4PP8C

Crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
168
structure length
146
Chain Sequence
HSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINATEVKKCLTQPLKNLCQKLRNKVSNTYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords NKG2-D type II integral membrane protein
total genus 42
structure length 146
sequence length 168
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pp8C00
1AGDA 4ZUTA 3ARFA 3WUWA 1I4FA 4L8CA 3MGOA 2ZSWA 2UWEA 2MHAA 5BRZA 1KJVA 4F7EA 4WW2C 2PYEA 1HHKA 2GAZA 4ELMA 4LHUA 3PQYA 5C0GA 3I6KA 3RWJA 1K8DA 1NAMH 3PWLA 5EO0A 5HHQA 2BVPA 3V5HA 1NANH 5GSVA 3PWPA 1EEYA 5C0IA 3KYNA 5DEGA 5FA3A 2XPGA 1AKJA 1JFMA 1YDPA 3ARDA 3BP7A 3GMMA 4QRRA 5BJTA 1N3NA 5F7DA 1LP9A 4L8DA 3BHBA 4IIQC 2F53A 5C0CA 1HHHA 1AGEA 3GSOA 4E5XA 4X6CA 1AGBA 3GMOA 4N0UA 1EFXA 1T1ZA 3BW9A 4MNQA 4U6YA 2X4QA 3L3JA 4JFFA 3FTGA 3LKRA 3QZWA 4G9DA 4S0UC 4U1MA 5C0DA 3TN0A 2ZSVA 3MRPA 1TMCA 4ZUUA 4K7FA 1ZHKA 5DDHA 1T1WA 3ARBA 1QRNA 3GMRA 3MRHA 3MRQA 3PABA 4O2CA 4PGEA 1DUZA 1A1OA 4L3CA 5INCA 5E8NA 3D39A 2NW3A 4PV9A 5HGAA 3MYJA 4IHOA 3GSVA 3CC5A 2AKRA 1GZPA 4MS8A 5D7LA 3RWEA 1LD9A 3MRNA 1A9EA 4IRSA 3KXFA 2F74A 4O2EA 3VXRA 1JGDA 4CW1A 5EUOA 5D9SA 4PJBA 5EU4A 2D31A 1W72A 4MNGA 5F1IA 3QDJA 3BEVA 1HSBA 2ZOKA 4NO5A 1T1XA 1Z5LA 3VXOA 3TPUE 1BD2A 1AGFA 3D2UA 3H7BA 3MR9A 3MRJA 4U1NA 1KPRA 3QUKA 1I1FA 4XXCA 1Q94A 3VXUA 3FOLA 1M6OA 1N5AA 3L9RA 5FDWA 1N2RA 4PRHA 3CH1A 1OSZA 3C8KA 3UBXA 1T7YA 3ROLA 3HG1A 1QQDA 4LCWA 3UTQA 2CLZA 5FKPA 5ACZA 1ZT7A 1VGKA 1S7SA 3CVHA 4CVXA 2CLRA 5FA4A 3T1FA 4GKNA 1QO3A 1ONQA 5SWZA 3VJ6A 1OGTA 3O3DA 4PRAA 3LN5A 2AV7A 4HV8A 5F1NA 3QDGA 3DTXA 4L4TA 5EOTA 1BIIA 3LKSA 4NQEA 4NO3A 2VLKA 4Y4KA 4ZUSA 5IVXA 4G42A 3VRJA 3PWVA 3VH8A 3UTSA 1PQZA 1B3JA 3QFJA 4APQA 3GSUA 4U1JA 1T1YA 4PJFA 1NEZA 1INQA 3KPQA 3D25A 3RWGA 5EU6A 1MHCA 2AXFA 1X7QA 2GTWA 1LQVA 4NNXA 3GMNA 3L3HA 3DBXA 3RL2A 3L3GA 2J8UA 3M17A 3AM8A 3E2HA 4PG2A 4HUUA 1S9WA 3IT8D 1W0VA 3UTTA 4QRUA 1JHTA 2BSTA 1M05A 4JQXA 3VFWA 1W0WA 4JRYA 4U1LA 3RWDA 1FO0H 1KPUA 3MRCA 4JRXA 4MXQA 4PJXA 5D2LA 3HUJA 3WS3A 2VE6A 4D0BA 3D18A 2DYPA 4NQVA 3TA3A 3TJHA 3X12A 3M1BA 1B0GA 4MQ7A 1BZ9A 5DEFA 3QUZA 2OL3H 5C0JA 2X70A 3TBYA 2E7LE 3VWJA 1S7UA 4ZFZA 5J6HA 4HKJA 5D2NA 5E8OA 5BS0A 1S9XA 3BXNA 3KPSA 4PJEA 4Y4FA 2GT9A 4FFEX 4L29A 3O9WA 1FZOA 2GITA 5C07A 2HJKA 1WBXA 2AV1A 4Z77A 1EXUA 4PP8C 3P73A 3BVNA 3FQRA 4G8IA 4MVBA 5B38A 3MRRA 3TO4A 3SKOA 1HOCA 3VFNA 3O4LA 1S8DA 2P5WA 4JFPA 1ED3A 4PGBA 1DE4A 1K5NA 3HE7A 1QVOA 3L3IA 4PRNA 1T22A 4NQXA 3DX8A 4U1IA 5E00A 5C9JA 5SWQA 3MV9A 3TFKA 1FZMA 4ONOA 3X14A 5AD0A 5E8PA 4PREA 4O2FA 4PRPA 3SJVA 3MGTA 2YEZA 1C16A 1IM9A 1T7VA 2V2WA 3KPPA 1S7WA 3P4MA 4U1KA 3GSQA 4QRQA 3BO8A 5IM7A 1UXSA 1TVHA 1E27A 4LNRA 2H26A 3GSWA 3H9HA 1T80A 3MROA 4JFQA 3BH8A 2HN7A 4U1HA 5HHNA 2VABA 5C0BA 1QSEA 1SYVA 3MRIA 4QRSA 3KYOA 5F9JA 4PG9A 5HGDA 2VLLA 2BVQA 1SYSA 4PDCE 3E6FA 4WU5A 5IEHA 3BGMA 3SDDA 4EUPA 3DX7A 5C0FA 3GMLA 1MHEA 4X6FA 3QUYA 5IB1A 1A6ZA 3FQXA 1FZKA 1YPZA 3TBWA 4GKSA 4I48A 5L2KA 1JE6A 2RFXA 1QR1A 3SPVA 3FOMA 1CG9A 3MRFA 4D0DA 3I6GA 3FQNA 3L3KA 3VFPA 5C09A 1N59A 3HAEA 4PRIA 4WWKC 3P9MA 1FFPA 3OXRA 2XFXA 4MJ5A 3RUGA 1AO7A 3GSXA 3MRGA 3V5KA 4PRBA 3ES6A 3RZCA 4HX1A 3BP4A 3H9SA 2HLAA 3MRMA 3QQ3A 4Y16A 4X6EA 3IXAA 4N0CA 1XR8A 2F54A 4PGDA 3RWFA 3U0PA 4X6DA 3GSNH 4ZAKA 4ZUVA 5IB2A 3MREA 4L9LC 1RJYA 5C0AA 3TVMA 2BSRA 4PJ9A 1AGCA 3ILQC 3WL9A 1VADA 3RTQA 1JUFA 4MJ6A 1XR9A 4JFOA 4PGCA 3B6SA 3E6HA 1T7WA 3FFCA 1R3HA 4NO0A 4U6XA 4WO4A 4G59A 2JCCA 4PJAA 1FFNA 1HHJA 5H94A 2A83A 3B3IA 1JF1A 3CZFA 3TBTA 3W0WA 4F7MA 5D7JC 3GIVA 5EU5A 5D7IA 1FG2A 4QRTA 5MEPA 1A1MA 1CD1A 3KPNA 4D0CA 3HE6A 4GUPA 3FT2A 3JTCA 4NNYA 4F7CA 1YN7A 1ZT1A 3O3EA 1A1NA 2FIKA 3HPJA 1GZQA 2VLRA 1UQSA 4QRPA 5B39A 3VFUA 5BXFA 1FZJA 2X4OA 4PR5A 1P1ZA 2CIKA 1S7TA 4ZUWA 1G7QA 3VCLA 1ZVSA 3LKQA 3TIDA 2BVOA 1KBGH 3FQUA 1TVBA 2OI9A 3X13A 1KJMA 1U58A 3P77A 5HHOA 3RWCA 3VXMA 1KCGC 4N8VA 5IB5A 3PWUA 4Y4HA 3TZVC 4G9FA 3RGVC 3MV8A 4LCCC 4WUUA 5EFIA 1LEKA 4NT6A 3VFRA 4Z78A 2GJ6A 2X4UA 3NFNA 3FQTA 3X11A 3KWWA 1I7UA 2C7UA 2BNRA 3KPMA 3RWIA 4Z76A 4EN3C 3QULA 1ZT4A 1IM3A 4MX7A 4HUVA 3JTSA 1WBYA 3GJFA 2X4RA 4Y2DA 5J1AA 1BQHA 4NQDA 3REWA 1ZHLA 5HYJA 4PJHA 3RWHA 3L3DA 3MRLA 5HHPA 4JFDA 3DMMA 1CE6A 3TIEA 5C08A 1L8JA 3KPOA 4MJIA 4PV8A 1JGEA 4PJCA 2FZ3A 3GMQA 4PJ5A 4HS3A 3SDAA 3PWNA 1JPFA 3VFSA 5E9DA 1EEZA 3MA7A 3MV7A 1S9YA 5HGHA 3FONA 4WJ5A 3TO2A 2YPKA 4V3DB 5SWSA 1KJ3H 4G43A 1DUYA 1S7VA 2BCKA 5ENWA 1QSFA 3QDMA 3DXAA 1HSAA 1KJ2H 1YN6A 1XH3A 3HCVA 4HWZA 2VLJA 3JTTA 4PJDA 2X4NA 2WY3A 2FYYA 1DDHA 2X4TA 3GSRA 1T20A 1OF2A 1ZAGA 1HHIA 3S6CA 3P9LA 3ECBA 3VXPA 3VFVA 3MRBA 3HLAA 2BNQA 3D3VA 1WBZA 4V3EB 2ZOLA 2X4SA 1HYRC 4EI5A 3BZFA 3ERYA 5C0EA 4JQVA 1FFOA 1G6RH 4WDIA 3ILPA 4JFEA 3VXNA 2CIIA 5HHMA 3ROOA 1ZSDA 1I7RA 1JPGA 3QUXA 4IRJA 3TBVA 5IEKA 1LEGA 1RK0A 4PJ7A 1S7QA 5EU3A 5L2JA 4E0RA 3TF7A 5JHDA 2V2XA 1I1AA 3P4OA 1KPVA 2CKBH 3MRDA 3ARGA 5HGBA 3QQ4A 5E6IC 3FRUA 3T8XA 4FTVA 1MI5A 3BUYA 4N0FA 2AXGA 4L4VA 2P5EA 3TBSA 5MENA 4F7PA 3FQWA 1XZ0A 3SDXA 5MERA 3KPLA 4NQCA 1LDPH 1ZS8A 3AREA 3FT4A 1S7RA 3C9NA 3SKMA 5GSRA 1UXWA 2H6PA 3OX8A 3W39A 3BWAA 3VFOA 3WS6A 3VFTA 5IB4A 3CDGA 3G08A 2VAAA 2Q7YA 1I7TA 1HHGA 1KTLA 3MRKA 3I6LD 1LK2A 1P7QA 4PJGA 4PJIA 3E3QA 2HJLA 4N5EA 3SCMA 3PWJA 1B0RA 3QFDA 3QI9A 4HUWA 3UPRA 3FT3A 1RK1A 4L8BA 3AU1A 4I4WA 2NX5A 1A9BA 3BEWA 1VACA 4L3EA 3WLBA 4G8GA 3O3BA 1T0MA 2CLVA 4QOKA 3OV6A 1P4LA 1I1YA 2PO6A 3OXSA 4PJ8A 3O3AA 5IROA 5IB3A 5MEOA 3LV3A 2GUOA 3DX6A 5ISZA 3V5DA 3VWKA 2BSSA 4U1SA 2GTZA 3JVGA 5J6GA 5D5MA 4NO2A 3QEQA 3VXSA 1ZHNA 3KPRA 1S7XA 2YPLA 1T0NA 2FO4A 3LN4A 3GMPA 5INDA 2X4PA 3BZEA 3O8XA 3P4NA 4NSKA 3CPLA 4UQ3A 1RJZA 3LKOA 3CCHA 3LKNA 2AK4A 3SDCA 1ZHBA 1T7XA 3BH9A 3VFMA 4CVZA 4PRDA 1T7ZA 5EO1A 1T21A 3KLAA 4LCYA 3LKPA 4F7TA 1E28A 2FWOA 1MWAH 1OGAA 2ESVA 4UQ2A 1QEWA 4K71B 3VRIA 1G7PA 4WU7A 3RL1A 4NHUE 4L8SC 1QLFA 4HUXA 5MEQA
chains in the Genus database with same CATH superfamily
1AGDA 4ZUTA 3ARFA 3WUWA 1I4FA 4L8CA 3MGOA 2ZSWA 2UWEA 2MHAA 5BRZA 1KJVA 4F7EA 4WW2C 2PYEA 1HHKA 2GAZA 4ELMA 4LHUA 3PQYA 5C0GA 3I6KA 3RWJA 1K8DA 1NAMH 3I0TA 3PWLA 5EO0A 2BVPA 5HHQA 3V5HA 1NANH 5GSVA 3PWPA 1EEYA 5C0IA 3KYNA 5DEGA 5FA3A 2XPGA 1AKJA 1JFMA 1YDPA 3ARDA 3BP7A 3GMMA 4QRRA 5BJTA 1N3NA 5F7DA 1LP9A 4L8DA 3BHBA 4IIQC 2F53A 5C0CA 1HHHA 1AGEA 3GSOA 4E5XA 4X6CA 1AGBA 3GMOA 4N0UA 1EFXA 1T1ZA 3BW9A 4MNQA 4U6YA 2X4QA 3L3JA 4JFFA 3FTGA 3LKRA 3QZWA 4G9DA 4S0UC 4U1MA 5C0DA 3TN0A 2ZSVA 3MRPA 1TMCA 4ZUUA 4K7FA 1ZHKA 5DDHA 1T1WA 3ARBA 1QRNA 3GMRA 3MRHA 3MRQA 3PABA 4O2CA 4PGEA 1DUZA 1A1OA 4L3CA 5INCA 5E8NA 3D39A 2NW3A 4PV9A 5HGAA 3MYJA 4IHOA 3GSVA 3CC5A 2AKRA 1GZPA 4MS8A 5D7LA 3RWEA 1LD9A 3MRNA 1A9EA 4IRSA 3KXFA 2F74A 4O2EA 3VXRA 1JGDA 4CW1A 5EUOA 5D9SA 4PJBA 5EU4A 2D31A 1W72A 4MNGA 5F1IA 3QDJA 3BEVA 1HSBA 2ZOKA 4NO5A 1T1XA 1Z5LA 3VXOA 3TPUE 1BD2A 1AGFA 3D2UA 3H7BA 3MR9A 3MRJA 4U1NA 1KPRA 3QUKA 1I1FA 4XXCA 1Q94A 3VXUA 3FOLA 1M6OA 1N5AA 3L9RA 5FDWA 4JO8A 1N2RA 4PRHA 3CH1A 1OSZA 3C8KA 3UBXA 1T7YA 3ROLA 3HG1A 1QQDA 4LCWA 3UTQA 2CLZA 5FKPA 5ACZA 1ZT7A 1VGKA 1S7SA 3CVHA 4CVXA 2CLRA 5FA4A 3T1FA 4GKNA 1QO3A 1ONQA 5SWZA 3VJ6A 1OGTA 3O3DA 4PRAA 3LN5A 2AV7A 4HV8A 5F1NA 3QDGA 3DTXA 4L4TA 5EOTA 1BIIA 3LKSA 4NQEA 4NO3A 2VLKA 4Y4KA 4ZUSA 5IVXA 4G42A 3VRJA 3PWVA 3VH8A 3UTSA 1PQZA 1B3JA 3QFJA 4APQA 3GSUA 4U1JA 1T1YA 4PJFA 1NEZA 1INQA 3KPQA 3D25A 3RWGA 5EU6A 1MHCA 2AXFA 1X7QA 2GTWA 1LQVA 4NNXA 3GMNA 3L3HA 3DBXA 3RL2A 3L3GA 2J8UA 3M17A 3AM8A 3E2HA 4PG2A 4HUUA 1S9WA 3IT8D 1W0VA 3UTTA 4QRUA 1JHTA 2BSTA 1M05A 4JQXA 3VFWA 1W0WA 4JRYA 4U1LA 3RWDA 1FO0H 1KPUA 3MRCA 4JRXA 4MXQA 4PJXA 5D2LA 3HUJA 3WS3A 2VE6A 4D0BA 3D18A 2DYPA 4NQVA 3TA3A 3TJHA 3X12A 3M1BA 1B0GA 4MQ7A 1BZ9A 5DEFA 3QUZA 2OL3H 5C0JA 2X70A 3TBYA 2E7LE 3VWJA 1S7UA 4ZFZA 5J6HA 4HKJA 5D2NA 5E8OA 5BS0A 1S9XA 3BXNA 3KPSA 4PJEA 4Y4FA 2GT9A 4FFEX 4L29A 3O9WA 1FZOA 2GITA 5C07A 2HJKA 1WBXA 2AV1A 4Z77A 1EXUA 4PP8C 3P73A 3BVNA 3FQRA 4G8IA 4MVBA 5B38A 3MRRA 3TO4A 3SKOA 1HOCA 3VFNA 3O4LA 1S8DA 2P5WA 4JFPA 1ED3A 4PGBA 1DE4A 1K5NA 3HE7A 1QVOA 3L3IA 4PRNA 1T22A 4NQXA 3DX8A 4U1IA 5E00A 5C9JA 5SWQA 3MV9A 3TFKA 1FZMA 4ONOA 3X14A 5AD0A 5E8PA 4PREA 4O2FA 4PRPA 3SJVA 3MGTA 2YEZA 1C16A 1IM9A 1T7VA 2V2WA 3KPPA 1S7WA 3P4MA 4U1KA 3GSQA 4QRQA 3BO8A 5IM7A 1UXSA 1TVHA 1E27A 4LNRA 2H26A 3GSWA 3H9HA 1T80A 3MROA 4JFQA 3BH8A 2HN7A 4U1HA 5HHNA 2VABA 5C0BA 1QSEA 1SYVA 3MRIA 4QRSA 3KYOA 5F9JA 4PG9A 5HGDA 2VLLA 2BVQA 1SYSA 4PDCE 3E6FA 4WU5A 5IEHA 3BGMA 3SDDA 4EUPA 3DX7A 5C0FA 3GMLA 1MHEA 4X6FA 3QUYA 5IB1A 1A6ZA 3FQXA 1FZKA 1YPZA 3TBWA 4GKSA 4I48A 5L2KA 1JE6A 2RFXA 1QR1A 3SPVA 3FOMA 1CG9A 3MRFA 4D0DA 3I6GA 3FQNA 3L3KA 3VFPA 5C09A 1N59A 3HAEA 4PRIA 4WWKC 3P9MA 1FFPA 3OXRA 2XFXA 4MJ5A 3RUGA 1AO7A 3GSXA 3MRGA 4BKWA 3V5KA 4PRBA 3ES6A 3RZCA 4HX1A 3BP4A 3H9SA 2HLAA 3MRMA 3QQ3A 4Y16A 4X6EA 3IXAA 4N0CA 1XR8A 2F54A 4PGDA 3RWFA 3U0PA 4X6DA 3GSNH 4ZAKA 4ZUVA 5IB2A 3MREA 4L9LC 1RJYA 5C0AA 3TVMA 2BSRA 4PJ9A 1AGCA 3ILQC 3WL9A 1VADA 3RTQA 1JUFA 4MJ6A 1XR9A 4JFOA 4PGCA 3B6SA 3E6HA 1T7WA 3FFCA 1R3HA 4NO0A 4U6XA 4WO4A 4G59A 2JCCA 4PJAA 1FFNA 1HHJA 5H94A 2A83A 3B3IA 1JF1A 3CZFA 3TBTA 3W0WA 4F7MA 5D7JC 3GIVA 5EU5A 5D7IA 1FG2A 4QRTA 5MEPA 1A1MA 1CD1A 3KPNA 4D0CA 3HE6A 4GUPA 3FT2A 3JTCA 4NNYA 4F7CA 1YN7A 1ZT1A 3O3EA 1A1NA 2FIKA 3HPJA 1GZQA 2VLRA 1UQSA 4QRPA 5B39A 3VFUA 5BXFA 1FZJA 2X4OA 2IA1A 4PR5A 1P1ZA 2CIKA 1S7TA 4ZUWA 1G7QA 3VCLA 1ZVSA 3LKQA 3TIDA 2BVOA 1KBGH 3FQUA 1TVBA 2OI9A 3X13A 1KJMA 1U58A 3P77A 5HHOA 3RWCA 3VXMA 1KCGC 4N8VA 5IB5A 3PWUA 4Y4HA 3TZVC 4G9FA 3RGVC 3MV8A 4LCCC 4WUUA 5EFIA 1LEKA 4NT6A 3VFRA 4Z78A 2GJ6A 2X4UA 3NFNA 3FQTA 3X11A 3KWWA 1I7UA 2C7UA 2BNRA 3KPMA 3RWIA 4Z76A 4EN3C 3QULA 1ZT4A 1IM3A 4MX7A 4HUVA 3JTSA 1WBYA 3GJFA 2X4RA 4Y2DA 5J1AA 1BQHA 4NQDA 3REWA 1ZHLA 5HYJA 4PJHA 3RWHA 3L3DA 3MRLA 5HHPA 4JFDA 3DMMA 1CE6A 3TIEA 5C08A 1L8JA 3KPOA 4MJIA 4PV8A 1JGEA 4PJCA 2FZ3A 3GMQA 4PJ5A 4HS3A 3SDAA 3PWNA 4G59C 1JPFA 3VFSA 5E9DA 1EEZA 3MA7A 3MV7A 1S9YA 5HGHA 3FONA 4WJ5A 3TO2A 2YPKA 4V3DB 5SWSA 1KJ3H 4G43A 1DUYA 1S7VA 2BCKA 5ENWA 1QSFA 3QDMA 3DXAA 1HSAA 1KJ2H 1YN6A 1XH3A 3HCVA 4HWZA 2VLJA 3JTTA 4PJDA 2X4NA 2WY3A 2FYYA 2NYKA 1DDHA 2X4TA 3GSRA 1T20A 1OF2A 1ZAGA 1HHIA 3S6CA 3P9LA 3ECBA 3VXPA 3VFVA 3MRBA 3HLAA 2BNQA 3D3VA 1WBZA 4V3EB 2ZOLA 2X4SA 1HYRC 4EI5A 3BZFA 3ERYA 5C0EA 4JQVA 1FFOA 1G6RH 4WDIA 3ILPA 4JFEA 3VXNA 2CIIA 5HHMA 3ROOA 1ZSDA 1I7RA 1JPGA 3QUXA 4IRJA 3TBVA 5IEKA 1LEGA 1RK0A 4PJ7A 1S7QA 5EU3A 5L2JA 4E0RA 3TF7A 5JHDA 2V2XA 1I1AA 3P4OA 1KPVA 2CKBH 3MRDA 3ARGA 5HGBA 3QQ4A 5E6IC 3FRUA 3T8XA 4FTVA 1MI5A 3BUYA 4N0FA 2AXGA 4L4VA 2P5EA 3TBSA 5MENA 4F7PA 3FQWA 1XZ0A 3SDXA 5MERA 3KPLA 4NQCA 1LDPH 1ZS8A 3AREA 3FT4A 1S7RA 3C9NA 3SKMA 5GSRA 1UXWA 2H6PA 3OX8A 3W39A 3BWAA 3VFOA 3WS6A 3VFTA 5IB4A 3CDGA 3G08A 2VAAA 2Q7YA 1I7TA 1HHGA 1KTLA 3MRKA 3I6LD 1LK2A 1P7QA 4PJGA 4PJIA 3E3QA 2HJLA 4N5EA 3SCMA 3PWJA 1B0RA 3QFDA 3QI9A 4HUWA 3UPRA 3FT3A 1RK1A 4L8BA 3AU1A 4I4WA 3BEWA 1A9BA 2NX5A 1VACA 4L3EA 3WLBA 2O5NA 4G8GA 3O3BA 1T0MA 2CLVA 4QOKA 3OV6A 1P4LA 1I1YA 2PO6A 3OXSA 4PJ8A 3O3AA 5IROA 5IB3A 5MEOA 3LV3A 2GUOA 3DX6A 5ISZA 3V5DA 3VWKA 2BSSA 4U1SA 2GTZA 3JVGA 5J6GA 5D5MA 4NO2A 3QEQA 3VXSA 1ZHNA 3KPRA 1S7XA 2YPLA 1T0NA 2FO4A 3LN4A 3GMPA 5INDA 2X4PA 3BZEA 3O8XA 3P4NA 4NSKA 3CPLA 4UQ3A 1RJZA 3LKOA 3CCHA 3LKNA 2AK4A 3SDCA 1ZHBA 1T7XA 3BH9A 3VFMA 4CVZA 4PRDA 1T7ZA 5EO1A 1T21A 3KLAA 4LCYA 3LKPA 4F7TA 1E28A 2FWOA 1MWAH 1OGAA 2ESVA 4UQ2A 1QEWA 4K71B 3VRIA 1G7PA 4WU7A 3RL1A 4NHUE 4L8SC 1QLFA 4HUXA 5MEQA
chains in the Genus database with same CATH topology
1AGDA 4ZUTA 3ARFA 3WUWA 1I4FA 4L8CA 3MGOA 2ZSWA 2UWEA 2MHAA 5BRZA 1KJVA 4F7EA 4WW2C 2PYEA 1HHKA 2GAZA 4ELMA 4LHUA 3PQYA 5C0GA 3I6KA 3RWJA 1K8DA 1NAMH 3PWLA 5EO0A 5HHQA 2BVPA 3V5HA 1NANH 5GSVA 3PWPA 1EEYA 5C0IA 3KYNA 5DEGA 5FA3A 2XPGA 1AKJA 1JFMA 1YDPA 3ARDA 3BP7A 3GMMA 4QRRA 5BJTA 1N3NA 5F7DA 1LP9A 4L8DA 3BHBA 4IIQC 2F53A 5C0CA 1HHHA 1AGEA 3GSOA 4E5XA 4X6CA 1AGBA 3GMOA 4N0UA 1EFXA 1T1ZA 3BW9A 4MNQA 4U6YA 2X4QA 3L3JA 4JFFA 3FTGA 3LKRA 3QZWA 4G9DA 4S0UC 4U1MA 5C0DA 3TN0A 2ZSVA 3MRPA 1TMCA 4ZUUA 4K7FA 1ZHKA 5DDHA 1T1WA 3ARBA 1QRNA 3GMRA 3MRHA 3MRQA 3PABA 4O2CA 4PGEA 1DUZA 1A1OA 4L3CA 5INCA 5E8NA 3D39A 2NW3A 4PV9A 5HGAA 3MYJA 4IHOA 3GSVA 3CC5A 2AKRA 1GZPA 4MS8A 5D7LA 3RWEA 1LD9A 3MRNA 1A9EA 4IRSA 3KXFA 2F74A 4O2EA 3VXRA 1JGDA 4CW1A 5EUOA 5D9SA 4PJBA 5EU4A 2D31A 1W72A 4MNGA 5F1IA 3QDJA 3BEVA 1HSBA 2ZOKA 4NO5A 1T1XA 1Z5LA 3VXOA 3TPUE 1BD2A 1AGFA 3D2UA 3H7BA 3MR9A 3MRJA 4U1NA 1KPRA 3QUKA 1I1FA 4XXCA 1Q94A 3VXUA 3FOLA 1M6OA 1N5AA 3L9RA 5FDWA 1N2RA 4PRHA 3CH1A 1OSZA 3C8KA 3UBXA 1T7YA 3ROLA 3HG1A 1QQDA 4LCWA 3UTQA 2CLZA 5FKPA 5ACZA 1ZT7A 1VGKA 1S7SA 3CVHA 4CVXA 2CLRA 5FA4A 3T1FA 4GKNA 1QO3A 1ONQA 5SWZA 3VJ6A 1OGTA 3O3DA 4PRAA 3LN5A 2AV7A 4HV8A 5F1NA 3QDGA 3DTXA 4L4TA 5EOTA 1BIIA 3LKSA 4NQEA 4NO3A 2VLKA 4Y4KA 4ZUSA 5IVXA 4G42A 3VRJA 3PWVA 3VH8A 3UTSA 1PQZA 1B3JA 3QFJA 4APQA 3GSUA 4U1JA 1T1YA 4PJFA 1NEZA 1INQA 3KPQA 3D25A 3RWGA 5EU6A 1MHCA 2AXFA 1X7QA 2GTWA 1LQVA 4NNXA 3GMNA 3L3HA 3DBXA 3RL2A 3L3GA 2J8UA 3M17A 3AM8A 3E2HA 4PG2A 4HUUA 1S9WA 3IT8D 1W0VA 3UTTA 4QRUA 1JHTA 2BSTA 1M05A 4JQXA 3VFWA 1W0WA 4JRYA 4U1LA 3RWDA 1FO0H 1KPUA 3MRCA 4JRXA 4MXQA 4PJXA 5D2LA 3HUJA 3WS3A 2VE6A 4D0BA 3D18A 2DYPA 4NQVA 3TA3A 3TJHA 3X12A 3M1BA 1B0GA 4MQ7A 1BZ9A 5DEFA 3QUZA 2OL3H 5C0JA 2X70A 3TBYA 2E7LE 3VWJA 1S7UA 4ZFZA 5J6HA 4HKJA 5D2NA 5E8OA 5BS0A 1S9XA 3BXNA 3KPSA 4PJEA 4Y4FA 2GT9A 4FFEX 4L29A 3O9WA 1FZOA 2GITA 5C07A 2HJKA 1WBXA 2AV1A 4Z77A 1EXUA 4PP8C 3P73A 3BVNA 3FQRA 4G8IA 4MVBA 5B38A 3MRRA 3TO4A 3SKOA 1HOCA 3VFNA 3O4LA 1S8DA 2P5WA 4JFPA 1ED3A 4PGBA 1DE4A 1K5NA 3HE7A 1QVOA 3L3IA 4PRNA 1T22A 4NQXA 3DX8A 4U1IA 5E00A 5C9JA 5SWQA 3MV9A 3TFKA 1FZMA 4ONOA 3X14A 5AD0A 5E8PA 4PREA 4O2FA 4PRPA 3SJVA 3MGTA 2YEZA 1C16A 1IM9A 1T7VA 2V2WA 3KPPA 1S7WA 3P4MA 4U1KA 3GSQA 4QRQA 3BO8A 5IM7A 1UXSA 1TVHA 1E27A 4LNRA 2H26A 3GSWA 3H9HA 1T80A 3MROA 4JFQA 3BH8A 2HN7A 4U1HA 5HHNA 2VABA 5C0BA 1QSEA 1SYVA 3MRIA 4QRSA 3KYOA 5F9JA 4PG9A 5HGDA 2VLLA 2BVQA 1SYSA 4PDCE 3E6FA 4WU5A 5IEHA 3BGMA 3SDDA 4EUPA 3DX7A 5C0FA 3GMLA 1MHEA 4X6FA 3QUYA 5IB1A 1A6ZA 3FQXA 1FZKA 1YPZA 3TBWA 4GKSA 4I48A 5L2KA 1JE6A 2RFXA 1QR1A 3SPVA 3FOMA 1CG9A 3MRFA 4D0DA 3I6GA 3FQNA 3L3KA 3VFPA 5C09A 1N59A 3HAEA 4PRIA 4WWKC 3P9MA 1FFPA 3OXRA 2XFXA 4MJ5A 3RUGA 1AO7A 3GSXA 3MRGA 3V5KA 4PRBA 3ES6A 3RZCA 4HX1A 3BP4A 3H9SA 2HLAA 3MRMA 3QQ3A 4Y16A 4X6EA 3IXAA 4N0CA 1XR8A 2F54A 4PGDA 3RWFA 3U0PA 4X6DA 3GSNH 4ZAKA 4ZUVA 5IB2A 3MREA 4L9LC 1RJYA 5C0AA 3TVMA 2BSRA 4PJ9A 1AGCA 3ILQC 3WL9A 1VADA 3RTQA 1JUFA 4MJ6A 1XR9A 4JFOA 4PGCA 3B6SA 3E6HA 1T7WA 3FFCA 1R3HA 4NO0A 4U6XA 4WO4A 4G59A 2JCCA 4PJAA 1FFNA 1HHJA 5H94A 2A83A 3B3IA 1JF1A 3CZFA 3TBTA 3W0WA 4F7MA 5D7JC 3GIVA 5EU5A 5D7IA 1FG2A 4QRTA 5MEPA 1A1MA 1CD1A 3KPNA 4D0CA 3HE6A 4GUPA 3FT2A 3JTCA 4NNYA 4F7CA 1YN7A 1ZT1A 3O3EA 1A1NA 2FIKA 3HPJA 1GZQA 2VLRA 1UQSA 4QRPA 5B39A 3VFUA 5BXFA 1FZJA 2X4OA 4PR5A 1P1ZA 2CIKA 1S7TA 4ZUWA 1G7QA 3VCLA 1ZVSA 3LKQA 3TIDA 2BVOA 1KBGH 3FQUA 1TVBA 2OI9A 3X13A 1KJMA 1U58A 3P77A 5HHOA 3RWCA 3VXMA 1KCGC 4N8VA 5IB5A 3PWUA 4Y4HA 3TZVC 4G9FA 3RGVC 3MV8A 4LCCC 4WUUA 5EFIA 1LEKA 4NT6A 3VFRA 4Z78A 2GJ6A 2X4UA 3NFNA 3FQTA 3X11A 3KWWA 1I7UA 2C7UA 2BNRA 3KPMA 3RWIA 4Z76A 4EN3C 3QULA 1ZT4A 1IM3A 4MX7A 4HUVA 3JTSA 1WBYA 3GJFA 2X4RA 4Y2DA 5J1AA 1BQHA 4NQDA 3REWA 1ZHLA 5HYJA 4PJHA 3RWHA 3L3DA 3MRLA 5HHPA 4JFDA 3DMMA 1CE6A 3TIEA 5C08A 1L8JA 3KPOA 4MJIA 4PV8A 1JGEA 4PJCA 2FZ3A 3GMQA 4PJ5A 4HS3A 3SDAA 3PWNA 1JPFA 3VFSA 5E9DA 1EEZA 3MA7A 3MV7A 1S9YA 5HGHA 3FONA 4WJ5A 3TO2A 2YPKA 4V3DB 5SWSA 1KJ3H 4G43A 1DUYA 1S7VA 2BCKA 5ENWA 1QSFA 3QDMA 3DXAA 1HSAA 1KJ2H 1YN6A 1XH3A 3HCVA 4HWZA 2VLJA 3JTTA 4PJDA 2X4NA 2WY3A 2FYYA 1DDHA 2X4TA 3GSRA 1T20A 1OF2A 1ZAGA 1HHIA 3S6CA 3P9LA 3ECBA 3VXPA 3VFVA 3MRBA 3HLAA 2BNQA 3D3VA 1WBZA 4V3EB 2ZOLA 2X4SA 1HYRC 4EI5A 3BZFA 3ERYA 5C0EA 4JQVA 1FFOA 1G6RH 4WDIA 3ILPA 4JFEA 3VXNA 2CIIA 5HHMA 3ROOA 1ZSDA 1I7RA 1JPGA 3QUXA 4IRJA 3TBVA 5IEKA 1LEGA 1RK0A 4PJ7A 1S7QA 5EU3A 5L2JA 4E0RA 3TF7A 5JHDA 2V2XA 1I1AA 3P4OA 1KPVA 2CKBH 3MRDA 3ARGA 5HGBA 3QQ4A 5E6IC 3FRUA 3T8XA 4FTVA 1MI5A 3BUYA 4N0FA 2AXGA 4L4VA 2P5EA 3TBSA 5MENA 4F7PA 3FQWA 1XZ0A 3SDXA 5MERA 3KPLA 4NQCA 1LDPH 1ZS8A 3AREA 3FT4A 1S7RA 3C9NA 3SKMA 5GSRA 1UXWA 2H6PA 3OX8A 3W39A 3BWAA 3VFOA 3WS6A 3VFTA 5IB4A 3CDGA 3G08A 2VAAA 2Q7YA 1I7TA 1HHGA 1KTLA 3MRKA 3I6LD 1LK2A 1P7QA 4PJGA 4PJIA 3E3QA 2HJLA 4N5EA 3SCMA 3PWJA 1B0RA 3QFDA 3QI9A 4HUWA 3UPRA 3FT3A 1RK1A 4L8BA 3AU1A 4I4WA 2NX5A 1A9BA 3BEWA 1VACA 4L3EA 3WLBA 4G8GA 3O3BA 1T0MA 2CLVA 4QOKA 3OV6A 1P4LA 1I1YA 2PO6A 3OXSA 4PJ8A 3O3AA 5IROA 5IB3A 5MEOA 3LV3A 2GUOA 3DX6A 5ISZA 3V5DA 3VWKA 2BSSA 4U1SA 2GTZA 3JVGA 5J6GA 5D5MA 4NO2A 3QEQA 3VXSA 1ZHNA 3KPRA 1S7XA 2YPLA 1T0NA 2FO4A 3LN4A 3GMPA 5INDA 2X4PA 3BZEA 3O8XA 3P4NA 4NSKA 3CPLA 4UQ3A 1RJZA 3LKOA 3CCHA 3LKNA 2AK4A 3SDCA 1ZHBA 1T7XA 3BH9A 3VFMA 4CVZA 4PRDA 1T7ZA 5EO1A 1T21A 3KLAA 4LCYA 3LKPA 4F7TA 1E28A 2FWOA 1MWAH 1OGAA 2ESVA 4UQ2A 1QEWA 4K71B 3VRIA 1G7PA 4WU7A 3RL1A 4NHUE 4L8SC 1QLFA 4HUXA 5MEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AGD A;  4ZUT A;  3ARF A;  3WUW A;  1I4F A;  4L8C A;  3MGO A;  2ZSW A;  2UWE A;  2MHA A;  5BRZ A;  1KJV A;  4F7E A;  4WW2 C;  2PYE A;  1HHK A;  2GAZ A;  4ELM A;  4LHU A;  3PQY A;  5C0G A;  3I6K A;  3RWJ A;  1K8D A;  1NAM H;  3PWL A;  5EO0 A;  5HHQ A;  2BVP A;  3V5H A;  1NAN H;  5GSV A;  3PWP A;  1EEY A;  5C0I A;  3KYN A;  5DEG A;  5FA3 A;  2XPG A;  1AKJ A;  1JFM A;  1YDP A;  3ARD A;  3BP7 A;  3GMM A;  4QRR A;  5BJT A;  1N3N A;  5F7D A;  1LP9 A;  4L8D A;  3BHB A;  4IIQ C;  2F53 A;  5C0C A;  1HHH A;  1AGE A;  3GSO A;  4E5X A;  4X6C A;  1AGB A;  3GMO A;  4N0U A;  1EFX A;  1T1Z A;  3BW9 A;  4MNQ A;  4U6Y A;  2X4Q A;  3L3J A;  4JFF A;  3FTG A;  3LKR A;  3QZW A;  4G9D A;  4S0U C;  4U1M A;  5C0D A;  3TN0 A;  2ZSV A;  3MRP A;  1TMC A;  4ZUU A;  4K7F A;  1ZHK A;  5DDH A;  1T1W A;  3ARB A;  1QRN A;  3GMR A;  3MRH A;  3MRQ A;  3PAB A;  4O2C A;  4PGE A;  1DUZ A;  1A1O A;  4L3C A;  5INC A;  5E8N A;  3D39 A;  2NW3 A;  4PV9 A;  5HGA A;  3MYJ A;  4IHO A;  3GSV A;  3CC5 A;  2AKR A;  1GZP A;  4MS8 A;  5D7L A;  3RWE A;  1LD9 A;  3MRN A;  1A9E A;  4IRS A;  3KXF A;  2F74 A;  4O2E A;  3VXR A;  1JGD A;  4CW1 A;  5EUO A;  5D9S A;  4PJB A;  5EU4 A;  2D31 A;  1W72 A;  4MNG A;  5F1I A;  3QDJ A;  3BEV A;  1HSB A;  2ZOK A;  4NO5 A;  1T1X A;  1Z5L A;  3VXO A;  3TPU E;  1BD2 A;  1AGF A;  3D2U A;  3H7B A;  3MR9 A;  3MRJ A;  4U1N A;  1KPR A;  3QUK A;  1I1F A;  4XXC A;  1Q94 A;  3VXU A;  3FOL A;  1M6O A;  1N5A A;  3L9R A;  5FDW A;  1N2R A;  4PRH A;  3CH1 A;  1OSZ A;  3C8K A;  3UBX A;  1T7Y A;  3ROL A;  3HG1 A;  1QQD A;  4LCW A;  3UTQ A;  2CLZ A;  5FKP A;  5ACZ A;  1ZT7 A;  1VGK A;  1S7S A;  3CVH A;  4CVX A;  2CLR A;  5FA4 A;  3T1F A;  4GKN A;  1QO3 A;  1ONQ A;  5SWZ A;  3VJ6 A;  1OGT A;  3O3D A;  4PRA A;  3LN5 A;  2AV7 A;  4HV8 A;  5F1N A;  3QDG A;  3DTX A;  4L4T A;  5EOT A;  1BII A;  3LKS A;  4NQE A;  4NO3 A;  2VLK A;  4Y4K A;  4ZUS A;  5IVX A;  4G42 A;  3VRJ A;  3PWV A;  3VH8 A;  3UTS A;  1PQZ A;  1B3J A;  3QFJ A;  4APQ A;  3GSU A;  4U1J A;  1T1Y A;  4PJF A;  1NEZ A;  1INQ A;  3KPQ A;  3D25 A;  3RWG A;  5EU6 A;  1MHC A;  2AXF A;  1X7Q A;  2GTW A;  1LQV A;  4NNX A;  3GMN A;  3L3H A;  3DBX A;  3RL2 A;  3L3G A;  2J8U A;  3M17 A;  3AM8 A;  3E2H A;  4PG2 A;  4HUU A;  1S9W A;  3IT8 D;  1W0V A;  3UTT A;  4QRU A;  1JHT A;  2BST A;  1M05 A;  4JQX A;  3VFW A;  1W0W A;  4JRY A;  4U1L A;  3RWD A;  1FO0 H;  1KPU A;  3MRC A;  4JRX A;  4MXQ A;  4PJX A;  5D2L A;  3HUJ A;  3WS3 A;  2VE6 A;  4D0B A;  3D18 A;  2DYP A;  4NQV A;  3TA3 A;  3TJH A;  3X12 A;  3M1B A;  1B0G A;  4MQ7 A;  1BZ9 A;  5DEF A;  3QUZ A;  2OL3 H;  5C0J A;  2X70 A;  3TBY A;  2E7L E;  3VWJ A;  1S7U A;  4ZFZ A;  5J6H A;  4HKJ A;  5D2N A;  5E8O A;  5BS0 A;  1S9X A;  3BXN A;  3KPS A;  4PJE A;  4Y4F A;  2GT9 A;  4FFE X;  4L29 A;  3O9W A;  1FZO A;  2GIT A;  5C07 A;  2HJK A;  1WBX A;  2AV1 A;  4Z77 A;  1EXU A;  4PP8 C;  3P73 A;  3BVN A;  3FQR A;  4G8I A;  4MVB A;  5B38 A;  3MRR A;  3TO4 A;  3SKO A;  1HOC A;  3VFN A;  3O4L A;  1S8D A;  2P5W A;  4JFP A;  1ED3 A;  4PGB A;  1DE4 A;  1K5N A;  3HE7 A;  1QVO A;  3L3I A;  4PRN A;  1T22 A;  4NQX A;  3DX8 A;  4U1I A;  5E00 A;  5C9J A;  5SWQ A;  3MV9 A;  3TFK A;  1FZM A;  4ONO A;  3X14 A;  5AD0 A;  5E8P A;  4PRE A;  4O2F A;  4PRP A;  3SJV A;  3MGT A;  2YEZ A;  1C16 A;  1IM9 A;  1T7V A;  2V2W A;  3KPP A;  1S7W A;  3P4M A;  4U1K A;  3GSQ A;  4QRQ A;  3BO8 A;  5IM7 A;  1UXS A;  1TVH A;  1E27 A;  4LNR A;  2H26 A;  3GSW A;  3H9H A;  1T80 A;  3MRO A;  4JFQ A;  3BH8 A;  2HN7 A;  4U1H A;  5HHN A;  2VAB A;  5C0B A;  1QSE A;  1SYV A;  3MRI A;  4QRS A;  3KYO A;  5F9J A;  4PG9 A;  5HGD A;  2VLL A;  2BVQ A;  1SYS A;  4PDC E;  3E6F A;  4WU5 A;  5IEH A;  3BGM A;  3SDD A;  4EUP A;  3DX7 A;  5C0F A;  3GML A;  1MHE A;  4X6F A;  3QUY A;  5IB1 A;  1A6Z A;  3FQX A;  1FZK A;  1YPZ A;  3TBW A;  4GKS A;  4I48 A;  5L2K A;  1JE6 A;  2RFX A;  1QR1 A;  3SPV A;  3FOM A;  1CG9 A;  3MRF A;  4D0D A;  3I6G A;  3FQN A;  3L3K A;  3VFP A;  5C09 A;  1N59 A;  3HAE A;  4PRI A;  4WWK C;  3P9M A;  1FFP A;  3OXR A;  2XFX A;  4MJ5 A;  3RUG A;  1AO7 A;  3GSX A;  3MRG A;  3V5K A;  4PRB A;  3ES6 A;  3RZC A;  4HX1 A;  3BP4 A;  3H9S A;  2HLA A;  3MRM A;  3QQ3 A;  4Y16 A;  4X6E A;  3IXA A;  4N0C A;  1XR8 A;  2F54 A;  4PGD A;  3RWF A;  3U0P A;  4X6D A;  3GSN H;  4ZAK A;  4ZUV A;  5IB2 A;  3MRE A;  4L9L C;  1RJY A;  5C0A A;  3TVM A;  2BSR A;  4PJ9 A;  1AGC A;  3ILQ C;  3WL9 A;  1VAD A;  3RTQ A;  1JUF A;  4MJ6 A;  1XR9 A;  4JFO A;  4PGC A;  3B6S A;  3E6H A;  1T7W A;  3FFC A;  1R3H A;  4NO0 A;  4U6X A;  4WO4 A;  4G59 A;  2JCC A;  4PJA A;  1FFN A;  1HHJ A;  5H94 A;  2A83 A;  3B3I A;  1JF1 A;  3CZF A;  3TBT A;  3W0W A;  4F7M A;  5D7J C;  3GIV A;  5EU5 A;  5D7I A;  1FG2 A;  4QRT A;  5MEP A;  1A1M A;  1CD1 A;  3KPN A;  4D0C A;  3HE6 A;  4GUP A;  3FT2 A;  3JTC A;  4NNY A;  4F7C A;  1YN7 A;  1ZT1 A;  3O3E A;  1A1N A;  2FIK A;  3HPJ A;  1GZQ A;  2VLR A;  1UQS A;  4QRP A;  5B39 A;  3VFU A;  5BXF A;  1FZJ A;  2X4O A;  4PR5 A;  1P1Z A;  2CIK A;  1S7T A;  4ZUW A;  1G7Q A;  3VCL A;  1ZVS A;  3LKQ A;  3TID A;  2BVO A;  1KBG H;  3FQU A;  1TVB A;  2OI9 A;  3X13 A;  1KJM A;  1U58 A;  3P77 A;  5HHO A;  3RWC A;  3VXM A;  1KCG C;  4N8V A;  5IB5 A;  3PWU A;  4Y4H A;  3TZV C;  4G9F A;  3RGV C;  3MV8 A;  4LCC C;  4WUU A;  5EFI A;  1LEK A;  4NT6 A;  3VFR A;  4Z78 A;  2GJ6 A;  2X4U A;  3NFN A;  3FQT A;  3X11 A;  3KWW A;  1I7U A;  2C7U A;  2BNR A;  3KPM A;  3RWI A;  4Z76 A;  4EN3 C;  3QUL A;  1ZT4 A;  1IM3 A;  4MX7 A;  4HUV A;  3JTS A;  1WBY A;  3GJF A;  2X4R A;  4Y2D A;  5J1A A;  1BQH A;  4NQD A;  3REW A;  1ZHL A;  5HYJ A;  4PJH A;  3RWH A;  3L3D A;  3MRL A;  5HHP A;  4JFD A;  3DMM A;  1CE6 A;  3TIE A;  5C08 A;  1L8J A;  3KPO A;  4MJI A;  4PV8 A;  1JGE A;  4PJC A;  2FZ3 A;  3GMQ A;  4PJ5 A;  4HS3 A;  3SDA A;  3PWN A;  1JPF A;  3VFS A;  5E9D A;  1EEZ A;  3MA7 A;  3MV7 A;  1S9Y A;  5HGH A;  3FON A;  4WJ5 A;  3TO2 A;  2YPK A;  4V3D B;  5SWS A;  1KJ3 H;  4G43 A;  1DUY A;  1S7V A;  2BCK A;  5ENW A;  1QSF A;  3QDM A;  3DXA A;  1HSA A;  1KJ2 H;  1YN6 A;  1XH3 A;  3HCV A;  4HWZ A;  2VLJ A;  3JTT A;  4PJD A;  2X4N A;  2WY3 A;  2FYY A;  1DDH A;  2X4T A;  3GSR A;  1T20 A;  1OF2 A;  1ZAG A;  1HHI A;  3S6C A;  3P9L A;  3ECB A;  3VXP A;  3VFV A;  3MRB A;  3HLA A;  2BNQ A;  3D3V A;  1WBZ A;  4V3E B;  2ZOL A;  2X4S A;  1HYR C;  4EI5 A;  3BZF A;  3ERY A;  5C0E A;  4JQV A;  1FFO A;  1G6R H;  4WDI A;  3ILP A;  4JFE A;  3VXN A;  2CII A;  5HHM A;  3ROO A;  1ZSD A;  1I7R A;  1JPG A;  3QUX A;  4IRJ A;  3TBV A;  5IEK A;  1LEG A;  1RK0 A;  4PJ7 A;  1S7Q A;  5EU3 A;  5L2J A;  4E0R A;  3TF7 A;  5JHD A;  2V2X A;  1I1A A;  3P4O A;  1KPV A;  2CKB H;  3MRD A;  3ARG A;  5HGB A;  3QQ4 A;  5E6I C;  3FRU A;  3T8X A;  4FTV A;  1MI5 A;  3BUY A;  4N0F A;  2AXG A;  4L4V A;  2P5E A;  3TBS A;  5MEN A;  4F7P A;  3FQW A;  1XZ0 A;  3SDX A;  5MER A;  3KPL A;  4NQC A;  1LDP H;  1ZS8 A;  3ARE A;  3FT4 A;  1S7R A;  3C9N A;  3SKM A;  5GSR A;  1UXW A;  2H6P A;  3OX8 A;  3W39 A;  3BWA A;  3VFO A;  3WS6 A;  3VFT A;  5IB4 A;  3CDG A;  3G08 A;  2VAA A;  2Q7Y A;  1I7T A;  1HHG A;  1KTL A;  3MRK A;  3I6L D;  1LK2 A;  1P7Q A;  4PJG A;  4PJI A;  3E3Q A;  2HJL A;  4N5E A;  3SCM A;  3PWJ A;  1B0R A;  3QFD A;  3QI9 A;  4HUW A;  3UPR A;  3FT3 A;  1RK1 A;  4L8B A;  3AU1 A;  4I4W A;  2NX5 A;  1A9B A;  3BEW A;  1VAC A;  4L3E A;  3WLB A;  4G8G A;  3O3B A;  1T0M A;  2CLV A;  4QOK A;  3OV6 A;  1P4L A;  1I1Y A;  2PO6 A;  3OXS A;  4PJ8 A;  3O3A A;  5IRO A;  5IB3 A;  5MEO A;  3LV3 A;  2GUO A;  3DX6 A;  5ISZ A;  3V5D A;  3VWK A;  2BSS A;  4U1S A;  2GTZ A;  3JVG A;  5J6G A;  5D5M A;  4NO2 A;  3QEQ A;  3VXS A;  1ZHN A;  3KPR A;  1S7X A;  2YPL A;  1T0N A;  2FO4 A;  3LN4 A;  3GMP A;  5IND A;  2X4P A;  3BZE A;  3O8X A;  3P4N A;  4NSK A;  3CPL A;  4UQ3 A;  1RJZ A;  3LKO A;  3CCH A;  3LKN A;  2AK4 A;  3SDC A;  1ZHB A;  1T7X A;  3BH9 A;  3VFM A;  4CVZ A;  4PRD A;  1T7Z A;  5EO1 A;  1T21 A;  3KLA A;  4LCY A;  3LKP A;  4F7T A;  1E28 A;  2FWO A;  1MWA H;  1OGA A;  2ESV A;  4UQ2 A;  1QEW A;  4K71 B;  3VRI A;  1G7P A;  4WU7 A;  3RL1 A;  4NHU E;  4L8S C;  1QLF A;  4HUX A;  5MEQ A; 
#chains in the Genus database with same CATH topology
 1AGD A;  4ZUT A;  3ARF A;  3WUW A;  1I4F A;  4L8C A;  3MGO A;  2ZSW A;  2UWE A;  2MHA A;  5BRZ A;  1KJV A;  4F7E A;  4WW2 C;  2PYE A;  1HHK A;  2GAZ A;  4ELM A;  4LHU A;  3PQY A;  5C0G A;  3I6K A;  3RWJ A;  1K8D A;  1NAM H;  3I0T A;  3PWL A;  5EO0 A;  2BVP A;  5HHQ A;  3V5H A;  1NAN H;  5GSV A;  3PWP A;  1EEY A;  5C0I A;  3KYN A;  5DEG A;  5FA3 A;  2XPG A;  1AKJ A;  1JFM A;  1YDP A;  3ARD A;  3BP7 A;  3GMM A;  4QRR A;  5BJT A;  1N3N A;  5F7D A;  1LP9 A;  4L8D A;  3BHB A;  4IIQ C;  2F53 A;  5C0C A;  1HHH A;  1AGE A;  3GSO A;  4E5X A;  4X6C A;  1AGB A;  3GMO A;  4N0U A;  1EFX A;  1T1Z A;  3BW9 A;  4MNQ A;  4U6Y A;  2X4Q A;  3L3J A;  4JFF A;  3FTG A;  3LKR A;  3QZW A;  4G9D A;  4S0U C;  4U1M A;  5C0D A;  3TN0 A;  2ZSV A;  3MRP A;  1TMC A;  4ZUU A;  4K7F A;  1ZHK A;  5DDH A;  1T1W A;  3ARB A;  1QRN A;  3GMR A;  3MRH A;  3MRQ A;  3PAB A;  4O2C A;  4PGE A;  1DUZ A;  1A1O A;  4L3C A;  5INC A;  5E8N A;  3D39 A;  2NW3 A;  4PV9 A;  5HGA A;  3MYJ A;  4IHO A;  3GSV A;  3CC5 A;  2AKR A;  1GZP A;  4MS8 A;  5D7L A;  3RWE A;  1LD9 A;  3MRN A;  1A9E A;  4IRS A;  3KXF A;  2F74 A;  4O2E A;  3VXR A;  1JGD A;  4CW1 A;  5EUO A;  5D9S A;  4PJB A;  5EU4 A;  2D31 A;  1W72 A;  4MNG A;  5F1I A;  3QDJ A;  3BEV A;  1HSB A;  2ZOK A;  4NO5 A;  1T1X A;  1Z5L A;  3VXO A;  3TPU E;  1BD2 A;  1AGF A;  3D2U A;  3H7B A;  3MR9 A;  3MRJ A;  4U1N A;  1KPR A;  3QUK A;  1I1F A;  4XXC A;  1Q94 A;  3VXU A;  3FOL A;  1M6O A;  1N5A A;  3L9R A;  5FDW A;  4JO8 A;  1N2R A;  4PRH A;  3CH1 A;  1OSZ A;  3C8K A;  3UBX A;  1T7Y A;  3ROL A;  3HG1 A;  1QQD A;  4LCW A;  3UTQ A;  2CLZ A;  5FKP A;  5ACZ A;  1ZT7 A;  1VGK A;  1S7S A;  3CVH A;  4CVX A;  2CLR A;  5FA4 A;  3T1F A;  4GKN A;  1QO3 A;  1ONQ A;  5SWZ A;  3VJ6 A;  1OGT A;  3O3D A;  4PRA A;  3LN5 A;  2AV7 A;  4HV8 A;  5F1N A;  3QDG A;  3DTX A;  4L4T A;  5EOT A;  1BII A;  3LKS A;  4NQE A;  4NO3 A;  2VLK A;  4Y4K A;  4ZUS A;  5IVX A;  4G42 A;  3VRJ A;  3PWV A;  3VH8 A;  3UTS A;  1PQZ A;  1B3J A;  3QFJ A;  4APQ A;  3GSU A;  4U1J A;  1T1Y A;  4PJF A;  1NEZ A;  1INQ A;  3KPQ A;  3D25 A;  3RWG A;  5EU6 A;  1MHC A;  2AXF A;  1X7Q A;  2GTW A;  1LQV A;  4NNX A;  3GMN A;  3L3H A;  3DBX A;  3RL2 A;  3L3G A;  2J8U A;  3M17 A;  3AM8 A;  3E2H A;  4PG2 A;  4HUU A;  1S9W A;  3IT8 D;  1W0V A;  3UTT A;  4QRU A;  1JHT A;  2BST A;  1M05 A;  4JQX A;  3VFW A;  1W0W A;  4JRY A;  4U1L A;  3RWD A;  1FO0 H;  1KPU A;  3MRC A;  4JRX A;  4MXQ A;  4PJX A;  5D2L A;  3HUJ A;  3WS3 A;  2VE6 A;  4D0B A;  3D18 A;  2DYP A;  4NQV A;  3TA3 A;  3TJH A;  3X12 A;  3M1B A;  1B0G A;  4MQ7 A;  1BZ9 A;  5DEF A;  3QUZ A;  2OL3 H;  5C0J A;  2X70 A;  3TBY A;  2E7L E;  3VWJ A;  1S7U A;  4ZFZ A;  5J6H A;  4HKJ A;  5D2N A;  5E8O A;  5BS0 A;  1S9X A;  3BXN A;  3KPS A;  4PJE A;  4Y4F A;  2GT9 A;  4FFE X;  4L29 A;  3O9W A;  1FZO A;  2GIT A;  5C07 A;  2HJK A;  1WBX A;  2AV1 A;  4Z77 A;  1EXU A;  4PP8 C;  3P73 A;  3BVN A;  3FQR A;  4G8I A;  4MVB A;  5B38 A;  3MRR A;  3TO4 A;  3SKO A;  1HOC A;  3VFN A;  3O4L A;  1S8D A;  2P5W A;  4JFP A;  1ED3 A;  4PGB A;  1DE4 A;  1K5N A;  3HE7 A;  1QVO A;  3L3I A;  4PRN A;  1T22 A;  4NQX A;  3DX8 A;  4U1I A;  5E00 A;  5C9J A;  5SWQ A;  3MV9 A;  3TFK A;  1FZM A;  4ONO A;  3X14 A;  5AD0 A;  5E8P A;  4PRE A;  4O2F A;  4PRP A;  3SJV A;  3MGT A;  2YEZ A;  1C16 A;  1IM9 A;  1T7V A;  2V2W A;  3KPP A;  1S7W A;  3P4M A;  4U1K A;  3GSQ A;  4QRQ A;  3BO8 A;  5IM7 A;  1UXS A;  1TVH A;  1E27 A;  4LNR A;  2H26 A;  3GSW A;  3H9H A;  1T80 A;  3MRO A;  4JFQ A;  3BH8 A;  2HN7 A;  4U1H A;  5HHN A;  2VAB A;  5C0B A;  1QSE A;  1SYV A;  3MRI A;  4QRS A;  3KYO A;  5F9J A;  4PG9 A;  5HGD A;  2VLL A;  2BVQ A;  1SYS A;  4PDC E;  3E6F A;  4WU5 A;  5IEH A;  3BGM A;  3SDD A;  4EUP A;  3DX7 A;  5C0F A;  3GML A;  1MHE A;  4X6F A;  3QUY A;  5IB1 A;  1A6Z A;  3FQX A;  1FZK A;  1YPZ A;  3TBW A;  4GKS A;  4I48 A;  5L2K A;  1JE6 A;  2RFX A;  1QR1 A;  3SPV A;  3FOM A;  1CG9 A;  3MRF A;  4D0D A;  3I6G A;  3FQN A;  3L3K A;  3VFP A;  5C09 A;  1N59 A;  3HAE A;  4PRI A;  4WWK C;  3P9M A;  1FFP A;  3OXR A;  2XFX A;  4MJ5 A;  3RUG A;  1AO7 A;  3GSX A;  3MRG A;  4BKW A;  3V5K A;  4PRB A;  3ES6 A;  3RZC A;  4HX1 A;  3BP4 A;  3H9S A;  2HLA A;  3MRM A;  3QQ3 A;  4Y16 A;  4X6E A;  3IXA A;  4N0C A;  1XR8 A;  2F54 A;  4PGD A;  3RWF A;  3U0P A;  4X6D A;  3GSN H;  4ZAK A;  4ZUV A;  5IB2 A;  3MRE A;  4L9L C;  1RJY A;  5C0A A;  3TVM A;  2BSR A;  4PJ9 A;  1AGC A;  3ILQ C;  3WL9 A;  1VAD A;  3RTQ A;  1JUF A;  4MJ6 A;  1XR9 A;  4JFO A;  4PGC A;  3B6S A;  3E6H A;  1T7W A;  3FFC A;  1R3H A;  4NO0 A;  4U6X A;  4WO4 A;  4G59 A;  2JCC A;  4PJA A;  1FFN A;  1HHJ A;  5H94 A;  2A83 A;  3B3I A;  1JF1 A;  3CZF A;  3TBT A;  3W0W A;  4F7M A;  5D7J C;  3GIV A;  5EU5 A;  5D7I A;  1FG2 A;  4QRT A;  5MEP A;  1A1M A;  1CD1 A;  3KPN A;  4D0C A;  3HE6 A;  4GUP A;  3FT2 A;  3JTC A;  4NNY A;  4F7C A;  1YN7 A;  1ZT1 A;  3O3E A;  1A1N A;  2FIK A;  3HPJ A;  1GZQ A;  2VLR A;  1UQS A;  4QRP A;  5B39 A;  3VFU A;  5BXF A;  1FZJ A;  2X4O A;  2IA1 A;  4PR5 A;  1P1Z A;  2CIK A;  1S7T A;  4ZUW A;  1G7Q A;  3VCL A;  1ZVS A;  3LKQ A;  3TID A;  2BVO A;  1KBG H;  3FQU A;  1TVB A;  2OI9 A;  3X13 A;  1KJM A;  1U58 A;  3P77 A;  5HHO A;  3RWC A;  3VXM A;  1KCG C;  4N8V A;  5IB5 A;  3PWU A;  4Y4H A;  3TZV C;  4G9F A;  3RGV C;  3MV8 A;  4LCC C;  4WUU A;  5EFI A;  1LEK A;  4NT6 A;  3VFR A;  4Z78 A;  2GJ6 A;  2X4U A;  3NFN A;  3FQT A;  3X11 A;  3KWW A;  1I7U A;  2C7U A;  2BNR A;  3KPM A;  3RWI A;  4Z76 A;  4EN3 C;  3QUL A;  1ZT4 A;  1IM3 A;  4MX7 A;  4HUV A;  3JTS A;  1WBY A;  3GJF A;  2X4R A;  4Y2D A;  5J1A A;  1BQH A;  4NQD A;  3REW A;  1ZHL A;  5HYJ A;  4PJH A;  3RWH A;  3L3D A;  3MRL A;  5HHP A;  4JFD A;  3DMM A;  1CE6 A;  3TIE A;  5C08 A;  1L8J A;  3KPO A;  4MJI A;  4PV8 A;  1JGE A;  4PJC A;  2FZ3 A;  3GMQ A;  4PJ5 A;  4HS3 A;  3SDA A;  3PWN A;  4G59 C;  1JPF A;  3VFS A;  5E9D A;  1EEZ A;  3MA7 A;  3MV7 A;  1S9Y A;  5HGH A;  3FON A;  4WJ5 A;  3TO2 A;  2YPK A;  4V3D B;  5SWS A;  1KJ3 H;  4G43 A;  1DUY A;  1S7V A;  2BCK A;  5ENW A;  1QSF A;  3QDM A;  3DXA A;  1HSA A;  1KJ2 H;  1YN6 A;  1XH3 A;  3HCV A;  4HWZ A;  2VLJ A;  3JTT A;  4PJD A;  2X4N A;  2WY3 A;  2FYY A;  2NYK A;  1DDH A;  2X4T A;  3GSR A;  1T20 A;  1OF2 A;  1ZAG A;  1HHI A;  3S6C A;  3P9L A;  3ECB A;  3VXP A;  3VFV A;  3MRB A;  3HLA A;  2BNQ A;  3D3V A;  1WBZ A;  4V3E B;  2ZOL A;  2X4S A;  1HYR C;  4EI5 A;  3BZF A;  3ERY A;  5C0E A;  4JQV A;  1FFO A;  1G6R H;  4WDI A;  3ILP A;  4JFE A;  3VXN A;  2CII A;  5HHM A;  3ROO A;  1ZSD A;  1I7R A;  1JPG A;  3QUX A;  4IRJ A;  3TBV A;  5IEK A;  1LEG A;  1RK0 A;  4PJ7 A;  1S7Q A;  5EU3 A;  5L2J A;  4E0R A;  3TF7 A;  5JHD A;  2V2X A;  1I1A A;  3P4O A;  1KPV A;  2CKB H;  3MRD A;  3ARG A;  5HGB A;  3QQ4 A;  5E6I C;  3FRU A;  3T8X A;  4FTV A;  1MI5 A;  3BUY A;  4N0F A;  2AXG A;  4L4V A;  2P5E A;  3TBS A;  5MEN A;  4F7P A;  3FQW A;  1XZ0 A;  3SDX A;  5MER A;  3KPL A;  4NQC A;  1LDP H;  1ZS8 A;  3ARE A;  3FT4 A;  1S7R A;  3C9N A;  3SKM A;  5GSR A;  1UXW A;  2H6P A;  3OX8 A;  3W39 A;  3BWA A;  3VFO A;  3WS6 A;  3VFT A;  5IB4 A;  3CDG A;  3G08 A;  2VAA A;  2Q7Y A;  1I7T A;  1HHG A;  1KTL A;  3MRK A;  3I6L D;  1LK2 A;  1P7Q A;  4PJG A;  4PJI A;  3E3Q A;  2HJL A;  4N5E A;  3SCM A;  3PWJ A;  1B0R A;  3QFD A;  3QI9 A;  4HUW A;  3UPR A;  3FT3 A;  1RK1 A;  4L8B A;  3AU1 A;  4I4W A;  3BEW A;  1A9B A;  2NX5 A;  1VAC A;  4L3E A;  3WLB A;  2O5N A;  4G8G A;  3O3B A;  1T0M A;  2CLV A;  4QOK A;  3OV6 A;  1P4L A;  1I1Y A;  2PO6 A;  3OXS A;  4PJ8 A;  3O3A A;  5IRO A;  5IB3 A;  5MEO A;  3LV3 A;  2GUO A;  3DX6 A;  5ISZ A;  3V5D A;  3VWK A;  2BSS A;  4U1S A;  2GTZ A;  3JVG A;  5J6G A;  5D5M A;  4NO2 A;  3QEQ A;  3VXS A;  1ZHN A;  3KPR A;  1S7X A;  2YPL A;  1T0N A;  2FO4 A;  3LN4 A;  3GMP A;  5IND A;  2X4P A;  3BZE A;  3O8X A;  3P4N A;  4NSK A;  3CPL A;  4UQ3 A;  1RJZ A;  3LKO A;  3CCH A;  3LKN A;  2AK4 A;  3SDC A;  1ZHB A;  1T7X A;  3BH9 A;  3VFM A;  4CVZ A;  4PRD A;  1T7Z A;  5EO1 A;  1T21 A;  3KLA A;  4LCY A;  3LKP A;  4F7T A;  1E28 A;  2FWO A;  1MWA H;  1OGA A;  2ESV A;  4UQ2 A;  1QEW A;  4K71 B;  3VRI A;  1G7P A;  4WU7 A;  3RL1 A;  4NHU E;  4L8S C;  1QLF A;  4HUX A;  5MEQ A; 
#chains in the Genus database with same CATH homology
 1AGD A;  4ZUT A;  3ARF A;  3WUW A;  1I4F A;  4L8C A;  3MGO A;  2ZSW A;  2UWE A;  2MHA A;  5BRZ A;  1KJV A;  4F7E A;  4WW2 C;  2PYE A;  1HHK A;  2GAZ A;  4ELM A;  4LHU A;  3PQY A;  5C0G A;  3I6K A;  3RWJ A;  1K8D A;  1NAM H;  3PWL A;  5EO0 A;  5HHQ A;  2BVP A;  3V5H A;  1NAN H;  5GSV A;  3PWP A;  1EEY A;  5C0I A;  3KYN A;  5DEG A;  5FA3 A;  2XPG A;  1AKJ A;  1JFM A;  1YDP A;  3ARD A;  3BP7 A;  3GMM A;  4QRR A;  5BJT A;  1N3N A;  5F7D A;  1LP9 A;  4L8D A;  3BHB A;  4IIQ C;  2F53 A;  5C0C A;  1HHH A;  1AGE A;  3GSO A;  4E5X A;  4X6C A;  1AGB A;  3GMO A;  4N0U A;  1EFX A;  1T1Z A;  3BW9 A;  4MNQ A;  4U6Y A;  2X4Q A;  3L3J A;  4JFF A;  3FTG A;  3LKR A;  3QZW A;  4G9D A;  4S0U C;  4U1M A;  5C0D A;  3TN0 A;  2ZSV A;  3MRP A;  1TMC A;  4ZUU A;  4K7F A;  1ZHK A;  5DDH A;  1T1W A;  3ARB A;  1QRN A;  3GMR A;  3MRH A;  3MRQ A;  3PAB A;  4O2C A;  4PGE A;  1DUZ A;  1A1O A;  4L3C A;  5INC A;  5E8N A;  3D39 A;  2NW3 A;  4PV9 A;  5HGA A;  3MYJ A;  4IHO A;  3GSV A;  3CC5 A;  2AKR A;  1GZP A;  4MS8 A;  5D7L A;  3RWE A;  1LD9 A;  3MRN A;  1A9E A;  4IRS A;  3KXF A;  2F74 A;  4O2E A;  3VXR A;  1JGD A;  4CW1 A;  5EUO A;  5D9S A;  4PJB A;  5EU4 A;  2D31 A;  1W72 A;  4MNG A;  5F1I A;  3QDJ A;  3BEV A;  1HSB A;  2ZOK A;  4NO5 A;  1T1X A;  1Z5L A;  3VXO A;  3TPU E;  1BD2 A;  1AGF A;  3D2U A;  3H7B A;  3MR9 A;  3MRJ A;  4U1N A;  1KPR A;  3QUK A;  1I1F A;  4XXC A;  1Q94 A;  3VXU A;  3FOL A;  1M6O A;  1N5A A;  3L9R A;  5FDW A;  1N2R A;  4PRH A;  3CH1 A;  1OSZ A;  3C8K A;  3UBX A;  1T7Y A;  3ROL A;  3HG1 A;  1QQD A;  4LCW A;  3UTQ A;  2CLZ A;  5FKP A;  5ACZ A;  1ZT7 A;  1VGK A;  1S7S A;  3CVH A;  4CVX A;  2CLR A;  5FA4 A;  3T1F A;  4GKN A;  1QO3 A;  1ONQ A;  5SWZ A;  3VJ6 A;  1OGT A;  3O3D A;  4PRA A;  3LN5 A;  2AV7 A;  4HV8 A;  5F1N A;  3QDG A;  3DTX A;  4L4T A;  5EOT A;  1BII A;  3LKS A;  4NQE A;  4NO3 A;  2VLK A;  4Y4K A;  4ZUS A;  5IVX A;  4G42 A;  3VRJ A;  3PWV A;  3VH8 A;  3UTS A;  1PQZ A;  1B3J A;  3QFJ A;  4APQ A;  3GSU A;  4U1J A;  1T1Y A;  4PJF A;  1NEZ A;  1INQ A;  3KPQ A;  3D25 A;  3RWG A;  5EU6 A;  1MHC A;  2AXF A;  1X7Q A;  2GTW A;  1LQV A;  4NNX A;  3GMN A;  3L3H A;  3DBX A;  3RL2 A;  3L3G A;  2J8U A;  3M17 A;  3AM8 A;  3E2H A;  4PG2 A;  4HUU A;  1S9W A;  3IT8 D;  1W0V A;  3UTT A;  4QRU A;  1JHT A;  2BST A;  1M05 A;  4JQX A;  3VFW A;  1W0W A;  4JRY A;  4U1L A;  3RWD A;  1FO0 H;  1KPU A;  3MRC A;  4JRX A;  4MXQ A;  4PJX A;  5D2L A;  3HUJ A;  3WS3 A;  2VE6 A;  4D0B A;  3D18 A;  2DYP A;  4NQV A;  3TA3 A;  3TJH A;  3X12 A;  3M1B A;  1B0G A;  4MQ7 A;  1BZ9 A;  5DEF A;  3QUZ A;  2OL3 H;  5C0J A;  2X70 A;  3TBY A;  2E7L E;  3VWJ A;  1S7U A;  4ZFZ A;  5J6H A;  4HKJ A;  5D2N A;  5E8O A;  5BS0 A;  1S9X A;  3BXN A;  3KPS A;  4PJE A;  4Y4F A;  2GT9 A;  4FFE X;  4L29 A;  3O9W A;  1FZO A;  2GIT A;  5C07 A;  2HJK A;  1WBX A;  2AV1 A;  4Z77 A;  1EXU A;  4PP8 C;  3P73 A;  3BVN A;  3FQR A;  4G8I A;  4MVB A;  5B38 A;  3MRR A;  3TO4 A;  3SKO A;  1HOC A;  3VFN A;  3O4L A;  1S8D A;  2P5W A;  4JFP A;  1ED3 A;  4PGB A;  1DE4 A;  1K5N A;  3HE7 A;  1QVO A;  3L3I A;  4PRN A;  1T22 A;  4NQX A;  3DX8 A;  4U1I A;  5E00 A;  5C9J A;  5SWQ A;  3MV9 A;  3TFK A;  1FZM A;  4ONO A;  3X14 A;  5AD0 A;  5E8P A;  4PRE A;  4O2F A;  4PRP A;  3SJV A;  3MGT A;  2YEZ A;  1C16 A;  1IM9 A;  1T7V A;  2V2W A;  3KPP A;  1S7W A;  3P4M A;  4U1K A;  3GSQ A;  4QRQ A;  3BO8 A;  5IM7 A;  1UXS A;  1TVH A;  1E27 A;  4LNR A;  2H26 A;  3GSW A;  3H9H A;  1T80 A;  3MRO A;  4JFQ A;  3BH8 A;  2HN7 A;  4U1H A;  5HHN A;  2VAB A;  5C0B A;  1QSE A;  1SYV A;  3MRI A;  4QRS A;  3KYO A;  5F9J A;  4PG9 A;  5HGD A;  2VLL A;  2BVQ A;  1SYS A;  4PDC E;  3E6F A;  4WU5 A;  5IEH A;  3BGM A;  3SDD A;  4EUP A;  3DX7 A;  5C0F A;  3GML A;  1MHE A;  4X6F A;  3QUY A;  5IB1 A;  1A6Z A;  3FQX A;  1FZK A;  1YPZ A;  3TBW A;  4GKS A;  4I48 A;  5L2K A;  1JE6 A;  2RFX A;  1QR1 A;  3SPV A;  3FOM A;  1CG9 A;  3MRF A;  4D0D A;  3I6G A;  3FQN A;  3L3K A;  3VFP A;  5C09 A;  1N59 A;  3HAE A;  4PRI A;  4WWK C;  3P9M A;  1FFP A;  3OXR A;  2XFX A;  4MJ5 A;  3RUG A;  1AO7 A;  3GSX A;  3MRG A;  3V5K A;  4PRB A;  3ES6 A;  3RZC A;  4HX1 A;  3BP4 A;  3H9S A;  2HLA A;  3MRM A;  3QQ3 A;  4Y16 A;  4X6E A;  3IXA A;  4N0C A;  1XR8 A;  2F54 A;  4PGD A;  3RWF A;  3U0P A;  4X6D A;  3GSN H;  4ZAK A;  4ZUV A;  5IB2 A;  3MRE A;  4L9L C;  1RJY A;  5C0A A;  3TVM A;  2BSR A;  4PJ9 A;  1AGC A;  3ILQ C;  3WL9 A;  1VAD A;  3RTQ A;  1JUF A;  4MJ6 A;  1XR9 A;  4JFO A;  4PGC A;  3B6S A;  3E6H A;  1T7W A;  3FFC A;  1R3H A;  4NO0 A;  4U6X A;  4WO4 A;  4G59 A;  2JCC A;  4PJA A;  1FFN A;  1HHJ A;  5H94 A;  2A83 A;  3B3I A;  1JF1 A;  3CZF A;  3TBT A;  3W0W A;  4F7M A;  5D7J C;  3GIV A;  5EU5 A;  5D7I A;  1FG2 A;  4QRT A;  5MEP A;  1A1M A;  1CD1 A;  3KPN A;  4D0C A;  3HE6 A;  4GUP A;  3FT2 A;  3JTC A;  4NNY A;  4F7C A;  1YN7 A;  1ZT1 A;  3O3E A;  1A1N A;  2FIK A;  3HPJ A;  1GZQ A;  2VLR A;  1UQS A;  4QRP A;  5B39 A;  3VFU A;  5BXF A;  1FZJ A;  2X4O A;  4PR5 A;  1P1Z A;  2CIK A;  1S7T A;  4ZUW A;  1G7Q A;  3VCL A;  1ZVS A;  3LKQ A;  3TID A;  2BVO A;  1KBG H;  3FQU A;  1TVB A;  2OI9 A;  3X13 A;  1KJM A;  1U58 A;  3P77 A;  5HHO A;  3RWC A;  3VXM A;  1KCG C;  4N8V A;  5IB5 A;  3PWU A;  4Y4H A;  3TZV C;  4G9F A;  3RGV C;  3MV8 A;  4LCC C;  4WUU A;  5EFI A;  1LEK A;  4NT6 A;  3VFR A;  4Z78 A;  2GJ6 A;  2X4U A;  3NFN A;  3FQT A;  3X11 A;  3KWW A;  1I7U A;  2C7U A;  2BNR A;  3KPM A;  3RWI A;  4Z76 A;  4EN3 C;  3QUL A;  1ZT4 A;  1IM3 A;  4MX7 A;  4HUV A;  3JTS A;  1WBY A;  3GJF A;  2X4R A;  4Y2D A;  5J1A A;  1BQH A;  4NQD A;  3REW A;  1ZHL A;  5HYJ A;  4PJH A;  3RWH A;  3L3D A;  3MRL A;  5HHP A;  4JFD A;  3DMM A;  1CE6 A;  3TIE A;  5C08 A;  1L8J A;  3KPO A;  4MJI A;  4PV8 A;  1JGE A;  4PJC A;  2FZ3 A;  3GMQ A;  4PJ5 A;  4HS3 A;  3SDA A;  3PWN A;  1JPF A;  3VFS A;  5E9D A;  1EEZ A;  3MA7 A;  3MV7 A;  1S9Y A;  5HGH A;  3FON A;  4WJ5 A;  3TO2 A;  2YPK A;  4V3D B;  5SWS A;  1KJ3 H;  4G43 A;  1DUY A;  1S7V A;  2BCK A;  5ENW A;  1QSF A;  3QDM A;  3DXA A;  1HSA A;  1KJ2 H;  1YN6 A;  1XH3 A;  3HCV A;  4HWZ A;  2VLJ A;  3JTT A;  4PJD A;  2X4N A;  2WY3 A;  2FYY A;  1DDH A;  2X4T A;  3GSR A;  1T20 A;  1OF2 A;  1ZAG A;  1HHI A;  3S6C A;  3P9L A;  3ECB A;  3VXP A;  3VFV A;  3MRB A;  3HLA A;  2BNQ A;  3D3V A;  1WBZ A;  4V3E B;  2ZOL A;  2X4S A;  1HYR C;  4EI5 A;  3BZF A;  3ERY A;  5C0E A;  4JQV A;  1FFO A;  1G6R H;  4WDI A;  3ILP A;  4JFE A;  3VXN A;  2CII A;  5HHM A;  3ROO A;  1ZSD A;  1I7R A;  1JPG A;  3QUX A;  4IRJ A;  3TBV A;  5IEK A;  1LEG A;  1RK0 A;  4PJ7 A;  1S7Q A;  5EU3 A;  5L2J A;  4E0R A;  3TF7 A;  5JHD A;  2V2X A;  1I1A A;  3P4O A;  1KPV A;  2CKB H;  3MRD A;  3ARG A;  5HGB A;  3QQ4 A;  5E6I C;  3FRU A;  3T8X A;  4FTV A;  1MI5 A;  3BUY A;  4N0F A;  2AXG A;  4L4V A;  2P5E A;  3TBS A;  5MEN A;  4F7P A;  3FQW A;  1XZ0 A;  3SDX A;  5MER A;  3KPL A;  4NQC A;  1LDP H;  1ZS8 A;  3ARE A;  3FT4 A;  1S7R A;  3C9N A;  3SKM A;  5GSR A;  1UXW A;  2H6P A;  3OX8 A;  3W39 A;  3BWA A;  3VFO A;  3WS6 A;  3VFT A;  5IB4 A;  3CDG A;  3G08 A;  2VAA A;  2Q7Y A;  1I7T A;  1HHG A;  1KTL A;  3MRK A;  3I6L D;  1LK2 A;  1P7Q A;  4PJG A;  4PJI A;  3E3Q A;  2HJL A;  4N5E A;  3SCM A;  3PWJ A;  1B0R A;  3QFD A;  3QI9 A;  4HUW A;  3UPR A;  3FT3 A;  1RK1 A;  4L8B A;  3AU1 A;  4I4W A;  2NX5 A;  1A9B A;  3BEW A;  1VAC A;  4L3E A;  3WLB A;  4G8G A;  3O3B A;  1T0M A;  2CLV A;  4QOK A;  3OV6 A;  1P4L A;  1I1Y A;  2PO6 A;  3OXS A;  4PJ8 A;  3O3A A;  5IRO A;  5IB3 A;  5MEO A;  3LV3 A;  2GUO A;  3DX6 A;  5ISZ A;  3V5D A;  3VWK A;  2BSS A;  4U1S A;  2GTZ A;  3JVG A;  5J6G A;  5D5M A;  4NO2 A;  3QEQ A;  3VXS A;  1ZHN A;  3KPR A;  1S7X A;  2YPL A;  1T0N A;  2FO4 A;  3LN4 A;  3GMP A;  5IND A;  2X4P A;  3BZE A;  3O8X A;  3P4N A;  4NSK A;  3CPL A;  4UQ3 A;  1RJZ A;  3LKO A;  3CCH A;  3LKN A;  2AK4 A;  3SDC A;  1ZHB A;  1T7X A;  3BH9 A;  3VFM A;  4CVZ A;  4PRD A;  1T7Z A;  5EO1 A;  1T21 A;  3KLA A;  4LCY A;  3LKP A;  4F7T A;  1E28 A;  2FWO A;  1MWA H;  1OGA A;  2ESV A;  4UQ2 A;  1QEW A;  4K71 B;  3VRI A;  1G7P A;  4WU7 A;  3RL1 A;  4NHU E;  4L8S C;  1QLF A;  4HUX A;  5MEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...