4PP8C

Crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
168
structure length
146
Chain Sequence
HSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINATEVKKCLTQPLKNLCQKLRNKVSNTYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords NKG2-D type II integral membrane protein
total genus 42
structure length 146
sequence length 168
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pp8C00
5B39A 4GUPA 5SWQA 2DYPA 1TVHA 2JCCA 5E00A 3KYNA 4PGBA 5J6HA 1W0WA 3LKQA 5L2JA 4L4TA 1E28A 3MRHA 4HUXA 3RWIA 3UTTA 4HS3A 3E6HA 3PWLA 4PGEA 4NNXA 1IM3A 5EOTA 1RK1A 3KPSA 4JFFA 2BCKA 4L3CA 5E8NA 4NNYA 3HPJA 1KPRA 4GKNA 4HV8A 5DEFA 3HAEA 4L4VA 1FFPA 3FRUA 4JRYA 3QUXA 3GMMA 4PJHA 5C0BA 4QRPA 2BSSA 2BVPA 1B0GA 2CLVA 4WDIA 1HHGA 5ISZA 4QRSA 1AGDA 3D2UA 3D18A 4PJXA 4PG2A 1A9EA 4LNRA 4PJAA 3PWVA 3SDXA 3QUZA 5FA4A 3S6CA 1S7QA 5BRZA 3VFOA 4S0UC 3BGMA 4U6XA 3BEVA 3ARFA 3BEWA 2VLLA 4MJ5A 1KJ3H 4PJ8A 1MHEA 3P77A 4D0CA 3WUWA 1S9WA 3W0WA 1SYVA 1N59A 1FO0H 2GUOA 3P4OA 3RWJA 4PRNA 5IVXA 1JFMA 3FQNA 1VADA 1AGBA 4FTVA 3RWGA 3GMOA 1T1WA 3MV7A 3KWWA 4EI5A 1A9BA 3MRIA 5AD0A 4U1NA 1MI5A 3GMRA 1X7QA 4ZAKA 1CE6A 1KCGC 3KPRA 2X4OA 4WJ5A 3WL9A 2X4RA 1FFOA 3FQUA 3HUJA 3RWDA 1T0MA 5EU6A 1NEZA 1I1AA 1M6OA 3UTQA 3VFSA 1T7YA 3D3VA 2GJ6A 4PRAA 3QDGA 3FQRA 4K7FA 1QEWA 1P1ZA 2OL3H 3UPRA 1FZOA 1I7RA 4CW1A 3MRRA 1EEYA 1ZSDA 4L8DA 2VLRA 3O3DA 2VLKA 1CD1A 1A1OA 3DTXA 2V2WA 3P73A 2Q7YA 3MRJA 1ZHNA 2PYEA 1SYSA 5IB1A 3ERYA 3GSVA 1JE6A 3SCMA 3GMPA 4I48A 4LCWA 3UTSA 4PJBA 1A1NA 4EUPA 3MRKA 1LK2A 2VAAA 2CLZA 5C0JA 1P7QA 3MRGA 1KPUA 3LKRA 1HSBA 4X6EA 3KPOA 3OXSA 3TBWA 3E2HA 3VXOA 4IRSA 5HYJA 1ZT4A 2AV7A 2FIKA 3LKNA 5BXFA 2CIKA 1RK0A 3D39A 1W0VA 4ZUTA 3C8KA 1G7QA 1A1MA 1HHIA 1I1YA 3MRFA 4HX1A 4QRQA 5HGBA 5INCA 1UQSA 4WU5A 5EO1A 4I4WA 3X12A 4JRXA 1FG2A 4U1LA 3MGOA 2D31A 3BP4A 2GAZA 2NX5A 3RZCA 5EO0A 3H9SA 3RWHA 1N5AA 2PO6A 2XPGA 4NQEA 1ZT1A 3DXAA 5IB2A 4D0BA 4FFEX 1I7TA 3P9MA 1QSFA 1A6ZA 1GZPA 2BNRA 3ROLA 1S7WA 4APQA 1I7UA 3M17A 1LQVA 3TA3A 3BUYA 5HHNA 3QEQA 3SKMA 1JPFA 3ES6A 4N0UA 4PG9A 5D2LA 1ZS8A 3GSOA 3MROA 3IXAA 3WLBA 3VRIA 1KJVA 5D7LA 4PJDA 1ED3A 1HHJA 1R3HA 2X4UA 3KPPA 4G8GA 3GMQA 1W72A 4HKJA 3AM8A 1T20A 4JQVA 5MENA 3DMMA 1S8DA 4LCYA 2X70A 5MERA 3D25A 3GMLA 3ILQC 1T7VA 1PQZA 5H94A 2VLJA 2GT9A 3FQTA 1N2RA 4PJCA 5C0FA 4WWKC 4HUVA 1HHHA 3QZWA 3V5DA 1XH3A 1BIIA 1LP9A 2ZSVA 4G8IA 1NAMH 4XXCA 5J6GA 1XZ0A 4JFDA 4F7EA 2X4NA 4NO3A 3TVMA 1S7TA 1XR9A 2X4PA 4F7PA 3H7BA 1UXWA 5C0DA 4ZUVA 1ZHBA 3GMNA 5D2NA 3O3BA 5SWSA 2E7LE 3QUYA 5F1IA 2P5EA 2GTZA 1FZKA 1VACA 4HUWA 2BVQA 3MREA 3TIEA 3JTSA 3X14A 3VRJA 2RFXA 3VFWA 4NQDA 2ESVA 1YN6A 4NO0A 1I1FA 1Z5LA 1KTLA 5FA3A 2AXFA 2F74A 4PJ9A 1ZHKA 3FQWA 4L9LC 1KPVA 1EFXA 1S9XA 1S7UA 1T7XA 1ZAGA 2YPKA 2FO4A 1E27A 4MS8A 4G9DA 2FWOA 3REWA 5ENWA 5IB5A 5MEPA 3LN5A 5C9JA 3ARDA 3O9WA 3RGVC 1T7ZA 3LKOA 2GTWA 5F7DA 3AREA 3ECBA 3JTCA 3TZVC 1I4FA 4PRDA 1AO7A 1FZMA 1BD2A 1HOCA 3CPLA 4MNGA 4Z76A 3FT3A 3CC5A 3TN0A 4IRJA 2OI9A 1T21A 4LCCC 1RJYA 4PRBA 4NHUE 1T7WA 3CH1A 4MX7A 4PJGA 4G59A 1AGEA 1S7SA 3WS6A 5C07A 3X11A 1OGTA 1YN7A 1YDPA 3ROOA 4MJ6A 5F1NA 3CVHA 5FKPA 3CDGA 4PRPA 4U1MA 2J8UA 3SDDA 3FOLA 4V3EB 2GITA 4NQVA 3T8XA 3CCHA 3TO2A 3TJHA 3MRLA 3VWKA 3TPUE 3FT2A 3OXRA 4PP8C 4Y4FA 1LDPH 1YPZA 1IM9A 1OGAA 4PGDA 1G6RH 3MA7A 4MNQA 3V5HA 2CKBH 4D0DA 1JPGA 5HGHA 4X6FA 2YEZA 1L8JA 4F7TA 4ZUWA 5JHDA 4JFQA 4L3EA 2HLAA 3HE7A 3B3IA 2HN7A 2P5WA 3LV3A 3FFCA 3MRBA 4V3DB 4WU7A 1BQHA 3I6KA 5DDHA 1TVBA 1AGFA 3O3AA 4NQCA 4PREA 1GZQA 2BSRA 3QI9A 2X4TA 4QRRA 1S7RA 2ZOKA 4N0FA 5C0GA 1KBGH 3BO8A 3G08A 3PQYA 2UWEA 3GSNH 3BXNA 4JQXA 4N8VA 4MXQA 4PGCA 4U1HA 5C09A 3VXNA 1Q94A 5EU3A 5C0CA 2X4QA 2WY3A 3FONA 1QQDA 4NQXA 5GSVA 3FQXA 5HGAA 3MV9A 4NSKA 1JUFA 3H9HA 5IEHA 4Y16A 3JTTA 4WUUA 4ZUUA 2VE6A 4HWZA 4L29A 2AK4A 4PJFA 2X4SA 2H6PA 3P9LA 3PWJA 3E3QA 5D9SA 1S9YA 2CIIA 5HHQA 5IM7A 3HG1A 3KPNA 5HGDA 3VXPA 3L3DA 3VXSA 1G7PA 3P4NA 1VGKA 3CZFA 5E6IC 4O2FA 3RTQA 2ZSWA 4NT6A 1FFNA 1MHCA 1EEZA 3ILPA 1P4LA 3L3JA 4NO5A 5L2KA 1OSZA 3DBXA 1QO3A 4PV8A 4ZUSA 5EFIA 1QR1A 2FYYA 3VXMA 2YPLA 1QRNA 5FDWA 1K8DA 1MWAH 2HJLA 1EXUA 1ZT7A 4F7MA 3TO4A 4PJEA 3BW9A 2H26A 3BHBA 1T0NA 5HHPA 1T1XA 3TIDA 3VFRA 5C0IA 1NANH 3L3IA 1INQA 3MRDA 3HLAA 3I6LD 2AV1A 3WS3A 1KJMA 4O2EA 1JGDA 4Y2DA 3VFMA 4U1SA 3C9NA 4MQ7A 3ARBA 3KPQA 4PRIA 5D5MA 4HUUA 5EU4A 1DDHA 3PWUA 5MEQA 3QQ3A 4UQ3A 5F9JA 3TBVA 5IB3A 3VFUA 1U58A 4G42A 3KYOA 3MRCA 3MV8A 3QUKA 5IROA 5E8OA 3RWEA 4GKSA 4JFPA 3MGTA 5HHMA 3AU1A 4PR5A 4CVZA 1WBXA 4F7CA 3FTGA 5IEKA 4U1KA 1BZ9A 2F53A 3BWAA 5C0EA 3L3KA 3M1BA 3VJ6A 1S7VA 4ONOA 1JHTA 5E9DA 4Y4KA 3BZFA 3BP7A 4U6YA 5C0AA 3JVGA 3X13A 3PABA 5EUOA 4Z77A 1WBZA 1S7XA 3TFKA 4K71B 3O8XA 3BH9A 1AKJA 3MRQA 3VXRA 3QQ4A 3GSUA 4L8SC 5ACZA 4X6CA 3B6SA 5INDA 3BZEA 2XFXA 3RL2A 3P4MA 5SWZA 3QFDA 3MRMA 4JFEA 3GSRA 4N0CA 4UQ2A 2AKRA 1ONQA 4MVBA 3KXFA 1T1YA 3OX8A 4Z78A 2F54A 3SKOA 3T1FA 4ELMA 4NO2A 3RWFA 4MJIA 4O2CA 3TF7A 2BNQA 1B0RA 3V5KA 3PWPA 2MHAA 3PWNA 3ARGA 4U1IA 4WO4A 4PJ5A 1C16A 1LEKA 3I6GA 3MR9A 3QDMA 5MEOA 3L3HA 3O3EA 4WW2C 1CG9A 3LN4A 1HYRC 1ZVSA 4PJ7A 2CLRA 1HSAA 2BVOA 3KPLA 3MYJA 3VCLA 4CVXA 1JGEA 1KJ2H 3VFNA 4L8BA 4E5XA 1FZJA 2NW3A 3DX6A 2A83A 5EU5A 4IIQC 5DEGA 3VFPA 4EN3C 3KPMA 5GSRA 1XR8A 3O4LA 3OV6A 4LHUA 3UBXA 4PJIA 4X6DA 3HE6A 1LD9A 3QULA 3SDAA 3GJFA 5D7JC 3RWCA 4E0RA 2ZOLA 3GSWA 4ZFZA 2C7UA 3W39A 3E6FA 2VABA 3TBSA 4JFOA 5C08A 4QRTA 3RUGA 3MRNA 1DE4A 1WBYA 1K5NA 4L8CA 4G43A 3QDJA 1QSEA 3FOMA 4G9FA 3L9RA 5J1AA 1ZHLA 1B3JA 1QVOA 1T1ZA 3LKPA 3GIVA 5BJTA 3DX7A 1OF2A 3VFVA 1AGCA 1DUZA 2AXGA 3DX8A 3L3GA 3TBTA 3VWJA 2FZ3A 4PDCE 3HCVA 1LEGA 3VXUA 3SPVA 1QLFA 3SJVA 3FT4A 1RJZA 3U0PA 5B38A 2BSTA 2V2XA 5D7IA 5IB4A 1UXSA 1TMCA 1DUYA 3VFTA 3SDCA 4QRUA 1T22A 3TBYA 3LKSA 1M05A 4PV9A 3GSQA 1T80A 3VH8A 4IHOA 5E8PA 3NFNA 5BS0A 3KLAA 5HHOA 4Y4HA 3MRPA 3QFJA 3BH8A 3IT8D 3BVNA 1HHKA 3GSXA 4N5EA 4QOKA 4U1JA 1N3NA 3RL1A 4PRHA 2HJKA 1JF1A
chains in the Genus database with same CATH superfamily
5B39A 4GUPA 5SWQA 2DYPA 1TVHA 2JCCA 5E00A 3KYNA 4PGBA 5J6HA 1W0WA 3LKQA 5L2JA 4L4TA 1E28A 3MRHA 4HUXA 3RWIA 3UTTA 4HS3A 3E6HA 3PWLA 4PGEA 4NNXA 1IM3A 5EOTA 1RK1A 3KPSA 4JFFA 2BCKA 4L3CA 5E8NA 4NNYA 3HPJA 1KPRA 4GKNA 4HV8A 5DEFA 3HAEA 4L4VA 1FFPA 3FRUA 4JRYA 3QUXA 3GMMA 4PJHA 5C0BA 4QRPA 2BSSA 2BVPA 1B0GA 2CLVA 4WDIA 1HHGA 5ISZA 4QRSA 1AGDA 3D2UA 3D18A 4PJXA 4PG2A 1A9EA 4LNRA 4PJAA 3PWVA 3SDXA 3QUZA 5FA4A 3S6CA 1S7QA 5BRZA 3VFOA 4S0UC 3BGMA 4U6XA 3BEVA 3ARFA 3BEWA 2VLLA 4MJ5A 1KJ3H 4PJ8A 1MHEA 3P77A 4D0CA 3WUWA 1S9WA 3W0WA 1SYVA 1N59A 1FO0H 2GUOA 3P4OA 3RWJA 4PRNA 5IVXA 1JFMA 3FQNA 1VADA 1AGBA 4FTVA 3RWGA 3GMOA 1T1WA 3MV7A 3KWWA 4EI5A 1A9BA 3MRIA 5AD0A 4U1NA 1MI5A 3GMRA 1X7QA 4ZAKA 1CE6A 1KCGC 3KPRA 2X4OA 4WJ5A 3WL9A 2X4RA 1FFOA 3FQUA 3HUJA 3RWDA 1T0MA 5EU6A 1NEZA 1I1AA 1M6OA 3UTQA 3VFSA 1T7YA 3D3VA 2GJ6A 4PRAA 3QDGA 3FQRA 4K7FA 1QEWA 1P1ZA 2OL3H 3UPRA 3I0TA 1FZOA 1I7RA 4BKWA 4CW1A 3MRRA 1EEYA 1ZSDA 4L8DA 2VLRA 3O3DA 2VLKA 1CD1A 1A1OA 3DTXA 2V2WA 3P73A 2Q7YA 3MRJA 1ZHNA 2PYEA 1SYSA 5IB1A 3ERYA 3GSVA 1JE6A 3SCMA 3GMPA 4I48A 4LCWA 3UTSA 4PJBA 1A1NA 4EUPA 3MRKA 1LK2A 2VAAA 2CLZA 5C0JA 1P7QA 3MRGA 1KPUA 3LKRA 1HSBA 4X6EA 3KPOA 3OXSA 3TBWA 3E2HA 3VXOA 4IRSA 5HYJA 1ZT4A 2AV7A 2FIKA 3LKNA 5BXFA 2CIKA 1RK0A 3D39A 1W0VA 4ZUTA 3C8KA 1G7QA 1A1MA 2O5NA 1HHIA 1I1YA 3MRFA 4HX1A 4QRQA 5HGBA 5INCA 1UQSA 4WU5A 5EO1A 4I4WA 3X12A 4JRXA 1FG2A 4U1LA 3MGOA 2D31A 3BP4A 2GAZA 2NX5A 3RZCA 5EO0A 3H9SA 3RWHA 1N5AA 2PO6A 2XPGA 4NQEA 1ZT1A 3DXAA 5IB2A 4D0BA 4FFEX 1I7TA 3P9MA 1QSFA 1A6ZA 1GZPA 2BNRA 3ROLA 1S7WA 4APQA 1I7UA 3M17A 1LQVA 3TA3A 3BUYA 5HHNA 3QEQA 3SKMA 1JPFA 3ES6A 4N0UA 4PG9A 5D2LA 1ZS8A 3GSOA 3MROA 3IXAA 3WLBA 3VRIA 1KJVA 5D7LA 4PJDA 1ED3A 1HHJA 1R3HA 2X4UA 3KPPA 4G8GA 3GMQA 1W72A 4HKJA 3AM8A 1T20A 4JQVA 5MENA 2NYKA 3DMMA 1S8DA 4LCYA 2X70A 5MERA 3D25A 3GMLA 3ILQC 1T7VA 1PQZA 5H94A 2VLJA 2GT9A 3FQTA 1N2RA 4PJCA 5C0FA 4WWKC 4HUVA 1HHHA 3QZWA 3V5DA 1XH3A 1BIIA 1LP9A 2ZSVA 4G8IA 1NAMH 4XXCA 5J6GA 1XZ0A 4JFDA 4F7EA 2X4NA 4NO3A 3TVMA 1S7TA 1XR9A 2X4PA 4F7PA 3H7BA 1UXWA 5C0DA 4ZUVA 1ZHBA 3GMNA 5D2NA 3O3BA 5SWSA 2E7LE 3QUYA 5F1IA 2P5EA 2GTZA 1FZKA 1VACA 4HUWA 2BVQA 3MREA 3TIEA 3JTSA 3X14A 3VRJA 2RFXA 3VFWA 4NQDA 2ESVA 1YN6A 4NO0A 1I1FA 1Z5LA 1KTLA 5FA3A 2AXFA 2F74A 4PJ9A 1ZHKA 3FQWA 4L9LC 1KPVA 1EFXA 1S9XA 1S7UA 1T7XA 1ZAGA 2YPKA 2FO4A 4G59C 1E27A 4MS8A 4G9DA 2FWOA 3REWA 5ENWA 5IB5A 5MEPA 3LN5A 5C9JA 3ARDA 3O9WA 3RGVC 1T7ZA 3LKOA 2GTWA 5F7DA 3AREA 3ECBA 3JTCA 3TZVC 1I4FA 4PRDA 1AO7A 1FZMA 3CPLA 1BD2A 1HOCA 4MNGA 4Z76A 3FT3A 3CC5A 3TN0A 4IRJA 2OI9A 1T21A 4LCCC 1RJYA 4PRBA 4NHUE 1T7WA 3CH1A 4MX7A 4PJGA 4G59A 1AGEA 1S7SA 3WS6A 5C07A 3X11A 1OGTA 1YN7A 1YDPA 3ROOA 4MJ6A 5F1NA 3CVHA 5FKPA 3CDGA 4PRPA 4U1MA 2J8UA 3SDDA 3FOLA 4V3EB 2GITA 4NQVA 3T8XA 3CCHA 3TO2A 3TJHA 3MRLA 3VWKA 3TPUE 3FT2A 3OXRA 4PP8C 4Y4FA 1LDPH 1YPZA 1IM9A 1OGAA 4PGDA 1G6RH 3MA7A 4MNQA 3V5HA 2CKBH 4D0DA 1JPGA 5HGHA 4X6FA 2YEZA 1L8JA 4F7TA 4ZUWA 5JHDA 4JFQA 4L3EA 2HLAA 3HE7A 3B3IA 2HN7A 2P5WA 3LV3A 3FFCA 3MRBA 4V3DB 4WU7A 1BQHA 3I6KA 5DDHA 1TVBA 1AGFA 3O3AA 4NQCA 4PREA 1GZQA 2BSRA 3QI9A 2X4TA 4QRRA 1S7RA 2ZOKA 4N0FA 5C0GA 1KBGH 3BO8A 3G08A 3PQYA 2UWEA 3GSNH 3BXNA 4JQXA 4N8VA 4MXQA 4PGCA 4U1HA 5C09A 3VXNA 1Q94A 5EU3A 5C0CA 2X4QA 2WY3A 3FONA 1QQDA 4NQXA 5GSVA 3FQXA 5HGAA 3MV9A 4NSKA 1JUFA 3H9HA 5IEHA 4Y16A 3JTTA 4WUUA 4ZUUA 2VE6A 4HWZA 4L29A 2AK4A 4PJFA 2X4SA 2H6PA 3P9LA 3PWJA 3E3QA 5D9SA 1S9YA 2CIIA 5HHQA 5IM7A 3HG1A 3KPNA 5HGDA 3VXPA 3L3DA 3VXSA 1G7PA 3P4NA 1VGKA 3CZFA 5E6IC 4O2FA 3RTQA 2ZSWA 4NT6A 1FFNA 1MHCA 1EEZA 3ILPA 1P4LA 3L3JA 4NO5A 5L2KA 1OSZA 3DBXA 1QO3A 4PV8A 4ZUSA 5EFIA 1QR1A 2FYYA 3VXMA 2YPLA 1QRNA 5FDWA 1K8DA 1MWAH 2HJLA 1EXUA 1ZT7A 4F7MA 3TO4A 4PJEA 3BW9A 2H26A 3BHBA 1T0NA 5HHPA 1T1XA 3TIDA 3VFRA 5C0IA 1NANH 3L3IA 1INQA 3MRDA 3HLAA 3I6LD 2AV1A 3WS3A 1KJMA 4O2EA 1JGDA 4Y2DA 3VFMA 4U1SA 3C9NA 4MQ7A 3ARBA 3KPQA 4PRIA 5D5MA 4HUUA 5EU4A 1DDHA 3PWUA 5MEQA 3QQ3A 4UQ3A 5F9JA 3TBVA 5IB3A 3VFUA 1U58A 4G42A 3KYOA 3MRCA 3MV8A 3QUKA 5IROA 5E8OA 3RWEA 4GKSA 4JFPA 2IA1A 3MGTA 3AU1A 5HHMA 4PR5A 4CVZA 1WBXA 4F7CA 3FTGA 5IEKA 4U1KA 1BZ9A 2F53A 3BWAA 5C0EA 3L3KA 3M1BA 3VJ6A 1S7VA 4ONOA 1JHTA 5E9DA 4Y4KA 3BZFA 3BP7A 4U6YA 5C0AA 3JVGA 3X13A 3PABA 5EUOA 4Z77A 1WBZA 1S7XA 3TFKA 4K71B 3O8XA 3BH9A 1AKJA 3MRQA 3VXRA 3QQ4A 3GSUA 4L8SC 5ACZA 4X6CA 3B6SA 5INDA 3BZEA 2XFXA 3RL2A 3P4MA 4JO8A 5SWZA 3QFDA 3MRMA 4JFEA 3GSRA 4N0CA 4UQ2A 2AKRA 1ONQA 4MVBA 3KXFA 1T1YA 3OX8A 4Z78A 2F54A 3SKOA 3T1FA 4ELMA 4NO2A 3RWFA 4MJIA 4O2CA 3TF7A 2BNQA 1B0RA 3V5KA 3PWPA 2MHAA 3PWNA 3ARGA 4U1IA 4WO4A 4PJ5A 1C16A 1LEKA 3I6GA 3MR9A 3QDMA 5MEOA 3L3HA 3O3EA 4WW2C 1CG9A 3LN4A 1HYRC 1ZVSA 4PJ7A 2CLRA 1HSAA 2BVOA 3KPLA 3MYJA 3VCLA 4CVXA 1JGEA 1KJ2H 3VFNA 4L8BA 4E5XA 1FZJA 2NW3A 3DX6A 2A83A 5EU5A 4IIQC 5DEGA 3VFPA 4EN3C 3KPMA 5GSRA 1XR8A 3O4LA 3OV6A 4LHUA 3UBXA 4PJIA 4X6DA 3HE6A 1LD9A 3QULA 3SDAA 3GJFA 5D7JC 3RWCA 4E0RA 2ZOLA 3GSWA 4ZFZA 2C7UA 3W39A 3E6FA 2VABA 3TBSA 4JFOA 5C08A 4QRTA 3RUGA 3MRNA 1DE4A 1WBYA 1K5NA 4L8CA 4G43A 3QDJA 1QSEA 3FOMA 4G9FA 3L9RA 5J1AA 1ZHLA 1B3JA 1QVOA 1T1ZA 3LKPA 3GIVA 5BJTA 3DX7A 1OF2A 3VFVA 1AGCA 1DUZA 2AXGA 3DX8A 3L3GA 3TBTA 3VWJA 2FZ3A 4PDCE 3HCVA 1LEGA 3VXUA 3SPVA 1QLFA 3SJVA 3FT4A 1RJZA 3U0PA 5B38A 2BSTA 2V2XA 5D7IA 5IB4A 1UXSA 1TMCA 1DUYA 3VFTA 3SDCA 4QRUA 1T22A 3TBYA 3LKSA 1M05A 4PV9A 3GSQA 1T80A 3VH8A 4IHOA 5E8PA 3NFNA 5BS0A 3KLAA 5HHOA 4Y4HA 3MRPA 3QFJA 3BH8A 3IT8D 3BVNA 1HHKA 3GSXA 4N5EA 4QOKA 4U1JA 1N3NA 3RL1A 4PRHA 2HJKA 1JF1A
chains in the Genus database with same CATH topology
5B39A 4GUPA 5SWQA 2DYPA 1TVHA 2JCCA 5E00A 3KYNA 4PGBA 5J6HA 1W0WA 3LKQA 5L2JA 4L4TA 1E28A 3MRHA 4HUXA 3RWIA 3UTTA 4HS3A 3E6HA 3PWLA 4PGEA 4NNXA 1IM3A 5EOTA 1RK1A 3KPSA 4JFFA 2BCKA 4L3CA 5E8NA 4NNYA 3HPJA 1KPRA 4GKNA 4HV8A 5DEFA 3HAEA 4L4VA 1FFPA 3FRUA 4JRYA 3QUXA 3GMMA 4PJHA 5C0BA 4QRPA 2BSSA 2BVPA 1B0GA 2CLVA 4WDIA 1HHGA 5ISZA 4QRSA 1AGDA 3D2UA 3D18A 4PJXA 4PG2A 1A9EA 4LNRA 4PJAA 3PWVA 3SDXA 3QUZA 5FA4A 3S6CA 1S7QA 5BRZA 3VFOA 4S0UC 3BGMA 4U6XA 3BEVA 3ARFA 3BEWA 2VLLA 4MJ5A 1KJ3H 4PJ8A 1MHEA 3P77A 4D0CA 3WUWA 1S9WA 3W0WA 1SYVA 1N59A 1FO0H 2GUOA 3P4OA 3RWJA 4PRNA 5IVXA 1JFMA 3FQNA 1VADA 1AGBA 4FTVA 3RWGA 3GMOA 1T1WA 3MV7A 3KWWA 4EI5A 1A9BA 3MRIA 5AD0A 4U1NA 1MI5A 3GMRA 1X7QA 4ZAKA 1CE6A 1KCGC 3KPRA 2X4OA 4WJ5A 3WL9A 2X4RA 1FFOA 3FQUA 3HUJA 3RWDA 1T0MA 5EU6A 1NEZA 1I1AA 1M6OA 3UTQA 3VFSA 1T7YA 3D3VA 2GJ6A 4PRAA 3QDGA 3FQRA 4K7FA 1QEWA 1P1ZA 2OL3H 3UPRA 1FZOA 1I7RA 4CW1A 3MRRA 1EEYA 1ZSDA 4L8DA 2VLRA 3O3DA 2VLKA 1CD1A 1A1OA 3DTXA 2V2WA 3P73A 2Q7YA 3MRJA 1ZHNA 2PYEA 1SYSA 5IB1A 3ERYA 3GSVA 1JE6A 3SCMA 3GMPA 4I48A 4LCWA 3UTSA 4PJBA 1A1NA 4EUPA 3MRKA 1LK2A 2VAAA 2CLZA 5C0JA 1P7QA 3MRGA 1KPUA 3LKRA 1HSBA 4X6EA 3KPOA 3OXSA 3TBWA 3E2HA 3VXOA 4IRSA 5HYJA 1ZT4A 2AV7A 2FIKA 3LKNA 5BXFA 2CIKA 1RK0A 3D39A 1W0VA 4ZUTA 3C8KA 1G7QA 1A1MA 1HHIA 1I1YA 3MRFA 4HX1A 4QRQA 5HGBA 5INCA 1UQSA 4WU5A 5EO1A 4I4WA 3X12A 4JRXA 1FG2A 4U1LA 3MGOA 2D31A 3BP4A 2GAZA 2NX5A 3RZCA 5EO0A 3H9SA 3RWHA 1N5AA 2PO6A 2XPGA 4NQEA 1ZT1A 3DXAA 5IB2A 4D0BA 4FFEX 1I7TA 3P9MA 1QSFA 1A6ZA 1GZPA 2BNRA 3ROLA 1S7WA 4APQA 1I7UA 3M17A 1LQVA 3TA3A 3BUYA 5HHNA 3QEQA 3SKMA 1JPFA 3ES6A 4N0UA 4PG9A 5D2LA 1ZS8A 3GSOA 3MROA 3IXAA 3WLBA 3VRIA 1KJVA 5D7LA 4PJDA 1ED3A 1HHJA 1R3HA 2X4UA 3KPPA 4G8GA 3GMQA 1W72A 4HKJA 3AM8A 1T20A 4JQVA 5MENA 3DMMA 1S8DA 4LCYA 2X70A 5MERA 3D25A 3GMLA 3ILQC 1T7VA 1PQZA 5H94A 2VLJA 2GT9A 3FQTA 1N2RA 4PJCA 5C0FA 4WWKC 4HUVA 1HHHA 3QZWA 3V5DA 1XH3A 1BIIA 1LP9A 2ZSVA 4G8IA 1NAMH 4XXCA 5J6GA 1XZ0A 4JFDA 4F7EA 2X4NA 4NO3A 3TVMA 1S7TA 1XR9A 2X4PA 4F7PA 3H7BA 1UXWA 5C0DA 4ZUVA 1ZHBA 3GMNA 5D2NA 3O3BA 5SWSA 2E7LE 3QUYA 5F1IA 2P5EA 2GTZA 1FZKA 1VACA 4HUWA 2BVQA 3MREA 3TIEA 3JTSA 3X14A 3VRJA 2RFXA 3VFWA 4NQDA 2ESVA 1YN6A 4NO0A 1I1FA 1Z5LA 1KTLA 5FA3A 2AXFA 2F74A 4PJ9A 1ZHKA 3FQWA 4L9LC 1KPVA 1EFXA 1S9XA 1S7UA 1T7XA 1ZAGA 2YPKA 2FO4A 1E27A 4MS8A 4G9DA 2FWOA 3REWA 5ENWA 5IB5A 5MEPA 3LN5A 5C9JA 3ARDA 3O9WA 3RGVC 1T7ZA 3LKOA 2GTWA 5F7DA 3AREA 3ECBA 3JTCA 3TZVC 1I4FA 4PRDA 1AO7A 1FZMA 1BD2A 1HOCA 3CPLA 4MNGA 4Z76A 3FT3A 3CC5A 3TN0A 4IRJA 2OI9A 1T21A 4LCCC 1RJYA 4PRBA 4NHUE 1T7WA 3CH1A 4MX7A 4PJGA 4G59A 1AGEA 1S7SA 3WS6A 5C07A 3X11A 1OGTA 1YN7A 1YDPA 3ROOA 4MJ6A 5F1NA 3CVHA 5FKPA 3CDGA 4PRPA 4U1MA 2J8UA 3SDDA 3FOLA 4V3EB 2GITA 4NQVA 3T8XA 3CCHA 3TO2A 3TJHA 3MRLA 3VWKA 3TPUE 3FT2A 3OXRA 4PP8C 4Y4FA 1LDPH 1YPZA 1IM9A 1OGAA 4PGDA 1G6RH 3MA7A 4MNQA 3V5HA 2CKBH 4D0DA 1JPGA 5HGHA 4X6FA 2YEZA 1L8JA 4F7TA 4ZUWA 5JHDA 4JFQA 4L3EA 2HLAA 3HE7A 3B3IA 2HN7A 2P5WA 3LV3A 3FFCA 3MRBA 4V3DB 4WU7A 1BQHA 3I6KA 5DDHA 1TVBA 1AGFA 3O3AA 4NQCA 4PREA 1GZQA 2BSRA 3QI9A 2X4TA 4QRRA 1S7RA 2ZOKA 4N0FA 5C0GA 1KBGH 3BO8A 3G08A 3PQYA 2UWEA 3GSNH 3BXNA 4JQXA 4N8VA 4MXQA 4PGCA 4U1HA 5C09A 3VXNA 1Q94A 5EU3A 5C0CA 2X4QA 2WY3A 3FONA 1QQDA 4NQXA 5GSVA 3FQXA 5HGAA 3MV9A 4NSKA 1JUFA 3H9HA 5IEHA 4Y16A 3JTTA 4WUUA 4ZUUA 2VE6A 4HWZA 4L29A 2AK4A 4PJFA 2X4SA 2H6PA 3P9LA 3PWJA 3E3QA 5D9SA 1S9YA 2CIIA 5HHQA 5IM7A 3HG1A 3KPNA 5HGDA 3VXPA 3L3DA 3VXSA 1G7PA 3P4NA 1VGKA 3CZFA 5E6IC 4O2FA 3RTQA 2ZSWA 4NT6A 1FFNA 1MHCA 1EEZA 3ILPA 1P4LA 3L3JA 4NO5A 5L2KA 1OSZA 3DBXA 1QO3A 4PV8A 4ZUSA 5EFIA 1QR1A 2FYYA 3VXMA 2YPLA 1QRNA 5FDWA 1K8DA 1MWAH 2HJLA 1EXUA 1ZT7A 4F7MA 3TO4A 4PJEA 3BW9A 2H26A 3BHBA 1T0NA 5HHPA 1T1XA 3TIDA 3VFRA 5C0IA 1NANH 3L3IA 1INQA 3MRDA 3HLAA 3I6LD 2AV1A 3WS3A 1KJMA 4O2EA 1JGDA 4Y2DA 3VFMA 4U1SA 3C9NA 4MQ7A 3ARBA 3KPQA 4PRIA 5D5MA 4HUUA 5EU4A 1DDHA 3PWUA 5MEQA 3QQ3A 4UQ3A 5F9JA 3TBVA 5IB3A 3VFUA 1U58A 4G42A 3KYOA 3MRCA 3MV8A 3QUKA 5IROA 5E8OA 3RWEA 4GKSA 4JFPA 3MGTA 5HHMA 3AU1A 4PR5A 4CVZA 1WBXA 4F7CA 3FTGA 5IEKA 4U1KA 1BZ9A 2F53A 3BWAA 5C0EA 3L3KA 3M1BA 3VJ6A 1S7VA 4ONOA 1JHTA 5E9DA 4Y4KA 3BZFA 3BP7A 4U6YA 5C0AA 3JVGA 3X13A 3PABA 5EUOA 4Z77A 1WBZA 1S7XA 3TFKA 4K71B 3O8XA 3BH9A 1AKJA 3MRQA 3VXRA 3QQ4A 3GSUA 4L8SC 5ACZA 4X6CA 3B6SA 5INDA 3BZEA 2XFXA 3RL2A 3P4MA 5SWZA 3QFDA 3MRMA 4JFEA 3GSRA 4N0CA 4UQ2A 2AKRA 1ONQA 4MVBA 3KXFA 1T1YA 3OX8A 4Z78A 2F54A 3SKOA 3T1FA 4ELMA 4NO2A 3RWFA 4MJIA 4O2CA 3TF7A 2BNQA 1B0RA 3V5KA 3PWPA 2MHAA 3PWNA 3ARGA 4U1IA 4WO4A 4PJ5A 1C16A 1LEKA 3I6GA 3MR9A 3QDMA 5MEOA 3L3HA 3O3EA 4WW2C 1CG9A 3LN4A 1HYRC 1ZVSA 4PJ7A 2CLRA 1HSAA 2BVOA 3KPLA 3MYJA 3VCLA 4CVXA 1JGEA 1KJ2H 3VFNA 4L8BA 4E5XA 1FZJA 2NW3A 3DX6A 2A83A 5EU5A 4IIQC 5DEGA 3VFPA 4EN3C 3KPMA 5GSRA 1XR8A 3O4LA 3OV6A 4LHUA 3UBXA 4PJIA 4X6DA 3HE6A 1LD9A 3QULA 3SDAA 3GJFA 5D7JC 3RWCA 4E0RA 2ZOLA 3GSWA 4ZFZA 2C7UA 3W39A 3E6FA 2VABA 3TBSA 4JFOA 5C08A 4QRTA 3RUGA 3MRNA 1DE4A 1WBYA 1K5NA 4L8CA 4G43A 3QDJA 1QSEA 3FOMA 4G9FA 3L9RA 5J1AA 1ZHLA 1B3JA 1QVOA 1T1ZA 3LKPA 3GIVA 5BJTA 3DX7A 1OF2A 3VFVA 1AGCA 1DUZA 2AXGA 3DX8A 3L3GA 3TBTA 3VWJA 2FZ3A 4PDCE 3HCVA 1LEGA 3VXUA 3SPVA 1QLFA 3SJVA 3FT4A 1RJZA 3U0PA 5B38A 2BSTA 2V2XA 5D7IA 5IB4A 1UXSA 1TMCA 1DUYA 3VFTA 3SDCA 4QRUA 1T22A 3TBYA 3LKSA 1M05A 4PV9A 3GSQA 1T80A 3VH8A 4IHOA 5E8PA 3NFNA 5BS0A 3KLAA 5HHOA 4Y4HA 3MRPA 3QFJA 3BH8A 3IT8D 3BVNA 1HHKA 3GSXA 4N5EA 4QOKA 4U1JA 1N3NA 3RL1A 4PRHA 2HJKA 1JF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B39 A;  4GUP A;  5SWQ A;  2DYP A;  1TVH A;  2JCC A;  5E00 A;  3KYN A;  4PGB A;  5J6H A;  1W0W A;  3LKQ A;  5L2J A;  4L4T A;  1E28 A;  3MRH A;  4HUX A;  3RWI A;  3UTT A;  4HS3 A;  3E6H A;  3PWL A;  4PGE A;  4NNX A;  1IM3 A;  5EOT A;  1RK1 A;  3KPS A;  4JFF A;  2BCK A;  4L3C A;  5E8N A;  4NNY A;  3HPJ A;  1KPR A;  4GKN A;  4HV8 A;  5DEF A;  3HAE A;  4L4V A;  1FFP A;  3FRU A;  4JRY A;  3QUX A;  3GMM A;  4PJH A;  5C0B A;  4QRP A;  2BSS A;  2BVP A;  1B0G A;  2CLV A;  4WDI A;  1HHG A;  5ISZ A;  4QRS A;  1AGD A;  3D2U A;  3D18 A;  4PJX A;  4PG2 A;  1A9E A;  4LNR A;  4PJA A;  3PWV A;  3SDX A;  3QUZ A;  5FA4 A;  3S6C A;  1S7Q A;  5BRZ A;  3VFO A;  4S0U C;  3BGM A;  4U6X A;  3BEV A;  3ARF A;  3BEW A;  2VLL A;  4MJ5 A;  1KJ3 H;  4PJ8 A;  1MHE A;  3P77 A;  4D0C A;  3WUW A;  1S9W A;  3W0W A;  1SYV A;  1N59 A;  1FO0 H;  2GUO A;  3P4O A;  3RWJ A;  4PRN A;  5IVX A;  1JFM A;  3FQN A;  1VAD A;  1AGB A;  4FTV A;  3RWG A;  3GMO A;  1T1W A;  3MV7 A;  3KWW A;  4EI5 A;  1A9B A;  3MRI A;  5AD0 A;  4U1N A;  1MI5 A;  3GMR A;  1X7Q A;  4ZAK A;  1CE6 A;  1KCG C;  3KPR A;  2X4O A;  4WJ5 A;  3WL9 A;  2X4R A;  1FFO A;  3FQU A;  3HUJ A;  3RWD A;  1T0M A;  5EU6 A;  1NEZ A;  1I1A A;  1M6O A;  3UTQ A;  3VFS A;  1T7Y A;  3D3V A;  2GJ6 A;  4PRA A;  3QDG A;  3FQR A;  4K7F A;  1QEW A;  1P1Z A;  2OL3 H;  3UPR A;  1FZO A;  1I7R A;  4CW1 A;  3MRR A;  1EEY A;  1ZSD A;  4L8D A;  2VLR A;  3O3D A;  2VLK A;  1CD1 A;  1A1O A;  3DTX A;  2V2W A;  3P73 A;  2Q7Y A;  3MRJ A;  1ZHN A;  2PYE A;  1SYS A;  5IB1 A;  3ERY A;  3GSV A;  1JE6 A;  3SCM A;  3GMP A;  4I48 A;  4LCW A;  3UTS A;  4PJB A;  1A1N A;  4EUP A;  3MRK A;  1LK2 A;  2VAA A;  2CLZ A;  5C0J A;  1P7Q A;  3MRG A;  1KPU A;  3LKR A;  1HSB A;  4X6E A;  3KPO A;  3OXS A;  3TBW A;  3E2H A;  3VXO A;  4IRS A;  5HYJ A;  1ZT4 A;  2AV7 A;  2FIK A;  3LKN A;  5BXF A;  2CIK A;  1RK0 A;  3D39 A;  1W0V A;  4ZUT A;  3C8K A;  1G7Q A;  1A1M A;  1HHI A;  1I1Y A;  3MRF A;  4HX1 A;  4QRQ A;  5HGB A;  5INC A;  1UQS A;  4WU5 A;  5EO1 A;  4I4W A;  3X12 A;  4JRX A;  1FG2 A;  4U1L A;  3MGO A;  2D31 A;  3BP4 A;  2GAZ A;  2NX5 A;  3RZC A;  5EO0 A;  3H9S A;  3RWH A;  1N5A A;  2PO6 A;  2XPG A;  4NQE A;  1ZT1 A;  3DXA A;  5IB2 A;  4D0B A;  4FFE X;  1I7T A;  3P9M A;  1QSF A;  1A6Z A;  1GZP A;  2BNR A;  3ROL A;  1S7W A;  4APQ A;  1I7U A;  3M17 A;  1LQV A;  3TA3 A;  3BUY A;  5HHN A;  3QEQ A;  3SKM A;  1JPF A;  3ES6 A;  4N0U A;  4PG9 A;  5D2L A;  1ZS8 A;  3GSO A;  3MRO A;  3IXA A;  3WLB A;  3VRI A;  1KJV A;  5D7L A;  4PJD A;  1ED3 A;  1HHJ A;  1R3H A;  2X4U A;  3KPP A;  4G8G A;  3GMQ A;  1W72 A;  4HKJ A;  3AM8 A;  1T20 A;  4JQV A;  5MEN A;  3DMM A;  1S8D A;  4LCY A;  2X70 A;  5MER A;  3D25 A;  3GML A;  3ILQ C;  1T7V A;  1PQZ A;  5H94 A;  2VLJ A;  2GT9 A;  3FQT A;  1N2R A;  4PJC A;  5C0F A;  4WWK C;  4HUV A;  1HHH A;  3QZW A;  3V5D A;  1XH3 A;  1BII A;  1LP9 A;  2ZSV A;  4G8I A;  1NAM H;  4XXC A;  5J6G A;  1XZ0 A;  4JFD A;  4F7E A;  2X4N A;  4NO3 A;  3TVM A;  1S7T A;  1XR9 A;  2X4P A;  4F7P A;  3H7B A;  1UXW A;  5C0D A;  4ZUV A;  1ZHB A;  3GMN A;  5D2N A;  3O3B A;  5SWS A;  2E7L E;  3QUY A;  5F1I A;  2P5E A;  2GTZ A;  1FZK A;  1VAC A;  4HUW A;  2BVQ A;  3MRE A;  3TIE A;  3JTS A;  3X14 A;  3VRJ A;  2RFX A;  3VFW A;  4NQD A;  2ESV A;  1YN6 A;  4NO0 A;  1I1F A;  1Z5L A;  1KTL A;  5FA3 A;  2AXF A;  2F74 A;  4PJ9 A;  1ZHK A;  3FQW A;  4L9L C;  1KPV A;  1EFX A;  1S9X A;  1S7U A;  1T7X A;  1ZAG A;  2YPK A;  2FO4 A;  1E27 A;  4MS8 A;  4G9D A;  2FWO A;  3REW A;  5ENW A;  5IB5 A;  5MEP A;  3LN5 A;  5C9J A;  3ARD A;  3O9W A;  3RGV C;  1T7Z A;  3LKO A;  2GTW A;  5F7D A;  3ARE A;  3ECB A;  3JTC A;  3TZV C;  1I4F A;  4PRD A;  1AO7 A;  1FZM A;  1BD2 A;  1HOC A;  3CPL A;  4MNG A;  4Z76 A;  3FT3 A;  3CC5 A;  3TN0 A;  4IRJ A;  2OI9 A;  1T21 A;  4LCC C;  1RJY A;  4PRB A;  4NHU E;  1T7W A;  3CH1 A;  4MX7 A;  4PJG A;  4G59 A;  1AGE A;  1S7S A;  3WS6 A;  5C07 A;  3X11 A;  1OGT A;  1YN7 A;  1YDP A;  3ROO A;  4MJ6 A;  5F1N A;  3CVH A;  5FKP A;  3CDG A;  4PRP A;  4U1M A;  2J8U A;  3SDD A;  3FOL A;  4V3E B;  2GIT A;  4NQV A;  3T8X A;  3CCH A;  3TO2 A;  3TJH A;  3MRL A;  3VWK A;  3TPU E;  3FT2 A;  3OXR A;  4PP8 C;  4Y4F A;  1LDP H;  1YPZ A;  1IM9 A;  1OGA A;  4PGD A;  1G6R H;  3MA7 A;  4MNQ A;  3V5H A;  2CKB H;  4D0D A;  1JPG A;  5HGH A;  4X6F A;  2YEZ A;  1L8J A;  4F7T A;  4ZUW A;  5JHD A;  4JFQ A;  4L3E A;  2HLA A;  3HE7 A;  3B3I A;  2HN7 A;  2P5W A;  3LV3 A;  3FFC A;  3MRB A;  4V3D B;  4WU7 A;  1BQH A;  3I6K A;  5DDH A;  1TVB A;  1AGF A;  3O3A A;  4NQC A;  4PRE A;  1GZQ A;  2BSR A;  3QI9 A;  2X4T A;  4QRR A;  1S7R A;  2ZOK A;  4N0F A;  5C0G A;  1KBG H;  3BO8 A;  3G08 A;  3PQY A;  2UWE A;  3GSN H;  3BXN A;  4JQX A;  4N8V A;  4MXQ A;  4PGC A;  4U1H A;  5C09 A;  3VXN A;  1Q94 A;  5EU3 A;  5C0C A;  2X4Q A;  2WY3 A;  3FON A;  1QQD A;  4NQX A;  5GSV A;  3FQX A;  5HGA A;  3MV9 A;  4NSK A;  1JUF A;  3H9H A;  5IEH A;  4Y16 A;  3JTT A;  4WUU A;  4ZUU A;  2VE6 A;  4HWZ A;  4L29 A;  2AK4 A;  4PJF A;  2X4S A;  2H6P A;  3P9L A;  3PWJ A;  3E3Q A;  5D9S A;  1S9Y A;  2CII A;  5HHQ A;  5IM7 A;  3HG1 A;  3KPN A;  5HGD A;  3VXP A;  3L3D A;  3VXS A;  1G7P A;  3P4N A;  1VGK A;  3CZF A;  5E6I C;  4O2F A;  3RTQ A;  2ZSW A;  4NT6 A;  1FFN A;  1MHC A;  1EEZ A;  3ILP A;  1P4L A;  3L3J A;  4NO5 A;  5L2K A;  1OSZ A;  3DBX A;  1QO3 A;  4PV8 A;  4ZUS A;  5EFI A;  1QR1 A;  2FYY A;  3VXM A;  2YPL A;  1QRN A;  5FDW A;  1K8D A;  1MWA H;  2HJL A;  1EXU A;  1ZT7 A;  4F7M A;  3TO4 A;  4PJE A;  3BW9 A;  2H26 A;  3BHB A;  1T0N A;  5HHP A;  1T1X A;  3TID A;  3VFR A;  5C0I A;  1NAN H;  3L3I A;  1INQ A;  3MRD A;  3HLA A;  3I6L D;  2AV1 A;  3WS3 A;  1KJM A;  4O2E A;  1JGD A;  4Y2D A;  3VFM A;  4U1S A;  3C9N A;  4MQ7 A;  3ARB A;  3KPQ A;  4PRI A;  5D5M A;  4HUU A;  5EU4 A;  1DDH A;  3PWU A;  5MEQ A;  3QQ3 A;  4UQ3 A;  5F9J A;  3TBV A;  5IB3 A;  3VFU A;  1U58 A;  4G42 A;  3KYO A;  3MRC A;  3MV8 A;  3QUK A;  5IRO A;  5E8O A;  3RWE A;  4GKS A;  4JFP A;  3MGT A;  5HHM A;  3AU1 A;  4PR5 A;  4CVZ A;  1WBX A;  4F7C A;  3FTG A;  5IEK A;  4U1K A;  1BZ9 A;  2F53 A;  3BWA A;  5C0E A;  3L3K A;  3M1B A;  3VJ6 A;  1S7V A;  4ONO A;  1JHT A;  5E9D A;  4Y4K A;  3BZF A;  3BP7 A;  4U6Y A;  5C0A A;  3JVG A;  3X13 A;  3PAB A;  5EUO A;  4Z77 A;  1WBZ A;  1S7X A;  3TFK A;  4K71 B;  3O8X A;  3BH9 A;  1AKJ A;  3MRQ A;  3VXR A;  3QQ4 A;  3GSU A;  4L8S C;  5ACZ A;  4X6C A;  3B6S A;  5IND A;  3BZE A;  2XFX A;  3RL2 A;  3P4M A;  5SWZ A;  3QFD A;  3MRM A;  4JFE A;  3GSR A;  4N0C A;  4UQ2 A;  2AKR A;  1ONQ A;  4MVB A;  3KXF A;  1T1Y A;  3OX8 A;  4Z78 A;  2F54 A;  3SKO A;  3T1F A;  4ELM A;  4NO2 A;  3RWF A;  4MJI A;  4O2C A;  3TF7 A;  2BNQ A;  1B0R A;  3V5K A;  3PWP A;  2MHA A;  3PWN A;  3ARG A;  4U1I A;  4WO4 A;  4PJ5 A;  1C16 A;  1LEK A;  3I6G A;  3MR9 A;  3QDM A;  5MEO A;  3L3H A;  3O3E A;  4WW2 C;  1CG9 A;  3LN4 A;  1HYR C;  1ZVS A;  4PJ7 A;  2CLR A;  1HSA A;  2BVO A;  3KPL A;  3MYJ A;  3VCL A;  4CVX A;  1JGE A;  1KJ2 H;  3VFN A;  4L8B A;  4E5X A;  1FZJ A;  2NW3 A;  3DX6 A;  2A83 A;  5EU5 A;  4IIQ C;  5DEG A;  3VFP A;  4EN3 C;  3KPM A;  5GSR A;  1XR8 A;  3O4L A;  3OV6 A;  4LHU A;  3UBX A;  4PJI A;  4X6D A;  3HE6 A;  1LD9 A;  3QUL A;  3SDA A;  3GJF A;  5D7J C;  3RWC A;  4E0R A;  2ZOL A;  3GSW A;  4ZFZ A;  2C7U A;  3W39 A;  3E6F A;  2VAB A;  3TBS A;  4JFO A;  5C08 A;  4QRT A;  3RUG A;  3MRN A;  1DE4 A;  1WBY A;  1K5N A;  4L8C A;  4G43 A;  3QDJ A;  1QSE A;  3FOM A;  4G9F A;  3L9R A;  5J1A A;  1ZHL A;  1B3J A;  1QVO A;  1T1Z A;  3LKP A;  3GIV A;  5BJT A;  3DX7 A;  1OF2 A;  3VFV A;  1AGC A;  1DUZ A;  2AXG A;  3DX8 A;  3L3G A;  3TBT A;  3VWJ A;  2FZ3 A;  4PDC E;  3HCV A;  1LEG A;  3VXU A;  3SPV A;  1QLF A;  3SJV A;  3FT4 A;  1RJZ A;  3U0P A;  5B38 A;  2BST A;  2V2X A;  5D7I A;  5IB4 A;  1UXS A;  1TMC A;  1DUY A;  3VFT A;  3SDC A;  4QRU A;  1T22 A;  3TBY A;  3LKS A;  1M05 A;  4PV9 A;  3GSQ A;  1T80 A;  3VH8 A;  4IHO A;  5E8P A;  3NFN A;  5BS0 A;  3KLA A;  5HHO A;  4Y4H A;  3MRP A;  3QFJ A;  3BH8 A;  3IT8 D;  3BVN A;  1HHK A;  3GSX A;  4N5E A;  4QOK A;  4U1J A;  1N3N A;  3RL1 A;  4PRH A;  2HJK A;  1JF1 A; 
#chains in the Genus database with same CATH topology
 5B39 A;  4GUP A;  5SWQ A;  2DYP A;  1TVH A;  2JCC A;  5E00 A;  3KYN A;  4PGB A;  5J6H A;  1W0W A;  3LKQ A;  5L2J A;  4L4T A;  1E28 A;  3MRH A;  4HUX A;  3RWI A;  3UTT A;  4HS3 A;  3E6H A;  3PWL A;  4PGE A;  4NNX A;  1IM3 A;  5EOT A;  1RK1 A;  3KPS A;  4JFF A;  2BCK A;  4L3C A;  5E8N A;  4NNY A;  3HPJ A;  1KPR A;  4GKN A;  4HV8 A;  5DEF A;  3HAE A;  4L4V A;  1FFP A;  3FRU A;  4JRY A;  3QUX A;  3GMM A;  4PJH A;  5C0B A;  4QRP A;  2BSS A;  2BVP A;  1B0G A;  2CLV A;  4WDI A;  1HHG A;  5ISZ A;  4QRS A;  1AGD A;  3D2U A;  3D18 A;  4PJX A;  4PG2 A;  1A9E A;  4LNR A;  4PJA A;  3PWV A;  3SDX A;  3QUZ A;  5FA4 A;  3S6C A;  1S7Q A;  5BRZ A;  3VFO A;  4S0U C;  3BGM A;  4U6X A;  3BEV A;  3ARF A;  3BEW A;  2VLL A;  4MJ5 A;  1KJ3 H;  4PJ8 A;  1MHE A;  3P77 A;  4D0C A;  3WUW A;  1S9W A;  3W0W A;  1SYV A;  1N59 A;  1FO0 H;  2GUO A;  3P4O A;  3RWJ A;  4PRN A;  5IVX A;  1JFM A;  3FQN A;  1VAD A;  1AGB A;  4FTV A;  3RWG A;  3GMO A;  1T1W A;  3MV7 A;  3KWW A;  4EI5 A;  1A9B A;  3MRI A;  5AD0 A;  4U1N A;  1MI5 A;  3GMR A;  1X7Q A;  4ZAK A;  1CE6 A;  1KCG C;  3KPR A;  2X4O A;  4WJ5 A;  3WL9 A;  2X4R A;  1FFO A;  3FQU A;  3HUJ A;  3RWD A;  1T0M A;  5EU6 A;  1NEZ A;  1I1A A;  1M6O A;  3UTQ A;  3VFS A;  1T7Y A;  3D3V A;  2GJ6 A;  4PRA A;  3QDG A;  3FQR A;  4K7F A;  1QEW A;  1P1Z A;  2OL3 H;  3UPR A;  3I0T A;  1FZO A;  1I7R A;  4BKW A;  4CW1 A;  3MRR A;  1EEY A;  1ZSD A;  4L8D A;  2VLR A;  3O3D A;  2VLK A;  1CD1 A;  1A1O A;  3DTX A;  2V2W A;  3P73 A;  2Q7Y A;  3MRJ A;  1ZHN A;  2PYE A;  1SYS A;  5IB1 A;  3ERY A;  3GSV A;  1JE6 A;  3SCM A;  3GMP A;  4I48 A;  4LCW A;  3UTS A;  4PJB A;  1A1N A;  4EUP A;  3MRK A;  1LK2 A;  2VAA A;  2CLZ A;  5C0J A;  1P7Q A;  3MRG A;  1KPU A;  3LKR A;  1HSB A;  4X6E A;  3KPO A;  3OXS A;  3TBW A;  3E2H A;  3VXO A;  4IRS A;  5HYJ A;  1ZT4 A;  2AV7 A;  2FIK A;  3LKN A;  5BXF A;  2CIK A;  1RK0 A;  3D39 A;  1W0V A;  4ZUT A;  3C8K A;  1G7Q A;  1A1M A;  2O5N A;  1HHI A;  1I1Y A;  3MRF A;  4HX1 A;  4QRQ A;  5HGB A;  5INC A;  1UQS A;  4WU5 A;  5EO1 A;  4I4W A;  3X12 A;  4JRX A;  1FG2 A;  4U1L A;  3MGO A;  2D31 A;  3BP4 A;  2GAZ A;  2NX5 A;  3RZC A;  5EO0 A;  3H9S A;  3RWH A;  1N5A A;  2PO6 A;  2XPG A;  4NQE A;  1ZT1 A;  3DXA A;  5IB2 A;  4D0B A;  4FFE X;  1I7T A;  3P9M A;  1QSF A;  1A6Z A;  1GZP A;  2BNR A;  3ROL A;  1S7W A;  4APQ A;  1I7U A;  3M17 A;  1LQV A;  3TA3 A;  3BUY A;  5HHN A;  3QEQ A;  3SKM A;  1JPF A;  3ES6 A;  4N0U A;  4PG9 A;  5D2L A;  1ZS8 A;  3GSO A;  3MRO A;  3IXA A;  3WLB A;  3VRI A;  1KJV A;  5D7L A;  4PJD A;  1ED3 A;  1HHJ A;  1R3H A;  2X4U A;  3KPP A;  4G8G A;  3GMQ A;  1W72 A;  4HKJ A;  3AM8 A;  1T20 A;  4JQV A;  5MEN A;  2NYK A;  3DMM A;  1S8D A;  4LCY A;  2X70 A;  5MER A;  3D25 A;  3GML A;  3ILQ C;  1T7V A;  1PQZ A;  5H94 A;  2VLJ A;  2GT9 A;  3FQT A;  1N2R A;  4PJC A;  5C0F A;  4WWK C;  4HUV A;  1HHH A;  3QZW A;  3V5D A;  1XH3 A;  1BII A;  1LP9 A;  2ZSV A;  4G8I A;  1NAM H;  4XXC A;  5J6G A;  1XZ0 A;  4JFD A;  4F7E A;  2X4N A;  4NO3 A;  3TVM A;  1S7T A;  1XR9 A;  2X4P A;  4F7P A;  3H7B A;  1UXW A;  5C0D A;  4ZUV A;  1ZHB A;  3GMN A;  5D2N A;  3O3B A;  5SWS A;  2E7L E;  3QUY A;  5F1I A;  2P5E A;  2GTZ A;  1FZK A;  1VAC A;  4HUW A;  2BVQ A;  3MRE A;  3TIE A;  3JTS A;  3X14 A;  3VRJ A;  2RFX A;  3VFW A;  4NQD A;  2ESV A;  1YN6 A;  4NO0 A;  1I1F A;  1Z5L A;  1KTL A;  5FA3 A;  2AXF A;  2F74 A;  4PJ9 A;  1ZHK A;  3FQW A;  4L9L C;  1KPV A;  1EFX A;  1S9X A;  1S7U A;  1T7X A;  1ZAG A;  2YPK A;  2FO4 A;  4G59 C;  1E27 A;  4MS8 A;  4G9D A;  2FWO A;  3REW A;  5ENW A;  5IB5 A;  5MEP A;  3LN5 A;  5C9J A;  3ARD A;  3O9W A;  3RGV C;  1T7Z A;  3LKO A;  2GTW A;  5F7D A;  3ARE A;  3ECB A;  3JTC A;  3TZV C;  1I4F A;  4PRD A;  1AO7 A;  1FZM A;  3CPL A;  1BD2 A;  1HOC A;  4MNG A;  4Z76 A;  3FT3 A;  3CC5 A;  3TN0 A;  4IRJ A;  2OI9 A;  1T21 A;  4LCC C;  1RJY A;  4PRB A;  4NHU E;  1T7W A;  3CH1 A;  4MX7 A;  4PJG A;  4G59 A;  1AGE A;  1S7S A;  3WS6 A;  5C07 A;  3X11 A;  1OGT A;  1YN7 A;  1YDP A;  3ROO A;  4MJ6 A;  5F1N A;  3CVH A;  5FKP A;  3CDG A;  4PRP A;  4U1M A;  2J8U A;  3SDD A;  3FOL A;  4V3E B;  2GIT A;  4NQV A;  3T8X A;  3CCH A;  3TO2 A;  3TJH A;  3MRL A;  3VWK A;  3TPU E;  3FT2 A;  3OXR A;  4PP8 C;  4Y4F A;  1LDP H;  1YPZ A;  1IM9 A;  1OGA A;  4PGD A;  1G6R H;  3MA7 A;  4MNQ A;  3V5H A;  2CKB H;  4D0D A;  1JPG A;  5HGH A;  4X6F A;  2YEZ A;  1L8J A;  4F7T A;  4ZUW A;  5JHD A;  4JFQ A;  4L3E A;  2HLA A;  3HE7 A;  3B3I A;  2HN7 A;  2P5W A;  3LV3 A;  3FFC A;  3MRB A;  4V3D B;  4WU7 A;  1BQH A;  3I6K A;  5DDH A;  1TVB A;  1AGF A;  3O3A A;  4NQC A;  4PRE A;  1GZQ A;  2BSR A;  3QI9 A;  2X4T A;  4QRR A;  1S7R A;  2ZOK A;  4N0F A;  5C0G A;  1KBG H;  3BO8 A;  3G08 A;  3PQY A;  2UWE A;  3GSN H;  3BXN A;  4JQX A;  4N8V A;  4MXQ A;  4PGC A;  4U1H A;  5C09 A;  3VXN A;  1Q94 A;  5EU3 A;  5C0C A;  2X4Q A;  2WY3 A;  3FON A;  1QQD A;  4NQX A;  5GSV A;  3FQX A;  5HGA A;  3MV9 A;  4NSK A;  1JUF A;  3H9H A;  5IEH A;  4Y16 A;  3JTT A;  4WUU A;  4ZUU A;  2VE6 A;  4HWZ A;  4L29 A;  2AK4 A;  4PJF A;  2X4S A;  2H6P A;  3P9L A;  3PWJ A;  3E3Q A;  5D9S A;  1S9Y A;  2CII A;  5HHQ A;  5IM7 A;  3HG1 A;  3KPN A;  5HGD A;  3VXP A;  3L3D A;  3VXS A;  1G7P A;  3P4N A;  1VGK A;  3CZF A;  5E6I C;  4O2F A;  3RTQ A;  2ZSW A;  4NT6 A;  1FFN A;  1MHC A;  1EEZ A;  3ILP A;  1P4L A;  3L3J A;  4NO5 A;  5L2K A;  1OSZ A;  3DBX A;  1QO3 A;  4PV8 A;  4ZUS A;  5EFI A;  1QR1 A;  2FYY A;  3VXM A;  2YPL A;  1QRN A;  5FDW A;  1K8D A;  1MWA H;  2HJL A;  1EXU A;  1ZT7 A;  4F7M A;  3TO4 A;  4PJE A;  3BW9 A;  2H26 A;  3BHB A;  1T0N A;  5HHP A;  1T1X A;  3TID A;  3VFR A;  5C0I A;  1NAN H;  3L3I A;  1INQ A;  3MRD A;  3HLA A;  3I6L D;  2AV1 A;  3WS3 A;  1KJM A;  4O2E A;  1JGD A;  4Y2D A;  3VFM A;  4U1S A;  3C9N A;  4MQ7 A;  3ARB A;  3KPQ A;  4PRI A;  5D5M A;  4HUU A;  5EU4 A;  1DDH A;  3PWU A;  5MEQ A;  3QQ3 A;  4UQ3 A;  5F9J A;  3TBV A;  5IB3 A;  3VFU A;  1U58 A;  4G42 A;  3KYO A;  3MRC A;  3MV8 A;  3QUK A;  5IRO A;  5E8O A;  3RWE A;  4GKS A;  4JFP A;  2IA1 A;  3MGT A;  3AU1 A;  5HHM A;  4PR5 A;  4CVZ A;  1WBX A;  4F7C A;  3FTG A;  5IEK A;  4U1K A;  1BZ9 A;  2F53 A;  3BWA A;  5C0E A;  3L3K A;  3M1B A;  3VJ6 A;  1S7V A;  4ONO A;  1JHT A;  5E9D A;  4Y4K A;  3BZF A;  3BP7 A;  4U6Y A;  5C0A A;  3JVG A;  3X13 A;  3PAB A;  5EUO A;  4Z77 A;  1WBZ A;  1S7X A;  3TFK A;  4K71 B;  3O8X A;  3BH9 A;  1AKJ A;  3MRQ A;  3VXR A;  3QQ4 A;  3GSU A;  4L8S C;  5ACZ A;  4X6C A;  3B6S A;  5IND A;  3BZE A;  2XFX A;  3RL2 A;  3P4M A;  4JO8 A;  5SWZ A;  3QFD A;  3MRM A;  4JFE A;  3GSR A;  4N0C A;  4UQ2 A;  2AKR A;  1ONQ A;  4MVB A;  3KXF A;  1T1Y A;  3OX8 A;  4Z78 A;  2F54 A;  3SKO A;  3T1F A;  4ELM A;  4NO2 A;  3RWF A;  4MJI A;  4O2C A;  3TF7 A;  2BNQ A;  1B0R A;  3V5K A;  3PWP A;  2MHA A;  3PWN A;  3ARG A;  4U1I A;  4WO4 A;  4PJ5 A;  1C16 A;  1LEK A;  3I6G A;  3MR9 A;  3QDM A;  5MEO A;  3L3H A;  3O3E A;  4WW2 C;  1CG9 A;  3LN4 A;  1HYR C;  1ZVS A;  4PJ7 A;  2CLR A;  1HSA A;  2BVO A;  3KPL A;  3MYJ A;  3VCL A;  4CVX A;  1JGE A;  1KJ2 H;  3VFN A;  4L8B A;  4E5X A;  1FZJ A;  2NW3 A;  3DX6 A;  2A83 A;  5EU5 A;  4IIQ C;  5DEG A;  3VFP A;  4EN3 C;  3KPM A;  5GSR A;  1XR8 A;  3O4L A;  3OV6 A;  4LHU A;  3UBX A;  4PJI A;  4X6D A;  3HE6 A;  1LD9 A;  3QUL A;  3SDA A;  3GJF A;  5D7J C;  3RWC A;  4E0R A;  2ZOL A;  3GSW A;  4ZFZ A;  2C7U A;  3W39 A;  3E6F A;  2VAB A;  3TBS A;  4JFO A;  5C08 A;  4QRT A;  3RUG A;  3MRN A;  1DE4 A;  1WBY A;  1K5N A;  4L8C A;  4G43 A;  3QDJ A;  1QSE A;  3FOM A;  4G9F A;  3L9R A;  5J1A A;  1ZHL A;  1B3J A;  1QVO A;  1T1Z A;  3LKP A;  3GIV A;  5BJT A;  3DX7 A;  1OF2 A;  3VFV A;  1AGC A;  1DUZ A;  2AXG A;  3DX8 A;  3L3G A;  3TBT A;  3VWJ A;  2FZ3 A;  4PDC E;  3HCV A;  1LEG A;  3VXU A;  3SPV A;  1QLF A;  3SJV A;  3FT4 A;  1RJZ A;  3U0P A;  5B38 A;  2BST A;  2V2X A;  5D7I A;  5IB4 A;  1UXS A;  1TMC A;  1DUY A;  3VFT A;  3SDC A;  4QRU A;  1T22 A;  3TBY A;  3LKS A;  1M05 A;  4PV9 A;  3GSQ A;  1T80 A;  3VH8 A;  4IHO A;  5E8P A;  3NFN A;  5BS0 A;  3KLA A;  5HHO A;  4Y4H A;  3MRP A;  3QFJ A;  3BH8 A;  3IT8 D;  3BVN A;  1HHK A;  3GSX A;  4N5E A;  4QOK A;  4U1J A;  1N3N A;  3RL1 A;  4PRH A;  2HJK A;  1JF1 A; 
#chains in the Genus database with same CATH homology
 5B39 A;  4GUP A;  5SWQ A;  2DYP A;  1TVH A;  2JCC A;  5E00 A;  3KYN A;  4PGB A;  5J6H A;  1W0W A;  3LKQ A;  5L2J A;  4L4T A;  1E28 A;  3MRH A;  4HUX A;  3RWI A;  3UTT A;  4HS3 A;  3E6H A;  3PWL A;  4PGE A;  4NNX A;  1IM3 A;  5EOT A;  1RK1 A;  3KPS A;  4JFF A;  2BCK A;  4L3C A;  5E8N A;  4NNY A;  3HPJ A;  1KPR A;  4GKN A;  4HV8 A;  5DEF A;  3HAE A;  4L4V A;  1FFP A;  3FRU A;  4JRY A;  3QUX A;  3GMM A;  4PJH A;  5C0B A;  4QRP A;  2BSS A;  2BVP A;  1B0G A;  2CLV A;  4WDI A;  1HHG A;  5ISZ A;  4QRS A;  1AGD A;  3D2U A;  3D18 A;  4PJX A;  4PG2 A;  1A9E A;  4LNR A;  4PJA A;  3PWV A;  3SDX A;  3QUZ A;  5FA4 A;  3S6C A;  1S7Q A;  5BRZ A;  3VFO A;  4S0U C;  3BGM A;  4U6X A;  3BEV A;  3ARF A;  3BEW A;  2VLL A;  4MJ5 A;  1KJ3 H;  4PJ8 A;  1MHE A;  3P77 A;  4D0C A;  3WUW A;  1S9W A;  3W0W A;  1SYV A;  1N59 A;  1FO0 H;  2GUO A;  3P4O A;  3RWJ A;  4PRN A;  5IVX A;  1JFM A;  3FQN A;  1VAD A;  1AGB A;  4FTV A;  3RWG A;  3GMO A;  1T1W A;  3MV7 A;  3KWW A;  4EI5 A;  1A9B A;  3MRI A;  5AD0 A;  4U1N A;  1MI5 A;  3GMR A;  1X7Q A;  4ZAK A;  1CE6 A;  1KCG C;  3KPR A;  2X4O A;  4WJ5 A;  3WL9 A;  2X4R A;  1FFO A;  3FQU A;  3HUJ A;  3RWD A;  1T0M A;  5EU6 A;  1NEZ A;  1I1A A;  1M6O A;  3UTQ A;  3VFS A;  1T7Y A;  3D3V A;  2GJ6 A;  4PRA A;  3QDG A;  3FQR A;  4K7F A;  1QEW A;  1P1Z A;  2OL3 H;  3UPR A;  1FZO A;  1I7R A;  4CW1 A;  3MRR A;  1EEY A;  1ZSD A;  4L8D A;  2VLR A;  3O3D A;  2VLK A;  1CD1 A;  1A1O A;  3DTX A;  2V2W A;  3P73 A;  2Q7Y A;  3MRJ A;  1ZHN A;  2PYE A;  1SYS A;  5IB1 A;  3ERY A;  3GSV A;  1JE6 A;  3SCM A;  3GMP A;  4I48 A;  4LCW A;  3UTS A;  4PJB A;  1A1N A;  4EUP A;  3MRK A;  1LK2 A;  2VAA A;  2CLZ A;  5C0J A;  1P7Q A;  3MRG A;  1KPU A;  3LKR A;  1HSB A;  4X6E A;  3KPO A;  3OXS A;  3TBW A;  3E2H A;  3VXO A;  4IRS A;  5HYJ A;  1ZT4 A;  2AV7 A;  2FIK A;  3LKN A;  5BXF A;  2CIK A;  1RK0 A;  3D39 A;  1W0V A;  4ZUT A;  3C8K A;  1G7Q A;  1A1M A;  1HHI A;  1I1Y A;  3MRF A;  4HX1 A;  4QRQ A;  5HGB A;  5INC A;  1UQS A;  4WU5 A;  5EO1 A;  4I4W A;  3X12 A;  4JRX A;  1FG2 A;  4U1L A;  3MGO A;  2D31 A;  3BP4 A;  2GAZ A;  2NX5 A;  3RZC A;  5EO0 A;  3H9S A;  3RWH A;  1N5A A;  2PO6 A;  2XPG A;  4NQE A;  1ZT1 A;  3DXA A;  5IB2 A;  4D0B A;  4FFE X;  1I7T A;  3P9M A;  1QSF A;  1A6Z A;  1GZP A;  2BNR A;  3ROL A;  1S7W A;  4APQ A;  1I7U A;  3M17 A;  1LQV A;  3TA3 A;  3BUY A;  5HHN A;  3QEQ A;  3SKM A;  1JPF A;  3ES6 A;  4N0U A;  4PG9 A;  5D2L A;  1ZS8 A;  3GSO A;  3MRO A;  3IXA A;  3WLB A;  3VRI A;  1KJV A;  5D7L A;  4PJD A;  1ED3 A;  1HHJ A;  1R3H A;  2X4U A;  3KPP A;  4G8G A;  3GMQ A;  1W72 A;  4HKJ A;  3AM8 A;  1T20 A;  4JQV A;  5MEN A;  3DMM A;  1S8D A;  4LCY A;  2X70 A;  5MER A;  3D25 A;  3GML A;  3ILQ C;  1T7V A;  1PQZ A;  5H94 A;  2VLJ A;  2GT9 A;  3FQT A;  1N2R A;  4PJC A;  5C0F A;  4WWK C;  4HUV A;  1HHH A;  3QZW A;  3V5D A;  1XH3 A;  1BII A;  1LP9 A;  2ZSV A;  4G8I A;  1NAM H;  4XXC A;  5J6G A;  1XZ0 A;  4JFD A;  4F7E A;  2X4N A;  4NO3 A;  3TVM A;  1S7T A;  1XR9 A;  2X4P A;  4F7P A;  3H7B A;  1UXW A;  5C0D A;  4ZUV A;  1ZHB A;  3GMN A;  5D2N A;  3O3B A;  5SWS A;  2E7L E;  3QUY A;  5F1I A;  2P5E A;  2GTZ A;  1FZK A;  1VAC A;  4HUW A;  2BVQ A;  3MRE A;  3TIE A;  3JTS A;  3X14 A;  3VRJ A;  2RFX A;  3VFW A;  4NQD A;  2ESV A;  1YN6 A;  4NO0 A;  1I1F A;  1Z5L A;  1KTL A;  5FA3 A;  2AXF A;  2F74 A;  4PJ9 A;  1ZHK A;  3FQW A;  4L9L C;  1KPV A;  1EFX A;  1S9X A;  1S7U A;  1T7X A;  1ZAG A;  2YPK A;  2FO4 A;  1E27 A;  4MS8 A;  4G9D A;  2FWO A;  3REW A;  5ENW A;  5IB5 A;  5MEP A;  3LN5 A;  5C9J A;  3ARD A;  3O9W A;  3RGV C;  1T7Z A;  3LKO A;  2GTW A;  5F7D A;  3ARE A;  3ECB A;  3JTC A;  3TZV C;  1I4F A;  4PRD A;  1AO7 A;  1FZM A;  1BD2 A;  1HOC A;  3CPL A;  4MNG A;  4Z76 A;  3FT3 A;  3CC5 A;  3TN0 A;  4IRJ A;  2OI9 A;  1T21 A;  4LCC C;  1RJY A;  4PRB A;  4NHU E;  1T7W A;  3CH1 A;  4MX7 A;  4PJG A;  4G59 A;  1AGE A;  1S7S A;  3WS6 A;  5C07 A;  3X11 A;  1OGT A;  1YN7 A;  1YDP A;  3ROO A;  4MJ6 A;  5F1N A;  3CVH A;  5FKP A;  3CDG A;  4PRP A;  4U1M A;  2J8U A;  3SDD A;  3FOL A;  4V3E B;  2GIT A;  4NQV A;  3T8X A;  3CCH A;  3TO2 A;  3TJH A;  3MRL A;  3VWK A;  3TPU E;  3FT2 A;  3OXR A;  4PP8 C;  4Y4F A;  1LDP H;  1YPZ A;  1IM9 A;  1OGA A;  4PGD A;  1G6R H;  3MA7 A;  4MNQ A;  3V5H A;  2CKB H;  4D0D A;  1JPG A;  5HGH A;  4X6F A;  2YEZ A;  1L8J A;  4F7T A;  4ZUW A;  5JHD A;  4JFQ A;  4L3E A;  2HLA A;  3HE7 A;  3B3I A;  2HN7 A;  2P5W A;  3LV3 A;  3FFC A;  3MRB A;  4V3D B;  4WU7 A;  1BQH A;  3I6K A;  5DDH A;  1TVB A;  1AGF A;  3O3A A;  4NQC A;  4PRE A;  1GZQ A;  2BSR A;  3QI9 A;  2X4T A;  4QRR A;  1S7R A;  2ZOK A;  4N0F A;  5C0G A;  1KBG H;  3BO8 A;  3G08 A;  3PQY A;  2UWE A;  3GSN H;  3BXN A;  4JQX A;  4N8V A;  4MXQ A;  4PGC A;  4U1H A;  5C09 A;  3VXN A;  1Q94 A;  5EU3 A;  5C0C A;  2X4Q A;  2WY3 A;  3FON A;  1QQD A;  4NQX A;  5GSV A;  3FQX A;  5HGA A;  3MV9 A;  4NSK A;  1JUF A;  3H9H A;  5IEH A;  4Y16 A;  3JTT A;  4WUU A;  4ZUU A;  2VE6 A;  4HWZ A;  4L29 A;  2AK4 A;  4PJF A;  2X4S A;  2H6P A;  3P9L A;  3PWJ A;  3E3Q A;  5D9S A;  1S9Y A;  2CII A;  5HHQ A;  5IM7 A;  3HG1 A;  3KPN A;  5HGD A;  3VXP A;  3L3D A;  3VXS A;  1G7P A;  3P4N A;  1VGK A;  3CZF A;  5E6I C;  4O2F A;  3RTQ A;  2ZSW A;  4NT6 A;  1FFN A;  1MHC A;  1EEZ A;  3ILP A;  1P4L A;  3L3J A;  4NO5 A;  5L2K A;  1OSZ A;  3DBX A;  1QO3 A;  4PV8 A;  4ZUS A;  5EFI A;  1QR1 A;  2FYY A;  3VXM A;  2YPL A;  1QRN A;  5FDW A;  1K8D A;  1MWA H;  2HJL A;  1EXU A;  1ZT7 A;  4F7M A;  3TO4 A;  4PJE A;  3BW9 A;  2H26 A;  3BHB A;  1T0N A;  5HHP A;  1T1X A;  3TID A;  3VFR A;  5C0I A;  1NAN H;  3L3I A;  1INQ A;  3MRD A;  3HLA A;  3I6L D;  2AV1 A;  3WS3 A;  1KJM A;  4O2E A;  1JGD A;  4Y2D A;  3VFM A;  4U1S A;  3C9N A;  4MQ7 A;  3ARB A;  3KPQ A;  4PRI A;  5D5M A;  4HUU A;  5EU4 A;  1DDH A;  3PWU A;  5MEQ A;  3QQ3 A;  4UQ3 A;  5F9J A;  3TBV A;  5IB3 A;  3VFU A;  1U58 A;  4G42 A;  3KYO A;  3MRC A;  3MV8 A;  3QUK A;  5IRO A;  5E8O A;  3RWE A;  4GKS A;  4JFP A;  3MGT A;  5HHM A;  3AU1 A;  4PR5 A;  4CVZ A;  1WBX A;  4F7C A;  3FTG A;  5IEK A;  4U1K A;  1BZ9 A;  2F53 A;  3BWA A;  5C0E A;  3L3K A;  3M1B A;  3VJ6 A;  1S7V A;  4ONO A;  1JHT A;  5E9D A;  4Y4K A;  3BZF A;  3BP7 A;  4U6Y A;  5C0A A;  3JVG A;  3X13 A;  3PAB A;  5EUO A;  4Z77 A;  1WBZ A;  1S7X A;  3TFK A;  4K71 B;  3O8X A;  3BH9 A;  1AKJ A;  3MRQ A;  3VXR A;  3QQ4 A;  3GSU A;  4L8S C;  5ACZ A;  4X6C A;  3B6S A;  5IND A;  3BZE A;  2XFX A;  3RL2 A;  3P4M A;  5SWZ A;  3QFD A;  3MRM A;  4JFE A;  3GSR A;  4N0C A;  4UQ2 A;  2AKR A;  1ONQ A;  4MVB A;  3KXF A;  1T1Y A;  3OX8 A;  4Z78 A;  2F54 A;  3SKO A;  3T1F A;  4ELM A;  4NO2 A;  3RWF A;  4MJI A;  4O2C A;  3TF7 A;  2BNQ A;  1B0R A;  3V5K A;  3PWP A;  2MHA A;  3PWN A;  3ARG A;  4U1I A;  4WO4 A;  4PJ5 A;  1C16 A;  1LEK A;  3I6G A;  3MR9 A;  3QDM A;  5MEO A;  3L3H A;  3O3E A;  4WW2 C;  1CG9 A;  3LN4 A;  1HYR C;  1ZVS A;  4PJ7 A;  2CLR A;  1HSA A;  2BVO A;  3KPL A;  3MYJ A;  3VCL A;  4CVX A;  1JGE A;  1KJ2 H;  3VFN A;  4L8B A;  4E5X A;  1FZJ A;  2NW3 A;  3DX6 A;  2A83 A;  5EU5 A;  4IIQ C;  5DEG A;  3VFP A;  4EN3 C;  3KPM A;  5GSR A;  1XR8 A;  3O4L A;  3OV6 A;  4LHU A;  3UBX A;  4PJI A;  4X6D A;  3HE6 A;  1LD9 A;  3QUL A;  3SDA A;  3GJF A;  5D7J C;  3RWC A;  4E0R A;  2ZOL A;  3GSW A;  4ZFZ A;  2C7U A;  3W39 A;  3E6F A;  2VAB A;  3TBS A;  4JFO A;  5C08 A;  4QRT A;  3RUG A;  3MRN A;  1DE4 A;  1WBY A;  1K5N A;  4L8C A;  4G43 A;  3QDJ A;  1QSE A;  3FOM A;  4G9F A;  3L9R A;  5J1A A;  1ZHL A;  1B3J A;  1QVO A;  1T1Z A;  3LKP A;  3GIV A;  5BJT A;  3DX7 A;  1OF2 A;  3VFV A;  1AGC A;  1DUZ A;  2AXG A;  3DX8 A;  3L3G A;  3TBT A;  3VWJ A;  2FZ3 A;  4PDC E;  3HCV A;  1LEG A;  3VXU A;  3SPV A;  1QLF A;  3SJV A;  3FT4 A;  1RJZ A;  3U0P A;  5B38 A;  2BST A;  2V2X A;  5D7I A;  5IB4 A;  1UXS A;  1TMC A;  1DUY A;  3VFT A;  3SDC A;  4QRU A;  1T22 A;  3TBY A;  3LKS A;  1M05 A;  4PV9 A;  3GSQ A;  1T80 A;  3VH8 A;  4IHO A;  5E8P A;  3NFN A;  5BS0 A;  3KLA A;  5HHO A;  4Y4H A;  3MRP A;  3QFJ A;  3BH8 A;  3IT8 D;  3BVN A;  1HHK A;  3GSX A;  4N5E A;  4QOK A;  4U1J A;  1N3N A;  3RL1 A;  4PRH A;  2HJK A;  1JF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...