2ZOLA

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
273
structure length
258
Chain Sequence
b'PHSMRYFETAVSRPGEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 62
structure length 258
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zolA01
1BFTA 4WHTB 3HRPA 5JXEC 1KACB 2DQEL 4M6NL 4LQFL 2HLAB 4XCEB 1GYAA 5J56B 3FO2A 3BOVA 3IETB 4EI6A 2MMXA 3RUGB 2Z91B 2M1KA 3QAZB 3H9SE 3UTZB 3W5MA 4UDTA 2WUCL 4MJID 1Q94A 5I18L 1X7QB 3D2UA 4UQ2B 5E4IA 1HXMB 1RK1B 3ZKSD 1KYOJ 4L5FL 2XRAH 3M07A 4PS4L 5ILTL 4D9QE 4OI9A 1KJ2A 2X09A 2YD7A 1D9KA 1INQB 3DRTB 2NY0D 2D4DA 3THML 4WFGE 3MLZH 3VXRB 3TPUA 4MD0A 1U8IB 3L5WB 1JGUH 4BFBD 1E4XL 3OL2A 4JY6A 2R0WH 4RBPH 5ESQA 4S0SD 4AJ0A 4JY4B 5DD1L 4JRXD 4AIZA 2AABH 1PQZA 4WO4A 1DCLA 1EXUB 3ARRA 5DJAB 3HZKB 5BS0A 2IPTH 4JPIB 5BXFA 1ZHKA 4PGBA 4X7CC 4O5LH 2X40A 2LQRA 1J1PL 1P4IH 5E2UL 1LE5A 1OB1A 1NC2A 3ME0A 3VFOB 4BM7A 1QBLL 5FKAA 3VGBA 3I9GL 4YC2C 4KMTL 4RRPA 3IAQA 2OJZH 1NJ9B 2ITDB 3H9SD 4URTB 2F53E 5IGXH 5J8OA 1BFVH 3HZVA 3SN6N 2LABA 1JF1B 1B0RA 3K2MC 1ZWIB 5L6YL 1S7TA 1FAIH 3ILQC 4AENA 4D9QD 2YWZA 1E27A 1Y18B 1SY6H 4QT5B 1FIGH 5GJSL 3RRQA 5DJZB 4WFGD 2FX8L 4PRAB 2LTQC 2H2PC 1MCFA 1IGML 4N68A 1OP5K 4P4KA 2W65A 4LNRB 4F15C 1TVHB 3SDDB 2WK2A 4CVUA 3L5XL 4M43L 1PEWA 1Q38A 4HIIB 2VZUA 3QJFA 3WV0A 5LJYH 3WNLA 4JGJA 5IW3A 1NL0L 1IAIL 4JPVL 4FNLL 4YQXH 5HYJB 1RUKL 1SY6A 3RWEA 1T66C 5FDWB 1XIWD 2X2YA 3UYOD 1CDCA 1KG0B 1CDJA 3A67H 1C16A 2F53D 5EUOB 4BFIB 1MFBH 3IU4H 4MNQE 1NDGB 3GSVB 2VDPH 2J6EL 4GW4B 1T3FB 1GC1L 3HC3H 4ZXBA 1BQHG 1RI8A 4CU7A 5FOBB 3FT2A 3O8XD 3RNQB 4C56B 1IAOB 3MJ9L 4XGZB 1VDGA 2Y5TB 5KVMC 1EAPB 1L0XA 1V8HA 1FYTB 4PJAE 4OFPA 4NQEA 4UB0H 1T21B 2V2WB 4PJCA 3W0WB 2BNUA 4XPAH 4DUVA 1JZ8A 3CSGA 1DE4B 2B5IB 4OLYH 3VXME 2X4UA 3D48R 3T2NL 3ZMRA 5DEGA 4G8IA 2Z35B 5A1AA 4LSSL 3GBMH 3FONB 3E2HA 4NZTL 3GO1H 1CZ8H 4HUMB 1C5BH 3DUSA 4FXKB 4Q0XH 3GGWA 4WEUD 5DMYA 3LDBC 4NKMA 1BEYH 2XN9B 1MCHA 1CLYL 3EO9L 4Y4FD 1IGYA 2HT4C 2D9QB 4NCC1 2HKFL 2GTWA 3DO7A 4L9LB 1K5NB 4YAQA 3G6JB 1YEHL 4ERSH 4NC0B 4WFEE 3SOBH 5EC1B 1HI6A 5SV4A 4G6KL 4HKXB 1B2WH 1XGYH 4P9HC 1E6JL 3RWFB 4PJAF 3V9FA 2JKXA 5IB3A 5E24E 4O2FA 4PJFF 4DW2L 5KVEH 5BOZG 4HDIA 1RZFH 1NSNL 4MCZA 3VXMD 2R1XA 3QA3A 1RULL 5GHWL 4DEPB 3GHBH 4RGOH 5JW5B 1P2CB 4PRHD 3C5JA 5FA4A 4JFYA 1YEDA 3QFJB 1MRDH 2PW1A 4XNYL 4NWUH 1J8HE 2F9BT 3MGTB 3EGSB 4NBYB 1CS6A 3GNMH 1WK0A 1KJ3H 3P0VH 3STBA 4OCXH 3QDGE 2DMBA 3F5WA 5EOQL 5GIRA 1WBZA 3SGKC 3DVIA 2EYTB 2E3VA 4NQCE 4JFFB 4WFED 1EA9C 3CDYA 5DC4B 4ISVA 4FZ8H 5D70H 3RWIA 1TIUA 4M61B 4G6JL 4JG0L 1DQJB 1RUAL 2F54D 1U8QA 1CE1L 2X9YA 3Q5YA 3KS0J 5CD3B 1TITA 2CRYA 1VEOA 1YMHA 4WTZG 3O2VL 1KN2H 4UT9L 5D6CB 5GGRY 1CFQA 4QCIB 3E6FB 5HPMA 5C3TA 3MMEB 3K8KA 2YPLB 2D0HA 1HDMB 3UYPA 4EQ3A 1MCDA 3P30L 5EBMA 3T2QA 1CGXA 5F7UA 4L3ED 5K9QI 4CMHB 2ZCHH 2I26N 2HRPH 1WZLA 1FZMB 3CUPA 3F7PC 1T0MB 3GK8L 2BHYA 2Q87A 1EO5A 5JW4M 2P5WE 1KJVB 4XVSH 1N5YH 4NQCD 3PGCA 4M48H 4OFDA 3AXLB 4NNPH 4HC1H 4J3VA 2XY1A 2Q7YB 3VGDA 4WI5A 4G7YH 5EU7C 2F74A 5C0DB 2VNCA 4XNMB 1BFOB 5ACZB 2CO7B 1X5YA 2VL5A 5DVKA 4KJYA 5EBWB 4HV8A 4MAYA 4A6YB 5CUSH 3HG1B 2VSDA 3CC5B 3FB5A 3LV3A 4L1HA 2Q8AL 3EFFB 2DJSA 5DWUH 5ESVB 3CLFH 3WS3A 2EDFA 4L3CB 4F58L 4MQ7A 1I7TB 4L8CB 3P11H 4HC1A 5F9JB 1IM9B 2XY2A 2CMRH 2APVA 4MJ5B 3NFPB 4FQIH 2XWBA 2N4IA 2ZG2A 1EX0A 2ESVA 4DN3H 5MEQB 2QEJA 4PGEA 4WV1C 5HYQA 4OQTL 1I7UB 5I1DA 2P5WD 3IAPA 1N64L 4KHXH 2IANB 4HPOH 3AAZA 1MCNA 1YECH 4XXDB 5A2JH 2O93L 1SEBA 3R4DA 3JXAA 5EU6E 5JPNB 5H35A 5IHUL 3ZZ1A 7FABH 1UM6H 4K71C 6FABL 5IEHB 1GRWA 1WWAX 4Z95H 1NAMB 5B39A 1PYWB 4F7EA 1S9VA 5CCKH 4WI8A 4XT1C 4FQCL 3PJSA 2APBA 1MCWW 2GITB 3RA7L 2D03H 2Q20A 4I77L 2PYEE 4YBLB 2CK0H 2ZCKH 3VFTA 5FA3A 4CW1B 2Q3ZA 4U3CA 1MHCB 5SWSA 1UYWH 4NUJB 1UA6H 1U9KA 2EC9U 3FFDA 5D1ZC 4NHUA 1Y6NR 1A14L 3S36H 4GRLC 5DJXB 4UILH 2JELL 3JZ7A 5E6ID 5CBEA 3MLYL 1BQSA 2BC4B 2FEEI 2AJZB 2ZKHH 5DFTA 1DEEB 1MVUA 2IALB 5BZDB 4XCNB 3DUUB 4IIQA 4OJFH 4OQ1A 1ZT4B 1MHEB 1LNUB 1B0GB 3QDMB 1F45A 1QSFE 4YDKL 5C0CA 3BW9A 5TF1H 4TUJA 3FZUC 5E00B 2PYED 2OR8A 1YNLH 1J1XH 2VQUA 5KJRH 1S9WB 4QOKA 2EDHA 1LEGA 1JWUA 3C2AL 1U93A 1GJIA 3QIWC 3U7WH 4ETYA 1CU4L 2CGRL 4X0KB 4KJQD 4L29B 1E4XI 1LO5A 1TFHA 25C8L 3WIHH 1G7JB 3RZCA 4GMSL 1ZEAL 1T03L 4MD5B 1G6RH 3LRHA 3MLRH 1KPUB 2OJEB 4QHLA 2YPKA 3B4NA 4IMLB 1C5DA 1MJ7H 1RJCA 3CFIC 4GBXB 2BY3A 3DI3B 5LAXB 3DURB 1Z3GH 3I85A 2MKWA 1IM3B 4I2XB 1QSFD 5IHLB 1KPVB 2IFFH 5EC2A 2ZCLH 1JZ3A 5MI0C 3JV4A 5B8CA 3VI4F 2J7LA 3HNSH 4GLRI 1OAQL 1EFXA 4KUZH 1A64A 4U33A 1KN4L 4JQXC 1YQVH 3WUWG 1JGDB 3WSQH 1ZA6A 3O3DA 2PXYC 3DX8B 3OB0H 5FF6A 2XZAH 5IJVA 4JDZB 4M3KB 4MS8A 1SEQL 3P4NB 5ITBL 1QBBA 5IOPB 4NJAL 3BIBX 1QRNB 3OKDB 4XWOD 2H45A 1KCKA 1B4RA 3H8NA 2LFGA 1OWWA 4M93C 1CFTB 1MNUL 2WANA 3O4LB 2DQUL 4NSKB 4ZS7L 4Z78A 1GZQA 3FRUB 1HYSC 3DMMA 4G5ZL 4GKNB 4JN1L 1IAII 3QWQB 4ZUVA 5KS9F 1K9TA 4EBQH 4LLUA 2I07A 3WCYA 3VG9B 2BRRH 3Q5TA 1NFKA 6CGTA 5IR1B 4YDJA 1L6ZA 1FP5A 3NCMA 2A38A 4K94H 2J4WH 4F7TB 2NZ9C 3FO2B 4RDQG 2N7BA 4Q9CA 5I74B 1OTSC 2A73B 3FB6A 5TE6H 1A7QL 2WM0A 4EKXA 1FGNL 3CFDA 5CP7B 4GRWB 5GSRB 3TEUA 5A2LH 5GGRB 4LL9A 1FLRH 4LVHB 3T8XB 2AERT 5FCSH 1J1OH 3LQZB 1EUUA 3D2UB 3EYQD 3BP7A 1ZLWK 3PP3K 3DYPA 1FVCA 2R2EB 1KJ2B 5INDA 2H32H 4JZNA 5KN5B 3DYMA 1F3RB 4FG6D 4NZJA 4MNGB 2DQGH 1CXLA 3HI6L 2BMKA 3S88L 4Z7WB 1HSBA 4BZ1H 4V1DE 3B5HA 1D6EB 1Y0LA 3WXWH 1LDPH 2BNQA 3IDYB 5E8PB 2G9HB 4PBWD 4TVPL 5J9PB 1PY9A 1VEPA 5ALBH 3K2UL 1I1RA 5DYOA 3LKQA 3MRMA 1W72B 3BE1H 5EU7E 2DQDL 1UWXH 4BUGA 3QCVH 2A9ML 2H32A 5F7EL 3EFDH 1JPFA 4NO2B 4A6YL 4M00A 1HQ4B 1BD2A 1KCUH 3K81A 3QEQB 5IMKB 4UIKL 2VZTA 3FQTA 4ODSL 3UBXB 3C9NB 4U0RB 5DRXB 2XZZA 1CFSA 1K85A 1U2CA 3IF1B 5D6DA 1OGAA 3BZEB 1E27B 3CNKA 1A22B 4P4RA 1CDHA 1GGIH 3O2WH 1KLGA 3DBXA 4V1DD 3GMQA 1RZKL 3ZL4L 1D5ZA 4N8PA 4YHIA 3PWJA 2QR0B 5DS8B 3BZDA 2V9RA 3SE4A 3KHOA 4ZS6C 1N6QL 1FIEA 4UAOC 5DQJA 5C2BH 1IFHH 4MJIA 4U1MA 3ZT6A 2WWKT 4KRPC 1H3XA 5FO7B 5D7LB 1NAML 4M1DL 4XVUC 1AD9B 1LE9B 4GG6E 2YEZA 1A6WL 1FNFA 5CIPH 3I6KB 4NHCL 4WEMB 4L4VE 2ZUSA 3KPSB 3CFEB 4GSDH 3NN8A 4RISL 5GS1B 3OG4B 4LLQB 2DKUA 3DX7A 4JRXA 1N7ML 1IQWL 2HVJA 2W0PA 1BQUA 3BKMH 4WNQA 4P59L 4EUPH 5TQ0L 5T3ZL 4NQDE 4NQEB 1WITA 1BBDH 5FUZL 3ZTNH 1BGXL 1OGTB 2OTPA 3VA2C 4PJCB 5J6HB 3ARGD 1WAAA 4ONHB 5L0QC 4TQEH 2EDEA 5CP3A 1C12B 1R3IH 4FS0A 1A1OA 4G8IB 3R1GL 4QHNA 4NO5B 5IW6A 1QFUL 4XAWH 5DFVD 3H9SA 3F7YA 1M7XA 3WXVH 2IQAA 3DUSB 1UQSA 1R24A 4Z7VB 1W0VB 3P73A 4S11A 1YN7B 5HGBA 4NGHH 3V6OC 3KPTA 2XFXA 2NPLX 4JQVC 3VFWA 1T20A 1IGYB 1MLCA 4EUPA 1MCOH 1L9NA 4D9LH 1JFMA 4ZUUB 5IVNA 1XF2B 1XR8A 2P46B 4ELMB 3WHXA 3QNZB 2IGFH 2R0KH 3UCRA 3HHRB 4BSWB 1PG7H 5BQ7B 3R8QA 3UTQA 4X80L 5EFIA 1Z0MA 3RVXC 3FT4B 1CT8B 4KK9D 5LCVH 4XZUA 3GMLA 1WICA 1XGRA 3QA3B 5TF0A 3JTCA 2VC2L 2PO6C 1OTTD 1XIWA 3BJLA 5I6XB 5BMFH 2FR4B 1YN6B 2P4AB 2F53A 1A5FL 1KBGH 4GG8B 2M2DA 4OI7A 4X6CE 4M7ZC 5BV7B 2KUTA 4HXAL 3A0OA 2BOCB 3S35L 3TF7A 5DR5H 4KTDL 4QRRB 2FX7L 4PJ7A 3QH3A 4KZEL 3O8XA 2E6QA 5GIRB 3H42L 3VD5A 1CLZH 2F15A 4I18A 4G42B 3CLEH 4NNXA 1I8LA 1JNHB 2DB8A 4LPVA 1C5CH 3G9VA 3OKMB 1KCVL 1H0DA 2XQYK 4GFTB 5D7IB 1NGWB 4WU7B 3ARXA 2MPAL 4JZJB 4PRIE 3WEXB 3C87A 3ZKMC 3NZHL 4KWUA 5ALCL 5BVJA 1Q9OA 4DQOL 3ARPA 1ZLUK 3QIWD 4TOYH 3C09B 5GPRA 1H9VA 3VGAB 3EKCA 1IGFL 1YEJL 3RL2B 1JPST 3NA9L 2NY1B 4ONOA 4Y4FA 1NCTA 5DD0H 4OSUH 5F96L 2XZCL 1PGRB 4YPGA 4B7IA 1MFEH 2EO9A 2PCPA 4HIJB 4X6CF 4OI8A 1KT2B 2A9NL 4PJBE 1CL7H 3EOBB 3MTRA 5M94B 4XBEH 4ZFOB 3UO1H 4WY7L 4KXZH 3HUJE 4NBZB 5TDPB 2OSLB 1K4DB 2XQYG 2VLJB 4Q2ZB 4PJAA 4XNQB 2EYSA 1HCFX 3IDIB 3DV6A 1DVFC 2IH3A 35C8L 4W4OA 4X4XB 5KBNC 1U3HD 1DBBH 1H5BB 1U58A 4Y7MA 3VXMA 1WWWX 1U8PA 2YHGA 4PRHA 2WSKA 4FQ1H 3PUCA 4FQHA 2A74B 1BAFH 4MVBC 4MAYB 3MGOA 3BDBA 4I3SL 3WIFA 5M7QA 2PUQT 4BUHA 3ZE1F 5KTEH 5BZWA 1T89C 1SYVA 4J23A 2YSSB 3KJ6H 1CICB 2NY4C 1KJ2L 1JWSA 3NABH 3WLWD 3CFBA 2GTZA 3PNWA 1KJMA 2ICWA 5HDOA 1JPSH 3SKMB 5HYFA 4PJBF 1KELL 2ATPA 1NANH 1XGUA 2HP4A 4QRPE 2V5SA 3JTTA 2XNAA 1OAZH 3RY4A 4R96B 1QLEH 5HHOE 2BJMH 3LN5B 5DVOA 2ADIB 1OP5H 3O2DA 5C0RH 3TCLA 4P5TC 2F54A 3RY6C 4Y16C 2N7AA 4P46D 2HMIC 4RAVA 3BKYL 1MI5B 3IU3A 1W72L 1JNJA 3ES6B 5DTFB 2AKRA 2XRAL 4LPCA 1G9MH 3MLZL 4RMSA 4AIXA 4JFPB 4RAUA 4ZFFA 1JGUL 4P57A 4L3EA 5D96B 2O5YH 5GGQH 4XRCA 1VACA 4PJ5E 2VQ1B 5F88A 3D3VE 4F7EB 5I1IH 2AABL 4R97B 1S9VB 3BT2H 1BQHA 3IFOA 4R26H 3B2UD 3O11A 3HNTL 1HQRB 2IPTL 3OKLB 3MLVH 4MDJA 2C9AA 4WEBH 3VFTB 4M62H 2CDFB 4NQCA 5EOCH 1MWAH 3TNNA 1HH9B 5HHOD 4C57C 4I5BA 1IL1A 5C6TH 2YS4A 2EDJA 1MREL 5EWIH 5F3HA 4QWWD 2AJ3A 3QZWG 4GUPA 1AXIB 3LKPA 2ZNXA 5IGXL 1TMCA 1JWMA 3OX8A 3RVVC 3O4OB 2WUBH 1FAIL 5TGBB 4IOIB 3AGVA 1G7QA 1N6VA 3JVGA 1G7IA 3GMNA 4N8VG 2B1HH 4CVWA 4PG2C 4S1RH 3DWTA 3BAEL 1QLRB 2CO6B 5D5MF 4WFHE 4HLZG 5AAMA 1JF5A 1MWAA 1UZ6F 2JB6A 3JTSA 2XYCA 1CE6A 3C6LD 3SDXE 1VFAA 2J12B 4G9DB 5C0CB 3BW9B 1KB5H 1NBQA 4F33B 2P5WA 1Q1JH 4XCFH 2Y36H 5BJTA 2QADC 4KMQA 1MUJA 4NRZA 4Y5YB 1NUNB 4LEOB 2B39A 1LEGB 1OAXL 1I75A 2YD3A 3CH8A 4CBPA 1L7TH 4NKIL 3VRLF 3MACH 1KGCE 3KGRA 4HKBB 3CFCH 4PJGE 3IU4L 4HAFA 3I02B 3F12A 4OCWH 3NH7H 4ZPVB 2ADJA 1YMMD 3C8KB 1ITBB 3BP5A 5B38G 1DBKH 1FH5L 3HC3L 1KB5A 3OWEA 4R0LC 3ARVA 3EYUL 3V6OE 2YRPA 3QWRD 2IADA 1H8SA 3DVGA 4UB0L 2QQQA 3SDXF 1Q0YH 2MHAB 1CDGA 3AU1A 3OKKA 4HFWA 3MV9E 4UU9B 2WBWB 4KK6C 3C08H 4NN5C 1VA9A 1L4IA 4KVCL 5I1AB 1WT5A 1UGNA 4KGJA 3WFHA 2CSPA 4H5SA 1GCFA 3GO1L 1CZ8L 1C5BL 4F9LA 5E6IA 2B2XL 1IT9L 4PRDA 1IJ9A 1ZSDA 2CRZA 4WTZA 1ZA6B 1BEYL 1XR9A 2R56H 1G6RB 3CDGA 2WP3O 2A6JB 3I3BA 4RZCA 1JPGB 4PP2B 3Q1SH 1IQDA 1IEAB 3VMPA 4PP1C 3VXOA 4ERSL 4ZAKC 1B2WL 3F7VB 5CZXC 5BV7L 1XGYL 5I73C 4XH2B 4E5XA 5D2LE 3BN9C 1MSPA 5E5UB 3X3GH 3U4BH 3DMMB 4L8DA 5KG9B 2X4OB 2PYEA 4ZUWA 3PGFH 4X6DE 3ARWA 3MODH 5E4EC 3V6ZA 1RZFL 4K3GA 4K7PY 4PRBA 3GHBL 3PHQA 5CEYB 4IOFD 1MH5A 2HWZH 2QHRL 4G9FB 1MRDL 3V4PH 4NWUL 4N0YL 1MQKH 5T3XE 4YJZL 3RTQC 3FB6B 1PZ5B 5ID0A 1QA9A 3CFDB 4KQ3L 3P0VL 5I71C 4UTBL 3PV7A 5AEAA 2BVOA 5I16B 4HGMA 1CXIA 4OLWH 5I1LA 3N1PC 5D8JH 1T5XB 2QHLA 1TPXB 5J6GB 3LQAC 4P2RB 5INCA 4LNVA 3OB8A 4U1JB 5D2LF 4ZFOL 3VXPB 1S7WA 1GGBH 4D0DB 1A6AA 1NBVH 1QSFA 3LOWA 3U9PL 2DQIH 1HSBB 5I8CA 1K8IB 3K8LA 5E95B 2OQJA 2BNQB 1FZOA 4NRYA 5DRZA 3KLHD 1S5IL 5EU4A 4KK5C 3HR5A 5EZOH 2VDNL 1RZ8A 5L9DL 3LKQB 1RUQH 3V4UL 3MNWB 5HGDB 4PB9L 3BO8A 3BJ91 4P9HH 5E7BA 1IBGH 3S4SG 4O58H 2ZCHL 3TN0D 4RGNB 2HRPL 3IXAA 3RIAK 1JTPA 4X4ZA 4PR5A 4K55A 1A6ZA 3IXTB 3JV0A 3FQTB 3L95B 3QRGH 2EDNA 1N5YL 1OGAB 1A7NH 3NOIA 4WW2A 3V6BR 4M48L 1XGQB 2XICA 1J87A 4F2MB 3MRDA 3FN9A 1GPOH 1D5ZB 1U8OB 2AJXL 2VDOL 2W9EH 3T3PE 2CIIA 1LO4H 3PWJB 4Q6YA 3QI9D 3V7MA 1ED3A 4PRPB 5IEKA 4QKXB 1UCBL 2AJVH 2QSQA 1WFOA 5ANME 3S37L 2FB4H 5DQJB 1J7VR 1I1FA 1ZA3A 1OLZA 4POUB 4PUBH 3UDWC 1RIUL 3PP4L 2ENSA 2FJGB 2UZYB 3CLFL 5HYEA 4HWBA 5KSAB 3NZ8A 5K9QG 1HE7A 5EO9B 3SGEH 2A6DB 2D31A 2FHCA 1G6VK 5HYSB 1U8NA 3IYLW 4JFZH 1CR9H 4KHXL 4HJJH 4KKBC 1L0QA 2KL6A 2PYFB 4S2SA 3PXHA 5IB5A 1IKFH 1PKQB 5EU3A 1OARH 2HVJB 2YUZA 2NY3D 2NY6B 4P2CG 4NM8H 4Y4HC 1A7RH 3D87B 2K9UA 2RGSA 4XP5H 4OCSL 1K4CA 2CRMA 3RWDA 1C1EH 2UZIL 3QIBC 4P23C 5SX5K 4OF8A 3KYOA 3WFBH 1X6NA 2AK1L 4H88L 2CH8A 4Y2DC 5IW6B 1QBMH 1CD1B 4WWID 5CIPB 1TJIH 1CFNA 1JZ4A 4K8RC 1OAKH 4XMPH 1Z9MA 5C8JB 5C0IB 5HGBB 1I9RH 1Z0NA 4IRJB 1U3JA 3T08A 5D1QD 4WI9A 1UYWL 4L4TE 3VFUB 4ODUB 3QISA 5MHSE 3TJHD 3JWOH 3S36L 3P3YA 2NTFB 3LKNB 4UILL 5IBLC 4V1DA 4JRYE 4K9EC 2VERN 1RK0B 4RNRA 1CFBA 2FIRT 2NW2A 2XTJD 1IGTB 2BOBA 3BH8A 1EEZA 2FL5A 4FFEX 3E3QE 1D5XA 3I75B 4FTVB 2QKIB 4HEPG 4MA3A 2R1YB 5EFIB 4R3SB 2KH2B 3JWDH 1HOCB 5GSVB 4NKOB 2VIRA 3K7UA 1ZK9A 5EU5B 5EB9A 5GGTH 4HGWB 1UWEH 4FP8H 4K3JH 4OJFL 5HVGB 4R7NA 4Q6IC 3RVUC 3IT8D 1CCZA 3S3PA 4CGTA 4EJ1C 5D2NC 5FYKU 5KVFH 1AGDB 3MRPA 5EOTA 5JLZB 4OGXH 2NXZC 3SCMD 4J8RB 1KLUA 5HHPA 1YNLL 3UJTL 1J1XL 5KJRL 1HILA 2P24A 2V7NA 3STZB 3T04D 5FUOH 1Q9WA 4I0KA 4J3OC 3PQYB 1AKJD 3BPOB 1ZTXH 2CUHA 3U7WL 5SWZE 3RBGA 4N90E 5GGTA 1S7XB 2JJSC 3SE9H 1T0PB 3EYFA 3TIDA 2H26A 2A83A 3U46B 1XZ0B 3ARGA 1ORSA 5HGHA 4LLDA 1OQOA 1H0DB 4BK4A 4FQ2H 3UBXI 2YZ1A 1RZJL 3WIHL 4OD3L 1K6QH 1RUPH 3UTTE 5ITFA 1RU9L 1NDMA 3RIAF 4JKPL 1YEGL 5GS0C 1G6RL 3MLRL 3OF6D 1A7BA 3HI5H 1F3JA 4M6OH 4WUUD 2XKNA 3RJDA 3TPKA 1YDPA 5IJKC 1JI2A 1P1ZB 2IBBA 2YBRB 3HE6C 1G9NL 4OCRL 1Z3GL 1S9XB 3GSQB 4BSVA 1ZLWH 3PP3H 4GG6A 2DJ4A 3AROA 4FFWC 4MNQB 4QTIH 3BXNA 4ZO9A 3LKOA 2IFFL 3WNOA 5FM8A 2OL3A 1JIBA 4OLZH 3IFPB 4RA3A 5CSZA 3WDIA 3UAJD 4Q9QL 3SQOH 2P49B 4ZFZB 1RD6A 4QGTA 3FB8B 3MOAL 3SDCC 3MRQB 3HR6A 1DR9A 3KWWB 3WSQL 4X7SH 4PJAB 2XZAL 3V5DA 5E08H 2EYSB 4ZDHA 3TO4B 2J5LC 1AC6A 4I3GA 5DRWA 1OWRM 4PJFB 3VFMB 3TH3T 3VXMB 1WQVT 1BZQK 3W11C 1U8PB 1NCAL 1BM3H 4P3CH 5JHLL 3B83A 5GJTH 4Y4KB 1AY1H 1T1ZA 4YIQA 2Q86A 2R0LH 3H0TB 3M17A 3E8UH 3X13B 5AZEH 1MJUL 4G6FB 1FG2A 1S3KL 1FO0A 4EBQL 3GMPA 1RFDH 3QUZC 1AJ7L 5J1AB 2Z92B 3VWJB 3CFBB 2BRRL 1QKZL 2GTZB 5I9QB 5B3JE 4NKDA 4N0FA 5L8JB 4X83A 4UV7H 3O9WC 1VGEL 3MSPA 1S8DA 2HH0H 4WHYG 4K94L 2J4WL 4LQ1A 3V5HB 4MQXD 3FMGH 5HYIA 4O2CB 2ZUWA 3VFVA 3OKEB 2H1PL 4Y5XB 4PP8C 4HUXB 1BOGA 2CIKB 4RIRB 5TE6L 1J0YA 1PVHA 3KPLB 3HAEB 3TCLB 1T2XA 4K7FB 4WU5A 2Q8BH 4QRSA 3KS0H 1DANT 1FLRL 3W2DH 5KSBE 3QIUC 3TA3D 4R2GC 3IU3B 1ZGLA 4N0UE 2AKRB 3A6CL 4X5XA 2HFGL 2BSRB 2VWEC 1T5WB 1GXEA 3GMMB 4LLVA 4OKVB 3RPKA 4FXGA 2Q76B 2KPNA 1J8HB 4R7DA 4LCCC 3QEGH 5FECB 1NMAH 4U7SA 1A6TB 3U36B 5CZKA 4BZ1L 3NCJH 3GSOA 1ADQL 1VACB 2WWMC 4X6CA 1LDPL 3WXWL 43CAB 1UVQB 2AEQH 4HKJB 5F88B 3QDGB 1QVOA 4MDIA 5AUMB 1BQHB 5B3JF 1GOHA 2B4CH 1A9BA 3BD5A 2EXWD 3EUUA 4OLXH 2BX5A 4PB0H 3C5ZD 3HZYA 1GHFH 3BE1L 1DUZA 1IC1A 4TRPL 1IL1B 3QCVL 4R4FH 5F9OL 1EBPA 1U3HA 3MNVA 4MA1B 3VRJB 4YK4B 4OFKA 3EFDL 5F3HB 5DD5H 3I6LE 3GI9L 3T77B 4LVNB 2ZZUT 5MENE 4LK4A 3VFPA 3T09A 2G2RB 2R69L 5H94B 4DVBB 1AHWB 3QULA 2HFEB 3O6LH 3HZMB 3PWPE 5ICZB 2ATKA 1T6VN 1TJGL 3FTGB 4LASL 1N2RA 1GGIL 4TTDC 2EDXA 4G6AC 2CKBH 3O2WL 3P9LA 4DJMA 4RMQA 2FGWL 5ISZE 3MRFA 4WFFD 5IKCB 5J13C 3MJGX 3U9UB 2EH7H 1F3DJ 1SBSH 2YD2A 3LH2L 3HB3C 2DM3A 3BQUD 4GKZA 3TBTB 3VD9A 1ZOXA 4QRTB 5KZCB 3HUJA 4X8XA 3VJ6A 3P77B 3LRSB 3VXUE 4J4PD 3NCFB 5CEXB 2E7BA 3QG6A 4JFQB 1HXYB 1LO0H 1YEKH 2A6KB 4JQIH 4P46A 5C2BL 3TC9A 5C71A 1U8KA 5D7JB 3DSFL 3REWB 3L7FB 5HDQL 3I6LD 1D5BB 1PJ9A 1VKXA 4OIIH 4PPTA 3CVHA 3FN0H 2F8OA 3INUH 3VRIA 3OZ9L 4ACPA 2L7JA 3AMKA 4X6BB 4CU8A 1NFIA 3OR6A 4WCYL 2VITB 3MXVH 4KQ4H 3BP5B 4NO0D 3JV6A 1T1XA 4NO3B 2Q6WB 4MLIA 4IJ3C 1CXFA 4HUUA 3BKML 4QXTB 1DN2A 1DLHB 3MA9H 1F6FB 1NKOA 2XV6B 2IADB 3BISA 1UXWA 1BBDL 2RFXB 1AI1L 5HGGS 3O3EA 4C59B 4NQSB 2BXYA 5F9AC 3P4OA 4ONFL 5HHOA 5IT2H 5C9JB 3TIEB 4YHKH 5IVZB 4H26B 3T0WA 5C1MB 1P7QD 3OJDA 3AREC 3QJHA 3WXVL 5C3LD 3TBVB 1KSRA 1MRFH 1N26A 2VISA 1DBJH 2EIBA 4PRDB 3KPMA 4YNYB 4NGHL 3AS2A 1TZIA 5EU6B 1DLFH 4KDTA 3OKOA 1NCBH 1ZLUH 4NN6B 2QSTA 4D9LL 3DGGB 5E70A 4PGJA 1HSAA 1QRKA 1C8PA 2IGFL 2R0KL 1BZ7A 1FCCA 4JHWL 3GEWB 3C6LA 1TETH 1W0WA 4LHUG 1A6PA 2PYEB 1ZGLM 4ZUWB 5LCVL 4FQLL 4QXUH 1LO2H 1YY9C 3HMWL 1LQVA 2EKSB 4HUVB 2WZPD 3VXSB 4PRBB 4HS3B 4IHOA 4I3RH 2CLZA 3PHQB 4MD4B 2XWJB 4F15B 1FNGA 4KTYA 1OT2A 2JCCA 3BH9B 2OI9A 1FE8L 3IJSB 1KBGL 5ID0B 5JHDB 2NW3A 4X5WB 1YMMA 3QDJE 1NC4D 1UXSA 2RAMA 5IFJB 2BVOB 4XVTH 5D1XC 5DR5L 2IQ9L 5K9KB 4U1NA 5JXAL 3O6FD 1NCCL 3WJLA 3TBWB 1JUFA 1CLZL 2DM7A 4D8PA 4LLMB 4JM4H 4Z9KB 4MAUL 4MXWH 1N0XL 3QWRA 1SJEA 3CLEL 4OGAC 2AJSH 5JPMA 1C5CL 4MX7A 3V7AG 2I5YH 3P9MA 4FQXD 4GO6B 4JN2B 3V4VL 3N1MC 4E42A 3GB7A 5JOPE 4K7PL 5C07E 4Z0BH 3IDXH 1K8DA 1SM3L 1R5IB 2DTMH 4HCRH 4XP9L 1PX3A 3RBSA 2HLFD 4P2QB 3IVKA 1J8KA 5IP4A 4UOW0 4NQXA 1T83A 4PJGA 4KI1A 4L4JA 3LIZL 1WBYA 4EEEA 2ZSVA 3QDJD 1OOAA 5TH2A 4QXGH 2P48B 5IFHL 1PD6A 3ZE0E 4HJ0C 2IH1A 2R2HA 2PN5A 3GKZA 3LDBB 4WJ5B 1TTUA 1OSZA 2EIZB 4WIQA 3DRQB 2Q1EA 3IDNA 4HLZH 1DL7H 4K3HA 3B2VH 3MRCB 2XTLA 4HCRA 4PBXA 5KS9B 1DBBL 4NQVA 3TVMD 3D18B 1AGFA 2HVKB 1UENA 3R06B 2Z31C 43C9A 3DECA 4ETQB 3BKJH 2QSCH 5JOPD 5C07D 2ARWA 4KKLD 5MEPB 4S10A 3IDJB 5C08B 4X7TA 1AR2A 2P43B 3T0ED 2GCYA 2X4RA 3KJ6L 3IAGC 3NABL 1NGXA 5F1OB 5J3HC 1DQQA 5DGQA 5HTSA 2VDLL 3NZ8B 1D5IH 4CADB 3SGJA 5T3XH 3K4ZA 4M6AA 3ZE0F 4XHJD 1QLEL 3V7AE 4PJ9C 2BJML 3MLSH 3D25A 1FFPB 5C0RL 5FO8B 3QO0A 1DN0B 2ED7A 4X6DA 4GKSA 1TVDA 1AQKL 1X5KA 4P2OD 4JLRB 5DEFA 5E2JA 5EPMA 1OHQA 1BX2B 4JR9H 1G9ML 3RVTD 5JDSB 4J7RA 5ETUB 4LSVH 1NH6A 4IDJH 5FYJL 2ORBH 1ZVHA 1OW0C 3RWGB 3HE7C 1F6AB 4FQQA 3ZKXC 5GGQL 1CGVA 2D7PA 3TN0A 4JKKA 4KROD 4KDVA 5B38A 3T4AA 3MYJA 1OQXA 1VHPA 3D85B 3BT2L 4R26L 4EXPX 3G04A 2Z8VC 3HS0B 3MLVL 1QP1A 3UTSE 4WEBL 1IVLA 5CILH 3O3UN 4BH8B 2P42B 5EOCL 3QNYB 1A6UL 1F4YH 1D6VH 5C6TL 1S9YA 1WC7B 3S35X 3QUXC 5C0FA 5CWSA 4XI5D 1FC1A 3UC0H 1KLFA 4TYUA 4RNRB 1S7RA 3TLRA 3L3IA 4WI4A 5DJ6B 5IF0B 2X4PA 1BWWA 4G8GE 2XT1B 4O00A 3QI9A 2I9LA 3S5LG 4NN7C 3ZYJA 2B1HL 1HINL 1SJHA 2ZP0T 2KBGA 2VIRB 3WUWB 4JO4H 4N9GA 1AGBB 4O02H 3SBWC 4H25A 1F90H 3NBNA 1I3GL 2OMNA 1I7RA 3N9GH 4CRPA 1ZS8B 1BREA 2D7QA 1HHJB 3V0VA 4DN4L 5I8KL 4F8TA 5FAAA 1MIEL 3DETC 1CIDA 2V17H 1OCWL 3MRNA 1RIHH 1Q1JL 3MA7A 5HHPB 2Y36L 2ZOKA 3CK0H 3C5SA 4A2LA 2V7NB 2D0FA 4R90H 3IFNL 4N1HB 1Q9WB 3ARBC 2R4SH 2VXSH 4J3UA 3BPCA 1L7TL 5CS7A 1F4WH 4HH9A 2YRLA 4U6TA 4UUJA 2H2SD 3CFCL 2BVUA 3NH7L 5F7DA 4LLDB 4WV1B 3NFNB 5D4QA 5H2BB 4DZ8A 5J0BA 1NQBA 1DBKL 5ITFB 2EC8A 4JM2C 1MPAH 4LSTH 1NDMB 3DJ9A 5DD6A 3SDDD 3W0WE 3W39A 2VDKH 3VXQA 1BLNA 2D7TH 2VZOA 5EN2B 5D1QA 3VFSB 1JN6A 2FHFA 4XP1L 4GRMB 4K71B 2ZOLB 3VWKD 3C08L 3U2SA 1EPFA 3TJHA 4ODBD 4M5ZH 4L4VB 5CSZB 5HYJD 3C2SA 1HKLH 3K80A 5T5FH 3L3KA 2WNGA 4HT1L 3ARTA 1JMZA 4LF3B 4GXVH 4GXUM 2Y7QB 4PG9A 2E27H 4OZ4A 4GW5B 4NQDB 3VXNA 3PIQB 3WN5A 5HDLA 4Y5VC 5DRWB 5ICXB 1G0DA 4MNHA 1JV5B 3GJFK 1IC5L 3Q1SL 4HZLA 4NNYA 4GRLB 2HJFA 3QBTB 1LP9F 2HTLC 4XNZC 4KK8D 5IIEA 1UADC 3MLXH 4KUCF 3TZVC 1I1AC 2BHZA 5CKGA 3W0WD 1MCCA 2JK5B 3U4BL 3SCMA 3LKSB 1FG2B 2LE9A 5CJ8A 3GMPB 4TUOB 5ESAA 4JDVA 1KTRL 3FOMB 1AKJA 3DX9B 3LMJH 1S8DB 1FNEB 1NEZG 4F3FA 1S7UA 2XACC 5B4MC 2XN9D 1MQKL 2YD9A 3QG7H 3E3QA 4LPTA 3ILPA 4E41B 5DHVA 4PJXA 3F65A 3SEPA 4J6RH 1I85C 4U1HA 1ES0B 1T7XA 3BKCH 4OT1H 2R2CA 2VMFA 3OF6A 2APXA 1KCLA 4JJ5A 4WUUA 1ZGLB 4N0RA 4X5XB 4F9PA 3QIWB 1KIPB 1JHKH 4UV4L 4RA0C 5CZVL 5DJYA 1INEL 1R3HB 2C1PB 2BFVH 4G80B 4EN3C 2ADFL 2OZ4A 5I2IA 1GGBL 5JUEH 2X7LB 1NBVL 4YDLC 1X5FA 4XVJL 3GSOB 4HIXL 1FRGH 5DMKB 4X6CB 4Q9BA 4EI5C 3QFDB 2YPLE 3OGOE 1X5XA 2OTUB 3QFJD 5FGRA 1OF2A 3ARSA 2FEDC 2VLLB 2M26A 1A9BB 3PWNB 1RUQL 3BHBA 1LWRA 1BECA 1NUGA 4XPGH 1UFUA 4X6EA 4G8EA 1PLGH 4G8FB 4EOWH 1U3HB 4P9HL 1FORL 1IBGL 5CFHA 5MI0B 4PRIB 1EFQA 5DJ2A 4PLKC 5SX5H 3VFPB 1RMFL 4PLJC 4PREA 5EBLA 2BSSA 3NIDE 1MY5A 3DI2B 3BD3A 3NCYP 4ZD3H 1A7NL 4JHBA 2PXYB 3UZEA 1F4XH 5DRNA 3MUGB 2DIBA 4RQQA 1GPOL 2PTTA 3HLAA 5DLMH 3HG1E 4IS6A 1A1MB 4M93B 1O5DT 2IPKA 2W9EL 1RZIA 1LO4L 2AV1A 4PJBB 1SVZA 2YPLD 5JW4R 1DUYB 5FCUL 2P44B 4XBPA 1EV2E 1XF3B 1E4KC 2AJVL 3T4YA 4F7CB 5I15H 2I25N 3W9DB 3GRWA 4WI7A 3DSNA 5E2WH 4AM0A 5BRZB 2BVTA 3HMXA 3TA3A 3TV3H 3S3JA 1GH7A 5EORL 3NTCL 1I7ZA 2CKBB 1CK0H 2Z0BA 2IANE 5EIIA 4XAKE 3QPXH 4TVPD 3NIDF 4PJEE 4F80A 4LSQH 1E4WL 1XF4B 1U3YA 1CR9L 1X44A 4OZFG 4DGVH 4OF0A 3S8WA 3C60A 1MRCL 3RAJH 1JVKA 2P8MB 4HUUB 3X12A 2EXYD 2DQEH 4M6NH 4OV5B 3V52L 1FJ1B 1RJLA 2J8UF 3HG1D 3V6FA 5CKAA 1MCKA 3C5ZA 4QRPB 1U8LB 5HHOB 4MJ2A 2FLRT 1YNTA 5E1AA 5I18H 5HI4D 4YR6A 3ULVC 5F1IA 1TJIL 1Q9LB 4L5FH 4N5ED 1RJYA 3QPQC 5T1KD 4ZO7A 1UJ3C 1TJHL 3FQWA 5KSBA 4YHMH 4R8WH 1I9RL 3THMH 4N0UA 4PJDA 5JMRA 2R9HD 1BPVA 4HFUH 3DVNB 4DCQB 2IAND 1GAFL 4OCLC 4XAKD 1AFVH 4H0GA 4Q74A 4Z76B 4PJEF 3D0VA 5AG8A 5C0BB 4S0TD 4HF5H 2DBLH 1HSAB 3SDAC 4D0CB 4HUNB 3AS0A 3QDHA 4PJ5B 3EDEA 3D3VB 3U79A 1HH6A 3BQUA 1J1PH 5E2UH 1TENA 1QBLH 2C1OB 3MGAA 4HLJA 3I9GH 4KRLB 4J4PA 1FNAA 1AO7E 2R23B 2MCG1 3IKCB 2MSPA 1NBYB 1UWEL 4FP8L 4K3JL 2RJMA 3FCTA 1JGLL 4WHYH 3MRLA 1Q0XL 3P4MB 4GLRH 1HHIB 2O61A 1FNGB 3VG0H 4LOUC 1A3QA 5GJSH 2OI9B 2FECI 5IG7B 2AW2A 4UAOB 3WO4C 3BRFA 5T3ZD 4XMLL 2AJUH 4NO0A 1FV1B 5FUOL 1IGMH 5F3BA 4HX1A 1JHLL 3BUYB 4KRPB 3ARYA 1ZTXL 4RX4D 4OZHE 4F7MA 3BIKB 3SE9L 3EIFA 3DXAE 2VZ3A 3U0TB 2Y6SD 3SDXB 1P84J 5CHNB 1IAIH 4FQ2L 4JPVH 4JVWA 3MPCA 1RUPL 4FNLH 2IMNA 3OKYA 3G5XA 4D9RD 1MCPL 1RUKH 3RHWK 4D0BA 1P7QA 3G5ZB 3HI5L 3DVFA 5IMMA 1M71A 4X98B 3QDMD 4BKLA 1QR1A 1K8DB 4I2XE 2CDGA 2NTSP 3QHFH 4JRWA 1CTOA 4K9EH 3V8OA 2BXZA 5L0QB 4QTIL 4F57H 2Z4QB 2FO4B 4X9HA 4ZNEA 1QFOA 2NNAB 3CGTA 3SQOL 3PWUA 2Y9RT 5F21B 2R2HB 4OZHF 4MJ6A 4POZC 4X7SL 1QRNE 2JJTA 1HEZA 2VQTA 4PY7A 3T65B 4FFYH 3QT2A 2CDEB 4LSSH 5DJCA 3MV9B 2WBJC 3LVEA 4NZTH 2CLRB 2GSIA 2DL2A 1AGFB 3O4LE 3DARA 3RWCA 2V6HA 2J6EA 3GDBA 1P7KB 1BM3L 2A77L 43C9B 4P3CL 1IMHC 4HHAB 4O4YH 4LAQL 5IB2A 3B9KD 3QZWB 4GBXD 1AY1L 1A7PL 4LKCA 1JK8A 3E8UL 4QYOB 1CLYH 3EO9H 3MJ9A 5AZEL 2JJWA 1EEYB 1NC4A 1RFDL 1YEHH 4N8VB 4XP6L 5JZ7D 5LKNA 3O6FA 4G6KH 5KW9L 1IAKA 2PO6B 32C2A 1QEWA 2HH0L 3CPLA 4ZNCD 1I4FA 4GRWE 5IQ7H 1IKNC 3FMGL 4X8JB 4OZIE 4IMKC 5GS0H 4FQXA 5D2LB 5JOFA 5L7XH 1QRND 3EYVA 2Q8BL 3LRGA 2OLDA 3U82B 1N4XH 5F1NB 1FFNA 2H6PB 2CD0A 3ULSB 3KR3L 3O4LD 1XEDA 4Z7WE 2EEDA 1UB5A 4XCYB 3LB6C 3QEGL 5LGJB 1NMAL 3PDDA 5HHQB 2A6IB 1JZ5A 3NCJL 5EOQH 2D7NA 3QDJA 3TYGL 3H9HA 2AEQL 3MYJB 1AR1D 1P9MA 1CGSL 3G04B 2D2OA 1LDSA 1KIQB 3O3AB 2E7CA 4JCLA 2MFNA 4OLXL 3GMRA 1M6OB 5HI3D 3VFGL 4ODVH 4PB0L 4AEFA 4JG0H 2XKUA 3M1BA 1RUAH 4OZIF 1CE1H 3N50A 3L3JA 3H3PL 2DF3A 4LRNL 4O2EA 3UPRA 2GW5A 2DWDB 1FPTL 5DD5L 4FHBD 2IAMC 3TVMA 2H8PA 4YFLF 3BEVB 3MRGB 4UT9H 2ZUXA 4JZOB 5C07A 3BZ4B 4M8QB 3TH4T 3QI9B 2I9LB 3SJVE 3P30H 5FGBC 4U1IB 2VJXA 3T0EA 4WDIB 1DDHB 4B41A 1DVFB 2VKXA 5DVLA 2CKBL 5I8OL 1ORQA 5DMGD 3NIFE 4O51B 3OKNB 2ED8A 2EH7L 1S78C 3HRZA 4CVXB 1UB6A 5I17A 5DUPH 4HS6A 1F11A 1R3JA 4NC2B 4L8SC 1YEKL 2NY4B 1QLFB 3RHWF 5D7LE 1FVEA 3QEQD 3VE0B 1XGPA 3VH8A 4ZG1A 3V5KA 4P2OA 4HH9B 4OIIL 4I13B 3FN0L 3RI5F 3W9EA 3B3IB 3G6AA 3TNMA 3ZDZF 3OPZH 4KQ4L 3ULVE 4P5TB 5IB4B 5ANMB 4Y16B 3PHSA 1ZLSL 2GT9B 3NIFF 4WHTA 1A3RL 1NGYB 2HLAA 3MA9L 4XCEA 4U3XA 2E9BA 2VDQL 3IETA 4OF7A 5CEZL 5E56A 2XWTB 1FNLA 2UVFA 2Z91A 4OQTH 1N64H 1QD0A 3ZKNC 1S7QB 2R15A 3UTZA 3EOTH 2ZUUA 3TWCL 4YHKL 4NT6A 2BVQA 4UQ2A 1HXMA 1RK1A 2X05A 3MNZB 1DANU 5D7LD 1MRFL 3DRTA 4WWKC 3VXRA 5IHUH 2BCKB 4P99A 1U8IA 3L5WA 4OZ4B 1TZHA 6FABH 3EO1A 5JW4Q 1G7LB 3KPSD 3U30C 4R4ND 4MNHB 4HZLB 3TCXA 3EDFA 4JY4A 3ULVF 4OQTA 4FQCH 1EXUA 3FRPA 3S4SB 5DJAA 3HZKA 2VDRL 4JPIA 3RPIB 2EDRA 3MLWL 4I77H 3GUTA 5BW7A 2VR9A 3VFOA 4XPHH 4QEGA 3SCMB 3ZHLA 1JGVH 1P5VA 4DAGL 3AY4A 4QO1A 1X6LA 1NJ9A 1VADB 1BIIB 2ITDA 2KQMA 2JELH 4L4TB 3HI1B 5FHAL 5IQ9B 2C3WA 4EIGB 3MLYH 1JF1A 1AKJB 4BYHA 1ZWIA 4CAGA 4DKAA 4JRYB 1KV3A 3QUKB 1Y18A 4QT5A 4CDHA 5DJZA 5I30H 1NGZB 2DLFH 2D3VA 4PJ8C 3SKOB 3KVQA 1MAKA 5IBTL 2QADB 4XVTL 4PRAA 4U1HB 2AK4E 4LNRA 1TVHA 3SDDA 1WVZA 4MXWL 4RFNC 2P47B 4YDKH 3R0NA 4HIIA 3S34H 4ZUSB 2H3NB 2D0GA 1BQLH 5DZLA 2M8XA 1XCQB 4PJHE 4KI5C 5I66A 3M8OL 3VWKA 1AP2B 1IC4L 5C0JA 4KKAD 1GGCL 1XF5B 5HYJA 4CMMB 3ARFC 4UT7H 5GGUA 5FDWA 1CG9B 3C2AH 2NLJB 4R0LB 3IDXL 1CU4H 1OF2B 1KG0A 2CGRH 2DTML 1M1SA 5EUOA 4BFIA 4KJPD 1ZHLB 1NDGA 3GSVA 25C8H 5SWZB 4X9FA 3MJ7B 4GW4A 2KDGA 1T3FA 4YXHL 4NN5B 4QRRD 5FOBA 4BQCA 1T03H 3RNQA 1IAOA 2X9WA 4G59A 1BP3B 1I8IB 4XGZA 2Y5TA 1EAPA 5DJ2B 3UTTB 4FOMA 2VLJE 4XC1L 3GSRB 1T1WB 3EDJA 3WO3B 4CDGC 4LCYA 4YH6A 4PREB 3OXSB 2BSSB 2AK4D 1T21A 2V2WA 3W0WA 2ICES 5L8LB 2E5EA 1V3KA 1DE4A 4QHKI 2X5PA 1CFVL 2NR6D 2A1WL 2R1WB 2DRUA 4ODWB 2Z35A 3PL6C 4JB9L 4PJHF 3BIAX 3FONA 4N5UA 1OAQH 1T2QL 4FXKA 3AM8C 2IPKB 4GS7C 3BKJL 2QSCL 5I73B 2EEBA 3RGVC 2XN9A 3K4AA 2NY1D 2DLTA 1SEQH 4L9LA 4NJAH 1K5NA 3G6JA 2OM5A 5E4EB 4LSUH 5EC1A 4HKXA 5DQ9B 3MBEC 4ZSOE 1D5IL 5DMJB 4ENED 5T3XL 5JDJA 1L6XA 4S1QL 3RWFA 2ZG1A 2VLJD 1TZGH 2X4SB 1X4YA 2X70B 3NFSH 1UKQA 1MI5E 5I71B 1JYXA 1OAUH 4YXLL 4MLSA 3DX6B 5JW5A 1P2CA 1J05B 4UBDC 3BWUC 5CJXC 3QFJA 3MUZ1 3X12B 1QFWH 2YPVL 3MGTA 4YEEA 3RJQB 3EGSA 2X1OA 1J86A 4JR9L 1JPTL 4IDJL 1FGNH 3C5ZB 1K2DB 2ORBL 4U6XB 5CMAA 1CICD 4KKNA 2UWEE 1YNTB 3REVB 5LG1A 3QEHB 1VSCA 1RY7B 2NY5C 1HK6A 1GIGH 1FYHB 2OP4L 1WZKA 1M05B 2FSEB 1RUML 5F7MC 4BQBA 4M61A 3HI6H 1DQJA 3KG5A 1T4KA 1F4YL 2MQCA 4MGXA 5CD3A 2DQCL 4BH7B 1MI5D 3UC0L 3GIZH 4QCIA 3E6FA 3MMEA 2FH8A 1LMKA 2YPLA 3ABZA 1HDMA 2NYYC 1HHHB 2DQDH 5HDBF 1A4JB 5DJ0B 4MXQD 4O02L 5F7EH 3ARDD 4A6YH 1OLLA 1ROWA 1R5VB 2UWEF 1XGTB 1N3NA 3QNXB 1FZMA 4Y19E 4UIKH 1WCQA 1T0MA 4I8DA 5MENB 1KJVA 3GJFH 1JZ7A 3AXLA 4PJIF 1A6VL 2EKJA 2E7LC 1RIHL 2Q7YA 2PTUA 3PWPB 3CK0L 4F7PB 4PTUA 1OPGL 2WINB 3MOBL 4XNMA 1BFOA 5ACZA 3O41B 5J4MA 5ISZB 5LBSH 5EBWA 1F4WL 1TTFA 4A6YA 3C6SB 3HG1A 3WKMH 1NEZA 3CC5A 3WDHA 5HHXH 4S1SL 3RY5A 3EFFA 3EJZC 3IDGA 1IRAY 2VO5A 3VXUB 5ESVA 1YNKL 1MPAL 4L3CA 3OAUH 1I7TA 1RURL 2VAAB 5H37G 1CBVH 4N5EA 5F9JA 1P6AB 3Q2CA 5T1KA 2NQCA 4MJ5A 3NFPA 4Y4HB 4OBSA 2D7TL 1A6WH 5MEQA 5F93C 1Q9KB 4NHCH 2XA8H 4FRWA 2IANA 3QIBB 4LCWB 4P23B 4OFVA 4RISH 5IUSA 3JV5A 1YYML 3WFDL 4XXDA 3KPRB 4M5ZL 4Y2DB 2F5AL 4P59H 4JFHE 5JPNA 5TQ0H 5T3ZH 5L8KB 3GMOB 4YLQT 1BGXH 4GXVL 5IVOA 3TBYB 5IEHA 1NAMA 1PYWA 3S97C 1ODAA 2RIKA 3R1GH 5GGSY 1QFUH 3N85H 3QXDB 1EJOH 5EULV 5F72S 1H15B 2EDWA 1TNMA 3MCKB 4ZTOH 4YFEA 4P5MB 5IB2B 3MLXL 4CW1A 3HKFA 2B8OT 2J1KA 5FIEA 3O6MH 1MHCA 3G9AB 4DEPC 1AQDB 4YO0B 4NUJA 3EOAB 1UM4H 5DJXA 3MUHL 1OSPL 2EDOA 1U92B 1B4JH 4Q6IB 1IAKB 3LMJL 4XWGH 3RGHA 4RX4A 4X80H 3ULUC 1QEWB 1ETZA 5D2NB 2PNDA 4JFHD 4OZFH 3HPLB 4KI5E 1ZVYA 2NXZB 4XCNA 3LKRA 3DUUA 3D0LB 4KKCC 1WFUA 4U7KA 1ZT4A 4J6RL 3KYNA 1MHEA 1LNUA 2VC2H 1FFNB 4OT1L 4WW1B 1B0GA 1JJUA 4QRQB 5HYSG 2C26A 3QDMA 1QFWM 1JHKL 2NY2C 1A5FH 3WLBB 5E00A 3Q0HA 1LEKB 1MAMH 2R8SL 2EE2A 3U0WH 1WFNA 2G5BB 1S9WA 3S35H 2IF7A 5CSBA 4KTDH 2XG4A 4NYLB 3P2TA 5DHYB 4KZEH 4NFDA 1H8NA 3KPOB 4G9FD 3IJYB 4OFYD 4X0KA 1KCVH 4L29A 1QOKA 3HE6B 4OZHA 4WHDA 3O3BB 4PFEA 5GZOD 4KI5F 1G7JA 3LEXB 2MPAH 3NAAL 3L3JB 3MROB 1PLGL 4X4ME 4EOWL 3MUY1 2VE6B 3NZHH 4MD5A 5MERA 3HC4H 1KPUA 2OJEA 4HJGB 1FCGA 5ALCH 5I75C 4S1DD 4IMLA 4P2RD 3B9KA 4GBXA 1T04B 2UUDK 2VXTL 2VN7A 4GW1A 3SDCB 3FQXB 1A21A 5LAXA 5E9DB 3KLDA 3DURA 4HWNA 1YEJH 4ZD3L 3NA9H 2A0LC 4I2XA 1KPVA 2APTA 1F4XL 3TFKC 2J5LB 5I1KL 3ARUA 3ET9F 3TT3H 2GJ6B 2EDQA 5DDHB 3QXWA 4BSJA 5DLML 4BQ6A 1UT9A 4DGYL 1JGDA 3DX8A 5CD5C 5HI5D 1EGJH 4LHUB 1F11B 1MFAH 4PGDB 5IOPA 1QRNA 3OKDA 3LQAL 3BWAB 3QUZB 4RGND 5E2WL 1FVEB 3TV3L 1CFTA 4C58B 5AAWA 3O9WB 4GRWH 5C0ND 4TSBL 2Y23A 3O4LA 4YBQC 2VLKB 2R4RH 4NSKA 2HG5B 2P7TB 2BY0A 4I3SH 3QPXL 1AGCB 2HT2D 4GKNA 2GSGB 4HIHB 1YEIH 4KC3B 4Y2OA 5AYQA 4LSQL 1QACA 4DGVL 4IRSC 5IR1A 1OP3K 4KROB 3RAJL 5C09B 2DLIA 2EZ0D 2FBOJ 3QIUB 5DK0B 1KELH 4MA8H 4R2GB 4WENB 4DFHA 1JYNA 2OXGA 4F7TA 3MUJA 2XKSA 3QHTC 4PRPD 2A73A 4I4WB 4M5YH 5CP7A 3WFZA 5GSRA 4LCCB 1IGJB 5GGRA 3T8XA 1DJSA 4NT6B 3BKYH 3LQZA 2BVQB 5KSAD 3MCLL 1W72H 1KXVC 1NBZB 2ZPKH 3UXFA 5LWYL 2R2EA 1NCWL 5DZNA 5TJWK 2PR4L 5KN5A 4YHML 4R8WL 1ZE3C 4I0PC 1YZZA 4MNGA 5L2KE 3MQIA 1XMWA 1TZHB 4HFUL 3DV4B 3EO1B 5IROC 4Z7WA 3T0VA 2NCMA 1AFVL 1D6EA 2P5EB 2A2QT 4W6YB 4X4YB 5E8PA 4HF5L 2G9HA 2DBLL 5J9PA 1HZHH 4APQC 3F6LA 4FTVE 2NY6D 3HNTH 1I3UA 5A2KH 1YJDC 3I3DA 1JGEA 5IV2B 3GUTB 3AS3A 2E7LE 5C6WH 1UACH 3RVWD 1W72A 5BOPA 1DSFL 3EHBC 3OGCB 4NFBA 4M7JH 3UTSB 1MREH 4LSDA 4NO2A 1HQ4A 3RDTC 2C3VB 2DBJA 5IMKA 3QEQA 2Z93B 3EZJB 5GGVY 3QUYC 1A8JH 4HK0A 3C9NA 4KHTL 3UBXA 5DRXA 4IRJD 2VZVA 3AFLA 3IF1A 3VG0L 3BZEA 1SJVA 4GAGH 3QB7C 1NCDL 4GQPH 1P6FA 5I76B 3VMOA 4G8GB 4H8WC 3BAEH 5HHMB 3PQYE 2LAAA 2HJKB 2AJUL 4DFIA 2LU7A 4JPKH 1VERA 2DDQH 3WFCL 2X1WL 1EHAA 2QR0A 3I2CL 1J0IA 1FGVL 5DS8A 2QTEA 4FTVD 3K1DA 1NPUA 3HAEG 4OF6A 3L3HA 2DMKA 4LCUB 3ULVH 3MRJB 5E2TH 4QHKJ 5CJ5A 4K8RL 5I66B 3VWKB 4M1CD 2HT3D 4MWFB 4NPYB 5C0JB 3AMLA 2O5ZH 1OAXH 1IEBB 5GGUB 3WJJC 3B5GA 4J1UB 5FO7A 5LQBH 4ESKA 5D7LA 4NKIH 5GRVK 1KNOA 5JORB 4HBQA 5JO5A 1AD9A 1LE9A 4ELKB 5TDNB 5L88L 5A16A 5GGSB 3I6KA 3QHFL 4K9EL 3KPSA 3CFEA 5HD8C 4M1GL 3KLAB 4F57L 1FH5H 3CVIH 4YHLL 5GS1A 4LLQA 5C0AE 4JCMA 3PQYD 4FMFA 1ZT1B 1VEMA 3EYUH 5HGAB 4JKWA 3AREB 1LP9B 2FCBA 4LCYB 1OGTA 3SO3C 5J6HA 4PJFE 4ONHA 4QXWA 1C12A 2GK0B 4KVCH 4FFYL 3FOLB 4NO5A 1HNFA 4N0CD 1P4BH 1SHMA 5F7NC 4YGVB 3VFNB 3TT1L 1OD9A 2B2XH 1W0VA 4Z7VA 1IT9H 4O4YL 1YN7A 4QY8B 3UEZA 1FVDB 1KULA 1PAMA 2XOTA 5A43C 2AXGB 1RQ5A 4MNQD 4XTRD 3S5LB 3BPNC 4ZUUA 2FYYB 1XF2A 4U6HB 1M4KA 2AGJH 4ELMA 3QNZA 3ROLB 1U91B 4BSWA 5BV7H 5BQ7A 2BP3A 5C0AD 2VABB 3PV6B 4NWTL 5DURD 5DHXB 3IFLH 5IQ7L 3IS1X 3FT4A 2W92A 1CT8A 5GS0L 3TO4D 4AT6B 5L7XL 5TPWH 1D9KC 2ZNWA 5D1XB 1N4XL 2DQJH 3C8DA 4JE4B 3S98A 3VW3H 2QHRH 4X6FA 4Y4KD 3ULUF 2FR4A 3MFFA 1JFQL 5ID1A 1YN6A 3EAKA 4N0YH 4LDEB 1QNZL 2V5MA 3ZTJG 4GG8A 4OGZA 3ZYIA 2J8OA 4KQ3H 4WO4C 4G6FD 4UTBH 5CMAB 2BOCA 3S6CA 2MOVA 3G08B 4KKCD 3VWJD 2O26U 3H9YA 4QRRA 4QRUB 3ZDYE 3F8UB 3Q3GA 3RKDD 4YHPB 3EYOB 4G42A 1FNHA 1JNHA 3CMGA 2AK4A 3DPBA 3OKMA 3IB4A 1VGKB 1KB9K 4OB5L 4ODVL 5D7IA 5F9WC 1NGWA 2HKHH 2UYLB 4WU7A 5E6YA 1I3RB 1T4KB 4HH8A 3U9PH 4JZJA 5FYJE 2HTKC 4U0RC 3WEXA 4M7KL 3WFEL 3QEUB 3WL9B 1MCSA 1S5IH 2OTWB 1R5WB 4NC1E 5IBUG 1AIFB 2VDNH 4LGSB 4RMVA 1I9IH 1NFDF 5L9DH 2FHBA 3V4UH 3RL2A 5J11C 1J8HD 4P4KC 3G5YA 4PB9H 4MB3A 3RIFK 4HIJA 2YOCA 1KT2A 4DK3A 3QDGD 1BBJB 3EOBA 1N3NB 4ZFOA 5A3IC 2VH5L 5IESH 3ZDYF 4OD1L 3DIFB 3VD3A 2BERA 2Z31B 3WS6A 5TDPA 3U4EB 2OSLA 1K4DA 2YK1L 1KENL 5E8NB 3BMVA 2VLJA 4Q2ZA 4XNQA 3WE6B 3S3SA 3IDIA 5DUPL 2BSTB 1MFDL 4X4XA 5BO1H 4ZYKB 3BI9X 4NQTA 1H5BA 1ND0A 2VLRB 4PTUB 2B0SL 2F19H 5FYJD 4YXKL 4XMKH 3GKWL 2AJXH 2VDOH 2YA2A 5ELIA 1CD9B 4FFVC 2A74A 4ZXBC 2J8UB 1NEZB 1UCBH 2RCSL 3S37H 1V7ML 3QQ9C 2YSSA 3ZT7A 1CICA 3IDGB 3RX7A 3OPZL 1Z9SA 1RIUH 3PP4H 3GJFB 1XCTB 3SKMA 1C08B 4H0HB 4NCDA 1F2XK 1ZGLP 5T1KB 1EEQA 1PSKH 4R96A 3LN5A 5KZCD 2ADIA 3E2HC 4PV9A 3HE7B 3EOTL 4KJWC 4PGCA 5ADPH 4PJEB 3ZHKA 3ZKXB 4C54A 1FBIL 3SPVB 5D7JD 3CJJA 1MI5A 3MYZA 3ES6A 3Q48A 5DTFA 1B88A 3AUVA 1T0NB 4UIMB 5JXED 1WCBB 1I8MB 1AC0A 4I0CC 5ENWB 4OCSH 4XBGB 4JFPA 4JREC 4RFEB 2UZIH 5DJDB 5J06A 4MB4A 3VGHA 3OHXB 1XH3B 3MRBA 2AK1H 4MXQA 4H88H 3VCLB 3ARDA 2KZWA 2VQ1A 1ITCA 3QUXB 5F89B 1BVKB 3MV7B 1NAKL 1DFBL 1HQRA 3OKLA 4NZDA 1FZJB 2CDFA 4C83B 5AWNL 1BZ9B 4JO2L 5CJQL 4XPHL 2AVGA 3VXSE 3LAFA 1HH9A 1KCGC 2VKWA 4NN7B 1JGVL 3MLPA 1LILA 3SE3A 4JHAH 3FN3A 1FFOA 1J88A 3OXRB 4FQJH 5DUML 1ETZB 5CJOL 5JHDE 4IOIA 5TGBA 5JNYA 1JNLL 3B8SA 5EU6D 1D7FA 1C7SA 5I30L 1HHGB 2DLFL 1EAJA 3LKRB 4U7MA 4BELD 2NMSA 4I48B 1QLRA 4RBPK 1AO7B 3KYNB 4WUKH 2PTVA 4CN6A 4LKXB 3ARBB 1JHTA 4RWYL 4G9DA 1CVRA 3ILQD 3M45A 2ZUQC 2N56A 2Y1VA 3S34L 4F33A 1EVUA 1BQLL 3UJTH 4U05A 2FWOA 3C09C 4Y5YA 3VGAC 3VXSD 4TULH 4LEOA 3VI4E 4OZFB 1KFAH 4I9WE 2H2PD 5H8DA 4UT7L 4CJ1A 1BF8A 4P2QE 4JY5L 4HKBA 1II4E 3I02A 4ZPVA 5AZ2L 4OZHB 5JHDD 2F5BH 3RIFF 3C8KA 4ODTH 1RZJH 4OD3H 5AYUH 1R0AH 3EYSL 3DXAB 5IMOB 3HFMH 1RU9H 4JKPH 5MERB 1YEGH 1G0XA 2IMMA 1T66D 4PV8A 3VFRB 1ZHNB 3BD4A 3UJIL 3B9KB 2JJVA 4GW1B 4AG4L 1G9NH 2ZSWB 2MHAA 4OCRH 5KS9E 1AE6L 3ALXA 4UU9A 3K46A 5IVXF 4Y5VB 5I1AA 1INDH 1YC7A 2H41A 3EJYC 4MAYC 5F6IC 4Q9QH 3TBSB 1YEFL 1IE5A 4LVOC 3WIHA 3MOAH 5C08E 4I9WD 4XNZB 2AQ1A 4P2QD 3LPGA 3TZVB 1I1AB 1G6RA 1MHPH 3ESUF 2A6JA 5K93A 1JPGA 4PP2A 4M03A 1IEAA 5IB1B 3KYAA 1VPOL 4LSUL 3OJ2C 5E5RB 3CH1B 1NCAH 3F7VA 5JHLH 4XH2A 2QV2A 3BVNB 1F4HA 3MX0A 5EZLB 1TZGL 1MJUH 1VESA 5KG9A 2X4OA 4X5LA 3NFSL 2HT4D 1S3KH 2NZIA 2W9DL 3T0DA 1AJ7H 1OAUL 5H37H 1QKZH 2W38A 3BEWB 5IM7B 2DLHA 1VGEH 2Y25A 5FYLL 1H3WM 5DGRA 1U8HB 5CEYA 5DJ8A 1UZ8A 4G9FA 3G6DL 4OFYA 5D96C 1QFWL 1G7HB 4MCYB 3EZ8A 2H1PH 1ZT7B 5C08D 1PZ5A 3AVEA 4EN3B 5I16A 1JNNL 5IHZB 4YDLB 4OZIB 4U1SB 2LV4A 5ADOH 1TQBC 3VDBA 3ECBB 5JOEA 2NXYC 3FB7B 3IGAB 4EI5B 1T5XA 2CUMA 1V3JA 3A6CH 4Z7QE 5J6GA 4P2RA 2HFGH 1GIGL 3GM8A 4EIZC 2EDLA 1U95B 4U1JA 3VXPA 3MFGB 3D6GA 4D0DA 3MREB 2QLVB 3L3DB 1U0QA 1K8IA 5GZNC 1ADQH 2Y4SA 2DM4A 1QFPA 1XFPA 3GIZL 1EEUA 3CSYB 4B53A 4IIQC 1JGEB 3QR2A 1JMXA 3IDMB 3MNWA 5HGDA 5DD3L 3C8HA 4TRPH 5F9OH 4ZOCA 4TSCH 1CLCA 1KC5L 2EYRB 3GI9H 1CIUA 1AXTL 2ADGB 3D85D 4EDXB 2R69H 3IXTA 3D69B 4HK0B 3CXDL 3IJHB 5I1HL 5JW3H 3L95A 1ADQA 4Z7QF 1TJGH 1XGQA 4LASH 4F2MA 1U8JB 3SJVB 2EE6A 2FGWH 4KRNA 1YY8B 1U8OA 3LH2H 2CRIA 5LBSL 1B6UA 3P0YH 2FZ3B 3RZCC 4PRPA 1OTUC 3WKML 2BVEA 3L3HB 5HHXL 2GUOB 1MLBB 2NY5H 2W07A 5ICYA 3CFKB 2FJGA 1MJ8H 3DSFH 5KSAA 4W81A 1R3LA 1X3DA 3OAUL 4OV6F 5HDQH 4Z18A 1CBVL 5EO9A 1KNOB 2A6DA 4ODXB 5JO5B 5HYSA 5A16B 4KY1L 3OZ9H 3DTXB 1J0JA 2WAHA 4WCYH 5B8CC 2XA8L 3QQ3B 1PBYA 1DP0A 4MXVE 4IEFB 4PIRF 4XXCA 4G7VL 2PYFA 4Q97A 1PKQA 1SBBA 4DVRH 4MS8C 1AXSB 2VR4A 4XPFH 4CNIA 4HIEA 1UJ3B 4X99A 1AI1H 4GXUN 3V95A 2AV7B 4LRIA 2HJLB 4ONFH 4OAWB 2GAZA 3ALWA 4HK3N 3UJJL 1ZHBB 3N85L 5I19H 1CD1A 5CIPA 1KOAA 3DMMC 1EJOL 5C0EB 3GHEH 2XPGB 4LLAA 5C8JA 3H7LA 4ZTOL 5C0IA 1U6AH 4IRJA 1F02I 1FL3B 1ZANL 5EZIH 3GI8L 5FUCC 5FHBH 3O6ML 1F8TH 2DL9A 2LAGB 1S7SB 3VFUA 4ODUA 1MCIA 1VB9A 5EDXA 2UUDH 4L4VD 1FAKT 1UM4L 2NTFA 3LKNA 4MXVF 1RK0A 3MBXH 1B4JL 5EH1A 1IGTA 4JFOB 4JHWH 1T22B 4XWGL 4E41E 3I75A 4FTVA 2QKIA 5CGYC 2R1YA 4R3SA 5DO2C 1HOCA 4NQDD 1EZVX 5CJBA 4NKOA 5GSVA 4U1LB 4FQLH 5KSUB 3HMWH 5D1ZD 5EU5A 3WO4B 4HGWA 4Y1AE 4LARH 2W9LA 4GRLD 3DUHA 1PY4A 4J3TA 2X1PA 1YPZE 5C0GB 4X6FB 1AGDA 3MFFB 2V5TA 5ID1B 2UVEA 5JLZA 1FE8H 2SEBB 2WLYA 3PHOB 4J8RA 4JANB 1MAML 3U0WL 5AD0B 2XQBL 2IQ9H 3STZA 4X7FC 5JXAH 3Q3GB 1NCCH 4ONGH 2DAVA 3PQYA 4BZ2L 4MAUH 1N0XH 1UH2A 4K2UL 1U8MB 1S7XA 2AK4B 3U46A 1YA5A 1XZ0A 2R39A 3KXFE 5EA0L 1OP3H 4E41D 3FZUD 3UROR 3VXTB 1BOYA 4ZQKB 3V4VH 3OJVC 2DQHL 3WD5H 2F8XC 5IWLA 5GRYA 1WV7T 4N0CA 5D6DC 4PJHB 4K7PH 3HC4L 1G84A 4Y1AD 1SM3H 2E9IA 1P1ZA 5DQDL 1YPZF 4XP9H 2YBRA 2YA0A 3EJJX 3ZE1E 2IC2A 1WBXB 2B7DT 2EO1A 4MMZC 4M7LT 1S9XA 3GSQA 1MFCL 3G5YB 3MOQA 4MNQA 2VXVL 1NLBL 3LIZH 2ESVE 3IFPA 3TT3L 2YUVA 3SE4C 2DQFB 2ICWJ 2WBJB 1UKTA 5IFHH 4ZFZA 3FB8A 3MRQA 4YDVB 4ZO8A 5C0AA 1F6LL 5DEZA 3KWWA 1KTKE 3RFZC 5SV3A 1EGJL 3TO4A 5BRZE 1MFAL 3CMOL 3KXFD 4PJFA 3VFMA 3B8YA 1PG7X 2NY0C 1ND0B 3QXAB 4QTHB 4PRID 3HAEH 4M6MH 4Y4KA 5C86A 2R4RL 3H0TA 2VXQL 3X13A 4XPTL 2PXYD 5FYKE 1YEIL 4D3CL 3W82A 5TFSL 5J1AA 2FJHB 2Z92A 3VWJA 4KGLA 5SWSE 4EQ2A 4XPBL 5TDOB 4FZEL 2BDNL 2VDLH 4M7LH 1OY3B 4MA8L 2DI8A 1JTTA 3NCEB 2W1NA 3ORJA 3V5HA 4ZSOB 4O2CA 3RWJA 3OKEA 4Y5XA 4HUXA 2CIKA 4RIRA 1HYSD 2QQKL 3KPLA 4MA7H 4M5YL 1ERNA 3HAEA 4ZUTB 4PV9B 1GZPA 4K7FA 2H9GA 4QF1B 4WGVB 4PGCB 5BRZD 2B1AL 2L7UA 1CI5A 3F58L 3BUTA 3D5OF 5HHNB 1AQKH 3U0PA 3ARQA 1FL5B 2ZPKL 2BSRA 1T5WA 3FO9B 2NZ9D 3GMMA 1TTGA 4IOSD 1AD0A 1MHHB 1FQ9C 3H2WA 4OKVA 5C0BE 1OTSD 5FYJH 2Q76A 1J8HA 5CEZE 3U7YL 3U36A 5FECA 1A6TA 5FYKD 5D5ME 5GISL 3MRBB 5DSCA 2P1YA 3ARDB 4GQ9L 43CAA 3UP1A 4X9IA 2VZ1A 1UVQA 4HKJA 5C6PB 3QDGA 1UZ6E 5DI8B 2BNRE 3NGBC 1EHLH 5AUMA 1HZHL 5K9OB 2IAMB 2UWEB 3LCYA 1N59B 4QOKE 1BJ8A 3FHAA 4WTXA 4CKVX 3X3FL 1EMTH 1UACL 4QRPD 4Y89A 1A6UH 5DVMA 1XIWC 4PJIB 3WMSA 1HIML 3ZSTA 1UG9A 4M7JL 4IBLT 3VRJA 2QQNL 4LIQE 3T77A 3MRRB 1FFOB 3VRLE 4Z7UE 2BVPB 1IC7L 2G2RA 4HUWB 2FIKB 1IGCH 5FM5M 5H94A 2UY7A 4DVBA 1AHWA 3TF7C 2HFEA 5JNYB 3HZMA 5F6HI 5ICZA 4LGPB 4GAGL 2VXUH 3FTGA 2GI7A 3O8XC 3WBDA 1HINH 2ZUTA 3BPOC 4I18C 4LBEB 5C0BD 1I3GH 5CEZD 1I8LC 4L8SB 1A4KB 5IKCA 1SYSB 4PTTB 1MEXH 4JPKL 2DDQL 3U9UA 2VSCA 2W0LA 4PJ5D 2D7OA 1QFWI 1JHTB 2GHWB 3D3VD 3ZTJH 2BNRD 3FO0H 4JHZA 4DN4H 5I8KH 3TBTA 4Y19B 1MIEH 4QRTA 3P77A 3LRSA 4U6VL 1OCWH 3ULVL 5CEXA 4JFQA 5E2TL 3BESR 4DZBB 2FWOB 1HXYA 2A6KA 3IFNH 2DYPD 5D7JA 2O5ZL 2Y5EA 3REWA 1KUMA 1EVTC 3D39B 3L7FA 4Y4FC 4YEFA 5LQBL 1D5BA 4Z7UF 2WQRA 5JXEA 4KDWA 3KPPB 4ZS6D 4X6BA 4X7DC 2VITA 2X4QA 1EO8L 4Z7OF 3CVIL 4NO3A 2Q6WA 3NCCB 3NCBB 3HTLX 4KAQH 4QXTA 5DUBB 2YC1A 4KRPD 1DLHA 4PV8B 4WFHD 1CGTA 5FUCE 4W4OC 4NZUL 4Z0XB 2RFXA 4XVUD 4WWKB 4F37F 4JKMA 1VENA 4NQSA 3UTOA 4ZFGL 4XP1H 3QWOB 5C9JA 3TIEA 3U30B 5IVZA 1DQDH 4H26A 5CBAA 1P4BL 4CVZB 3GBNH 4Z6AT 4HT1H 3TBVA 4PY8I 4H8WH 1HYRC 1FNSH 4NOBA 4YNYA 2ZWLT 3TM6A 5EU6A 5I9QC 1NGPH 3KHQA 1KGCD 4ORGB 4KZDH 1YUHB 1IC5H 1WIOA 3DGGA 3Q6FA 2AGJL 4GOSA 3LZFL 2R2BB 3QUMB 2BY1A 4AYFA 3IFLL 1YEEH 3ZKQD 2EDKA 4Q9RH 4GT7A 2EKSA 4YE4L 4PJ8B 2C3HA 5TPWL 1CD0A 1PZUB 4HUVA 3MV9D 3VXSA 2YD6A 3QXVA 4HS3A 1LO3H 5GXBB 2DQJL 4K3EL 4NRXB 5DJ8B 4MD4A 5GRXG 2XWJA 3VI3E 1UZ8B 3VW3L 4KTEL 1RPQA 4HD9A 2Y07L 3CX5K 4KMLB 1BD2E 4RFNB 4F8QA 3BH9A 1QQDB 3IJSA 3RVXD 5JHDA 4X5WA 4P9ML 1KEGH 5IFJA 2RB8A 4M4PA 5HPOA 3HPJA 5K9KA 2YMXH 3TBWA 4Y0GA 3ARFB 4LLMA 2PO6D 1FZKB 5LGKA 2K7PA 2IFGA 4QLRA 4UV4H 4OUOA 3MRHB 5CZVH 1INEH 3FQRA 4JDTH 1UWGL 2ADFH 4EVNB 1LD9B 1VFBB 4LLWB 1PG7W 2HKHL 4JN2A 4JAMB 4XVJH 4HIXH 1BVZA 3JVGC 2XI9A 1A0QH 5FB8B 2DLGA 3O6KH 1I9IL 1R5IA 2FGZA 4MJIE 1E28B 3OAYK 3VI3F 4P2QA 2AXHA 3MO1B 1X4ZA 5ACMA 5T3XD 1J0HA 1FORH 3X14A 1IGIH 3DROB 3ZKMD 4TTGA 1MF2H 1MCRA 2CLVB 3MXWL 3NACH 5FO9A 5IESL 2I9TB 2YR3A 1RMFH 3LEYL 5FV1L 4JRXE 4GS7B 3EW3B 2XZQL 3KYMA 4WJ5A 4L9DA 5JA9A 3RGVB 2EIZA 3DRQA 2BSED 4M3JA 1P4LB 4OM1L 4HKZA 5BO1L 3MRCA 5KS9A 2ID5A 1WAAE 3D18A 2HVKA 3R06A 2F19L 4XMKL 4ETQA 3MBEB 1G0YR 5JA8B 3WKNA 4PYGA 3ZT5A 5FCUH 5MEPA 4R4BB 4LGRB 2FBJL 1I1YA 3IDJA 5C08A 4OLUL 3B9AA 2X4NB 1DVFD 3A6OA 3WUZA 3BN3B 1F4AA 5ICYB 4Y8AA 2DMCA 1R3LB 3T0XA 1LEIB 4CADA 2ICCA 5EORH 5HJ3B 3NTCH 2Y06L 4PD4J 4YHYC 2PW2B 2CPCA 2ERJC 1PSKL 1F42A 1WTLA 1WT5C 2CR3A 1MJJB 4MVBD 4JO1L 5FGSA 1FFPA 1E4WH 4F9LC 5E6IC 4HQQL 5FO8A 3FT3B 2NY4D 3WIIL 1DN0A 1U36A 1QHPA 3V0AC 5ADPL 1CTNA 4HPYH 2VUOA 1MRCH 4UT6H 5DK2A 1WAAF 3SGKA 1VFMA 1ULVA 5J12C 1I9EA 3TESA 1JRHI 4JLRA 1MELA 3V52H 4NN6C 4CNIB 4AEHL 1BX2A 4HIEB 5JDSA 4X99B 5ETUA 3I84A 4CU6A 5MP6H 4AL8L 1A3LL 3RWGA 2GY5A 5MEOA 5T33L 1F6AA 4P5TD 2GAZB 5C92A 4Y16D 2HMID 3D85A 3MLTB 4OBRA 4PRNB 1TJHH 3HS0A 2BY2A 3MV8E 4PJ7E 3LD8C 4BH8A 3QNYA 1T1YB 3GSXB 1GAFH 1WC7A 5L2KB 4MJ4A 4AQOA 4JHAL 2CR6A 2YKLH 4KJQC 3FQNB 5DJ6A 1ONQB 5IF0A 4FQJL 4JFXB 2OK0L 2YN5A 2JJUA 4YHOH 4YFLI 3WUWA 1NEUA 1AGBA 1P69B 4H1LB 3K3QA 5FK9B 5I1CL 1X5LA 1JGLH 8FABB 4WUKL 2R0ZH 1ZS8A 1Q0XH 3TO2B 1MY7A 3X11B 3D9AL 1ZV5A 2JB5L 1HHJA 3RVVD 5A40E 2E8ZA 4PJ7F 3TH2T 3MV8D 3CU7A 1U41A 2XA3A 4XMLH 5I1JH 3SY0B 4TNVK 4TULL 4L4TD 1KFAL 5CGMA 5MHSD 3VD7A 1JHLH 4EDWL 1DBAL 2G60L 4JRYD 3L6FB 1JZ2A 4XWOC 5IW1B 4PRHE 1H3UA 3ROOB 4AEIL 3KPQB 5TQ2L 4U1KA 4WV1A 3NFNA 5H2BA 2F5BL 5E8EB 4ODTL 5AYUL 3RQ3A 4OTXH 2QADD 1R0AL 1OAYL 3HFML 1MCPH 5KVGL 4WW2C 2IPUK 2JF1A 5J1SC 1EERB 1I8KB 3MJ6A 2V2TB 2IBGA 4OD2B 5EN2A 3VFSA 2VOTA 4GRMA 4HWZB 2ZOLA 3PABB 1E6OL 3GSNH 3QUML 5EZJB 1INDL 4L4VA 4QNPE 5LVEA 1CDYA 4YDIH 3JUZA 2F54E 1KPRB 1ACYL 4LF3A 4OM0L 2G75A 5C0AB 5DK3A 5DURB 2Y7QA 1MCWM 4OF5A 4X9GA 2AXFA 5SWZD 4GW5A 1MHPL 4NQDA 3PIQA 4N90D 4OIAA 3EYQC 3K0WA 5ICXA 3ZDXE 4KK6D 5D1ZA 4LMQI 1JV5A 2IPUG 4HXBH 4GRLA 4FG6C 3TJEL 5GRUH 4UNUA 3UTTD 4L3EE 2A77H 1A2YB 1QSVA 5JQ6L 5E8OB 4LAQH 3OMZA 1JL8A 5F70A 3B6SB 1HHKB 3GSNA 5E5MB 1URLA 1A7PH 2JK5A 4X7EC 3V0WH 1R6VA 3LKSA 3BZFB 1WUNT 3FFCB 1WIUA 4ZPTA 4TUOA 4XP6H 5I1GH 3HCVB 4PP1D 3FOMA 4B0MM 5KW9H 4QNPF 4HGKC 1RSFA 4ZAKD 3DX9A 5J89A 3PWLB 1FNEA 2CKNA 5CZXD 4AZ8A 1QR4A 2HAZA 4NOFA 1NCUA 2IG2L 2JIXD 3PDOB 3BN9D 2NY2B 1EO7A 3RWJB 1KCSL 2D4FA 4E41A 3L3GA 1GZPB 2H9GB 1JCKA 1T7WA 3EO0B 5DMIH 3ZDXF 5ADOL 1ES0A 2VB5A 2HYMA 4NJ9L 4Y1AA 3U0PB 5ERWB 3KR3H 3QIWA 4N9OB 1G7MA 1KIPA 4N8CL 4WI2A 4K23H 1NFDB 5F6HJ 1YPZA 1R3HA 2C1PA 1AD0B 4G80A 3L9RB 3RTQD 2QQLL 4LFHG 2X7LA 4LHJB 3MLUL 3MR9B 1O7VA 4PBVC 5DMKA 5DSCB 3MRKA 3TYGH 4LLYA 1AGEB 4HWUA 2P45B 3QFDA 1MIMH 3CDFA 5EIQA 2OTUA 1CGSH 3FO1B 5I75B 2VLLA 2DD8L 2R29H 1Q8MA 3PWNA 4GAYA 1GOGA 4DTGH 1F58H 3VFGH 1FLTX 2YN3A 5GQBA 2IJ0C 1FN4B 2VL4A 3H3PH 4G8FA 3KXFA 4LRNH 4TSCL 5D93C 2V5RA 4L8BB 1FPTH 3GIVA 2W0FB 3JWOC 1QPXA 4XP4L 4PRIA 4KK5D 5TE7H 5JW3L 4JQXA 3J8F7 2PXYA 3UZVB 5HY9B 3FQUB 3JWDC 1QSEE 2HN7B 4MSWB 1HNGA 1Z5LA 3MUGA 4AMKH 3NA4A 1JF6A 4TNVF 5I8OH 3ARGC 1KCRL 4FABH 1GGTA 1A1MA 5FYKH 5F7LB 4PJBA 4D94A 3P0YL 1DUYA 4RMWA 5DFVC 1XF3A 2X4TB 4NZRL 4F7CA 2NY5L 3W9DA 3CX2A 5BRZA 3I6GB 3E0GA 1RIVL 1B9ZA 1MJ8L 4IRSB 1DQLH 4HBCH 1NGQH 1IARB 4PY8J 4GJTB 2CKBA 5MEND 2VDMH 4LCWE 4ZOEA 1BFSA 1EBAA 5T1LB 1XF4A 3KPRE 3PWPD 2X4QB 1QSED 1ZLSH 1N0LA 2P8MA 3T0AA 5ISZD 1A3RH 4KK9C 2YC1B 4DVRL 4OV5A 2EDDA 4XPFL 1FJ1A 3O45B 2VDQH 5CEZH 4WI3A 2WIIA 4P5KB 4QRPA 5F97E 4I0PB 1U8LA 3PGDB 1OTTC 1S5HB 3SKNB 2MTPA 4KKBD 3TWCH 3VXUD 4P3DB 5CBAB 5I8EB 5I19L 1Q9LA 3GHEL 3G5VB 2J8HA 3A6BL 4APQB 5E94B 2K7QA 2W59A 4Y4HD 1KYOK 1U6AL 5IBUB 4OF3A 5EZIL 5EIVA 2XG5A 5FHBL 5HXMA 3DVNA 1F8TL 4DCQA 1Q72L 4LIQH 3QCTL 3QIBD 4LCWD 4P23D 4Z76A 4YC2B 5C0BA 2ARJB 4OGYH 2NX5B 4LFHD 4PD4K 3KPRD 4Y2DD 3Q6FB