LEGA 4IHOA 3FRUA 3MRHA 3GMMA 3X14A 4U1NA 3VFSA 4NNYA 2D31A 3MRJA 4HS3A 2BCKA 3VXUA 4WWKC 4D0DA 5ACZA 1T22A 5D7JC 3SDAA 3V5KA 3VH8A 3KLAA 5EU6A 3LKRA 2X4RA 4N0FA 1ZT7A 3KPPA 3MREA 3KXFA 4PP8C 5FKPA 3SDDA 3BXNA 3OXSA 1T7XA 3CC5A 5C0EA 1YPZA 1QEWA 3MRKA 4MVBA 3L9RA 4NO0A 3ERYA 4F7EA 1EFXA 3QUXA 3TPUE 5C0FA 2E7LE 4U6XA 1YN6A 3BZFA 1JGDA 1ZHKA 2CLZA 1UXSA 4QRPA 2H26A 5IM7A 1I4FA 3P4MA 1U58A 2X70A 5J6HA 3E3QA 1KJVA 1IM9A 4NQEA 4ZUWA 4EI5A 1KBGH 3QQ4A 1T7YA 3GSXA 3WS3A 4GKNA 1E27A 4WJ5A 4PGDA 3MRMA 3LKOA 1ZSDA 4QRRA 1FZJA 1LQVA 1FO0H 4Z77A 5SWQA 4MX7A 4WUUA 2GJ6A 1T7VA 1S9XA 4ZUVA 4PRBA 3LKNA 1JE6A 2BSSA 2WY3A 1S7XA 5SWZA 3P77A 2GT9A 5C0JA 4EN3C 4U6YA 1I7TA 4JQXA 3DXAA 4LCWA 1RJZA 1LEKA 5C09A 3SDCA 3RWEA 3LN4A 4PRDA 4V3DB 4MNQA 5IB4A 3BP7A 5IVXA 3VFWA 3FFCA 1S7WA 4PJEA 4PV9A 4S0UC 3BW9A 4PR5A 3HLAA 4PREA 3LV3A 3VXPA 2UWEA 3KPOA 3MRGA 4APQA 3SCMA 4ZFZA 3RGVC 1I1FA 1JF1A 1OSZA 2ZSWA 2A83A 4I4WA 4XXCA 5IEHA 3QQ3A 1I7RA 3LKQA 3O3BA 5ENWA 3RWDA 4QRSA 3REWA 1RK1A 1KJ2H 1ZVSA 3E6FA 4PRPA 5MENA 3FQTA 1P1ZA 3KPMA 1I1AA 3DMMA 2ESVA 4NQCA 2X4NA 3QFJA 5H94A 3VWJA 1Q94A 5D2LA 1Z5LA 3JTCA 1OGTA 3O8XA 3WUWA 5E00A 1LDPH 3CZFA 3FOMA 1MWAH 4I48A 3SJVA 1GZPA 4JFEA 5E8NA 3GMRA 4MQ7A 1CG9A 3VFTA 3L3KA 3KWWA 5BRZA 3OX8A 4Y4KA 5IB3A 1A1NA 3TZVC 1S8DA 4MJ5A 3UTSA 3DX6A 5BXFA 4PGEA 5D5MA 3MV9A 3JTSA 3P73A 5D7IA 3T8XA 1OF2A 3LN5A 1AGEA 4JQVA 3TF7A 3BEWA 1M05A 3U0PA 4PJXA 2VLJA 4MJIA 3WLBA 2X4OA 4LNRA 1JGEA 5IB1A 3VRJA 1IM3A 1RK0A 3MRDA 3MRPA 3RWHA 2X4SA 1L8JA 4JFFA 5EFIA 3H9HA 4NHUE 3MRRA 4MXQA 4NT6A 1T7ZA 1ZHLA 1T21A 1WBXA 2XFXA 3ILPA 2VAAA 2P5EA 3GSNH 3MA7A 2BNQA 3TIDA 5INDA 3ILQC 3VXNA 4HUVA 2GTWA 4G9DA 5DDHA 5EOTA 3RL2A 3RTQA 3FTGA 5IEKA 5SWSA 4NO5A 4NO3A 1PQZA 4L8DA 2AXFA 3MRCA 3V5HA 1S7UA 1QVOA 1SYSA 4HUXA 1MI5A 4V3EB 3M1BA 4PRNA 2AK4A 2X4PA 1S7QA 5HYJA 1FZOA 2CLVA 5INCA 5HHOA 4FFEX 5IROA 4CW1A 3VFOA 3O3AA 1QQDA 2MHAA 1MHCA 4NO2A 5E8PA 3SPVA 3TO2A 1I7UA 3HPJA 3ROLA 1T1XA 4WU7A 3FT3A 4Z76A 3I6GA 3MRIA 2FIKA 3QI9A 1MHEA 3PABA 2AV7A 2BVPA 3GJFA 3UPRA 4Y4FA 4O2CA 1KTLA 1T0MA 2NX5A 3GMNA 5C9JA 4JFPA 2X4QA 2GTZA 3KPLA 4MS8A 4PGCA 4L9LC 4PRHA 5EO1A 3LKSA 5B38A 2GITA 1AKJA 4L8BA 4PRIA 3GMQA 3BUYA 1AGCA 3GSWA 3X13A 4K7FA 3D39A 4PJAA 1M6OA 3SDXA 3FQNA 2VLRA 5HHQA 5HGBA 3BP4A 1YDPA 2ZOKA 3GIVA 5E8OA 4CVZA 3IXAA 3RWGA 2AXGA 3L3HA 4PJHA 1QR1A 5HGDA 5F9JA 3QUZA 3P9LA 4U1HA 1EXUA 1HHJA 3D2UA 3HE6A 5HGHA 1DE4A 3RUGA 5MEOA 3MV8A 3CPLA 3E2HA 3L3DA 1N5AA 4NQVA 1N3NA 3B3IA 4PRAA 5IB5A 3TFKA 2F53A 3HCVA 5EO0A 4ELMA 3QDMA 3V5DA 3VFUA 3O3DA 4N8VA 3FOLA 3C9NA 5EU4A 5F1NA 1A1OA 3D18A 1HHGA 3OV6A 3DTXA 1AGDA 1HOCA 2XPGA 3HAEA 5L2JA 5HHMA 3OXRA 4NQXA 1QSEA 3MRFA 1FFNA 3GSRA 3HG1A 3RL1A 3AU1A 3S6CA 4F7TA 1DUZA 1E28A 3ROOA 1NEZA 4U1LA 3QDGA 5GSVA 2C7UA 3TA3A 1KJMA 4G42A 3C8KA 4L29A 1T0NA 5HHPA 1JUFA 1G6RH 2RFXA 3JTTA 5D9SA 5DEFA 3VFRA 3FT2A 4D0BA 5BS0A 2BVOA 3BVNA 1HSAA 3ARBA 2PYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KPV A;  3RWI A;  3AM8 A;  3QFD A;  5BJT A;  4EUP A;  5F7D A;  4ZUU A;  1DUY A;  2HJK A;  2GUO A;  3PWL A;  1JPF A;  4U1S A;  4Y16 A;  4WO4 A;  5HHN A;  3GMP A;  4ZUS A;  2VE6 A;  1A6Z A;  5MEP A;  1CD1 A;  3NFN A;  1KPU A;  3JVG A;  3MGT A;  3W0W A;  1XR8 A;  5GSR A;  5J6G A;  1W72 A;  3ARD A;  3VXS A;  3ARG A;  4UQ2 A;  3PQY A;  4LHU A;  5EUO A;  3DBX A;  3QDJ A;  1FFP A;  3VRI A;  2V2W A;  3VFM A;  3TIE A;  3GSQ A;  2HLA A;  1RJY A;  4N5E A;  3CCH A;  3VFN A;  4E5X A;  2F54 A;  2X4T A;  4HUW A;  2BST A;  1HHK A;  1NAN H;  2HN7 A;  1TVB A;  4GKS A;  4WW2 C;  3BH9 A;  1KCG C;  2CLR A;  3ARF A;  3O4L A;  3H9S A;  4L8C A;  1B3J A;  1ED3 A;  1B0R A;  3BZE A;  3L3I A;  4JFQ A;  4U1M A;  4X6C A;  1XH3 A;  1BII A;  1LK2 A;  3MRQ A;  5C0G A;  1T1Y A;  3P4O A;  4Z78 A;  3IT8 D;  2NW3 A;  4F7P A;  3M17 A;  2X4U A;  4JRY A;  2AV1 A;  5C0B A;  1FFO A;  1QLF A;  4JFO A;  5FA4 A;  3L3J A;  2Q7Y A;  3QUY A;  4G8I A;  4PJ7 A;  3FQR A;  4E0R A;  3ES6 A;  4NNX A;  1QSF A;  2J8U A;  4G9F A;  1AGF A;  1ZS8 A;  4X6E A;  3TBV A;  4L3E A;  4ZUT A;  3FQW A;  4WU5 A;  1BQH A;  4N0C A;  4PG9 A;  1P7Q A;  3UTT A;  5MER A;  1T80 A;  1ZT1 A;  5C08 A;  3X12 A;  1ZT4 A;  1X7Q A;  4U1K A;  5DEG A;  3FQX A;  3TBY A;  3MRL A;  3GSO A;  4CVX A;  2BNR A;  3D3V A;  5IB2 A;  1VAC A;  4G59 A;  5EU5 A;  4F7M A;  1S7V A;  4PJ8 A;  2YPL A;  3VWK A;  4MJ6 A;  3WS6 A;  3G08 A;  4HKJ A;  3QZW A;  2H6P A;  3VCL A;  3SKO A;  5FDW A;  3QUL A;  3HUJ A;  3O9W A;  1UXW A;  2CKB H;  1BZ9 A;  1W0W A;  2AKR A;  2OI9 A;  4PV8 A;  1G7Q A;  1B0G A;  3TJH A;  1OGA A;  3I6L D;  1T1W A;  4JFD A;  2VLL A;  4O2F A;  1ZAG A;  4HV8 A;  3VJ6 A;  4U1I A;  1UQS A;  1ONQ A;  4L4T A;  4K71 B;  3D25 A;  1KJ3 H;  4QRU A;  3CVH A;  1A1M A;  3BGM A;  1WBY A;  4QRT A;  4Y2D A;  4NQD A;  4X6D A;  3BHB A;  1S7R A;  1DDH A;  3MV7 A;  5E9D A;  5F1I A;  3VFV A;  3E6H A;  5J1A A;  1P4L A;  2GAZ A;  3PWN A;  3W39 A;  2YEZ A;  3FQU A;  1W0V A;  2CII A;  4HWZ A;  1S9Y A;  4PJG A;  4PDC E;  4UQ3 A;  1YN7 A;  3TO4 A;  1K8D A;  2BVQ A;  5HGA A;  5AD0 A;  3FON A;  3T1F A;  3GSU A;  1FZM A;  4WDI A;  3ECB A;  1S7T A;  3VFP A;  4L4V A;  4PJC A;  1VGK A;  1C16 A;  5C0C A;  4ZAK A;  3UTQ A;  1JPG A;  4PJ5 A;  3BEV A;  3DX8 A;  3WL9 A;  1N2R A;  5C07 A;  1FG2 A;  1GZQ A;  1T7W A;  4ONO A;  3SKM A;  3RZC A;  3QEQ A;  1T1Z A;  3DX7 A;  1INQ A;  1ZHB A;  3PWU A;  4N0U A;  4Y4H A;  1AGB A;  3FT4 A;  3MR9 A;  5FA3 A;  2VAB A;  4L3C A;  4QRQ A;  3MGO A;  3MRN A;  1JFM A;  1N59 A;  1HHH A;  3GMO A;  5D7L A;  1LD9 A;  5E6I C;  3TBS A;  5B39 A;  3KPS A;  4PG2 A;  1KPR A;  1JHT A;  2ZSV A;  1R3H A;  5EU3 A;  4IRS A;  2FWO A;  3UBX A;  4PJI A;  4QOK A;  1HHI A;  3ARE A;  1SYV A;  4PJF A;  1G7P A;  2V2X A;  5JHD A;  3VXM A;  3BO8 A;  4MNG A;  3L3G A;  3H7B A;  1A9B A;  5D2N A;  2HJL A;  5ISZ A;  5C0A A;  3MYJ A;  3GML A;  3P4N A;  1I1Y A;  2FZ3 A;  2P5W A;  4PJB A;  4IRJ A;  3TN0 A;  4PJD A;  1S7S A;  1TMC A;  4F7C A;  3MRB A;  1TVH A;  3I6K A;  3TVM A;  3RWF A;  1WBZ A;  4PGB A;  5C0D A;  1T20 A;  3KYO A;  1A9E A;  1VAD A;  3RWJ A;  1CE6 A;  2PO6 A;  4GUP A;  3TBW A;  3VXO A;  2VLK A;  4LCY A;  3KPN A;  4IIQ C;  3VXR A;  1FZK A;  4U1J A;  3X11 A;  3QUK A;  4JRX A;  2FYY A;  3B6S A;  2OL3 H;  4FTV A;  4O2E A;  4G8G A;  4NSK A;  1QRN A;  4G43 A;  5L2K A;  2CIK A;  2FO4 A;  4X6F A;  3MRO A;  1EEZ A;  1HYR C;  1QO3 A;  1S9W A;  3LKP A;  1LP9 A;  1XR9 A;  2JCC A;  1ZHN A;  1AO7 A;  2YPK A;  2BSR A;  4HX1 A;  1EEY A;  2F74 A;  4HUU A;  3PWJ A;  1K5N A;  5C0I A;  3P9M A;  3HE7 A;  3PWP A;  1HSB A;  3O3E A;  3PWV A;  3TBT A;  3BH8 A;  1NAM H;  1BD2 A;  3RWC A;  3GSV A;  3KPQ A;  4D0C A;  3KPR A;  4LCC C;  4L8S C;  5MEQ A;  3CH1 A;  3KYN A;  1XZ0 A;  2ZOL A;  3CDG A;  4PJ9 A;  3BWA A;  2DYP A;  1LEG A;  4IHO A;  3FRU A;  3MRH A;  3GMM A;  3X14 A;  4U1N A;  3VFS A;  4NNY A;  2D31 A;  3MRJ A;  4HS3 A;  2BCK A;  3VXU A;  4WWK C;  4D0D A;  5ACZ A;  1T22 A;  5D7J C;  3SDA A;  3V5K A;  3VH8 A;  3KLA A;  5EU6 A;  3LKR A;  2X4R A;  4N0F A;  1ZT7 A;  3KPP A;  3MRE A;  3KXF A;  4PP8 C;  5FKP A;  3SDD A;  3BXN A;  3OXS A;  1T7X A;  3CC5 A;  5C0E A;  1YPZ A;  1QEW A;  3MRK A;  4MVB A;  3L9R A;  4NO0 A;  3ERY A;  4F7E A;  1EFX A;  3QUX A;  3TPU E;  5C0F A;  2E7L E;  4U6X A;  1YN6 A;  3BZF A;  1JGD A;  1ZHK A;  2CLZ A;  1UXS A;  4QRP A;  2H26 A;  5IM7 A;  1I4F A;  3P4M A;  1U58 A;  2X70 A;  5J6H A;  3E3Q A;  1KJV A;  1IM9 A;  4NQE A;  4ZUW A;  4EI5 A;  1KBG H;  3QQ4 A;  1T7Y A;  3GSX A;  3WS3 A;  4GKN A;  1E27 A;  4WJ5 A;  4PGD A;  3MRM A;  3LKO A;  1ZSD A;  4QRR A;  1FZJ A;  1LQV A;  1FO0 H;  4Z77 A;  5SWQ A;  4MX7 A;  4WUU A;  2GJ6 A;  1T7V A;  1S9X A;  4ZUV A;  4PRB A;  3LKN A;  1JE6 A;  2BSS A;  2WY3 A;  1S7X A;  5SWZ A;  3P77 A;  2GT9 A;  5C0J A;  4EN3 C;  4U6Y A;  1I7T A;  4JQX A;  3DXA A;  4LCW A;  1RJZ A;  1LEK A;  5C09 A;  3SDC A;  3RWE A;  3LN4 A;  4PRD A;  4V3D B;  4MNQ A;  5IB4 A;  3BP7 A;  5IVX A;  3VFW A;  3FFC A;  1S7W A;  4PJE A;  4PV9 A;  4S0U C;  3BW9 A;  4PR5 A;  3HLA A;  4PRE A;  3LV3 A;  3VXP A;  2UWE A;  3KPO A;  3MRG A;  4APQ A;  3SCM A;  4ZFZ A;  3RGV C;  1I1F A;  1JF1 A;  1OSZ A;  2ZSW A;  2A83 A;  4I4W A;  4XXC A;  5IEH A;  3QQ3 A;  1I7R A;  3LKQ A;  3O3B A;  5ENW A;  3RWD A;  4QRS A;  3REW A;  1RK1 A;  1KJ2 H;  1ZVS A;  3E6F A;  4PRP A;  5MEN A;  3FQT A;  1P1Z A;  3KPM A;  1I1A A;  3DMM A;  2ESV A;  4NQC A;  2X4N A;  3QFJ A;  5H94 A;  3VWJ A;  1Q94 A;  5D2L A;  1Z5L A;  3JTC A;  1OGT A;  3O8X A;  3WUW A;  5E00 A;  1LDP H;  3CZF A;  3FOM A;  1MWA H;  4I48 A;  3SJV A;  1GZP A;  4JFE A;  5E8N A;  3GMR A;  4MQ7 A;  1CG9 A;  3VFT A;  3L3K A;  3KWW A;  5BRZ A;  3OX8 A;  4Y4K A;  5IB3 A;  1A1N A;  3TZV C;  1S8D A;  4MJ5 A;  3UTS A;  3DX6 A;  5BXF A;  4PGE A;  5D5M A;  3MV9 A;  3JTS A;  3P73 A;  5D7I A;  3T8X A;  1OF2 A;  3LN5 A;  1AGE A;  4JQV A;  3TF7 A;  3BEW A;  1M05 A;  3U0P A;  4PJX A;  2VLJ A;  4MJI A;  3WLB A;  2X4O A;  4LNR A;  1JGE A;  5IB1 A;  3VRJ A;  1IM3 A;  1RK0 A;  3MRD A;  3MRP A;  3RWH A;  2X4S A;  1L8J A;  4JFF A;  5EFI A;  3H9H A;  4NHU E;  3MRR A;  4MXQ A;  4NT6 A;  1T7Z A;  1ZHL A;  1T21 A;  1WBX A;  2XFX A;  3ILP A;  2VAA A;  2P5E A;  3GSN H;  3MA7 A;  2BNQ A;  3TID A;  5IND A;  3ILQ C;  3VXN A;  4HUV A;  2GTW A;  4G9D A;  5DDH A;  5EOT A;  3RL2 A;  3RTQ A;  3FTG A;  5IEK A;  5SWS A;  4NO5 A;  4NO3 A;  1PQZ A;  4L8D A;  2AXF A;  3MRC A;  3V5H A;  1S7U A;  1QVO A;  1SYS A;  4HUX A;  1MI5 A;  4V3E B;  3M1B A;  4PRN A;  2AK4 A;  2X4P A;  1S7Q A;  5HYJ A;  1FZO A;  2CLV A;  5INC A;  5HHO A;  4FFE X;  5IRO A;  4CW1 A;  3VFO A;  3O3A A;  1QQD A;  2MHA A;  1MHC A;  4NO2 A;  5E8P A;  3SPV A;  3TO2 A;  1I7U A;  3HPJ A;  3ROL A;  1T1X A;  4WU7 A;  3FT3 A;  4Z76 A;  3I6G A;  3MRI A;  2FIK A;  3QI9 A;  1MHE A;  3PAB A;  2AV7 A;  2BVP A;  3GJF A;  3UPR A;  4Y4F A;  4O2C A;  1KTL A;  1T0M A;  2NX5 A;  3GMN A;  5C9J A;  4JFP A;  2X4Q A;  2GTZ A;  3KPL A;  4MS8 A;  4PGC A;  4L9L C;  4PRH A;  5EO1 A;  3LKS A;  5B38 A;  2GIT A;  1AKJ A;  4L8B A;  4PRI A;  3GMQ A;  3BUY A;  1AGC A;  3GSW A;  3X13 A;  4K7F A;  3D39 A;  4PJA A;  1M6O A;  3SDX A;  3FQN A;  2VLR A;  5HHQ A;  5HGB A;  3BP4 A;  1YDP A;  2ZOK A;  3GIV A;  5E8O A;  4CVZ A;  3IXA A;  3RWG A;  2AXG A;  3L3H A;  4PJH A;  1QR1 A;  5HGD A;  5F9J A;  3QUZ A;  3P9L A;  4U1H A;  1EXU A;  1HHJ A;  3D2U A;  3HE6 A;  5HGH A;  1DE4 A;  3RUG A;  5MEO A;  3MV8 A;  3CPL A;  3E2H A;  3L3D A;  1N5A A;  4NQV A;  1N3N A;  3B3I A;  4PRA A;  5IB5 A;  3TFK A;  2F53 A;  3HCV A;  5EO0 A;  4ELM A;  3QDM A;  3V5D A;  3VFU A;  3O3D A;  4N8V A;  3FOL A;  3C9N A;  5EU4 A;  5F1N A;  1A1O A;  3D18 A;  1HHG A;  3OV6 A;  3DTX A;  1AGD A;  1HOC A;  2XPG A;  3HAE A;  5L2J A;  5HHM A;  3OXR A;  4NQX A;  1QSE A;  3MRF A;  1FFN A;  3GSR A;  3HG1 A;  3RL1 A;  3AU1 A;  3S6C A;  4F7T A;  1DUZ A;  1E28 A;  3ROO A;  1NEZ A;  4U1L A;  3QDG A;  5GSV A;  2C7U A;  3TA3 A;  1KJM A;  4G42 A;  3C8K A;  4L29 A;  1T0N A;  5HHP A;  1JUF A;  1G6R H;  2RFX A;  3JTT A;  5D9S A;  5DEF A;  3VFR A;  3FT2 A;  4D0B A;  5BS0 A;  2BVO A;  3BVN A;  1HSA A;  3ARB A;  2PYE A; 
#chains in the Genus database with same CATH topology
 1KPV A;  3RWI A;  3AM8 A;  3QFD A;  5BJT A;  4EUP A;  5F7D A;  4ZUU A;  1DUY A;  2HJK A;  2GUO A;  3PWL A;  1JPF A;  4U1S A;  4Y16 A;  4WO4 A;  5HHN A;  3GMP A;  4ZUS A;  2VE6 A;  1A6Z A;  5MEP A;  1CD1 A;  3NFN A;  1KPU A;  3JVG A;  3MGT A;  3W0W A;  1XR8 A;  5GSR A;  5J6G A;  1W72 A;  3ARD A;  3VXS A;  3ARG A;  4UQ2 A;  3PQY A;  4LHU A;  5EUO A;  3DBX A;  2IA1 A;  1FFP A;  3QDJ A;  2V2W A;  3VRI A;  3VFM A;  3TIE A;  3GSQ A;  2HLA A;  1RJY A;  4N5E A;  3CCH A;  3VFN A;  4E5X A;  2F54 A;  2X4T A;  4HUW A;  2BST A;  1HHK A;  1NAN H;  2HN7 A;  1TVB A;  4GKS A;  4WW2 C;  3BH9 A;  1KCG C;  2CLR A;  3ARF A;  3O4L A;  3H9S A;  4L8C A;  1B3J A;  1ED3 A;  1B0R A;  3BZE A;  3L3I A;  4JFQ A;  4U1M A;  4X6C A;  1XH3 A;  1BII A;  1LK2 A;  3MRQ A;  5C0G A;  1T1Y A;  3P4O A;  4Z78 A;  3IT8 D;  2NW3 A;  4F7P A;  3M17 A;  2X4U A;  4JRY A;  2AV1 A;  5C0B A;  1FFO A;  1QLF A;  4JFO A;  5FA4 A;  3L3J A;  2Q7Y A;  3QUY A;  4G8I A;  4PJ7 A;  3FQR A;  4E0R A;  3ES6 A;  4NNX A;  1QSF A;  2J8U A;  4G9F A;  1AGF A;  1ZS8 A;  4X6E A;  3TBV A;  4L3E A;  4ZUT A;  3FQW A;  4WU5 A;  1BQH A;  4N0C A;  4PG9 A;  1P7Q A;  3UTT A;  5MER A;  1T80 A;  1ZT1 A;  5C08 A;  3X12 A;  1ZT4 A;  1X7Q A;  4U1K A;  5DEG A;  3FQX A;  3TBY A;  3MRL A;  3GSO A;  4CVX A;  2BNR A;  3D3V A;  5IB2 A;  1VAC A;  4G59 A;  5EU5 A;  4F7M A;  1S7V A;  4PJ8 A;  2YPL A;  3VWK A;  4MJ6 A;  3WS6 A;  3G08 A;  4HKJ A;  3QZW A;  2H6P A;  3VCL A;  3SKO A;  5FDW A;  3QUL A;  3HUJ A;  3O9W A;  1UXW A;  2CKB H;  1BZ9 A;  1W0W A;  2AKR A;  2OI9 A;  4PV8 A;  1G7Q A;  1B0G A;  3TJH A;  1OGA A;  3I6L D;  1T1W A;  4JFD A;  2VLL A;  4O2F A;  1ZAG A;  4HV8 A;  3VJ6 A;  4U1I A;  1UQS A;  1ONQ A;  4L4T A;  4K71 B;  3D25 A;  1KJ3 H;  4QRU A;  3CVH A;  1A1M A;  3BGM A;  1WBY A;  4QRT A;  4Y2D A;  4NQD A;  4X6D A;  3BHB A;  1S7R A;  1DDH A;  3MV7 A;  5E9D A;  5F1I A;  3VFV A;  3E6H A;  5J1A A;  1P4L A;  2GAZ A;  3PWN A;  3W39 A;  2YEZ A;  3FQU A;  1W0V A;  2CII A;  4HWZ A;  1S9Y A;  4PJG A;  4PDC E;  4UQ3 A;  1YN7 A;  3TO4 A;  1K8D A;  2BVQ A;  5HGA A;  5AD0 A;  3FON A;  3T1F A;  3GSU A;  1FZM A;  4WDI A;  3ECB A;  1S7T A;  3VFP A;  4L4V A;  4PJC A;  1VGK A;  1C16 A;  5C0C A;  4ZAK A;  3UTQ A;  1JPG A;  4PJ5 A;  3BEV A;  3DX8 A;  3WL9 A;  1N2R A;  5C07 A;  1FG2 A;  1GZQ A;  1T7W A;  4ONO A;  3SKM A;  3RZC A;  3QEQ A;  1T1Z A;  3DX7 A;  1INQ A;  1ZHB A;  3PWU A;  4N0U A;  4Y4H A;  1AGB A;  3FT4 A;  3MR9 A;  5FA3 A;  2VAB A;  4L3C A;  4QRQ A;  3MGO A;  3MRN A;  1JFM A;  1N59 A;  1HHH A;  3GMO A;  5D7L A;  1LD9 A;  5E6I C;  3TBS A;  5B39 A;  3KPS A;  4PG2 A;  1KPR A;  1JHT A;  2ZSV A;  1R3H A;  5EU3 A;  4IRS A;  2FWO A;  3UBX A;  4PJI A;  4QOK A;  1HHI A;  3ARE A;  1SYV A;  4PJF A;  1G7P A;  2V2X A;  5JHD A;  3VXM A;  3BO8 A;  4MNG A;  3L3G A;  3H7B A;  1A9B A;  5D2N A;  2HJL A;  5ISZ A;  2NYK A;  5C0A A;  3MYJ A;  3GML A;  3P4N A;  1I1Y A;  2FZ3 A;  2P5W A;  4PJB A;  4IRJ A;  3TN0 A;  4PJD A;  1S7S A;  1TMC A;  4F7C A;  3MRB A;  1TVH A;  3I6K A;  3TVM A;  3RWF A;  1WBZ A;  4PGB A;  5C0D A;  1T20 A;  3KYO A;  1A9E A;  1VAD A;  3RWJ A;  1CE6 A;  2PO6 A;  4GUP A;  3TBW A;  3VXO A;  2VLK A;  4LCY A;  3KPN A;  4IIQ C;  3VXR A;  1FZK A;  4U1J A;  3X11 A;  3QUK A;  4JRX A;  2FYY A;  3B6S A;  2OL3 H;  4FTV A;  4O2E A;  4G8G A;  4NSK A;  1QRN A;  4G43 A;  5L2K A;  2CIK A;  2FO4 A;  4X6F A;  3MRO A;  1EEZ A;  1HYR C;  1QO3 A;  1S9W A;  3LKP A;  1LP9 A;  1XR9 A;  2JCC A;  1ZHN A;  1AO7 A;  2YPK A;  2BSR A;  4HX1 A;  1EEY A;  2F74 A;  4HUU A;  3PWJ A;  1K5N A;  5C0I A;  3P9M A;  3HE7 A;  3PWP A;  1HSB A;  3O3E A;  3PWV A;  3TBT A;  3BH8 A;  1NAM H;  1BD2 A;  3RWC A;  3GSV A;  3KPQ A;  4D0C A;  3KPR A;  4LCC C;  4L8S C;  5MEQ A;  3CH1 A;  3KYN A;  1XZ0 A;  2ZOL A;  3CDG A;  4PJ9 A;  3BWA A;  2DYP A;  1LEG A;  4IHO A;  3FRU A;  3MRH A;  3GMM A;  3X14 A;  4U1N A;  3VFS A;  4NNY A;  2D31 A;  3MRJ A;  4HS3 A;  2BCK A;  3VXU A;  4WWK C;  4D0D A;  5ACZ A;  1T22 A;  5D7J C;  3SDA A;  3V5K A;  3VH8 A;  3KLA A;  5EU6 A;  3LKR A;  2X4R A;  4N0F A;  1ZT7 A;  3KPP A;  3MRE A;  3KXF A;  4PP8 C;  5FKP A;  3SDD A;  3BXN A;  3OXS A;  1T7X A;  3CC5 A;  5C0E A;  1YPZ A;  1QEW A;  3MRK A;  4MVB A;  3L9R A;  4NO0 A;  3ERY A;  4F7E A;  1EFX A;  3QUX A;  3TPU E;  5C0F A;  2E7L E;  4U6X A;  1YN6 A;  3BZF A;  1JGD A;  1ZHK A;  2CLZ A;  1UXS A;  4QRP A;  2H26 A;  5IM7 A;  1I4F A;  3P4M A;  1U58 A;  2X70 A;  5J6H A;  3E3Q A;  1KJV A;  1IM9 A;  4NQE A;  4ZUW A;  4EI5 A;  1KBG H;  3QQ4 A;  1T7Y A;  3GSX A;  3WS3 A;  4GKN A;  1E27 A;  4WJ5 A;  4PGD A;  3MRM A;  3LKO A;  1ZSD A;  4QRR A;  1FZJ A;  1LQV A;  1FO0 H;  4Z77 A;  5SWQ A;  4MX7 A;  4WUU A;  2GJ6 A;  1T7V A;  1S9X A;  4ZUV A;  4PRB A;  3LKN A;  1JE6 A;  2BSS A;  2WY3 A;  1S7X A;  5SWZ A;  3P77 A;  2GT9 A;  5C0J A;  4EN3 C;  4U6Y A;  1I7T A;  4JQX A;  3DXA A;  2O5N A;  4LCW A;  1RJZ A;  1LEK A;  5C09 A;  3SDC A;  3RWE A;  3LN4 A;  4PRD A;  4V3D B;  4MNQ A;  5IB4 A;  3BP7 A;  5IVX A;  3VFW A;  3FFC A;  1S7W A;  4PJE A;  4PV9 A;  4S0U C;  3BW9 A;  4PR5 A;  3HLA A;  4PRE A;  3LV3 A;  3VXP A;  2UWE A;  3KPO A;  3MRG A;  4APQ A;  3SCM A;  4ZFZ A;  3RGV C;  1I1F A;  1JF1 A;  1OSZ A;  2ZSW A;  2A83 A;  4I4W A;  4XXC A;  5IEH A;  3QQ3 A;  1I7R A;  3LKQ A;  3O3B A;  5ENW A;  3RWD A;  4QRS A;  3REW A;  1RK1 A;  1KJ2 H;  1ZVS A;  3E6F A;  4PRP A;  5MEN A;  3FQT A;  1P1Z A;  3KPM A;  1I1A A;  3DMM A;  2ESV A;  4NQC A;  2X4N A;  3QFJ A;  5H94 A;  3VWJ A;  1Q94 A;  5D2L A;  1Z5L A;  3JTC A;  1OGT A;  3O8X A;  3WUW A;  5E00 A;  1LDP H;  3CZF A;  3FOM A;  1MWA H;  4I48 A;  3SJV A;  1GZP A;  4JFE A;  5E8N A;  3GMR A;  4MQ7 A;  1CG9 A;  3VFT A;  3L3K A;  3KWW A;  5BRZ A;  3OX8 A;  4Y4K A;  5IB3 A;  1A1N A;  3TZV C;  1S8D A;  4MJ5 A;  3UTS A;  3DX6 A;  5BXF A;  4PGE A;  5D5M A;  3MV9 A;  3JTS A;  3P73 A;  5D7I A;  3T8X A;  1OF2 A;  3LN5 A;  1AGE A;  4JQV A;  3TF7 A;  3BEW A;  1M05 A;  3U0P A;  4PJX A;  2VLJ A;  4MJI A;  3WLB A;  2X4O A;  4LNR A;  1JGE A;  5IB1 A;  3VRJ A;  1IM3 A;  1RK0 A;  3MRD A;  3MRP A;  3RWH A;  2X4S A;  1L8J A;  4JFF A;  5EFI A;  3H9H A;  4NHU E;  3MRR A;  4MXQ A;  4NT6 A;  1T7Z A;  1ZHL A;  1T21 A;  1WBX A;  2XFX A;  3ILP A;  2VAA A;  2P5E A;  3GSN H;  3MA7 A;  2BNQ A;  3TID A;  5IND A;  3ILQ C;  3VXN A;  4HUV A;  2GTW A;  4G9D A;  5DDH A;  5EOT A;  3RL2 A;  3RTQ A;  3FTG A;  5IEK A;  5SWS A;  4NO5 A;  4NO3 A;  1PQZ A;  4L8D A;  2AXF A;  3MRC A;  3V5H A;  1S7U A;  1QVO A;  1SYS A;  4HUX A;  1MI5 A;  4V3E B;  3M1B A;  4PRN A;  2AK4 A;  2X4P A;  1S7Q A;  5HYJ A;  1FZO A;  2CLV A;  5INC A;  5HHO A;  4FFE X;  5IRO A;  4CW1 A;  3VFO A;  3O3A A;  1QQD A;  2MHA A;  1MHC A;  4NO2 A;  5E8P A;  3SPV A;  3TO2 A;  1I7U A;  3HPJ A;  3ROL A;  1T1X A;  4WU7 A;  3FT3 A;  4Z76 A;  3I6G A;  3MRI A;  2FIK A;  3QI9 A;  1MHE A;  3PAB A;  2AV7 A;  2BVP A;  3GJF A;  3UPR A;  4Y4F A;  4O2C A;  1KTL A;  1T0M A;  2NX5 A;  3GMN A;  5C9J A;  4G59 C;  4JFP A;  2X4Q A;  2GTZ A;  3KPL A;  4MS8 A;  4PGC A;  4L9L C;  4PRH A;  5EO1 A;  3LKS A;  5B38 A;  2GIT A;  1AKJ A;  4L8B A;  4PRI A;  3GMQ A;  3BUY A;  1AGC A;  4BKW A;  3GSW A;  3X13 A;  4K7F A;  3D39 A;  4PJA A;  1M6O A;  3SDX A;  3FQN A;  2VLR A;  5HHQ A;  5HGB A;  3BP4 A;  1YDP A;  2ZOK A;  3GIV A;  5E8O A;  4CVZ A;  3IXA A;  3RWG A;  2AXG A;  3L3H A;  4PJH A;  1QR1 A;  5HGD A;  5F9J A;  3QUZ A;  3P9L A;  4JO8 A;  4U1H A;  1EXU A;  1HHJ A;  3D2U A;  3HE6 A;  5HGH A;  1DE4 A;  3RUG A;  5MEO A;  3MV8 A;  3CPL A;  3E2H A;  3L3D A;  1N5A A;  4NQV A;  1N3N A;  3B3I A;  4PRA A;  5IB5 A;  3TFK A;  2F53 A;  3HCV A;  5EO0 A;  4ELM A;  3QDM A;  3V5D A;  3VFU A;  3O3D A;  4N8V A;  3FOL A;  3C9N A;  5EU4 A;  5F1N A;  1A1O A;  3D18 A;  1HHG A;  3OV6 A;  3DTX A;  1AGD A;  1HOC A;  2XPG A;  3HAE A;  5L2J A;  3I0T A;  5HHM A;  3OXR A;  4NQX A;  1QSE A;  3MRF A;  1FFN A;  3GSR A;  3HG1 A;  3RL1 A;  3AU1 A;  3S6C A;  4F7T A;  1DUZ A;  1E28 A;  3ROO A;  1NEZ A;  4U1L A;  3QDG A;  5GSV A;  2C7U A;  3TA3 A;  1KJM A;  4G42 A;  3C8K A;  4L29 A;  1T0N A;  5HHP A;  1JUF A;  1G6R H;  2RFX A;  3JTT A;  5D9S A;  5DEF A;  3VFR A;  3FT2 A;  4D0B A;  5BS0 A;  2BVO A;  3BVN A;  1HSA A;  3ARB A;  2PYE A; 
#chains in the Genus database with same CATH homology
 1KPV A;  3RWI A;  3AM8 A;  3QFD A;  5BJT A;  4EUP A;  5F7D A;  4ZUU A;  1DUY A;  2HJK A;  2GUO A;  3PWL A;  1JPF A;  4U1S A;  4Y16 A;  4WO4 A;  5HHN A;  3GMP A;  4ZUS A;  2VE6 A;  1A6Z A;  5MEP A;  1CD1 A;  3NFN A;  1KPU A;  3JVG A;  3MGT A;  3W0W A;  1XR8 A;  5GSR A;  5J6G A;  1W72 A;  3ARD A;  3VXS A;  3ARG A;  4UQ2 A;  3PQY A;  4LHU A;  5EUO A;  3DBX A;  3QDJ A;  1FFP A;  3VRI A;  2V2W A;  3VFM A;  3TIE A;  3GSQ A;  2HLA A;  1RJY A;  4N5E A;  3CCH A;  3VFN A;  4E5X A;  2F54 A;  2X4T A;  4HUW A;  2BST A;  1HHK A;  1NAN H;  2HN7 A;  1TVB A;  4GKS A;  4WW2 C;  3BH9 A;  1KCG C;  2CLR A;  3ARF A;  3O4L A;  3H9S A;  4L8C A;  1B3J A;  1ED3 A;  1B0R A;  3BZE A;  3L3I A;  4JFQ A;  4U1M A;  4X6C A;  1XH3 A;  1BII A;  1LK2 A;  3MRQ A;  5C0G A;  1T1Y A;  3P4O A;  4Z78 A;  3IT8 D;  2NW3 A;  4F7P A;  3M17 A;  2X4U A;  4JRY A;  2AV1 A;  5C0B A;  1FFO A;  1QLF A;  4JFO A;  5FA4 A;  3L3J A;  2Q7Y A;  3QUY A;  4G8I A;  4PJ7 A;  3FQR A;  4E0R A;  3ES6 A;  4NNX A;  1QSF A;  2J8U A;  4G9F A;  1AGF A;  1ZS8 A;  4X6E A;  3TBV A;  4L3E A;  4ZUT A;  3FQW A;  4WU5 A;  1BQH A;  4N0C A;  4PG9 A;  1P7Q A;  3UTT A;  5MER A;  1T80 A;  1ZT1 A;  5C08 A;  3X12 A;  1ZT4 A;  1X7Q A;  4U1K A;  5DEG A;  3FQX A;  3TBY A;  3MRL A;  3GSO A;  4CVX A;  2BNR A;  3D3V A;  5IB2 A;  1VAC A;  4G59 A;  5EU5 A;  4F7M A;  1S7V A;  4PJ8 A;  2YPL A;  3VWK A;  4MJ6 A;  3WS6 A;  3G08 A;  4HKJ A;  3QZW A;  2H6P A;  3VCL A;  3SKO A;  5FDW A;  3QUL A;  3HUJ A;  3O9W A;  1UXW A;  2CKB H;  1BZ9 A;  1W0W A;  2AKR A;  2OI9 A;  4PV8 A;  1G7Q A;  1B0G A;  3TJH A;  1OGA A;  3I6L D;  1T1W A;  4JFD A;  2VLL A;  4O2F A;  1ZAG A;  4HV8 A;  3VJ6 A;  4U1I A;  1UQS A;  1ONQ A;  4L4T A;  4K71 B;  3D25 A;  1KJ3 H;  4QRU A;  3CVH A;  1A1M A;  3BGM A;  1WBY A;  4QRT A;  4Y2D A;  4NQD A;  4X6D A;  3BHB A;  1S7R A;  1DDH A;  3MV7 A;  5E9D A;  5F1I A;  3VFV A;  3E6H A;  5J1A A;  1P4L A;  2GAZ A;  3PWN A;  3W39 A;  2YEZ A;  3FQU A;  1W0V A;  2CII A;  4HWZ A;  1S9Y A;  4PJG A;  4PDC E;  4UQ3 A;  1YN7 A;  3TO4 A;  1K8D A;  2BVQ A;  5HGA A;  5AD0 A;  3FON A;  3T1F A;  3GSU A;  1FZM A;  4WDI A;  3ECB A;  1S7T A;  3VFP A;  4L4V A;  4PJC A;  1VGK A;  1C16 A;  5C0C A;  4ZAK A;  3UTQ A;  1JPG A;  4PJ5 A;  3BEV A;  3DX8 A;  3WL9 A;  1N2R A;  5C07 A;  1FG2 A;  1GZQ A;  1T7W A;  4ONO A;  3SKM A;  3RZC A;  3QEQ A;  1T1Z A;  3DX7 A;  1INQ A;  1ZHB A;  3PWU A;  4N0U A;  4Y4H A;  1AGB A;  3FT4 A;  3MR9 A;  5FA3 A;  2VAB A;  4L3C A;  4QRQ A;  3MGO A;  3MRN A;  1JFM A;  1N59 A;  1HHH A;  3GMO A;  5D7L A;  1LD9 A;  5E6I C;  3TBS A;  5B39 A;  3KPS A;  4PG2 A;  1KPR A;  1JHT A;  2ZSV A;  1R3H A;  5EU3 A;  4IRS A;  2FWO A;  3UBX A;  4PJI A;  4QOK A;  1HHI A;  3ARE A;  1SYV A;  4PJF A;  1G7P A;  2V2X A;  5JHD A;  3VXM A;  3BO8 A;  4MNG A;  3L3G A;  3H7B A;  1A9B A;  5D2N A;  2HJL A;  5ISZ A;  5C0A A;  3MYJ A;  3GML A;  3P4N A;  1I1Y A;  2FZ3 A;  2P5W A;  4PJB A;  4IRJ A;  3TN0 A;  4PJD A;  1S7S A;  1TMC A;  4F7C A;  3MRB A;  1TVH A;  3I6K A;  3TVM A;  3RWF A;  1WBZ A;  4PGB A;  5C0D A;  1T20 A;  3KYO A;  1A9E A;  1VAD A;  3RWJ A;  1CE6 A;  2PO6 A;  4GUP A;  3TBW A;  3VXO A;  2VLK A;  4LCY A;  3KPN A;  4IIQ C;  3VXR A;  1FZK A;  4U1J A;  3X11 A;  3QUK A;  4JRX A;  2FYY A;  3B6S A;  2OL3 H;  4FTV A;  4O2E A;  4G8G A;  4NSK A;  1QRN A;  4G43 A;  5L2K A;  2CIK A;  2FO4 A;  4X6F A;  3MRO A;  1EEZ A;  1HYR C;  1QO3 A;  1S9W A;  3LKP A;  1LP9 A;  1XR9 A;  2JCC A;  1ZHN A;  1AO7 A;  2YPK A;  2BSR A;  4HX1 A;  1EEY A;  2F74 A;  4HUU A;  3PWJ A;  1K5N A;  5C0I A;  3P9M A;  3HE7 A;  3PWP A;  1HSB A;  3O3E A;  3PWV A;  3TBT A;  3BH8 A;  1NAM H;  1BD2 A;  3RWC A;  3GSV A;  3KPQ A;  4D0C A;  3KPR A;  4LCC C;  4L8S C;  5MEQ A;  3CH1 A;  3KYN A;  1XZ0 A;  2ZOL A;  3CDG A;  4PJ9 A;  3BWA A;  2DYP A;  1LEG A;  4IHO A;  3FRU A;  3MRH A;  3GMM A;  3X14 A;  4U1N A;  3VFS A;  4NNY A;  2D31 A;  3MRJ A;  4HS3 A;  2BCK A;  3VXU A;  4WWK C;  4D0D A;  5ACZ A;  1T22 A;  5D7J C;  3SDA A;  3V5K A;  3VH8 A;  3KLA A;  5EU6 A;  3LKR A;  2X4R A;  4N0F A;  1ZT7 A;  3KPP A;  3MRE A;  3KXF A;  4PP8 C;  5FKP A;  3SDD A;  3BXN A;  3OXS A;  1T7X A;  3CC5 A;  5C0E A;  1YPZ A;  1QEW A;  3MRK A;  4MVB A;  3L9R A;  4NO0 A;  3ERY A;  4F7E A;  1EFX A;  3QUX A;  3TPU E;  5C0F A;  2E7L E;  4U6X A;  1YN6 A;  3BZF A;  1JGD A;  1ZHK A;  2CLZ A;  1UXS A;  4QRP A;  2H26 A;  5IM7 A;  1I4F A;  3P4M A;  1U58 A;  2X70 A;  5J6H A;  3E3Q A;  1KJV A;  1IM9 A;  4NQE A;  4ZUW A;  4EI5 A;  1KBG H;  3QQ4 A;  1T7Y A;  3GSX A;  3WS3 A;  4GKN A;  1E27 A;  4WJ5 A;  4PGD A;  3MRM A;  3LKO A;  1ZSD A;  4QRR A;  1FZJ A;  1LQV A;  1FO0 H;  4Z77 A;  5SWQ A;  4MX7 A;  4WUU A;  2GJ6 A;  1T7V A;  1S9X A;  4ZUV A;  4PRB A;  3LKN A;  1JE6 A;  2BSS A;  2WY3 A;  1S7X A;  5SWZ A;  3P77 A;  2GT9 A;  5C0J A;  4EN3 C;  4U6Y A;  1I7T A;  4JQX A;  3DXA A;  4LCW A;  1RJZ A;  1LEK A;  5C09 A;  3SDC A;  3RWE A;  3LN4 A;  4PRD A;  4V3D B;  4MNQ A;  5IB4 A;  3BP7 A;  5IVX A;  3VFW A;  3FFC A;  1S7W A;  4PJE A;  4PV9 A;  4S0U C;  3BW9 A;  4PR5 A;  3HLA A;  4PRE A;  3LV3 A;  3VXP A;  2UWE A;  3KPO A;  3MRG A;  4APQ A;  3SCM A;  4ZFZ A;  3RGV C;  1I1F A;  1JF1 A;  1OSZ A;  2ZSW A;  2A83 A;  4I4W A;  4XXC A;  5IEH A;  3QQ3 A;  1I7R A;  3LKQ A;  3O3B A;  5ENW A;  3RWD A;  4QRS A;  3REW A;  1RK1 A;  1KJ2 H;  1ZVS A;  3E6F A;  4PRP A;  5MEN A;  3FQT A;  1P1Z A;  3KPM A;  1I1A A;  3DMM A;  2ESV A;  4NQC A;  2X4N A;  3QFJ A;  5H94 A;  3VWJ A;  1Q94 A;  5D2L A;  1Z5L A;  3JTC A;  1OGT A;  3O8X A;  3WUW A;  5E00 A;  1LDP H;  3CZF A;  3FOM A;  1MWA H;  4I48 A;  3SJV A;  1GZP A;  4JFE A;  5E8N A;  3GMR A;  4MQ7 A;  1CG9 A;  3VFT A;  3L3K A;  3KWW A;  5BRZ A;  3OX8 A;  4Y4K A;  5IB3 A;  1A1N A;  3TZV C;  1S8D A;  4MJ5 A;  3UTS A;  3DX6 A;  5BXF A;  4PGE A;  5D5M A;  3MV9 A;  3JTS A;  3P73 A;  5D7I A;  3T8X A;  1OF2 A;  3LN5 A;  1AGE A;  4JQV A;  3TF7 A;  3BEW A;  1M05 A;  3U0P A;  4PJX A;  2VLJ A;  4MJI A;  3WLB A;  2X4O A;  4LNR A;  1JGE A;  5IB1 A;  3VRJ A;  1IM3 A;  1RK0 A;  3MRD A;  3MRP A;  3RWH A;  2X4S A;  1L8J A;  4JFF A;  5EFI A;  3H9H A;  4NHU E;  3MRR A;  4MXQ A;  4NT6 A;  1T7Z A;  1ZHL A;  1T21 A;  1WBX A;  2XFX A;  3ILP A;  2VAA A;  2P5E A;  3GSN H;  3MA7 A;  2BNQ A;  3TID A;  5IND A;  3ILQ C;  3VXN A;  4HUV A;  2GTW A;  4G9D A;  5DDH A;  5EOT A;  3RL2 A;  3RTQ A;  3FTG A;  5IEK A;  5SWS A;  4NO5 A;  4NO3 A;  1PQZ A;  4L8D A;  2AXF A;  3MRC A;  3V5H A;  1S7U A;  1QVO A;  1SYS A;  4HUX A;  1MI5 A;  4V3E B;  3M1B A;  4PRN A;  2AK4 A;  2X4P A;  1S7Q A;  5HYJ A;  1FZO A;  2CLV A;  5INC A;  5HHO A;  4FFE X;  5IRO A;  4CW1 A;  3VFO A;  3O3A A;  1QQD A;  2MHA A;  1MHC A;  4NO2 A;  5E8P A;  3SPV A;  3TO2 A;  1I7U A;  3HPJ A;  3ROL A;  1T1X A;  4WU7 A;  3FT3 A;  4Z76 A;  3I6G A;  3MRI A;  2FIK A;  3QI9 A;  1MHE A;  3PAB A;  2AV7 A;  2BVP A;  3GJF A;  3UPR A;  4Y4F A;  4O2C A;  1KTL A;  1T0M A;  2NX5 A;  3GMN A;  5C9J A;  4JFP A;  2X4Q A;  2GTZ A;  3KPL A;  4MS8 A;  4PGC A;  4L9L C;  4PRH A;  5EO1 A;  3LKS A;  5B38 A;  2GIT A;  1AKJ A;  4L8B A;  4PRI A;  3GMQ A;  3BUY A;  1AGC A;  3GSW A;  3X13 A;  4K7F A;  3D39 A;  4PJA A;  1M6O A;  3SDX A;  3FQN A;  2VLR A;  5HHQ A;  5HGB A;  3BP4 A;  1YDP A;  2ZOK A;  3GIV A;  5E8O A;  4CVZ A;  3IXA A;  3RWG A;  2AXG A;  3L3H A;  4PJH A;  1QR1 A;  5HGD A;  5F9J A;  3QUZ A;  3P9L A;  4U1H A;  1EXU A;  1HHJ A;  3D2U A;  3HE6 A;  5HGH A;  1DE4 A;  3RUG A;  5MEO A;  3MV8 A;  3CPL A;  3E2H A;  3L3D A;  1N5A A;  4NQV A;  1N3N A;  3B3I A;  4PRA A;  5IB5 A;  3TFK A;  2F53 A;  3HCV A;  5EO0 A;  4ELM A;  3QDM A;  3V5D A;  3VFU A;  3O3D A;  4N8V A;  3FOL A;  3C9N A;  5EU4 A;  5F1N A;  1A1O A;  3D18 A;  1HHG A;  3OV6 A;  3DTX A;  1AGD A;  1HOC A;  2XPG A;  3HAE A;  5L2J A;  5HHM A;  3OXR A;  4NQX A;  1QSE A;  3MRF A;  1FFN A;  3GSR A;  3HG1 A;  3RL1 A;  3AU1 A;  3S6C A;  4F7T A;  1DUZ A;  1E28 A;  3ROO A;  1NEZ A;  4U1L A;  3QDG A;  5GSV A;  2C7U A;  3TA3 A;  1KJM A;  4G42 A;  3C8K A;  4L29 A;  1T0N A;  5HHP A;  1JUF A;  1G6R H;  2RFX A;  3JTT A;  5D9S A;  5DEF A;  3VFR A;  3FT2 A;  4D0B A;  5BS0 A;  2BVO A;  3BVN A;  1HSA A;  3ARB A;  2PYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...