4PP8C

Crystal structure of murine nk cell ligand rae-1 beta in complex with nkg2d
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
168
structure length
146
Chain Sequence
b'HSLRCNLTIKDPTPADPLWYEAKCFVGEILILHLSNINATEVKKCLTQPLKNLCQKLRNKVSNTYPHLQVTMIYPQSQGRTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGEFVKQLKFLIHECSQKMDEFLKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NKG2-D type II integral membrane protein
publication title Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 146
sequence length 168
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14586 MHC_I_2 Class I Histocompatibility antigen, NKG2D ligand, domains 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pp8C00
4I48A 4LCCC 3JTTA 3RWHA 4G8GA 4S0UC 4JFPA 3VJ6A 1ONQA 1N2RA 1T1YA 1ZAGA 1GZQA 5EU3A 2D31A 3JTCA 3OXSA 5F7DA 4APQA 2X4OA 3E2HA 3LV3A 1HYRC 4U1KA 5F9JA 3L3GA 1OF2A 5E9DA 1FFNA 3BUYA 5GSRA 1QEWA 5SWZA 5HHNA 5E6IC 5C0FA 3ECBA 5L2KA 4HV8A 1QRNA 5FA3A 3C8KA 4ONOA 4Z77A 1I7UA 3KWWA 3HE7A 1HHKA 4L8DA 5GSVA 3MRHA 1NAMH 5L2JA 4NO3A 4NQEA 5AD0A 4EUPA 3D25A 3L3IA 1A1NA 3O4LA 1S7TA 5HGAA 1T0MA 3VXUA 4X6EA 3IT8D 5H94A 3TN0A 3MV8A 4HUUA 5HHOA 3BEVA 1JF1A 1P4LA 5E8PA 2F53A 4Z76A 3DXAA 3VFWA 4PG2A 4X6DA 1LP9A 1A1MA 1ZS8A 2MHAA 3WS6A 4Y2DA 1ZHKA 2X4QA 3VXPA 5MEPA 1KTLA 1NEZA 2CIIA 3TFKA 2J8UA 2VLKA 3LKQA 3ILQC 4Z78A 5C0IA 1T7XA 2DYPA 3QEQA 4MJ5A 4JFFA 3SKMA 3DMMA 3HE6A 3SJVA 3VXNA 4LHUA 4MVBA 5D7LA 5MEQA 3H9HA 4PRIA 1VGKA 3VXSA 5BXFA 2OL3H 3HLAA 4PJCA 4FTVA 1SYSA 3RWGA 4D0DA 5HGBA 3AREA 1T21A 1XZ0A 5DDHA 3BW9A 3WS3A 1T1WA 3FQWA 3VFPA 2X4NA 1JHTA 2H6PA 3GMPA 4HUXA 4K7FA 3HPJA 3W0WA 1HOCA 3BXNA 3KPQA 3PWJA 4U1MA 4V3EB 3MRFA 3MROA 3KYNA 5C0DA 4PRAA 4QOKA 1FZKA 3O3DA 4PGBA 5EU5A 4N0UA 2ZSWA 4XXCA 3DX6A 5SWSA 1S7VA 2CKBH 3T8XA 5ENWA 3LKRA 4WW2C 1MWAH 3CPLA 4Y4FA 1KPUA 1W0VA 3MRJA 4ZUTA 2GJ6A 2FZ3A 3SDAA 5ISZA 3TF7A 4D0BA 3TBWA 2WY3A 2GAZA 2FO4A 5IB5A 3CCHA 1CG9A 4U1JA 1T7WA 1QO3A 4EI5A 5IROA 1C16A 2VE6A 2JCCA 3O9WA 3B6SA 4NO2A 1AO7A 3FT3A 4D0CA 5J6GA 3VWKA 1ZHBA 1ZT7A 1G6RH 2V2WA 3GIVA 3BP4A 4NNYA 1R3HA 3NFNA 2XPGA 4G59A 4NQCA 3SCMA 4MXQA 2YPKA 1VADA 4MX7A 4PG9A 2HN7A 3RWFA 5D7IA 2GUOA 5IB2A 4JFQA 4PJ7A 4L29A 3GSRA 4NNXA 3VRJA 2AK4A 2BSRA 4PJXA 4U1HA 5SWQA 1AGBA 4HKJA 5D2NA 3H9SA 5F1IA 3MYJA 3WUWA 1AGCA 4IRSA 3P9MA 2X4TA 4F7CA 3AM8A 4PRHA 1OSZA 4G9FA 3MV9A 1YDPA 2AV7A 5D2LA 3L9RA 2X4RA 2BVPA 3KPNA 3QQ3A 5D5MA 5EO1A 3TZVC 5C0CA 1HHJA 4PV8A 5EOTA 3GMLA 3GSVA 4O2CA 1JPFA 4QRRA 3UTTA 4U1SA 5INDA 3UBXA 4JQXA 5FKPA 4JFOA 5IB4A 1JPGA 4X6FA 1YN7A 4WO4A 4F7MA 1I7TA 4MJ6A 4NO5A 1RJZA 4JFEA 3QUZA 4NQXA 1IM3A 3QDMA 3S6CA 3PQYA 2CIKA 2OI9A 3G08A 3ROLA 3RWDA 4LCWA 3ARFA 3BO8A 3D18A 3HAEA 1CD1A 4WU5A 1INQA 4N0FA 3MRIA 5C07A 4L8SC 1M6OA 3MR9A 4QRTA 1AKJA 3KYOA 3UPRA 3FT4A 4PJIA 3LN4A 5EU6A 2ZSVA 4WU7A 1G7QA 5IEKA 3LKNA 2P5WA 3C9NA 4WUUA 5IM7A 1I1YA 3GMOA 4X6CA 4NQVA 4HUVA 1I1FA 1OGAA 5HYJA 3QI9A 2C7UA 1RK1A 4WJ5A 2HJKA 3TPUE 4ZUVA 1WBZA 4Y16A 1FG2A 1HHGA 4NHUE 1FFPA 1GZPA 1T7ZA 3U0PA 1WBXA 1XR8A 4IHOA 3D39A 4JRXA 3O3BA 1A9BA 4PJGA 4UQ3A 5DEFA 5FA4A 5C9JA 3RUGA 3TIDA 1U58A 3SKOA 4HX1A 1EFXA 3FQTA 1NANH 3OXRA 4EN3C 4PP8C 3T1FA 2CLZA 3VFMA 4NQDA 3B3IA 1HSAA 1S9XA 3MRMA 2P5EA 3E3QA 2ESVA 3PWUA 4Y4KA 3QUYA 3TBSA 1M05A 4NT6A 4QRUA 2AV1A 3PWVA 3MRNA 4U6YA 3ROOA 3GMNA 3P4OA 1FZJA 3GSWA 3BVNA 2F74A 1T1XA 4MNQA 2BSSA 3UTSA 4F7TA 1T80A 3IXAA 1N59A 3MREA 1E27A 2UWEA 3V5HA 2FYYA 1S9WA 1DDHA 1YPZA 3O3AA 3PWPA 3QUKA 5BJTA 3M17A 1DUZA 3UTQA 3FQXA 4ZFZA 3VCLA 2BSTA 3HG1A 5C0AA 3FTGA 3MA7A 5ACZA 1E28A 1T7VA 2NX5A 3X12A 3TVMA 4F7PA 3FQRA 1QVOA 3KPRA 3DX8A 3ARDA 3M1BA 3QUXA 4ZUSA 3GSUA 3SPVA 3VFRA 2BCKA 4WWKC 4PRPA 4L8BA 3GMRA 4PJ8A 4PJ5A 3O3EA 4U1LA 4PJ9A 3WL9A 1EEYA 1S7RA 5IB1A 2H26A 1N5AA 2V2XA 4F7EA 1S7SA 2YPLA 4PREA 4PGCA 2ZOKA 1Z5LA 3D2UA 1X7QA 5IEHA 1FO0H 3WLBA 2FWOA 3MRRA 4PRDA 3BP7A 1S7QA 1LK2A 1T20A 1UXWA 2BNRA 4CW1A 3AU1A 1ZHNA 5C09A 2GTWA 1DUYA 4MJIA 4L9LC 2RFXA 2VLRA 1HHHA 5C0JA 1MHCA 3FOLA 4PJEA 1P1ZA 1RK0A 3PABA 1KPVA 3BH9A 1Q94A 1ZT4A 2VAAA 3MRGA 3PWNA 1KJVA 4PJDA 4QRPA 3OX8A 1JUFA 2GT9A 2NW3A 3GSQA 5D7JC 1IM9A 3FQUA 4K71B 1T22A 1JGDA 4L8CA 4GKNA 2VLJA 2ZOLA 3CZFA 1S7WA 3VXMA 3VFVA 3V5KA 3QFDA 3GSXA 3D3VA 1S8DA 4GKSA 4ZUWA 3MRCA 2E7LE 1N3NA 4MNGA 4PGEA 4G42A 1G7PA 3HUJA 4HUWA 3RWCA 4N5EA 1K8DA 4G8IA 3ERYA 1AGDA 2XFXA 4PR5A 3RL2A 1W72A 3P9LA 3LKSA 3BWAA 3VFTA 4E5XA 2CLVA 4E0RA 3ARGA 1I4FA 4N0CA 2X70A 4MS8A 3LKOA 1KCGC 3KPLA 3MRPA 1ZSDA 3P73A 3QZWA 3V5DA 1ZT1A 1EXUA 1LD9A 4Y4HA 3CDGA 4G43A 3TJHA 1AGFA 1KBGH 1SYVA 1LEGA 3BZEA 4PV9A 1ZHLA 4UQ2A 3TO2A 2X4PA 5EUOA 1QSEA 3FOMA 1TVBA 4V3DB 4L4TA 3X13A 3BZFA 3JVGA 4PRNA 3CVHA 4JRYA 3QQ4A 3HCVA 1UXSA 3TBVA 1QSFA 4GUPA 3W39A 4LCYA 3H7BA 3SDXA 4JFDA 5J1AA 2VABA 3I6KA 4PJBA 3L3HA 3GMMA 4FFEX 4ZUUA 1XH3A 1OGTA 5MERA 1JGEA 2Q7YA 1K5NA 1B0GA 2BVOA 4PDCE 5HGHA 1I1AA 2PO6A 1BD2A 3X11A 1TMCA 2GTZA 3REWA 3KPPA 1MHEA 3L3JA 2BNQA 3RL1A 3DTXA 5MEOA 5IVXA 4IIQC 1S7XA 3GJFA 3VH8A 5HHPA 4G9DA 4N8VA 1BIIA 3RWEA 4L4VA 5B38A 1ZVSA 3I6GA 3QULA 3BGMA 3MGTA 3MV7A 3QDGA 3GSNH 5C08A 5BS0A 3MRLA 4U1IA 3TIEA 1VACA 2A83A 3MRBA 1XR9A 3FFCA 3CC5A 1T0NA 1A6ZA 4O2FA 3MGOA 3P4NA 3KPSA 4PGDA 3TA3A 2AXFA 1QR1A 4L3CA 1B3JA 4NO0A 3FT2A 4L3EA 2HLAA 4HS3A 3RZCA 3O8XA 3VFNA 4IRJA 3VXOA 4HWZA 1KJ2H 3L3DA 3DX7A 2F54A 2BVQA 2X4SA 3DBXA 3BEWA 5HHMA 1T1ZA 1BQHA 4LNRA 2CLRA 1FFOA 3BHBA 3FQNA 3LN5A 5E8NA 5C0EA 2GITA 4QRQA 5E8OA 1PQZA 5JHDA 4NSKA 5F1NA 3VFUA 1JFMA 3P77A 1I7RA 1BZ9A 2VLLA 1DE4A 4WDIA 1QLFA 4ZAKA 3KPMA 5EFIA 5C0GA 5J6HA 1FZOA 3P4MA 3GMQA 4PJHA 4U6XA 5BRZA 3VFOA 1CE6A 5C0BA 1LDPH 5INCA 3SDDA 1B0RA 3ILPA 1HSBA 3BH8A 1UQSA 1KJMA 5IB3A 4CVXA 1A1OA 3QDJA 2AKRA 5HHQA 3GSOA 1S9YA 1EEZA 5DEGA 1JE6A 1AGEA 5D9SA 5B39A 2X4UA 1A9EA 3L3KA 1HHIA 1RJYA 3OV6A 4CVZA 3KLAA 1QQDA 2HJLA 3ES6A 3TO4A 1LEKA 3KXFA 3MRDA 3RGVC 1S7UA 4O2EA 5EO0A 1LQVA 3RWJA 3QFJA 3VFSA 3PWLA 3FRUA 4PJAA 5FDWA 5EU4A 1WBYA 3SDCA 1ED3A 3VWJA 1KJ3H 1P7QA 2YEZA 2FIKA 5HGDA 2PYEA 3JTSA 3CH1A 3E6FA 1L8JA 2AXGA 3TBTA 4PJFA 1W0WA 3KPOA 3X14A 5MENA 5E00A 3MRQA 3RTQA 3RWIA 4JQVA 3E6HA 3TBYA 4U1NA 3VRIA 3FONA 3I6LD 1KPRA 3VXRA 1MI5A 3LKPA 4ELMA 4MQ7A 1YN6A 1FZMA 1TVHA 3ARBA 4I4WA 3MRKA 4PRBA 1T7YA 4QRSA
chains in the Genus database with same CATH superfamily
4I48A 4LCCC 3JTTA 3RWHA 4G8GA 4S0UC 4JFPA 3VJ6A 1ONQA 1N2RA 1T1YA 1ZAGA 1GZQA 5EU3A 2D31A 3JTCA 3OXSA 5F7DA 4APQA 2X4OA 3E2HA 3LV3A 1HYRC 4U1KA 5F9JA 3L3GA 1OF2A 5E9DA 1FFNA 3BUYA 5GSRA 1QEWA 5SWZA 5HHNA 5E6IC 5C0FA 3ECBA 5L2KA 4HV8A 1QRNA 5FA3A 3C8KA 4ONOA 4Z77A 1I7UA 3KWWA 3HE7A 1HHKA 4L8DA 5GSVA 3MRHA 1NAMH 5L2JA 4NO3A 4NQEA 5AD0A 4EUPA 3D25A 3L3IA 1A1NA 3O4LA 1S7TA 5HGAA 1T0MA 3VXUA 4X6EA 3IT8D 5H94A 3TN0A 3MV8A 4HUUA 5HHOA 3BEVA 1JF1A 1P4LA 5E8PA 2F53A 4Z76A 3DXAA 3VFWA 4PG2A 4X6DA 1LP9A 1A1MA 1ZS8A 2MHAA 3WS6A 4Y2DA 1ZHKA 2X4QA 3VXPA 5MEPA 1KTLA 1NEZA 2CIIA 3TFKA 2J8UA 2VLKA 3LKQA 3ILQC 4Z78A 5C0IA 1T7XA 2DYPA 3QEQA 4MJ5A 4JFFA 3SKMA 3DMMA 3HE6A 3SJVA 3VXNA 4LHUA 4MVBA 5D7LA 5MEQA 3H9HA 4BKWA 4PRIA 1VGKA 3VXSA 5BXFA 2OL3H 3HLAA 4PJCA 4FTVA 1SYSA 3RWGA 4D0DA 5HGBA 3AREA 1T21A 1XZ0A 5DDHA 3BW9A 3WS3A 1T1WA 3FQWA 3VFPA 2X4NA 1JHTA 2H6PA 3GMPA 4HUXA 4K7FA 3HPJA 3W0WA 1HOCA 3BXNA 3KPQA 3PWJA 4U1MA 4V3EB 3MRFA 3MROA 3KYNA 5C0DA 4PRAA 4QOKA 1FZKA 3O3DA 4PGBA 5EU5A 4N0UA 2ZSWA 4XXCA 3DX6A 5SWSA 1S7VA 2CKBH 3T8XA 5ENWA 3LKRA 4WW2C 1MWAH 3CPLA 3I0TA 4Y4FA 1KPUA 1W0VA 3MRJA 4ZUTA 2GJ6A 2FZ3A 3SDAA 5ISZA 3TF7A 4D0BA 3TBWA 2WY3A 2GAZA 2FO4A 5IB5A 3CCHA 1CG9A 4U1JA 1T7WA 1QO3A 4EI5A 5IROA 1C16A 2VE6A 2JCCA 3O9WA 3B6SA 4NO2A 1AO7A 3FT3A 4D0CA 5J6GA 3VWKA 1ZHBA 1ZT7A 1G6RH 2V2WA 3GIVA 3BP4A 4NNYA 1R3HA 3NFNA 2XPGA 4G59A 4NQCA 3SCMA 4MXQA 2YPKA 1VADA 4MX7A 4PG9A 2HN7A 3RWFA 5D7IA 2GUOA 5IB2A 4JFQA 4PJ7A 4L29A 3GSRA 4NNXA 3VRJA 2AK4A 2BSRA 4PJXA 4U1HA 5SWQA 1AGBA 4HKJA 5D2NA 3H9SA 5F1IA 3MYJA 3WUWA 1AGCA 4IRSA 3P9MA 2X4TA 4F7CA 3AM8A 4PRHA 1OSZA 4G9FA 3MV9A 1YDPA 2AV7A 5D2LA 3L9RA 2X4RA 2NYKA 2BVPA 3KPNA 3QQ3A 5D5MA 5EO1A 3TZVC 5C0CA 1HHJA 4PV8A 5EOTA 3GMLA 3GSVA 4O2CA 1JPFA 4QRRA 3UTTA 4U1SA 5INDA 3UBXA 4JQXA 5FKPA 4JFOA 5IB4A 1JPGA 4X6FA 1YN7A 4WO4A 4F7MA 1I7TA 4MJ6A 4NO5A 1RJZA 4JFEA 3QUZA 4NQXA 1IM3A 3QDMA 3S6CA 3PQYA 2CIKA 2OI9A 3G08A 3ROLA 3RWDA 4LCWA 3ARFA 3BO8A 3D18A 3HAEA 1CD1A 4WU5A 1INQA 4N0FA 3MRIA 5C07A 4L8SC 1M6OA 3MR9A 4QRTA 1AKJA 3KYOA 3UPRA 3FT4A 4PJIA 3LN4A 5EU6A 2ZSVA 4WU7A 1G7QA 5IEKA 3LKNA 2P5WA 3C9NA 4WUUA 5IM7A 2IA1A 1I1YA 3GMOA 4X6CA 4NQVA 4HUVA 1I1FA 1OGAA 5HYJA 3QI9A 2C7UA 1RK1A 4WJ5A 2HJKA 3TPUE 4ZUVA 1WBZA 4Y16A 1FG2A 1HHGA 4NHUE 1FFPA 1GZPA 1T7ZA 3U0PA 1WBXA 1XR8A 4IHOA 3D39A 4JRXA 3O3BA 1A9BA 4PJGA 4UQ3A 5DEFA 5FA4A 5C9JA 3RUGA 3TIDA 1U58A 3SKOA 4HX1A 1EFXA 3FQTA 1NANH 3OXRA 4EN3C 4PP8C 3T1FA 2CLZA 3VFMA 4NQDA 3B3IA 1HSAA 1S9XA 3MRMA 2P5EA 3E3QA 2ESVA 3PWUA 4Y4KA 3QUYA 3TBSA 1M05A 4NT6A 4QRUA 2AV1A 3PWVA 3MRNA 4U6YA 3ROOA 3GMNA 3P4OA 1FZJA 3GSWA 3BVNA 2F74A 1T1XA 4MNQA 2BSSA 3UTSA 4F7TA 1T80A 3IXAA 1N59A 3MREA 1E27A 2UWEA 3V5HA 2FYYA 1S9WA 1DDHA 1YPZA 3O3AA 3PWPA 3QUKA 5BJTA 3M17A 1DUZA 3UTQA 3FQXA 4ZFZA 3VCLA 2BSTA 3HG1A 5C0AA 3FTGA 3MA7A 5ACZA 1E28A 1T7VA 2NX5A 3X12A 3TVMA 4F7PA 3FQRA 1QVOA 3KPRA 3DX8A 3ARDA 3M1BA 3QUXA 4ZUSA 3GSUA 3SPVA 3VFRA 2BCKA 4WWKC 4PRPA 4L8BA 3GMRA 4PJ8A 4PJ5A 3O3EA 4U1LA 4PJ9A 3WL9A 1EEYA 1S7RA 5IB1A 2H26A 1N5AA 2V2XA 4F7EA 1S7SA 2YPLA 4PREA 4PGCA 2ZOKA 1Z5LA 4G59C 3D2UA 1X7QA 5IEHA 1FO0H 3WLBA 2FWOA 3MRRA 4PRDA 3BP7A 1S7QA 1LK2A 1T20A 1UXWA 2BNRA 4CW1A 3AU1A 1ZHNA 5C09A 2GTWA 1DUYA 4MJIA 4L9LC 2RFXA 2VLRA 1HHHA 5C0JA 1MHCA 3FOLA 4PJEA 1P1ZA 1RK0A 3PABA 1KPVA 3BH9A 1Q94A 1ZT4A 2VAAA 3MRGA 3PWNA 1KJVA 4PJDA 4QRPA 3OX8A 1JUFA 2GT9A 2NW3A 3GSQA 5D7JC 1IM9A 3FQUA 4K71B 1T22A 1JGDA 4L8CA 4GKNA 2VLJA 2ZOLA 3CZFA 1S7WA 3VXMA 3VFVA 3V5KA 3QFDA 3GSXA 3D3VA 1S8DA 4GKSA 4ZUWA 3MRCA 2E7LE 1N3NA 4MNGA 4PGEA 4G42A 1G7PA 3HUJA 4HUWA 3RWCA 4N5EA 1K8DA 4G8IA 3ERYA 1AGDA 2XFXA 4PR5A 3RL2A 1W72A 3P9LA 3LKSA 3BWAA 3VFTA 4E5XA 2CLVA 4E0RA 3ARGA 1I4FA 4N0CA 2X70A 4MS8A 3LKOA 1KCGC 3KPLA 3MRPA 1ZSDA 3P73A 3QZWA 3V5DA 1ZT1A 1EXUA 1LD9A 4Y4HA 3CDGA 4G43A 3TJHA 1AGFA 1KBGH 1SYVA 1LEGA 3BZEA 4PV9A 1ZHLA 4UQ2A 3TO2A 2X4PA 5EUOA 1QSEA 3FOMA 1TVBA 4V3DB 4L4TA 3X13A 3BZFA 3JVGA 4PRNA 3CVHA 4JRYA 3QQ4A 3HCVA 1UXSA 3TBVA 1QSFA 4GUPA 3W39A 4JO8A 4LCYA 3H7BA 3SDXA 4JFDA 5J1AA 2VABA 3I6KA 4PJBA 3L3HA 3GMMA 4FFEX 4ZUUA 1XH3A 1OGTA 5MERA 1JGEA 2Q7YA 1K5NA 1B0GA 2BVOA 4PDCE 5HGHA 1I1AA 2PO6A 1BD2A 3X11A 1TMCA 2GTZA 3REWA 3KPPA 1MHEA 3L3JA 2BNQA 3RL1A 3DTXA 5MEOA 5IVXA 4IIQC 1S7XA 3GJFA 3VH8A 5HHPA 4G9DA 4N8VA 1BIIA 3RWEA 4L4VA 5B38A 1ZVSA 3I6GA 3QULA 3BGMA 3MGTA 3MV7A 3QDGA 3GSNH 5C08A 5BS0A 3MRLA 4U1IA 3TIEA 1VACA 2A83A 3MRBA 1XR9A 3FFCA 3CC5A 1T0NA 1A6ZA 4O2FA 3MGOA 3P4NA 3KPSA 4PGDA 3TA3A 2AXFA 1QR1A 4L3CA 1B3JA 4NO0A 3FT2A 4L3EA 2HLAA 4HS3A 3RZCA 3O8XA 3VFNA 4IRJA 3VXOA 4HWZA 1KJ2H 3L3DA 3DX7A 2F54A 2BVQA 2X4SA 3DBXA 3BEWA 5HHMA 1T1ZA 1BQHA 4LNRA 2CLRA 1FFOA 3BHBA 3FQNA 3LN5A 5E8NA 5C0EA 2GITA 4QRQA 5E8OA 1PQZA 5JHDA 4NSKA 5F1NA 3VFUA 1JFMA 3P77A 1I7RA 1BZ9A 2VLLA 1DE4A 4WDIA 1QLFA 4ZAKA 3KPMA 5EFIA 5C0GA 5J6HA 1FZOA 3P4MA 3GMQA 4PJHA 4U6XA 5BRZA 3VFOA 1CE6A 5C0BA 1LDPH 5INCA 3SDDA 1B0RA 3ILPA 1HSBA 3BH8A 1UQSA 1KJMA 5IB3A 4CVXA 1A1OA 3QDJA 2AKRA 5HHQA 3GSOA 1S9YA 1EEZA 5DEGA 1JE6A 1AGEA 5D9SA 5B39A 2X4UA 1A9EA 3L3KA 1HHIA 1RJYA 3OV6A 4CVZA 3KLAA 1QQDA 2HJLA 3ES6A 3TO4A 1LEKA 3KXFA 3MRDA 3RGVC 1S7UA 4O2EA 5EO0A 1LQVA 3RWJA 3QFJA 3VFSA 3PWLA 3FRUA 4PJAA 5FDWA 5EU4A 1WBYA 3SDCA 1ED3A 3VWJA 1KJ3H 1P7QA 2YEZA 2FIKA 5HGDA 2O5NA 2PYEA 3JTSA 3CH1A 3E6FA 1L8JA 2AXGA 3TBTA 4PJFA 1W0WA 3KPOA 3X14A 5MENA 5E00A 3MRQA 3RTQA 3RWIA 4JQVA 3E6HA 3TBYA 4U1NA 3VRIA 3FONA 3I6LD 1KPRA 3VXRA 1MI5A 3LKPA 4ELMA 4MQ7A 1YN6A 1FZMA 1TVHA 3ARBA 4I4WA 3MRKA 4PRBA 1T7YA 4QRSA
chains in the Genus database with same CATH topology
4I48A 4LCCC 3JTTA 3RWHA 4G8GA 4S0UC 4JFPA 3VJ6A 1ONQA 1N2RA 1T1YA 1ZAGA 1GZQA 5EU3A 2D31A 3JTCA 3OXSA 5F7DA 4APQA 2X4OA 3E2HA 3LV3A 1HYRC 4U1KA 5F9JA 3L3GA 1OF2A 5E9DA 1FFNA 3BUYA 5GSRA 1QEWA 5SWZA 5HHNA 5E6IC 5C0FA 3ECBA 5L2KA 4HV8A 1QRNA 5FA3A 3C8KA 4ONOA 4Z77A 1I7UA 3KWWA 3HE7A 1HHKA 4L8DA 5GSVA 3MRHA 1NAMH 5L2JA 4NO3A 4NQEA 5AD0A 4EUPA 3D25A 3L3IA 1A1NA 3O4LA 1S7TA 5HGAA 1T0MA 3VXUA 4X6EA 3IT8D 5H94A 3TN0A 3MV8A 4HUUA 5HHOA 3BEVA 1JF1A 1P4LA 5E8PA 2F53A 4Z76A 3DXAA 3VFWA 4PG2A 4X6DA 1LP9A 1A1MA 1ZS8A 2MHAA 3WS6A 4Y2DA 1ZHKA 2X4QA 3VXPA 5MEPA 1KTLA 1NEZA 2CIIA 3TFKA 2J8UA 2VLKA 3LKQA 3ILQC 4Z78A 5C0IA 1T7XA 2DYPA 3QEQA 4MJ5A 4JFFA 3SKMA 3DMMA 3HE6A 3SJVA 3VXNA 4LHUA 4MVBA 5D7LA 5MEQA 3H9HA 4PRIA 1VGKA 3VXSA 5BXFA 2OL3H 3HLAA 4PJCA 4FTVA 1SYSA 3RWGA 4D0DA 5HGBA 3AREA 1T21A 1XZ0A 5DDHA 3BW9A 3WS3A 1T1WA 3FQWA 3VFPA 2X4NA 1JHTA 2H6PA 3GMPA 4HUXA 4K7FA 3HPJA 3W0WA 1HOCA 3BXNA 3KPQA 3PWJA 4U1MA 4V3EB 3MRFA 3MROA 3KYNA 5C0DA 4PRAA 4QOKA 1FZKA 3O3DA 4PGBA 5EU5A 4N0UA 2ZSWA 4XXCA 3DX6A 5SWSA 1S7VA 2CKBH 3T8XA 5ENWA 3LKRA 4WW2C 1MWAH 3CPLA 4Y4FA 1KPUA 1W0VA 3MRJA 4ZUTA 2GJ6A 2FZ3A 3SDAA 5ISZA 3TF7A 4D0BA 3TBWA 2WY3A 2GAZA 2FO4A 5IB5A 3CCHA 1CG9A 4U1JA 1T7WA 1QO3A 4EI5A 5IROA 1C16A 2VE6A 2JCCA 3O9WA 3B6SA 4NO2A 1AO7A 3FT3A 4D0CA 5J6GA 3VWKA 1ZHBA 1ZT7A 1G6RH 2V2WA 3GIVA 3BP4A 4NNYA 1R3HA 3NFNA 2XPGA 4G59A 4NQCA 3SCMA 4MXQA 2YPKA 1VADA 4MX7A 4PG9A 2HN7A 3RWFA 5D7IA 2GUOA 5IB2A 4JFQA 4PJ7A 4L29A 3GSRA 4NNXA 3VRJA 2AK4A 2BSRA 4PJXA 4U1HA 5SWQA 1AGBA 4HKJA 5D2NA 3H9SA 5F1IA 3MYJA 3WUWA 1AGCA 4IRSA 3P9MA 2X4TA 4F7CA 3AM8A 4PRHA 1OSZA 4G9FA 3MV9A 1YDPA 2AV7A 5D2LA 3L9RA 2X4RA 2BVPA 3KPNA 3QQ3A 5D5MA 5EO1A 3TZVC 5C0CA 1HHJA 4PV8A 5EOTA 3GMLA 3GSVA 4O2CA 1JPFA 4QRRA 3UTTA 4U1SA 5INDA 3UBXA 4JQXA 5FKPA 4JFOA 5IB4A 1JPGA 4X6FA 1YN7A 4WO4A 4F7MA 1I7TA 4MJ6A 4NO5A 1RJZA 4JFEA 3QUZA 4NQXA 1IM3A 3QDMA 3S6CA 3PQYA 2CIKA 2OI9A 3G08A 3ROLA 3RWDA 4LCWA 3ARFA 3BO8A 3D18A 3HAEA 1CD1A 4WU5A 1INQA 4N0FA 3MRIA 5C07A 4L8SC 1M6OA 3MR9A 4QRTA 1AKJA 3KYOA 3UPRA 3FT4A 4PJIA 3LN4A 5EU6A 2ZSVA 4WU7A 1G7QA 5IEKA 3LKNA 2P5WA 3C9NA 4WUUA 5IM7A 1I1YA 3GMOA 4X6CA 4NQVA 4HUVA 1I1FA 1OGAA 5HYJA 3QI9A 2C7UA 1RK1A 4WJ5A 2HJKA 3TPUE 4ZUVA 1WBZA 4Y16A 1FG2A 1HHGA 4NHUE 1FFPA 1GZPA 1T7ZA 3U0PA 1WBXA 1XR8A 4IHOA 3D39A 4JRXA 3O3BA 1A9BA 4PJGA 4UQ3A 5DEFA 5FA4A 5C9JA 3RUGA 3TIDA 1U58A 3SKOA 4HX1A 1EFXA 3FQTA 1NANH 3OXRA 4EN3C 4PP8C 3T1FA 2CLZA 3VFMA 4NQDA 3B3IA 1HSAA 1S9XA 3MRMA 2P5EA 3E3QA 2ESVA 3PWUA 4Y4KA 3QUYA 3TBSA 1M05A 4NT6A 4QRUA 2AV1A 3PWVA 3MRNA 4U6YA 3ROOA 3GMNA 3P4OA 1FZJA 3GSWA 3BVNA 2F74A 1T1XA 4MNQA 2BSSA 3UTSA 4F7TA 1T80A 3IXAA 1N59A 3MREA 1E27A 2UWEA 3V5HA 2FYYA 1S9WA 1DDHA 1YPZA 3O3AA 3PWPA 3QUKA 5BJTA 3M17A 1DUZA 3UTQA 3FQXA 4ZFZA 3VCLA 2BSTA 3HG1A 5C0AA 3FTGA 3MA7A 5ACZA 1E28A 1T7VA 2NX5A 3X12A 3TVMA 4F7PA 3FQRA 1QVOA 3KPRA 3DX8A 3ARDA 3M1BA 3QUXA 4ZUSA 3GSUA 3SPVA 3VFRA 2BCKA 4WWKC 4PRPA 4L8BA 3GMRA 4PJ8A 4PJ5A 3O3EA 4U1LA 4PJ9A 3WL9A 1EEYA 1S7RA 5IB1A 2H26A 1N5AA 2V2XA 4F7EA 1S7SA 2YPLA 4PREA 4PGCA 2ZOKA 1Z5LA 3D2UA 1X7QA 5IEHA 1FO0H 3WLBA 2FWOA 3MRRA 4PRDA 3BP7A 1S7QA 1LK2A 1T20A 1UXWA 2BNRA 4CW1A 3AU1A 1ZHNA 5C09A 2GTWA 1DUYA 4MJIA 4L9LC 2RFXA 2VLRA 1HHHA 5C0JA 1MHCA 3FOLA 4PJEA 1P1ZA 1RK0A 3PABA 1KPVA 3BH9A 1Q94A 1ZT4A 2VAAA 3MRGA 3PWNA 1KJVA 4PJDA 4QRPA 3OX8A 1JUFA 2GT9A 2NW3A 3GSQA 5D7JC 1IM9A 3FQUA 4K71B 1T22A 1JGDA 4L8CA 4GKNA 2VLJA 2ZOLA 3CZFA 1S7WA 3VXMA 3VFVA 3V5KA 3QFDA 3GSXA 3D3VA 1S8DA 4GKSA 4ZUWA 3MRCA 2E7LE 1N3NA 4MNGA 4PGEA 4G42A 1G7PA 3HUJA 4HUWA 3RWCA 4N5EA 1K8DA 4G8IA 3ERYA 1AGDA 2XFXA 4PR5A 3RL2A 1W72A 3P9LA 3LKSA 3BWAA 3VFTA 4E5XA 2CLVA 4E0RA 3ARGA 1I4FA 4N0CA 2X70A 4MS8A 3LKOA 1KCGC 3KPLA 3MRPA 1ZSDA 3P73A 3QZWA 3V5DA 1ZT1A 1EXUA 1LD9A 4Y4HA 3CDGA 4G43A 3TJHA 1AGFA 1KBGH 1SYVA 1LEGA 3BZEA 4PV9A 1ZHLA 4UQ2A 3TO2A 2X4PA 5EUOA 1QSEA 3FOMA 1TVBA 4V3DB 4L4TA 3X13A 3BZFA 3JVGA 4PRNA 3CVHA 4JRYA 3QQ4A 3HCVA 1UXSA 3TBVA 1QSFA 4GUPA 3W39A 4LCYA 3H7BA 3SDXA 4JFDA 5J1AA 2VABA 3I6KA 4PJBA 3L3HA 3GMMA 4FFEX 4ZUUA 1XH3A 1OGTA 5MERA 1JGEA 2Q7YA 1K5NA 1B0GA 2BVOA 4PDCE 5HGHA 1I1AA 2PO6A 1BD2A 3X11A 1TMCA 2GTZA 3REWA 3KPPA 1MHEA 3L3JA 2BNQA 3RL1A 3DTXA 5MEOA 5IVXA 4IIQC 1S7XA 3GJFA 3VH8A 5HHPA 4G9DA 4N8VA 1BIIA 3RWEA 4L4VA 5B38A 1ZVSA 3I6GA 3QULA 3BGMA 3MGTA 3MV7A 3QDGA 3GSNH 5C08A 5BS0A 3MRLA 4U1IA 3TIEA 1VACA 2A83A 3MRBA 1XR9A 3FFCA 3CC5A 1T0NA 1A6ZA 4O2FA 3MGOA 3P4NA 3KPSA 4PGDA 3TA3A 2AXFA 1QR1A 4L3CA 1B3JA 4NO0A 3FT2A 4L3EA 2HLAA 4HS3A 3RZCA 3O8XA 3VFNA 4IRJA 3VXOA 4HWZA 1KJ2H 3L3DA 3DX7A 2F54A 2BVQA 2X4SA 3DBXA 3BEWA 5HHMA 1T1ZA 1BQHA 4LNRA 2CLRA 1FFOA 3BHBA 3FQNA 3LN5A 5E8NA 5C0EA 2GITA 4QRQA 5E8OA 1PQZA 5JHDA 4NSKA 5F1NA 3VFUA 1JFMA 3P77A 1I7RA 1BZ9A 2VLLA 1DE4A 4WDIA 1QLFA 4ZAKA 3KPMA 5EFIA 5C0GA 5J6HA 1FZOA 3P4MA 3GMQA 4PJHA 4U6XA 5BRZA 3VFOA 1CE6A 5C0BA 1LDPH 5INCA 3SDDA 1B0RA 3ILPA 1HSBA 3BH8A 1UQSA 1KJMA 5IB3A 4CVXA 1A1OA 3QDJA 2AKRA 5HHQA 3GSOA 1S9YA 1EEZA 5DEGA 1JE6A 1AGEA 5D9SA 5B39A 2X4UA 1A9EA 3L3KA 1HHIA 1RJYA 3OV6A 4CVZA 3KLAA 1QQDA 2HJLA 3ES6A 3TO4A 1LEKA 3KXFA 3MRDA 3RGVC 1S7UA 4O2EA 5EO0A 1LQVA 3RWJA 3QFJA 3VFSA 3PWLA 3FRUA 4PJAA 5FDWA 5EU4A 1WBYA 3SDCA 1ED3A 3VWJA 1KJ3H 1P7QA 2YEZA 2FIKA 5HGDA 2PYEA 3JTSA 3CH1A 3E6FA 1L8JA 2AXGA 3TBTA 4PJFA 1W0WA 3KPOA 3X14A 5MENA 5E00A 3MRQA 3RTQA 3RWIA 4JQVA 3E6HA 3TBYA 4U1NA 3VRIA 3FONA 3I6LD 1KPRA 3VXRA 1MI5A 3LKPA 4ELMA 4MQ7A 1YN6A 1FZMA 1TVHA 3ARBA 4I4WA 3MRKA 4PRBA 1T7YA 4QRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I48 A;  4LCC C;  3JTT A;  3RWH A;  4G8G A;  4S0U C;  4JFP A;  3VJ6 A;  1ONQ A;  1N2R A;  1T1Y A;  1ZAG A;  1GZQ A;  5EU3 A;  2D31 A;  3JTC A;  3OXS A;  5F7D A;  4APQ A;  2X4O A;  3E2H A;  3LV3 A;  1HYR C;  4U1K A;  5F9J A;  3L3G A;  1OF2 A;  5E9D A;  1FFN A;  3BUY A;  5GSR A;  1QEW A;  5SWZ A;  5HHN A;  5E6I C;  5C0F A;  3ECB A;  5L2K A;  4HV8 A;  1QRN A;  5FA3 A;  3C8K A;  4ONO A;  4Z77 A;  1I7U A;  3KWW A;  3HE7 A;  1HHK A;  4L8D A;  5GSV A;  3MRH A;  1NAM H;  5L2J A;  4NO3 A;  4NQE A;  5AD0 A;  4EUP A;  3D25 A;  3L3I A;  1A1N A;  3O4L A;  1S7T A;  5HGA A;  1T0M A;  3VXU A;  4X6E A;  3IT8 D;  5H94 A;  3TN0 A;  3MV8 A;  4HUU A;  5HHO A;  3BEV A;  1JF1 A;  1P4L A;  5E8P A;  2F53 A;  4Z76 A;  3DXA A;  3VFW A;  4PG2 A;  4X6D A;  1LP9 A;  1A1M A;  1ZS8 A;  2MHA A;  3WS6 A;  4Y2D A;  1ZHK A;  2X4Q A;  3VXP A;  5MEP A;  1KTL A;  1NEZ A;  2CII A;  3TFK A;  2J8U A;  2VLK A;  3LKQ A;  3ILQ C;  4Z78 A;  5C0I A;  1T7X A;  2DYP A;  3QEQ A;  4MJ5 A;  4JFF A;  3SKM A;  3DMM A;  3HE6 A;  3SJV A;  3VXN A;  4LHU A;  4MVB A;  5D7L A;  5MEQ A;  3H9H A;  4PRI A;  1VGK A;  3VXS A;  5BXF A;  2OL3 H;  3HLA A;  4PJC A;  4FTV A;  1SYS A;  3RWG A;  4D0D A;  5HGB A;  3ARE A;  1T21 A;  1XZ0 A;  5DDH A;  3BW9 A;  3WS3 A;  1T1W A;  3FQW A;  3VFP A;  2X4N A;  1JHT A;  2H6P A;  3GMP A;  4HUX A;  4K7F A;  3HPJ A;  3W0W A;  1HOC A;  3BXN A;  3KPQ A;  3PWJ A;  4U1M A;  4V3E B;  3MRF A;  3MRO A;  3KYN A;  5C0D A;  4PRA A;  4QOK A;  1FZK A;  3O3D A;  4PGB A;  5EU5 A;  4N0U A;  2ZSW A;  4XXC A;  3DX6 A;  5SWS A;  1S7V A;  2CKB H;  3T8X A;  5ENW A;  3LKR A;  4WW2 C;  1MWA H;  3CPL A;  4Y4F A;  1KPU A;  1W0V A;  3MRJ A;  4ZUT A;  2GJ6 A;  2FZ3 A;  3SDA A;  5ISZ A;  3TF7 A;  4D0B A;  3TBW A;  2WY3 A;  2GAZ A;  2FO4 A;  5IB5 A;  3CCH A;  1CG9 A;  4U1J A;  1T7W A;  1QO3 A;  4EI5 A;  5IRO A;  1C16 A;  2VE6 A;  2JCC A;  3O9W A;  3B6S A;  4NO2 A;  1AO7 A;  3FT3 A;  4D0C A;  5J6G A;  3VWK A;  1ZHB A;  1ZT7 A;  1G6R H;  2V2W A;  3GIV A;  3BP4 A;  4NNY A;  1R3H A;  3NFN A;  2XPG A;  4G59 A;  4NQC A;  3SCM A;  4MXQ A;  2YPK A;  1VAD A;  4MX7 A;  4PG9 A;  2HN7 A;  3RWF A;  5D7I A;  2GUO A;  5IB2 A;  4JFQ A;  4PJ7 A;  4L29 A;  3GSR A;  4NNX A;  3VRJ A;  2AK4 A;  2BSR A;  4PJX A;  4U1H A;  5SWQ A;  1AGB A;  4HKJ A;  5D2N A;  3H9S A;  5F1I A;  3MYJ A;  3WUW A;  1AGC A;  4IRS A;  3P9M A;  2X4T A;  4F7C A;  3AM8 A;  4PRH A;  1OSZ A;  4G9F A;  3MV9 A;  1YDP A;  2AV7 A;  5D2L A;  3L9R A;  2X4R A;  2BVP A;  3KPN A;  3QQ3 A;  5D5M A;  5EO1 A;  3TZV C;  5C0C A;  1HHJ A;  4PV8 A;  5EOT A;  3GML A;  3GSV A;  4O2C A;  1JPF A;  4QRR A;  3UTT A;  4U1S A;  5IND A;  3UBX A;  4JQX A;  5FKP A;  4JFO A;  5IB4 A;  1JPG A;  4X6F A;  1YN7 A;  4WO4 A;  4F7M A;  1I7T A;  4MJ6 A;  4NO5 A;  1RJZ A;  4JFE A;  3QUZ A;  4NQX A;  1IM3 A;  3QDM A;  3S6C A;  3PQY A;  2CIK A;  2OI9 A;  3G08 A;  3ROL A;  3RWD A;  4LCW A;  3ARF A;  3BO8 A;  3D18 A;  3HAE A;  1CD1 A;  4WU5 A;  1INQ A;  4N0F A;  3MRI A;  5C07 A;  4L8S C;  1M6O A;  3MR9 A;  4QRT A;  1AKJ A;  3KYO A;  3UPR A;  3FT4 A;  4PJI A;  3LN4 A;  5EU6 A;  2ZSV A;  4WU7 A;  1G7Q A;  5IEK A;  3LKN A;  2P5W A;  3C9N A;  4WUU A;  5IM7 A;  1I1Y A;  3GMO A;  4X6C A;  4NQV A;  4HUV A;  1I1F A;  1OGA A;  5HYJ A;  3QI9 A;  2C7U A;  1RK1 A;  4WJ5 A;  2HJK A;  3TPU E;  4ZUV A;  1WBZ A;  4Y16 A;  1FG2 A;  1HHG A;  4NHU E;  1FFP A;  1GZP A;  1T7Z A;  3U0P A;  1WBX A;  1XR8 A;  4IHO A;  3D39 A;  4JRX A;  3O3B A;  1A9B A;  4PJG A;  4UQ3 A;  5DEF A;  5FA4 A;  5C9J A;  3RUG A;  3TID A;  1U58 A;  3SKO A;  4HX1 A;  1EFX A;  3FQT A;  1NAN H;  3OXR A;  4EN3 C;  4PP8 C;  3T1F A;  2CLZ A;  3VFM A;  4NQD A;  3B3I A;  1HSA A;  1S9X A;  3MRM A;  2P5E A;  3E3Q A;  2ESV A;  3PWU A;  4Y4K A;  3QUY A;  3TBS A;  1M05 A;  4NT6 A;  4QRU A;  2AV1 A;  3PWV A;  3MRN A;  4U6Y A;  3ROO A;  3GMN A;  3P4O A;  1FZJ A;  3GSW A;  3BVN A;  2F74 A;  1T1X A;  4MNQ A;  2BSS A;  3UTS A;  4F7T A;  1T80 A;  3IXA A;  1N59 A;  3MRE A;  1E27 A;  2UWE A;  3V5H A;  2FYY A;  1S9W A;  1DDH A;  1YPZ A;  3O3A A;  3PWP A;  3QUK A;  5BJT A;  3M17 A;  1DUZ A;  3UTQ A;  3FQX A;  4ZFZ A;  3VCL A;  2BST A;  3HG1 A;  5C0A A;  3FTG A;  3MA7 A;  5ACZ A;  1E28 A;  1T7V A;  2NX5 A;  3X12 A;  3TVM A;  4F7P A;  3FQR A;  1QVO A;  3KPR A;  3DX8 A;  3ARD A;  3M1B A;  3QUX A;  4ZUS A;  3GSU A;  3SPV A;  3VFR A;  2BCK A;  4WWK C;  4PRP A;  4L8B A;  3GMR A;  4PJ8 A;  4PJ5 A;  3O3E A;  4U1L A;  4PJ9 A;  3WL9 A;  1EEY A;  1S7R A;  5IB1 A;  2H26 A;  1N5A A;  2V2X A;  4F7E A;  1S7S A;  2YPL A;  4PRE A;  4PGC A;  2ZOK A;  1Z5L A;  3D2U A;  1X7Q A;  5IEH A;  1FO0 H;  3WLB A;  2FWO A;  3MRR A;  4PRD A;  3BP7 A;  1S7Q A;  1LK2 A;  1T20 A;  1UXW A;  2BNR A;  4CW1 A;  3AU1 A;  1ZHN A;  5C09 A;  2GTW A;  1DUY A;  4MJI A;  4L9L C;  2RFX A;  2VLR A;  1HHH A;  5C0J A;  1MHC A;  3FOL A;  4PJE A;  1P1Z A;  1RK0 A;  3PAB A;  1KPV A;  3BH9 A;  1Q94 A;  1ZT4 A;  2VAA A;  3MRG A;  3PWN A;  1KJV A;  4PJD A;  4QRP A;  3OX8 A;  1JUF A;  2GT9 A;  2NW3 A;  3GSQ A;  5D7J C;  1IM9 A;  3FQU A;  4K71 B;  1T22 A;  1JGD A;  4L8C A;  4GKN A;  2VLJ A;  2ZOL A;  3CZF A;  1S7W A;  3VXM A;  3VFV A;  3V5K A;  3QFD A;  3GSX A;  3D3V A;  1S8D A;  4GKS A;  4ZUW A;  3MRC A;  2E7L E;  1N3N A;  4MNG A;  4PGE A;  4G42 A;  1G7P A;  3HUJ A;  4HUW A;  3RWC A;  4N5E A;  1K8D A;  4G8I A;  3ERY A;  1AGD A;  2XFX A;  4PR5 A;  3RL2 A;  1W72 A;  3P9L A;  3LKS A;  3BWA A;  3VFT A;  4E5X A;  2CLV A;  4E0R A;  3ARG A;  1I4F A;  4N0C A;  2X70 A;  4MS8 A;  3LKO A;  1KCG C;  3KPL A;  3MRP A;  1ZSD A;  3P73 A;  3QZW A;  3V5D A;  1ZT1 A;  1EXU A;  1LD9 A;  4Y4H A;  3CDG A;  4G43 A;  3TJH A;  1AGF A;  1KBG H;  1SYV A;  1LEG A;  3BZE A;  4PV9 A;  1ZHL A;  4UQ2 A;  3TO2 A;  2X4P A;  5EUO A;  1QSE A;  3FOM A;  1TVB A;  4V3D B;  4L4T A;  3X13 A;  3BZF A;  3JVG A;  4PRN A;  3CVH A;  4JRY A;  3QQ4 A;  3HCV A;  1UXS A;  3TBV A;  1QSF A;  4GUP A;  3W39 A;  4LCY A;  3H7B A;  3SDX A;  4JFD A;  5J1A A;  2VAB A;  3I6K A;  4PJB A;  3L3H A;  3GMM A;  4FFE X;  4ZUU A;  1XH3 A;  1OGT A;  5MER A;  1JGE A;  2Q7Y A;  1K5N A;  1B0G A;  2BVO A;  4PDC E;  5HGH A;  1I1A A;  2PO6 A;  1BD2 A;  3X11 A;  1TMC A;  2GTZ A;  3REW A;  3KPP A;  1MHE A;  3L3J A;  2BNQ A;  3RL1 A;  3DTX A;  5MEO A;  5IVX A;  4IIQ C;  1S7X A;  3GJF A;  3VH8 A;  5HHP A;  4G9D A;  4N8V A;  1BII A;  3RWE A;  4L4V A;  5B38 A;  1ZVS A;  3I6G A;  3QUL A;  3BGM A;  3MGT A;  3MV7 A;  3QDG A;  3GSN H;  5C08 A;  5BS0 A;  3MRL A;  4U1I A;  3TIE A;  1VAC A;  2A83 A;  3MRB A;  1XR9 A;  3FFC A;  3CC5 A;  1T0N A;  1A6Z A;  4O2F A;  3MGO A;  3P4N A;  3KPS A;  4PGD A;  3TA3 A;  2AXF A;  1QR1 A;  4L3C A;  1B3J A;  4NO0 A;  3FT2 A;  4L3E A;  2HLA A;  4HS3 A;  3RZC A;  3O8X A;  3VFN A;  4IRJ A;  3VXO A;  4HWZ A;  1KJ2 H;  3L3D A;  3DX7 A;  2F54 A;  2BVQ A;  2X4S A;  3DBX A;  3BEW A;  5HHM A;  1T1Z A;  1BQH A;  4LNR A;  2CLR A;  1FFO A;  3BHB A;  3FQN A;  3LN5 A;  5E8N A;  5C0E A;  2GIT A;  4QRQ A;  5E8O A;  1PQZ A;  5JHD A;  4NSK A;  5F1N A;  3VFU A;  1JFM A;  3P77 A;  1I7R A;  1BZ9 A;  2VLL A;  1DE4 A;  4WDI A;  1QLF A;  4ZAK A;  3KPM A;  5EFI A;  5C0G A;  5J6H A;  1FZO A;  3P4M A;  3GMQ A;  4PJH A;  4U6X A;  5BRZ A;  3VFO A;  1CE6 A;  5C0B A;  1LDP H;  5INC A;  3SDD A;  1B0R A;  3ILP A;  1HSB A;  3BH8 A;  1UQS A;  1KJM A;  5IB3 A;  4CVX A;  1A1O A;  3QDJ A;  2AKR A;  5HHQ A;  3GSO A;  1S9Y A;  1EEZ A;  5DEG A;  1JE6 A;  1AGE A;  5D9S A;  5B39 A;  2X4U A;  1A9E A;  3L3K A;  1HHI A;  1RJY A;  3OV6 A;  4CVZ A;  3KLA A;  1QQD A;  2HJL A;  3ES6 A;  3TO4 A;  1LEK A;  3KXF A;  3MRD A;  3RGV C;  1S7U A;  4O2E A;  5EO0 A;  1LQV A;  3RWJ A;  3QFJ A;  3VFS A;  3PWL A;  3FRU A;  4PJA A;  5FDW A;  5EU4 A;  1WBY A;  3SDC A;  1ED3 A;  3VWJ A;  1KJ3 H;  1P7Q A;  2YEZ A;  2FIK A;  5HGD A;  2PYE A;  3JTS A;  3CH1 A;  3E6F A;  1L8J A;  2AXG A;  3TBT A;  4PJF A;  1W0W A;  3KPO A;  3X14 A;  5MEN A;  5E00 A;  3MRQ A;  3RTQ A;  3RWI A;  4JQV A;  3E6H A;  3TBY A;  4U1N A;  3VRI A;  3FON A;  3I6L D;  1KPR A;  3VXR A;  1MI5 A;  3LKP A;  4ELM A;  4MQ7 A;  1YN6 A;  1FZM A;  1TVH A;  3ARB A;  4I4W A;  3MRK A;  4PRB A;  1T7Y A;  4QRS A; 
#chains in the Genus database with same CATH topology
 4I48 A;  4LCC C;  3JTT A;  3RWH A;  4G8G A;  4S0U C;  4JFP A;  3VJ6 A;  1ONQ A;  1N2R A;  1T1Y A;  1ZAG A;  1GZQ A;  5EU3 A;  2D31 A;  3JTC A;  3OXS A;  5F7D A;  4APQ A;  2X4O A;  3E2H A;  3LV3 A;  1HYR C;  4U1K A;  5F9J A;  3L3G A;  1OF2 A;  5E9D A;  1FFN A;  3BUY A;  5GSR A;  1QEW A;  5SWZ A;  5HHN A;  5E6I C;  5C0F A;  3ECB A;  5L2K A;  4HV8 A;  1QRN A;  5FA3 A;  3C8K A;  4ONO A;  4Z77 A;  1I7U A;  3KWW A;  3HE7 A;  1HHK A;  4L8D A;  5GSV A;  3MRH A;  1NAM H;  5L2J A;  4NO3 A;  4NQE A;  5AD0 A;  4EUP A;  3D25 A;  3L3I A;  1A1N A;  3O4L A;  1S7T A;  5HGA A;  1T0M A;  3VXU A;  4X6E A;  3IT8 D;  5H94 A;  3TN0 A;  3MV8 A;  4HUU A;  5HHO A;  3BEV A;  1JF1 A;  1P4L A;  5E8P A;  2F53 A;  4Z76 A;  3DXA A;  3VFW A;  4PG2 A;  4X6D A;  1LP9 A;  1A1M A;  1ZS8 A;  2MHA A;  3WS6 A;  4Y2D A;  1ZHK A;  2X4Q A;  3VXP A;  5MEP A;  1KTL A;  1NEZ A;  2CII A;  3TFK A;  2J8U A;  2VLK A;  3LKQ A;  3ILQ C;  4Z78 A;  5C0I A;  1T7X A;  2DYP A;  3QEQ A;  4MJ5 A;  4JFF A;  3SKM A;  3DMM A;  3HE6 A;  3SJV A;  3VXN A;  4LHU A;  4MVB A;  5D7L A;  5MEQ A;  3H9H A;  4BKW A;  4PRI A;  1VGK A;  3VXS A;  5BXF A;  2OL3 H;  3HLA A;  4PJC A;  4FTV A;  1SYS A;  3RWG A;  4D0D A;  5HGB A;  3ARE A;  1T21 A;  1XZ0 A;  5DDH A;  3BW9 A;  3WS3 A;  1T1W A;  3FQW A;  3VFP A;  2X4N A;  1JHT A;  2H6P A;  3GMP A;  4HUX A;  4K7F A;  3HPJ A;  3W0W A;  1HOC A;  3BXN A;  3KPQ A;  3PWJ A;  4U1M A;  4V3E B;  3MRF A;  3MRO A;  3KYN A;  5C0D A;  4PRA A;  4QOK A;  1FZK A;  3O3D A;  4PGB A;  5EU5 A;  4N0U A;  2ZSW A;  4XXC A;  3DX6 A;  5SWS A;  1S7V A;  2CKB H;  3T8X A;  5ENW A;  3LKR A;  4WW2 C;  1MWA H;  3CPL A;  3I0T A;  4Y4F A;  1KPU A;  1W0V A;  3MRJ A;  4ZUT A;  2GJ6 A;  2FZ3 A;  3SDA A;  5ISZ A;  3TF7 A;  4D0B A;  3TBW A;  2WY3 A;  2GAZ A;  2FO4 A;  5IB5 A;  3CCH A;  1CG9 A;  4U1J A;  1T7W A;  1QO3 A;  4EI5 A;  5IRO A;  1C16 A;  2VE6 A;  2JCC A;  3O9W A;  3B6S A;  4NO2 A;  1AO7 A;  3FT3 A;  4D0C A;  5J6G A;  3VWK A;  1ZHB A;  1ZT7 A;  1G6R H;  2V2W A;  3GIV A;  3BP4 A;  4NNY A;  1R3H A;  3NFN A;  2XPG A;  4G59 A;  4NQC A;  3SCM A;  4MXQ A;  2YPK A;  1VAD A;  4MX7 A;  4PG9 A;  2HN7 A;  3RWF A;  5D7I A;  2GUO A;  5IB2 A;  4JFQ A;  4PJ7 A;  4L29 A;  3GSR A;  4NNX A;  3VRJ A;  2AK4 A;  2BSR A;  4PJX A;  4U1H A;  5SWQ A;  1AGB A;  4HKJ A;  5D2N A;  3H9S A;  5F1I A;  3MYJ A;  3WUW A;  1AGC A;  4IRS A;  3P9M A;  2X4T A;  4F7C A;  3AM8 A;  4PRH A;  1OSZ A;  4G9F A;  3MV9 A;  1YDP A;  2AV7 A;  5D2L A;  3L9R A;  2X4R A;  2NYK A;  2BVP A;  3KPN A;  3QQ3 A;  5D5M A;  5EO1 A;  3TZV C;  5C0C A;  1HHJ A;  4PV8 A;  5EOT A;  3GML A;  3GSV A;  4O2C A;  1JPF A;  4QRR A;  3UTT A;  4U1S A;  5IND A;  3UBX A;  4JQX A;  5FKP A;  4JFO A;  5IB4 A;  1JPG A;  4X6F A;  1YN7 A;  4WO4 A;  4F7M A;  1I7T A;  4MJ6 A;  4NO5 A;  1RJZ A;  4JFE A;  3QUZ A;  4NQX A;  1IM3 A;  3QDM A;  3S6C A;  3PQY A;  2CIK A;  2OI9 A;  3G08 A;  3ROL A;  3RWD A;  4LCW A;  3ARF A;  3BO8 A;  3D18 A;  3HAE A;  1CD1 A;  4WU5 A;  1INQ A;  4N0F A;  3MRI A;  5C07 A;  4L8S C;  1M6O A;  3MR9 A;  4QRT A;  1AKJ A;  3KYO A;  3UPR A;  3FT4 A;  4PJI A;  3LN4 A;  5EU6 A;  2ZSV A;  4WU7 A;  1G7Q A;  5IEK A;  3LKN A;  2P5W A;  3C9N A;  4WUU A;  5IM7 A;  2IA1 A;  1I1Y A;  3GMO A;  4X6C A;  4NQV A;  4HUV A;  1I1F A;  1OGA A;  5HYJ A;  3QI9 A;  2C7U A;  1RK1 A;  4WJ5 A;  2HJK A;  3TPU E;  4ZUV A;  1WBZ A;  4Y16 A;  1FG2 A;  1HHG A;  4NHU E;  1FFP A;  1GZP A;  1T7Z A;  3U0P A;  1WBX A;  1XR8 A;  4IHO A;  3D39 A;  4JRX A;  3O3B A;  1A9B A;  4PJG A;  4UQ3 A;  5DEF A;  5FA4 A;  5C9J A;  3RUG A;  3TID A;  1U58 A;  3SKO A;  4HX1 A;  1EFX A;  3FQT A;  1NAN H;  3OXR A;  4EN3 C;  4PP8 C;  3T1F A;  2CLZ A;  3VFM A;  4NQD A;  3B3I A;  1HSA A;  1S9X A;  3MRM A;  2P5E A;  3E3Q A;  2ESV A;  3PWU A;  4Y4K A;  3QUY A;  3TBS A;  1M05 A;  4NT6 A;  4QRU A;  2AV1 A;  3PWV A;  3MRN A;  4U6Y A;  3ROO A;  3GMN A;  3P4O A;  1FZJ A;  3GSW A;  3BVN A;  2F74 A;  1T1X A;  4MNQ A;  2BSS A;  3UTS A;  4F7T A;  1T80 A;  3IXA A;  1N59 A;  3MRE A;  1E27 A;  2UWE A;  3V5H A;  2FYY A;  1S9W A;  1DDH A;  1YPZ A;  3O3A A;  3PWP A;  3QUK A;  5BJT A;  3M17 A;  1DUZ A;  3UTQ A;  3FQX A;  4ZFZ A;  3VCL A;  2BST A;  3HG1 A;  5C0A A;  3FTG A;  3MA7 A;  5ACZ A;  1E28 A;  1T7V A;  2NX5 A;  3X12 A;  3TVM A;  4F7P A;  3FQR A;  1QVO A;  3KPR A;  3DX8 A;  3ARD A;  3M1B A;  3QUX A;  4ZUS A;  3GSU A;  3SPV A;  3VFR A;  2BCK A;  4WWK C;  4PRP A;  4L8B A;  3GMR A;  4PJ8 A;  4PJ5 A;  3O3E A;  4U1L A;  4PJ9 A;  3WL9 A;  1EEY A;  1S7R A;  5IB1 A;  2H26 A;  1N5A A;  2V2X A;  4F7E A;  1S7S A;  2YPL A;  4PRE A;  4PGC A;  2ZOK A;  1Z5L A;  4G59 C;  3D2U A;  1X7Q A;  5IEH A;  1FO0 H;  3WLB A;  2FWO A;  3MRR A;  4PRD A;  3BP7 A;  1S7Q A;  1LK2 A;  1T20 A;  1UXW A;  2BNR A;  4CW1 A;  3AU1 A;  1ZHN A;  5C09 A;  2GTW A;  1DUY A;  4MJI A;  4L9L C;  2RFX A;  2VLR A;  1HHH A;  5C0J A;  1MHC A;  3FOL A;  4PJE A;  1P1Z A;  1RK0 A;  3PAB A;  1KPV A;  3BH9 A;  1Q94 A;  1ZT4 A;  2VAA A;  3MRG A;  3PWN A;  1KJV A;  4PJD A;  4QRP A;  3OX8 A;  1JUF A;  2GT9 A;  2NW3 A;  3GSQ A;  5D7J C;  1IM9 A;  3FQU A;  4K71 B;  1T22 A;  1JGD A;  4L8C A;  4GKN A;  2VLJ A;  2ZOL A;  3CZF A;  1S7W A;  3VXM A;  3VFV A;  3V5K A;  3QFD A;  3GSX A;  3D3V A;  1S8D A;  4GKS A;  4ZUW A;  3MRC A;  2E7L E;  1N3N A;  4MNG A;  4PGE A;  4G42 A;  1G7P A;  3HUJ A;  4HUW A;  3RWC A;  4N5E A;  1K8D A;  4G8I A;  3ERY A;  1AGD A;  2XFX A;  4PR5 A;  3RL2 A;  1W72 A;  3P9L A;  3LKS A;  3BWA A;  3VFT A;  4E5X A;  2CLV A;  4E0R A;  3ARG A;  1I4F A;  4N0C A;  2X70 A;  4MS8 A;  3LKO A;  1KCG C;  3KPL A;  3MRP A;  1ZSD A;  3P73 A;  3QZW A;  3V5D A;  1ZT1 A;  1EXU A;  1LD9 A;  4Y4H A;  3CDG A;  4G43 A;  3TJH A;  1AGF A;  1KBG H;  1SYV A;  1LEG A;  3BZE A;  4PV9 A;  1ZHL A;  4UQ2 A;  3TO2 A;  2X4P A;  5EUO A;  1QSE A;  3FOM A;  1TVB A;  4V3D B;  4L4T A;  3X13 A;  3BZF A;  3JVG A;  4PRN A;  3CVH A;  4JRY A;  3QQ4 A;  3HCV A;  1UXS A;  3TBV A;  1QSF A;  4GUP A;  3W39 A;  4JO8 A;  4LCY A;  3H7B A;  3SDX A;  4JFD A;  5J1A A;  2VAB A;  3I6K A;  4PJB A;  3L3H A;  3GMM A;  4FFE X;  4ZUU A;  1XH3 A;  1OGT A;  5MER A;  1JGE A;  2Q7Y A;  1K5N A;  1B0G A;  2BVO A;  4PDC E;  5HGH A;  1I1A A;  2PO6 A;  1BD2 A;  3X11 A;  1TMC A;  2GTZ A;  3REW A;  3KPP A;  1MHE A;  3L3J A;  2BNQ A;  3RL1 A;  3DTX A;  5MEO A;  5IVX A;  4IIQ C;  1S7X A;  3GJF A;  3VH8 A;  5HHP A;  4G9D A;  4N8V A;  1BII A;  3RWE A;  4L4V A;  5B38 A;  1ZVS A;  3I6G A;  3QUL A;  3BGM A;  3MGT A;  3MV7 A;  3QDG A;  3GSN H;  5C08 A;  5BS0 A;  3MRL A;  4U1I A;  3TIE A;  1VAC A;  2A83 A;  3MRB A;  1XR9 A;  3FFC A;  3CC5 A;  1T0N A;  1A6Z A;  4O2F A;  3MGO A;  3P4N A;  3KPS A;  4PGD A;  3TA3 A;  2AXF A;  1QR1 A;  4L3C A;  1B3J A;  4NO0 A;  3FT2 A;  4L3E A;  2HLA A;  4HS3 A;  3RZC A;  3O8X A;  3VFN A;  4IRJ A;  3VXO A;  4HWZ A;  1KJ2 H;  3L3D A;  3DX7 A;  2F54 A;  2BVQ A;  2X4S A;  3DBX A;  3BEW A;  5HHM A;  1T1Z A;  1BQH A;  4LNR A;  2CLR A;  1FFO A;  3BHB A;  3FQN A;  3LN5 A;  5E8N A;  5C0E A;  2GIT A;  4QRQ A;  5E8O A;  1PQZ A;  5JHD A;  4NSK A;  5F1N A;  3VFU A;  1JFM A;  3P77 A;  1I7R A;  1BZ9 A;  2VLL A;  1DE4 A;  4WDI A;  1QLF A;  4ZAK A;  3KPM A;  5EFI A;  5C0G A;  5J6H A;  1FZO A;  3P4M A;  3GMQ A;  4PJH A;  4U6X A;  5BRZ A;  3VFO A;  1CE6 A;  5C0B A;  1LDP H;  5INC A;  3SDD A;  1B0R A;  3ILP A;  1HSB A;  3BH8 A;  1UQS A;  1KJM A;  5IB3 A;  4CVX A;  1A1O A;  3QDJ A;  2AKR A;  5HHQ A;  3GSO A;  1S9Y A;  1EEZ A;  5DEG A;  1JE6 A;  1AGE A;  5D9S A;  5B39 A;  2X4U A;  1A9E A;  3L3K A;  1HHI A;  1RJY A;  3OV6 A;  4CVZ A;  3KLA A;  1QQD A;  2HJL A;  3ES6 A;  3TO4 A;  1LEK A;  3KXF A;  3MRD A;  3RGV C;  1S7U A;  4O2E A;  5EO0 A;  1LQV A;  3RWJ A;  3QFJ A;  3VFS A;  3PWL A;  3FRU A;  4PJA A;  5FDW A;  5EU4 A;  1WBY A;  3SDC A;  1ED3 A;  3VWJ A;  1KJ3 H;  1P7Q A;  2YEZ A;  2FIK A;  5HGD A;  2O5N A;  2PYE A;  3JTS A;  3CH1 A;  3E6F A;  1L8J A;  2AXG A;  3TBT A;  4PJF A;  1W0W A;  3KPO A;  3X14 A;  5MEN A;  5E00 A;  3MRQ A;  3RTQ A;  3RWI A;  4JQV A;  3E6H A;  3TBY A;  4U1N A;  3VRI A;  3FON A;  3I6L D;  1KPR A;  3VXR A;  1MI5 A;  3LKP A;  4ELM A;  4MQ7 A;  1YN6 A;  1FZM A;  1TVH A;  3ARB A;  4I4W A;  3MRK A;  4PRB A;  1T7Y A;  4QRS A; 
#chains in the Genus database with same CATH homology
 4I48 A;  4LCC C;  3JTT A;  3RWH A;  4G8G A;  4S0U C;  4JFP A;  3VJ6 A;  1ONQ A;  1N2R A;  1T1Y A;  1ZAG A;  1GZQ A;  5EU3 A;  2D31 A;  3JTC A;  3OXS A;  5F7D A;  4APQ A;  2X4O A;  3E2H A;  3LV3 A;  1HYR C;  4U1K A;  5F9J A;  3L3G A;  1OF2 A;  5E9D A;  1FFN A;  3BUY A;  5GSR A;  1QEW A;  5SWZ A;  5HHN A;  5E6I C;  5C0F A;  3ECB A;  5L2K A;  4HV8 A;  1QRN A;  5FA3 A;  3C8K A;  4ONO A;  4Z77 A;  1I7U A;  3KWW A;  3HE7 A;  1HHK A;  4L8D A;  5GSV A;  3MRH A;  1NAM H;  5L2J A;  4NO3 A;  4NQE A;  5AD0 A;  4EUP A;  3D25 A;  3L3I A;  1A1N A;  3O4L A;  1S7T A;  5HGA A;  1T0M A;  3VXU A;  4X6E A;  3IT8 D;  5H94 A;  3TN0 A;  3MV8 A;  4HUU A;  5HHO A;  3BEV A;  1JF1 A;  1P4L A;  5E8P A;  2F53 A;  4Z76 A;  3DXA A;  3VFW A;  4PG2 A;  4X6D A;  1LP9 A;  1A1M A;  1ZS8 A;  2MHA A;  3WS6 A;  4Y2D A;  1ZHK A;  2X4Q A;  3VXP A;  5MEP A;  1KTL A;  1NEZ A;  2CII A;  3TFK A;  2J8U A;  2VLK A;  3LKQ A;  3ILQ C;  4Z78 A;  5C0I A;  1T7X A;  2DYP A;  3QEQ A;  4MJ5 A;  4JFF A;  3SKM A;  3DMM A;  3HE6 A;  3SJV A;  3VXN A;  4LHU A;  4MVB A;  5D7L A;  5MEQ A;  3H9H A;  4PRI A;  1VGK A;  3VXS A;  5BXF A;  2OL3 H;  3HLA A;  4PJC A;  4FTV A;  1SYS A;  3RWG A;  4D0D A;  5HGB A;  3ARE A;  1T21 A;  1XZ0 A;  5DDH A;  3BW9 A;  3WS3 A;  1T1W A;  3FQW A;  3VFP A;  2X4N A;  1JHT A;  2H6P A;  3GMP A;  4HUX A;  4K7F A;  3HPJ A;  3W0W A;  1HOC A;  3BXN A;  3KPQ A;  3PWJ A;  4U1M A;  4V3E B;  3MRF A;  3MRO A;  3KYN A;  5C0D A;  4PRA A;  4QOK A;  1FZK A;  3O3D A;  4PGB A;  5EU5 A;  4N0U A;  2ZSW A;  4XXC A;  3DX6 A;  5SWS A;  1S7V A;  2CKB H;  3T8X A;  5ENW A;  3LKR A;  4WW2 C;  1MWA H;  3CPL A;  4Y4F A;  1KPU A;  1W0V A;  3MRJ A;  4ZUT A;  2GJ6 A;  2FZ3 A;  3SDA A;  5ISZ A;  3TF7 A;  4D0B A;  3TBW A;  2WY3 A;  2GAZ A;  2FO4 A;  5IB5 A;  3CCH A;  1CG9 A;  4U1J A;  1T7W A;  1QO3 A;  4EI5 A;  5IRO A;  1C16 A;  2VE6 A;  2JCC A;  3O9W A;  3B6S A;  4NO2 A;  1AO7 A;  3FT3 A;  4D0C A;  5J6G A;  3VWK A;  1ZHB A;  1ZT7 A;  1G6R H;  2V2W A;  3GIV A;  3BP4 A;  4NNY A;  1R3H A;  3NFN A;  2XPG A;  4G59 A;  4NQC A;  3SCM A;  4MXQ A;  2YPK A;  1VAD A;  4MX7 A;  4PG9 A;  2HN7 A;  3RWF A;  5D7I A;  2GUO A;  5IB2 A;  4JFQ A;  4PJ7 A;  4L29 A;  3GSR A;  4NNX A;  3VRJ A;  2AK4 A;  2BSR A;  4PJX A;  4U1H A;  5SWQ A;  1AGB A;  4HKJ A;  5D2N A;  3H9S A;  5F1I A;  3MYJ A;  3WUW A;  1AGC A;  4IRS A;  3P9M A;  2X4T A;  4F7C A;  3AM8 A;  4PRH A;  1OSZ A;  4G9F A;  3MV9 A;  1YDP A;  2AV7 A;  5D2L A;  3L9R A;  2X4R A;  2BVP A;  3KPN A;  3QQ3 A;  5D5M A;  5EO1 A;  3TZV C;  5C0C A;  1HHJ A;  4PV8 A;  5EOT A;  3GML A;  3GSV A;  4O2C A;  1JPF A;  4QRR A;  3UTT A;  4U1S A;  5IND A;  3UBX A;  4JQX A;  5FKP A;  4JFO A;  5IB4 A;  1JPG A;  4X6F A;  1YN7 A;  4WO4 A;  4F7M A;  1I7T A;  4MJ6 A;  4NO5 A;  1RJZ A;  4JFE A;  3QUZ A;  4NQX A;  1IM3 A;  3QDM A;  3S6C A;  3PQY A;  2CIK A;  2OI9 A;  3G08 A;  3ROL A;  3RWD A;  4LCW A;  3ARF A;  3BO8 A;  3D18 A;  3HAE A;  1CD1 A;  4WU5 A;  1INQ A;  4N0F A;  3MRI A;  5C07 A;  4L8S C;  1M6O A;  3MR9 A;  4QRT A;  1AKJ A;  3KYO A;  3UPR A;  3FT4 A;  4PJI A;  3LN4 A;  5EU6 A;  2ZSV A;  4WU7 A;  1G7Q A;  5IEK A;  3LKN A;  2P5W A;  3C9N A;  4WUU A;  5IM7 A;  1I1Y A;  3GMO A;  4X6C A;  4NQV A;  4HUV A;  1I1F A;  1OGA A;  5HYJ A;  3QI9 A;  2C7U A;  1RK1 A;  4WJ5 A;  2HJK A;  3TPU E;  4ZUV A;  1WBZ A;  4Y16 A;  1FG2 A;  1HHG A;  4NHU E;  1FFP A;  1GZP A;  1T7Z A;  3U0P A;  1WBX A;  1XR8 A;  4IHO A;  3D39 A;  4JRX A;  3O3B A;  1A9B A;  4PJG A;  4UQ3 A;  5DEF A;  5FA4 A;  5C9J A;  3RUG A;  3TID A;  1U58 A;  3SKO A;  4HX1 A;  1EFX A;  3FQT A;  1NAN H;  3OXR A;  4EN3 C;  4PP8 C;  3T1F A;  2CLZ A;  3VFM A;  4NQD A;  3B3I A;  1HSA A;  1S9X A;  3MRM A;  2P5E A;  3E3Q A;  2ESV A;  3PWU A;  4Y4K A;  3QUY A;  3TBS A;  1M05 A;  4NT6 A;  4QRU A;  2AV1 A;  3PWV A;  3MRN A;  4U6Y A;  3ROO A;  3GMN A;  3P4O A;  1FZJ A;  3GSW A;  3BVN A;  2F74 A;  1T1X A;  4MNQ A;  2BSS A;  3UTS A;  4F7T A;  1T80 A;  3IXA A;  1N59 A;  3MRE A;  1E27 A;  2UWE A;  3V5H A;  2FYY A;  1S9W A;  1DDH A;  1YPZ A;  3O3A A;  3PWP A;  3QUK A;  5BJT A;  3M17 A;  1DUZ A;  3UTQ A;  3FQX A;  4ZFZ A;  3VCL A;  2BST A;  3HG1 A;  5C0A A;  3FTG A;  3MA7 A;  5ACZ A;  1E28 A;  1T7V A;  2NX5 A;  3X12 A;  3TVM A;  4F7P A;  3FQR A;  1QVO A;  3KPR A;  3DX8 A;  3ARD A;  3M1B A;  3QUX A;  4ZUS A;  3GSU A;  3SPV A;  3VFR A;  2BCK A;  4WWK C;  4PRP A;  4L8B A;  3GMR A;  4PJ8 A;  4PJ5 A;  3O3E A;  4U1L A;  4PJ9 A;  3WL9 A;  1EEY A;  1S7R A;  5IB1 A;  2H26 A;  1N5A A;  2V2X A;  4F7E A;  1S7S A;  2YPL A;  4PRE A;  4PGC A;  2ZOK A;  1Z5L A;  3D2U A;  1X7Q A;  5IEH A;  1FO0 H;  3WLB A;  2FWO A;  3MRR A;  4PRD A;  3BP7 A;  1S7Q A;  1LK2 A;  1T20 A;  1UXW A;  2BNR A;  4CW1 A;  3AU1 A;  1ZHN A;  5C09 A;  2GTW A;  1DUY A;  4MJI A;  4L9L C;  2RFX A;  2VLR A;  1HHH A;  5C0J A;  1MHC A;  3FOL A;  4PJE A;  1P1Z A;  1RK0 A;  3PAB A;  1KPV A;  3BH9 A;  1Q94 A;  1ZT4 A;  2VAA A;  3MRG A;  3PWN A;  1KJV A;  4PJD A;  4QRP A;  3OX8 A;  1JUF A;  2GT9 A;  2NW3 A;  3GSQ A;  5D7J C;  1IM9 A;  3FQU A;  4K71 B;  1T22 A;  1JGD A;  4L8C A;  4GKN A;  2VLJ A;  2ZOL A;  3CZF A;  1S7W A;  3VXM A;  3VFV A;  3V5K A;  3QFD A;  3GSX A;  3D3V A;  1S8D A;  4GKS A;  4ZUW A;  3MRC A;  2E7L E;  1N3N A;  4MNG A;  4PGE A;  4G42 A;  1G7P A;  3HUJ A;  4HUW A;  3RWC A;  4N5E A;  1K8D A;  4G8I A;  3ERY A;  1AGD A;  2XFX A;  4PR5 A;  3RL2 A;  1W72 A;  3P9L A;  3LKS A;  3BWA A;  3VFT A;  4E5X A;  2CLV A;  4E0R A;  3ARG A;  1I4F A;  4N0C A;  2X70 A;  4MS8 A;  3LKO A;  1KCG C;  3KPL A;  3MRP A;  1ZSD A;  3P73 A;  3QZW A;  3V5D A;  1ZT1 A;  1EXU A;  1LD9 A;  4Y4H A;  3CDG A;  4G43 A;  3TJH A;  1AGF A;  1KBG H;  1SYV A;  1LEG A;  3BZE A;  4PV9 A;  1ZHL A;  4UQ2 A;  3TO2 A;  2X4P A;  5EUO A;  1QSE A;  3FOM A;  1TVB A;  4V3D B;  4L4T A;  3X13 A;  3BZF A;  3JVG A;  4PRN A;  3CVH A;  4JRY A;  3QQ4 A;  3HCV A;  1UXS A;  3TBV A;  1QSF A;  4GUP A;  3W39 A;  4LCY A;  3H7B A;  3SDX A;  4JFD A;  5J1A A;  2VAB A;  3I6K A;  4PJB A;  3L3H A;  3GMM A;  4FFE X;  4ZUU A;  1XH3 A;  1OGT A;  5MER A;  1JGE A;  2Q7Y A;  1K5N A;  1B0G A;  2BVO A;  4PDC E;  5HGH A;  1I1A A;  2PO6 A;  1BD2 A;  3X11 A;  1TMC A;  2GTZ A;  3REW A;  3KPP A;  1MHE A;  3L3J A;  2BNQ A;  3RL1 A;  3DTX A;  5MEO A;  5IVX A;  4IIQ C;  1S7X A;  3GJF A;  3VH8 A;  5HHP A;  4G9D A;  4N8V A;  1BII A;  3RWE A;  4L4V A;  5B38 A;  1ZVS A;  3I6G A;  3QUL A;  3BGM A;  3MGT A;  3MV7 A;  3QDG A;  3GSN H;  5C08 A;  5BS0 A;  3MRL A;  4U1I A;  3TIE A;  1VAC A;  2A83 A;  3MRB A;  1XR9 A;  3FFC A;  3CC5 A;  1T0N A;  1A6Z A;  4O2F A;  3MGO A;  3P4N A;  3KPS A;  4PGD A;  3TA3 A;  2AXF A;  1QR1 A;  4L3C A;  1B3J A;  4NO0 A;  3FT2 A;  4L3E A;  2HLA A;  4HS3 A;  3RZC A;  3O8X A;  3VFN A;  4IRJ A;  3VXO A;  4HWZ A;  1KJ2 H;  3L3D A;  3DX7 A;  2F54 A;  2BVQ A;  2X4S A;  3DBX A;  3BEW A;  5HHM A;  1T1Z A;  1BQH A;  4LNR A;  2CLR A;  1FFO A;  3BHB A;  3FQN A;  3LN5 A;  5E8N A;  5C0E A;  2GIT A;  4QRQ A;  5E8O A;  1PQZ A;  5JHD A;  4NSK A;  5F1N A;  3VFU A;  1JFM A;  3P77 A;  1I7R A;  1BZ9 A;  2VLL A;  1DE4 A;  4WDI A;  1QLF A;  4ZAK A;  3KPM A;  5EFI A;  5C0G A;  5J6H A;  1FZO A;  3P4M A;  3GMQ A;  4PJH A;  4U6X A;  5BRZ A;  3VFO A;  1CE6 A;  5C0B A;  1LDP H;  5INC A;  3SDD A;  1B0R A;  3ILP A;  1HSB A;  3BH8 A;  1UQS A;  1KJM A;  5IB3 A;  4CVX A;  1A1O A;  3QDJ A;  2AKR A;  5HHQ A;  3GSO A;  1S9Y A;  1EEZ A;  5DEG A;  1JE6 A;  1AGE A;  5D9S A;  5B39 A;  2X4U A;  1A9E A;  3L3K A;  1HHI A;  1RJY A;  3OV6 A;  4CVZ A;  3KLA A;  1QQD A;  2HJL A;  3ES6 A;  3TO4 A;  1LEK A;  3KXF A;  3MRD A;  3RGV C;  1S7U A;  4O2E A;  5EO0 A;  1LQV A;  3RWJ A;  3QFJ A;  3VFS A;  3PWL A;  3FRU A;  4PJA A;  5FDW A;  5EU4 A;  1WBY A;  3SDC A;  1ED3 A;  3VWJ A;  1KJ3 H;  1P7Q A;  2YEZ A;  2FIK A;  5HGD A;  2PYE A;  3JTS A;  3CH1 A;  3E6F A;  1L8J A;  2AXG A;  3TBT A;  4PJF A;  1W0W A;  3KPO A;  3X14 A;  5MEN A;  5E00 A;  3MRQ A;  3RTQ A;  3RWI A;  4JQV A;  3E6H A;  3TBY A;  4U1N A;  3VRI A;  3FON A;  3I6L D;  1KPR A;  3VXR A;  1MI5 A;  3LKP A;  4ELM A;  4MQ7 A;  1YN6 A;  1FZM A;  1TVH A;  3ARB A;  4I4W A;  3MRK A;  4PRB A;  1T7Y A;  4QRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...