2ZOLA

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
273
structure length
258
Chain Sequence
PHSMRYFETAVSRPGEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 62
structure length 258
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zolA01
2DM2A 4D2NA 1OGAD 5SWQA 4M7ZC 3C5ZA 2QKIA 4YGAB 1QLFB 4PLNC 5D2LB 1KEMH 3BPCB 2NY1B 4KRLB 1MJ7L 25C8L 5GHWH 3FFCA 4BSWB 4U2ZA 4R26L 1IM9D 3FB5A 4ODVL 3GBMH 3KPNB 4Y19D 4J4PA 1JHKH 1Q94A 1TJIH 3P2TA 2JCCA 4U33A 4NQUA 2Z8SA 4NWUH 2RBLA 4GT7A 3HNVL 2CJUL 4GMSL 2ZUXA 4FQIL 3SPVA 1CN4A 4OI8A 5EORH 4MZ2A 3UJIL 1A3RH 4KKAC 4YHOH 3CFJB 1GC1C 4Z0XB 5TF1L 1Q0XL 4W4NA 1CF8H 4G8FB 2QHRL 5GJTL 5CMAA 5F9WC 1U8KA 2C4XA 2GKIA 1DFBH 2DLHA 1K4DB 4YHIB 2A6IA 2ICEB 1QSFB 4OZ4B 3PXHA 3RVWD 2Q7NA 4QT5A 2DJ4A 4XCCH 5DUPH 2NY5C 2VL4A 5DUPL 3K1DA 4M93C 1Q94B 2I5YL 3GSOA 3MRQB 3PQYB 1UM6L 1M1SA 1MH5A 1ZA6B 2HKFH 3U36B 5MHSD 5CS7A 3ZLQC 5FOBB 1IEAA 4KTEL 3IB4A 4N8VA 1CLYH 2G2RB 3ZE0F 1B0RB 4Q6IA 1R6VA 2BMKB 4F3FA 1TVBA 5I73B 5HDQL 1I8LC 5SWQB 1S9XA 2IBZY 4PJCF 4HCRH 1MHCA 2BVTA 4XP9L 3PHOA 2CQVA 1HDMA 2H9GA 3QUML 3N1QC 2XWBB 4KZDH 5LGHH 2WUCH 2ZOKB 3RGVA 3DO7A 5J0BA 4KU1A 2MNUA 3TN0A 3O2VL 1DN0A 4EUPG 4D9QE 4GSDL 2D03L 3P9LA 4WUUB 2IPUG 1NFKA 2ADFH 2OJZH 1V7MH 5B39A 4WHYG 3KYAA 4L29A 1I9IL 5DLMH 5CHNA 5F3HB 4IBLT 3RTQD 1MPAL 1M6OA 1J8HA 1DBJH 4PY7A 2YBRB 1PFCA 2EDYA 3SGJC 1OB1A 3RZCB 4EBQL 3CFBA 2EH7H 5FO9B 2PO6B 4OV5A 1AGDA 4NN5C 5IQ7H 1C12B 3NZHH 1PY4A 4HMEA 3MFFB 4RISL 5DMYA 3HPJA 5DK2A 3G9AB 5CWSB 4P4RA 4Y4FC 1KBGL 1PVHA 5D7LA 1PZUB 4NWTL 4L9LA 1Q0XH 3I9GL 1NJ9B 2BXZA 5DJCB 3U9UB 1LILA 4LCCC 4MJ6A 4LVOB 3KPTA 4KI5F 5KS9B 4XX1E 3TO2A 3R0MA 1MCJA 4PUBH 4EEEA 1KCKA 2GJ6B 1BEYL 2YSSB 1YEHH 4WFHD 3RDTD 2VXTH 5DHVB 4CMHC 5BO1H 4TVPE 3VA6A 1FORL 1Y6NR 2DMKA 2A77L 3AUVA 3LIZL 4KY1L 5LCVL 4FQJH 3VFGL 5KVGL 4NBXB 3IDIB 5SWZE 3GSUB 4NUGH 5FAAA 2RCSL 43C9A 3MRGA 4Z76B 1FGVH 2X4OB 2H26A 5INCB 3DBXA 1P5VA 1Y0LA 2P43B 3FO2A 4JDTL 3OHXB 3C9NB 4FS0A 2YD1A 2Y6SC 3DUSB 1I7UB 2D7MA 3NCBB 3MRFB 3AMKA 2GY5A 3GJFK 3H9SA 3P9LB 2E6QA 2P5EB 2AJUL 3WXVH 3JSSA 5L7XH 5ESQB 5MENA 5IJKA 4WTZG 5D70H 1ZT4A 1CIUA 3PWPA 1FCGA 1FFOA 4R4FH 1CDYA 1Q72L 2M2DA 3SKOB 1YZZA 4OM1L 4MNGA 3BGMA 5DZLA 2BRQA 4R97C 2NX5A 5IB4B 4LK4A 2ZUVA 2B1AH 4M6NH 2Z9TA 5KW9H 2VDLH 4APQD 1CWVA 4UB0H 4QHMB 1G7MB 2IQAA 2OXGA 4N8VB 1U8QB 2QHRH 1I4FB 3H6JA 2ORBL 3DX9A 1JRHH 3MCKA 5IEHA 3MRLB 1S5HB 3IS0X 2GITA 5EORL 3SDXB 2BVEA 3SKMB 4FQIH 3U46B 1OAXL 5I1DA 4OKDA 1T2QH 2A0LC 3IRZA 1MFAH 2X1QA 3RY4A 3BP6B 2R8SH 4QTHA 2Z31C 3C6LA 1HHHB 4G8FA 1ZS8A 2NTFA 5DVKA 1QHPA 1NEZA 3BO8A 4YE4H 1HQRB 4Z18A 3FFDA 1CK0L 1XCTA 2AKRA 1AGCA 2CO7B 1WCQA 4P2QA 4CDHA 4JM4H 3LH2L 4FFWC 4X4XB 5GGSB 2B1HL 4G80A 2GJJA 2Q3AA 2HTKC 3UDWC 3FFCB 4BSWA 4NZDA 2GJ6E 2IADA 4KK8D 4KHXL 3E6HA 1ONQB 3UMTA 1N5YL 2DIBA 2NZ9D 3CD4A 1X6NA 5I1CL 5E8DH 1LWRA 3P0YL 3TBYA 2BNRE 4MB3A 2WQ8A 4BM7A 1XGQA 5DJ0A 4AEIH 2KDGA 1NMAH 3V5KA 3U0PA 3KLHC 3MLTB 4YPJA 3L7FA 4L8DB 3QB7C 3V4VL 1T4KB 2NY6C 5FK9A 3ECBB 3MCKB 3V6FA 1P53A 3BQUC 3UO1L 1XFPA 4OIIL 1F3JA 3GMMA 3P0GB 3HE6B 4Q9CA 3OKOA 4PRBA 3ARGB 4LPYA 3PNWB 5CD5C 4Z7WB 4PJBE 5BW7C 5KSAC 3FCTB 1EO7A 1QO3A 4JQVA 2UYLB 1C5BL 3SO3C 1A5FH 4KI5D 4J2XA 2HAZA 3MA9H 2G60H 4DN4L 2VLRB 4HV8A 3DHJA 1G7HB 3O45B 3IFNL 1OCWL 3V8OA 3QDJB 5D7IF 5F7WC 2P5EA 2ICWB 2VIRA 2QLVB 3RI5K 4F15C 1NKOA 5B8CC 1ZT7B 3GJFB 4JFQB 4MA8L 1DUYB 2CK0L 5DMGD 5IMOA 2FD6L 4P2OB 1MHPL 2NY1C 2X4UA 4BQ8A 3LKQB 3R06B 3FO2B 4YHLH 4S1DD 4WW2A 5BCAA 4U3HA 3TEUA 43C9B 1L7IL 1OSPH 3PHQB 1JGEB 5BRZE 3CU1A 3OPZL 3CSPA 4XMKH 5I8OL 4HJ0C 4HIIB 1EH9A 3BFOA 1QFHA 4HH8A 4O2CA 4PJHA 4R0LA 3S8WA 3BP7B 2VNCA 3O0RH 5ISZB 1INEL 1I3GH 5DT1H 4UZGA 3ULUD 4MVBA 4OCRL 5MI0B 4UT9L 3OGCB 1CDCA 3WIHA 4RIRA 3HZVA 3LKRA 5FDWA 2LTQC 5KS9A 4LHJB 1C08B 1CDBA 4PJDB 4HPYL 3MV9A 5BQ7B 1KXTB 3IJYB 4AIZA 2PO6D 3TJHD 5D4QA 2V9RA 1CT8B 1JUFB 4FABL 1IKNA 4NKMA 3MRKA 3LQZA 1EO8H 1C12A 1FZMA 3QXDA 5CINH 5DTFA 5FO9A 1OB1B 1F02I 3CX5K 4PP1C 3VWKD 4HXAH 3RZCA 2ADJA 3GO1L 3KPOA 3JTCA 1JYNA 3ZDZE 3KPMB 4Y16A 1CBVL 1N0XH 3EYOB 4NYLB 1KB9K 4UV4H 4OUOA 4K8RH 5DHYB 5GS3A 1RIUL 5JXEA 3ILQC 4YH6A 4P3CL 2IPKB 5I75B 2P8LA 2X70A 1GGCH 3QDGD 2X5PA 4BSVA 2XN9A 4LLQA 3AM8A 4U7MA 1AGEB 4D3CL 2C7UA 3GSVA 3NCYP 3QWRD 1A9BA 2BNQE 3V7AE 5I71B 5IWLC 4HIXL 1BIIB 1BQUA 5FM8A 5JLZB 4JJ5A 2VLLB 4PV8A 1LO3L 1CI5A 5EH1A 3EOAB 4OCLC 2VLRE 4LRNL 5DJ8A 3LD8C 2DQTH 5AD0B 3F12B 2H9GB 4M1GL 4XP4H 1HIMH 3PHOB 4DN3L 3O3BB 2P5WB 3LVEA 4M7JL 4PJEE 3VGAC 2BJMH 1TVBB 3AB0B 3WL9A 2ZUSA 4U7KA 3DSNA 3QT2A 5DVOA 1T83A 4PPTA 2VH5L 5IB1A 1G7QA 3TA3C 5BMFL 3C2SA 1K85A 4TRPH 4XP6H 3OL2A 1T04B 3T4YA 1T6WA 3LPGA 1QBBA 1HXYA 4CADB 5CSZA 5FIEA 3OR7B 4NPYB 3PWUB 4NHUE 5GS1A 1FNFA 5JPMA 4MNQB 2VL5B 3QAZC 4MVBC 5CMAB 1T5XA 4LCUA 2HT2D 4LLMB 1P5UA 3I50L 2EXWD 5C2UB 3HB3C 5IBTL 3X3FL 5CEYB 1RSFA 1IEBB 3VH8G 3NH7L 2DICA 3GSXA 2I9TB 3PWVA 5FECB 4PJCE 3T04D 1EMTL 3PDOB 4WV1C 5D1QD 1W8NA 4PJ7B 4IOFD 1WBXA 2F5AL 4PJDE 5E8NA 5F89B 3VWJB 3LQAL 4M1CC 3TV3H 5MP6L 1LP9E 4P46A 5JQ6H 2QKIB 3DVFA 5B8CA 1IAIH 1U8LA 4C56E 3BSZL 3O11A 3VI4E 4MAYB 1A6WH 5H8DA 3PP4L 2FJHB 2R23A 4RRPA 5I15L 1FVDA 3KNBA 1BVLA 1RFDL 2XA8H 3PJSA 4GRLB 4ELKA 4M1GH 3DV4B 1JPSH 3C60B 3QQNA 3VD4A 3GZKA 1TETL 1JBJA 3REWB 4IOFC 1YN7B 3TNNA 5FHBL 4PJIA 3L9RA 4U05A 1BQHG 4ACPA 1Q9WB 3WJJC 5GGVY 1A1OA 4XPFH 1N8ZB 1H0DB 4R7DB 3GRWA 3K74B 4GFTB 1VADB 5JZ7D 2PYEA 4KI5E 4OGZA 1Y18A 3QH3B 1YQVL 3CLEH 4XT1C 5DWUH 5EU4A 2Q7YB 3QDAA 2P46B 3L5HA 2A6KB 3K2UL 3DX8A 5ESAB 5E2TL 4O5LH 3BE1L 1MCRA 5A43C 4PB0L 1BJ1J 4O4YL 5EIVA 3EFFA 3FT4B 5IW3A 2L7UA 2W0FA 5C07B 5T1DL 5E7FA 3ARVA 3D0LA 5A2KH 4HK3N 1YY9C 4I3GA 4RSVA 1S7XB 1AH1A 2VYRE 4D0CB 5GXBB 1MQ8A 1PSKL 1IAKA 1PYWB 1ZTXL 3N85H 4CVXA 1LGVA 2AK4D 3G6DH 5HI5C 1H8NA 2A1WH 1NGZA 5C0FB 4FABH 4LPWA 5IK3A 2ZJSH 4POUB 5GIRA 3D39A 2IWGA 4AEHL 3CFIC 3EYSH 3S36H 5DFWH 4UTBL 3Q6FA 5DK0B 3MRDB 5HHOD 3D18A 4PD4J 4WHTA 4KRMB 1MY7A 3WUZA 5KSVA 4KPHL 3C2AH 4A2MA 2QQLH 5EO0B 2Z93B 3NCEB 1I3GL 4ZFZA 2YPKB 4BJLA 1TIUA 3IYLW 2Y9RT 1VERA 3MRJB 3PQYE 1K4CB 1CD8A 1F6FB 3D18B 3O2WH 5CLWA 4JN1H 2BOBA 5GSVB 1HH9B 4LGPB 1PZ5A 4X7SL 3MV9E 4U1KB 5IFHL 1NL0H 4XWOD 5B38G 1KIQB 2FX9L 3O6ML 3V5HA 1FFNB 4LKXB 1UFUA 1QEWB 1P1ZA 4JFEB 3ABZA 1ZLUH 2EO9A 4W4OA 3MR9A 3LOWA 4LSTH 1UVQB 2RIKA 2R39A 1NCUA 3TZVA 2XRAL 4JGJA 2EECA 5KVDH 2AGJL 3TPUA 5BOPA 1URLA 2VLRD 1EK3A 4F15B 5CP7B 3MODH 1YN6B 1QPPA 3GUTA 3V5DB 2FCBA 3KLAB 1CDHA 1NGWB 1UEMA 2XZAH 3SDDD 5HVWA 1FNGB 3W2DH 3P30L 3QDGE 2V2XA 3V6OE 4K3EL 1INEH 1YPZA 1CFSA 4HIHB 1HXMB 2AJVL 2I07B 1J1XH 1M05B 1X3DA 2AABL 2VZTA 3BJ91 4G6FD 4RAUA 4AT6B 4UIKL 4MXWL 1RURH 5MEND 1MFNA 5MEQB 4NO0A 4PJEA 3SGKA 3VDBA 2W59A 4MSWA 5I1CH 1T89A 4X6CA 3QI9B 2VUOA 4Y2DC 4Z7QF 1U8LB 4FQCL 4QY8A 1T2XA 3LKNB 5D2LE 4O9HL 5GRVK 3TYGH 5BV7H 2BVQB 2X2YA 3BIBX 1UZ8A 1ZV5A 1XGTB 1PG7L 1GL4B 1F4WL 2ARJQ 2IALA 3MOAH 4OQTA 1WWCA 4LCWD 5HPMB 1J05A 1A9EB 5I18L 5JXEC 3GBNH 4PJHE 5E6IB 2R0WH 1NBYB 1XGRB 3RJQB 2A6JA 3NVQA 3DV6B 1A3QA 5T5FH 1IC7L 1PKQA 4XBPA 3RVTC 1IGYA 4P2RE 1DBAH 3FZUC 4FOMA 4U1IB 1D6VL 4BQ6A 3KJ6H 3D39D 1WEJL 1A9EA 2B4CL 3MGTB 5JW4M 3KYMB 1L7TH 1AQKL 2BC4A 5EN2A 2P42B 5MEPA 1NSNH 3DX6A 5F93C 3L95B 5E24E 1PG7X 3M17B 3ROOB 1M4KA 1RIVL 1UZ8B 2VE6B 1T04A 3SQOH 3T4YB 1ED3A 1MWAA 3A6BL 4XBGB 5D6CA 4Y4HD 2XG5A 4YDIH 3KPPA 4U6TA 1RAMA 1G9NH 2VDOH 1U92B 3C87A 2F74A 4Y4FD 4RNRB 3AFLA 5FYLE 4KQ3H 5SV3A 1FAIL 2O5ZH 2FLBT 3EIFA 4I0PB 3GNMH 3JXAA 1P7QA 5CKAA 4ONGL 2P45B 4M1DH 1CE1H 2HLFD 5HHVH 43CAA 1HHKB 3SGJA 3LD8B 1UT9A 4Q0XL 3PWNA 5F9AC 4EN3A 5GISH 2VLMD 3EDJA 4S0UC 3OKMA 1G9MH 4Y5YB 3BYTA 1U8MB 3OF6A 4HXBH 1VHPA 2JB6A 4C56D 3MLVH 5CZXC 1AGEA 3PDGA 1U91B 3QNYA 5BV7C 1KELH 4X6EB 1QFPA 5CP7A 5BRZA 4PP2B 2R56L 5C0GB 1FBIL 3EOTL 2V17L 3KYNA 1XCQB 1W0VA 4YHYB 3N1MC 1RIHL 2PXYC 3T4AB 2X09A 2ITDB 5D1QC 1NSNL 3RGVC 3UCRA 4RMVA 5CZXD 4LGRB 2H41A 4YWGH 3UJJH 4ZFOL 3HS0B 1NCWL 3WFBL 2YRZA 2YR3A 5E8PA 4XB7A 3H7LA 4CAGA 3TBTB 5BVJA 2PYFB 5T3ZH 2ARWA 1ZLSH 1SEBA 4Y0GA 4GLRH 5BZWB 3FQXA 5AAWA 1CD1A 5L88L 4OFPA 5GSRB 4N9GB 2V5TA 5F6HJ 1DBBH 4OZFH 2RFXB 4NSKB 3WIFA 3TBTA 4H8WL 2XOTA 1WJ3A 4H0HB 1EA9C 4G8EA 5IUSA 1JZ6A 1Z3GL 4JO1L 1WZ1L 3UAJD 1BOGA 4FFEX 2MKWA 3MYZA 3GI8H 3JTSA 2AJSH 1HKLH 3QCUH 4Z7WF 4IRJD 4WFED 4ZS7L 5GRJL 2FATH 1P7HL 3BMWA 3QXAA 4C58B 3ARBB 4RA3A 1DSFH 2V2WB 3OX8B 5TFSL 1EFXD 4QHUA 1N0LA 3BZDA 4K3EH 1J0IA 4NDMA 4JFYB 4PP2A 3ORJA 2GI7A 3GKWL 1IM9A 4JHWL 5E9DA 1MCDA 2B2XL 3GKZA 5IVOA 4K94L 1FYTB 3U4EA 2MQ0A 1JTOA 1ZHBA 2P24B 1HHIB 3UTTE 2OI9C 3X17A 3L3KB 4PBXA 3H3BC 1TQCB 4U1HB 1QSEB 1PYWA 1NMCC 1CLOH 4M62H 1QFWI 1V5JA 3MLRL 2CKBH 4PJ5D 2JJWA 3RZCC 4FQHA 2ICWA 4JVUA 3O2VH 3C5SB 3PWNB 4NN5B 3NIDE 1DBKH 3RX7A 3ZDXF 2OX5A 3IU4L 3QG7L 4JR9H 3CH1A 4YHKH 3QEGH 5L8LB 5C07D 5SWSB 1C1EL 4LVEA 2EIBA 2VC2H 4FFYH 3WSQL 4X9HA 5DSCB 4M61A 1QO3B 3VI3E 4D9LH 3G5YB 3FCTA 4ZO8A 1WBZA 5KN5A 1HK6A 5LJYH 5FOJA 15C8L 1H0DA 3KPPB 4G42B 2J6EA 1R3KA 1OM3H 1AO7E 2DBJA 2VE6A 4F7CA 4HD9A 4JRXB 3GMMB 5FYKH 1MCCA 2FX9H 3O6MH 4ZAKC 5HDOA 3NIGE 1MELA 1YQ2A 4FN0A 3L95A 4QYOB 1LQVA 4DCQA 2HKFL 4FTVB 3V6FB 4R4ND 4ELKB 1KF9B 4MQ7A 3VWKA 5F71A 4I9WE 4AIXA 4G6KH 4WHDA 4MNQE 3C60D 3CC5B 4D3CH 1X44A 3DMMA 4MAYA 3CDYA 4K9EC 3FL7A 5JO5A 1FZKA 4KJYB 4HEME 2M1KA 4M7LT 3TIEB 1LEIB 1HZHL 5EWIL 1YEJL 1ZLSL 1VACA 1M7IA 1FNEA 2YD3A 2ZUTA 1ACZA 5DRWB 3I2CL 3IDUA 3HA0A 3TH3T 3VFNB 5I1AB 2ATKB 3K8MA 4PJ7E 3D39E 3BPLC 1G9NC 3BGAA 5BZDB 3ZE0E 1MCLA 3TCLA 4NZRH 4W6YB 4ZFOA 1G6RL 1XGYL 2BY2A 1EUUA 2GTWA 2GT9A 5F9JB 2WIMA 2A1WL 5C9KA 2NTFB 2LU3A 1TCRB 3T0BA 1VFBB 4NO0B 4X9IA 2JJTC 2BCKA 5AAMA 2UUDH 2VL5A 4DFHA 2HT2C 3FRPG 3JWNC 5D93B 2CDGB 1HXMA 2WWMC 3IAGC 4JCMA 4UQ2B 4QXTB 2WUBH 4HWZB 2PTTA 2ERJC 4ZUUA 4ONFH 3D2UD 4YHMH 4MYWB 2NX5E 3O9WA 5M94B 2VLME 1JGVH 3U0TB 1G7MA 1IGIH 2IQAB 4XCCL 3QHZH 4PJBB 5E00A 4WJ5B 3H42L 2Y6SD 5MERB 2IC2A 3ZSTA 2NX5B 4Y4FA 1OAKH 4LCIL 2SEBA 1NGXB 3LS5L 5I19L 3ALXA 5K59F 1MVUA 4HUWA 2XICA 5J12C 1GGYA 2EXYC 2F19H 1OT1A 5FV2A 2PCPB 4JZJA 4LPXA 4NCDA 4U1GB 3HNVH 4HAFA 5F1SA 1QPXA 4UAOB 4R4NC 4LHUA 1ZVSB 3HMWH 3NA9H 3Q5TA 3MXVL 3VFVB 1A9BB 4M7KL 3KJ6L 2DJSA 5FKAA 3JV6A 1YNTB 3NFNA 4WIQA 2F8VA 4RAHA 1N59B 1JE6A 4K9EH 3Q3GA 3QXUA 1MAMH 5E8EA 2EDRA 3KAAA 3D25A 1CLOL 5DDHA 2WAHA 2WINB 3IDIA 2AJ3B 3B3IB 3EYOA 4LCWA 4GG6E 4XCNA 4E42A 4PJXE 5HI4D 3T0DA 5L2JB 4F2MB 1R5WA 3MRIA 1FLRL 1MI5A 4UOJA 4QXUH 4CBPA 2OLDA 5A3ID 1JUFA 4Y5VB 1I8LA 4BFEA 4NC1C 4HQQL 1Z5LB 1MRDH 3MRDA 1A0QH 3WLWC 2V5YA 3JUZA 3RPKA 2YUVA 1BQLH 5T1MA 3LSOA 3D39B 4M5YL 5FYLD 2Z92B 1C08A 4BSJA 1NBZB 5KSAB 3SJVD 5TH2B 1XR9A 4JAMB 2BNUB 3GGWB 4YEEA 5C2BH 2NNAB 3MUGA 2XIDA 2EDXA 4QRQB 2ATPB 4PJAA 2GIYA 2X41A 1NBQA 1KSRA 5E6ID 1OP5K 4LSDA 2B1HH 4G3YH 4H5SB 3TJHC 3MFFA 4C57C 5FYKU 1I3UA 2VLKE 2AEPL 2EDBA 4CU7A 1FO0A 5F6IB 2AJYH 3DX7A 1BJMA 1T03L 2LU4A 3BESR 4LRNH 1OW0C 5D2NB 3DX8B 4RGOH 1NAMH 3WUWA 5IW6A 4WVRA 4OUUA 3TVMB 4FXGA 3ULUE 4WENB 3IVKA 5IB3A 5KSBF 2OSLA 2FYYB 5DD6A 1G0XA 2NQCA 4NO5B 1AXSB 1PJ9A 4KTYA 3ZL4L 3OXSB 3ULUF 4IM8A 1FBIH 4ZDHA 1BQHB 4JKLA 3MNVA 1S7WA 1IKFL 2PR4H 3HRPA 2VN7A 4MCZB 2AV1B 1AR2A 5IEKB 3T0XA 4UB0L 1RIUH 3S98A 1REIA 4TUJA 4HS6B 4HLZH 4NQDA 3BPOB 3P11H 4JG1L 2Z31B 3O11B 2YUZA 3A67H 1MI5D 4Q9QH 4PRHB 32C2B 5KSAD 1R0AH 4MDJB 1U8JB 5JW5B 3OKOB 4PRBB 4Q6IB 3CVIH 5GRXG 5D70L 1W0WB 4U1SA 4PRPB 3DETD 1QLEH 1T7ZA 3HB3D 2X40A 5DUBB 1Z2KA 3PDOA 3IXTA 5FGSA 2I9TA 3GSXB 4X6BB 2BFVL 1JZ4A 4P5MB 3BD3A 3HC4H 2R9HD 2H2SC 1A6UL 4NQTA 3BHBB 4KI1A 1CZ8H 1TVHA 4Q6YA 3VMNA 4Q9RL 3RA7L 3SDAD 2ZJSL 3E6HB 1XMWA 1HSAB 4GQPH 4FFVC 5D5MA 2ZKHL 3MLWH 2OMNA 1L7TL 1SM3H 2NY4D 1I9JL 5DGQA 3O0RL 1QSZA 1XR8A 5K9QG 2H2SD 3BPNB 2G9HB 3QFJA 5CBAA 2MCPH 3O8XD 3MXWL 1JZ5A 3A6CH 3OPZH 3VFTA 3OWEA 5C09E 3WNLA 4NQCB 3IFLL 1TQCC 2A38A 1G7JB 4MB5A 4ZD3L 2YN3A 3OJ2C 3VRJB 4TSBL 4LMQI 2BZDA 4OB5H 5HYJE 2BVUA 2D31B 2PN5A 5HBBA 3MLPA 4L4VB 1B3JA 1X7QB 2WSKA 4U6YB 3EJZC 1PBYA 4MHHI 4UV7H 3QUYD 4M48L 4WUUE 4JJ5B 3NGBB 2G60L 4DN4H 4I4WB 3DVGB 2DDQH 4JPVL 2F54E 4M8QA 4WW1A 4MQXC 2YXFA 4P48A 5E6ZA 4NFCA 4JPIA 4X80L 3RNQA 4NM8H 3MGOA 3JTTB 5KBNC 1ZHKB 1MCPL 1XF5A 4HK0A 2UV3A 3WFEH 4ZXBA 3X12B 3SCMB 4I18C 5B4MC 4MNGB 4YDKL 5B3JF 1LEKA 3T0EB 1V3KA 5I76A 1DEEB 2Q6WA 1MCKA 5FCUL 2X89D 1CGSL 1UM4H 3G6JE 2YPVL 1ZLUK 3D9AL 4OLWH 1I7ZA 4Y16B 1T7VA 1JHLL 2D31A 3C8DA 4JQVC 5LG1A 5BOZG 2JK5B 4OLVL 3LEYH 5D1QA 1X5YA 3EJYD 4FQQB 1W2KT 4FQLH 3EGSB 5DR5H 4S2SB 3U7YL 3MRKB 4NKMB 1IGTA 4X4MA 2Y06H 4E5XA 4HQQH 1JNLL 2BVOA 5E5MB 1UWXK 3B9VA 2DLEA 1PKOA 1WUNT 3V7MA 5DQDH 1HH6A 3EYQC 4PB9L 3ULUC 3B6SB 1D9KD 4MD0B 4MD5B 1EUTA 3KDMA 4G5ZL 4JY6A 4GKSA 2D7QA 2GFBA 3L5IA 1CLYL 4Z77A 2DI9A 2C5DC 4RMWA 1FSKC 3E0GA 1CK0H 2NXYC 5C0IB 3L5XH 3GSNH 3U2SB 1S7QA 4XPHH 2I5YH 2BHYA 3DGGB 4PJHB 5TPWH 1A7RH 2YSSA 5D7IE 5F8QC 4X9FA 5LXGL 2WV3A 1QD0A 2E7MA 4ZO6A 3FB8B 1IARB 3FRUB 2OMBA 4DFIA 4MCYA 2Y1VA 1D5XA 4P23A 1BQSA 3HRZA 2F5BL 4M7JH 4NBZB 5I75C 4XC1H 5IBUB 3I75B 4H0GA 4X7DC 1I9EA 1JRHI 4TYUA 3EO1A 2NZ9C 1TJHL 1JPSL 3GM0A 5JW5A 2DQEH 4KJQD 4RGNE 4AENB 2C1PA 1J18A 3ARFC 1OQXA 4JFQA 3GMOA 4LPUA 5D71H 2GQHA 3OKKA 3RWFA 5CD3B 5E9DD 2V2TA 1KTLB 1Q9OB 4PY7B 5EU3B 5I1JH 3ISWA 5DMKA 5C0JB 4EUPH 1QRNE 2OM5A 3WFZA 4QRRA 5JDSB 1MCFA 3IJSB 1WIUA 4IRJA 5IBUG 1CGYA 5FYLL 2DQFA 1FFRA 1ZTXH 1EEYA 3QEUB 4UAOC 3U6RA 4W4OC 4ZAKD 3QRGH 1ZA3A 4G5ZH 2IBBA 1UC6A 3VXME 2IANE 5HJ3A 3DXAA 2QQNH 3SE3C 2Y07H 3MBXL 4ODWA 3GO1H 4ODXB 4WUUA 4QRUA 3QUZD 4PRNB 1J5OH 5FA4A 3ARWA 1HNFA 2WBJB 5I74B 1T1YA 2VUYA 2DQUL 2DYPA 2X9YA 4KROB 3I6KB 3QEQD 4IRSA 4QO1A 5DWUL 1MFEH 5E70A 4XVSH 1AC6A 3V5KB 4NUGL 4UINL 3VG9C 2Y36H 4LVNB 3VFMA 2JIXD 4RZCB 4UIMA 3LDBB 5IG7B 5JHDE 3TBYB 4H1LG 3D3VA 3UTPE 1HEZB 3LEVH 1YEIL 4M6ML 3VGDA 1AHWC 3VRJA 1T0PB 3VCLA 1UB5B 5C0BB 3WE6B 2FJGA 3TFKA 1GZQB 3BKCH 3TBSA 4HDIB 4V2CB 3U4BL 2BSED 4G80B 1DANU 4PJAE 5L6YL 4WV1B 4N90D 5F6HI 3VFTB 1FL3A 1CGVA 3DGCR 1AQDA 3R1GL 2AVGA 2X9XA 4QT5B 1XCTB 5KTEL 3FFDB 2FEDD 4OZ4A 4TUKH 3BO8B 4IRZH 3DYOA 2XTJD 2FO4B 4YBHA 1HSAA 3F8UB 5D7JD 3UTZB 1PQZB 2OJEA 3SE8H 5FYKL 3PHSA 2F5AH 3EJYC 3WLBA 4XCNB 4E42B 3BKJL 1BAFH 4MAYC 4JANA 3TNMB 1A14L 4KKAD 2AJ3A 3B3IA 5FEBA 3FONB 3SOBH 4CVWA 5HGHB 4FHBD 1QR4A 5IVXA 1FG2A 5I8KH 5ILTL 4IHOB 1KENH 2CMRH 4XXDB 4GAGL 4KMQA 1F13A 1K5NB 3AU1A 4Z7WE 2FR4B 4PRPA 2EE9A 3NFNB 2WUBL 1IGFL 1U8QA 1WZKA 1UH3A 3C6SA 1CGTA 4QHMA 4XAKD 3QXWA 4MDJA 1SJHB 3QEHB 1CBVH 3TESA 2P48B 5IGXH 2EE2A 4CJ1A 1QACA 3RIFK 3F7PC 4NQDE 1OW0A 2CRMA 5F7NC 2IAMA 2PCPA 4OF8A 3BWAB 5CEZE 2RR3A 1JNLH 1YEFL 2CGRL 4UUJB 4J3OC 5KZCB 3K81A 5GGVL 1EHXA 1U93B 3NA4A 1C8PA 2AEIT 3UXFA 4TULL 4JM2B 5ACZB 2YWZA 4X9GA 4X98B 3HNTH 1AXSA 2XZQL 2CDFB 3D85A 2WBJD 3O6FC 4FG6D 5SWZB 3UPCA 5DD6B 1KCUL 1ZT1A 1ULVA 1AE6L 2BSSA 4NN7B 4J1UA 1I7RB 4XPGL 2DQHH 1Z9MA 1YMHA 5EBWA 4GW4B 3RL1B 4LF3B 4BZ2L 1WC7A 4XVTL 4EJ1C 4OLUH 2VZ3A 4JRXE 1FO0B 1KTRL 2VDNL 3VMOA 3OKNB 2K1MA 2HTLD 1BD2B 3SDYH 2I25N 2Q76B 3OAUH 2BCKB 5ICXB 1LK2A 3GMQA 4YXHH 2UZIL 3OB0K 4G6JH 3ALPA 2QTEA 2W1NA 3RL2A 3U48A 1MREH 3ZTJG 3FOLB 2Q3ZA 1E4XL 1GZPB 4JKKA 5E56A 4JFZL 1S9VB 5CJ5A 1UH2A 3NACL 3JBG7 4BUHA 3GGWA 1XIWA 1JGLL 2XWJA 3BIKB 3UTOA 4QHLB 3LPWA 3NPSC 1JPTH 4QHNA 1LQSR 2HFTA 1H8SA 2NYYD 4Z0BL 4JO2L 4MS8D 4OQTL 3IDMB 5K9KB 1VACB 3QG7H 4JR9L 4OZIA 1DCLA 1W72H 5DC4B 3PGFL 4M6AA 5DRNB 3JUYA 1LEIA 5DRZB 3AVEA 2YA1A 5L0QB 4HJGA 4XNQB 3ZTJH 4R8WL 5ISZE 3S96A 4OLZL 3HCVB 1RZGB 1A2YA 1M7DB 4G6ML 1J8HB 1M6OB 4APQA 1RUKH 1KTDA 3T65B 1U42A 1ZLWH 2GK0B 2IFFH 1Z0MA 3REVA 4NHUA 5T5NG 3GIVA 2UZXB 3FQNA 1EJOL 2JJSC 2BY0A 1CGWA 3MBEB 1T1WA 3MREA 1PLGL 5CJOH 2CUHA 4WHYH 3GSNA 3BMVA 2YD9A 2XTJC 1FDLH 4TNVF 3STZB 4M1DL 2VO5A 3GK8L 5AWNH 1KT2B 4YHNA 4ZSOA 4P0DA 3B9KD 1BQLL 2VDPL 5H94B 4PREA 4K7FA 2O5ZL 3J7HA 5JXAL 3ARED 2C1OA 5J9PA 4NUJA 2GUOB 2G75B 4Y4KB 4YHLL 3UJTL 5IOPA 1DANT 2DQJL 4R2GD 4PGEB 1FLRH 1HWHB 3KYKH 4PLJD 4PV9B 3VG0L 2H1PH 5B38B 3QWOA 3HPLA 4U2YA 3MV8E 4ZQKA 2ARJA 4YHPB 1HHJA 1A22B 1YY8B 1MCOH 5LCVH 5FOBA 1CLZH 1DBAL 3PABB 3L3OB 3W9EB 3KXFD 4QHUB 1EAJA 5DMGC 2R29H 4AEFA 2MFNA 3EZ8A 1T83C 2Q1EA 1A7BA 4OLYH 3UTTA 5JOFA 3QUZC 1ES0A 1MJ8L 4YGVB 5E7BA 4AH2B 4MGXA 4M4PA 4PJFF 2NXYB 4AMKL 1ZGLP 2FSEA 1SQ2N 1ADQA 5IP4A 1FYHB 4ZG1A 3HC0A 2GHWB 1DDHA 5DFVD 2WNGA 3QEQE 3OR6A 4XNZC 1QBLH 2NY6B 3WIFB 5H2BB 3ETBF 3C5JB 4PJXB 4ZFGH 3RP1A 2R1YA 5F7FA 2OYPA 4UTAL 3T2NL 2B1AL 4GRWH 4KDVA 4GUPB 4YNYB 3C09C 4HKXA 4LSQH 4EBQH 3AXLB 4WHCA 4PJGB 5L8JB 1BFTA 1NMCB 1UYWL 5C09B 2PYFA 2DJUA 5IHBA 2OTUB 1WWWX 5DRWA 4ONFL 5ICZB 2FIKB 1NFIA 3SDXF 5C0RL 4FTVE 5EZIL 1XGUB 3MJ7A 4XI5C 4M43H 3G9VA 4NC2B 5D7IA 5GZOD 3ZDYF 1A0QL 5ALCL 1IGJA 2R1WB 3BEVB 5ANMA 2IH1A 3CC5A 4I9WD 3HI1A 1DQJB 2W65B 3UTQB 4MD4B 4KDWA 4OSUL 3VD7A 3LB6D 3MV7E 3DXAE 5B3JE 4M6OL 4QYOA 5JW4R 5KVDL 2Z91A 1LEGB 2MQCA 4NRXB 1YMMB 3RPIA 4ZAKB 4WDIB 5IT2L 3L5JA 1E6OL 4HLJA 3ZT5A 1R5IA 2IH3A 4Z0BH 3PG2A 5C0AA 3V6ZA 4QRPA 3VFGH 5JW4N 1RJZA 4I3SL 3T2QA 1PEZA 2X4SB 5I1HH 5C07E 1DZBA 1I1AD 3KPQB 3CH1B 5CJ8A 4JFZH 5DJDB 5D1ZB 4XAKE 3F6IA 4LVNC 4Y1AA 1KXQE 3QA3B 4X7SH 4NRYB 3VJ6B 1QSVA 2NPLX 2CLVB 4P99A 4ZUVB 5C0CA 4DUXA 1EZVY 4X8XA 4Z7UB 2IH3B 2VXSH 2APFA 5HVHC 5D96B 4LNRA 3DUHA 1AR1D 1FN4A 5E4EC 4DKEH 1R5VB 4YQXH 1S78D 2QQLL 4P5TB 3GJEA 3L3IA 1IQWL 1ZKAA 15C8H 3FAXA 3MNWA 1O5DT 3UTQA 1ORQB 1RURL 3GMRB 4D9LL 2IH1B 5ANMB 4U1IA 2AJVH 1FZJA 1RZJH 1QHOA 4ETYA 1PLGH 5CJOL 3DV6A 3V52H 2OL3L 2EDOA 4H20H 3MJ9H 1I9IH 1XEDA 2HN7A 3HZKB 4Y4KD 4AG4L 2EYTA 5ICZA 1FL6B 5DYOB 1UKQA 4X5WA 2RFXA 2DQGL 5HYSB 2M26A 1FGNL 2B20A 2VR9A 4MHHG 3VXSA 5DEFA 5JORA 4YFDB 1KB5L 4XC3H 3ZZ1A 2XY1A 4UINH 5ID1A 4QY8B 1XIWC 4R3SB 5T1DH 1U58B 2F53A 5FM4A 2Q20A 3IFPB 5HYJB 4CN6A 4Y1AE 3MJ9L 4RGMB 3QG6B 1U95B 3DECA 3Q6GH 4TTDC 5FO7A 1F58H 5I73C 4QGYA 5J6GB 1OWRM 3WN5C 1F90L 5C0CE 1DSFL 4XP9H 2P8MB 2QEJA 3FT3B 1II4E 3K2UH 5EPMA 3EDDA 1KPVA 1HKLL 3QCUL 4U1GC 1MIML 1EXUB 1CQKA 3CX2A 2CLRA 1ES0B 1J86A 2O5XH 4F7EA 1BAFL 4NWTH 5GS0L 1MEXL 1YEJH 5LAXB 1NL0L 4NHCL 1F3RB 2OL3B 2UUDK 3KYNB 3MUY1 5ESVA 1LO5A 1JNHB 4H8WH 4NN6C 1FNGA 1QQDA 5INDB 1WF5A 5CEXA 3IDNB 3LRSB 4WTXA 4FNLH 5T3ZD 2K3TA 1QKZL 2AQ2A 2JB6B 3LRSA 3GUTB 5JIKA 3CGTA 1MRCL 4NN7C 5C6PB 3TPUB 4L8BB 1KIUA 2VLKD 1A6TA 4MJIE 5GJTH 3MV9D 1NGQH 3KHQA 1CFTB 1A6PA 4NM4L 3V4UL 1NDMB 2DQEL 3ZE2E 4RMRA 4P59H 4MJIB 3BD5A 1G1YA 4P5TD 3WHXB 4I5BA 3ZTNL 4PREB 4HUVB 4RCAA 5EOTB 1I8MB 3ROLB 5HI3D 2D4FA 3EOYG 4XPAL 1VB9A 5I6XC 3K4DA 3OSKA 1EGJH 3IFPA 5GRYA 3EOTH 3RBSA 4X4YB 5DJ6A 1ZHLB 4TNWF 3MROA 1G7IA 2VLJE 2BSTA 1QTYT 3DROA 4XVJH 3REVB 3WNOA 4U0QB 3RUGA 3S37H 4JGUA 2CIIA 4LBEA 4HKJA 2YPKA 2APWA 5EUKB 3VDCA 5D72L 3MOQA 1G9ML 3CU7A 3A0OA 1CTNA 5EO0A 5F1IB 5GGQH 3L3JB 4RRPG 3HZKA 2JE8A 4NKDA 4P5KA 5KSVB 4JZOB 4WHTB 1LE5B 2AJXL 2CMRL 4FTVD 4IIQB 5BMFH 4FZEH 1YQVH 3CLEL 3F5WB 3DRTB 2BRRH 4X99A 4EI5A 1JZ8A 3IKCB 4G7VH 2V5SA 5D71L 2GJZA 4UDTA 4PGDB 3O2DA 4RGNB 1UXWB 3R8BB 4BUGA 4WO4A 4GKZA 4X0KA 2ERJB 4NQVA 1R5VA 1F6LL 3Q5YA 3VXNA 4OF0A 1JPFA 5FCUH 3ULVE 4FFZL 3SQOL 2I9LA 4I13B 3QQ9D 4LSVL 1HCVA 5BXFB 1KGCE 4YAQA 1DVFA 3BZFA 1LO3H 1I7TA 4NCC1 1YYLH 2R4RH 1AQKH 5C0CB 5HHOB 2W0PA 3HAEB 3HZYA 4EI6B 1B6UA 3GB7A 3HE7A 2YD8A 5D1ZA 2IMNA 2EYSB 3H9YA 4X5LA 2FWOB 2EO1A 4IOSD 2QSQA 4WI3A 3GSNL 3I3EA 5TDOB 3PDDA 3VXUB 3RTQB 4JHAH 2UZYB 5DO2D 1HSBB 3EDEA 4M48H 4S1DC 4F37F 3T3PE 4QRPB 1JF5A 4NQED 1EMTH 4M9PA 1WT5C 5B22A 1N5AA 5TE6L 2P5WD 3S97C 1FIEA 1OSZA 1KJ3L 5DQ9B 5I1LB 2AQ3A 4NRXA 1IRAY 1LEGA 4OB5L 3V5DA 4HFWA 3TPUE 2IAND 4U6XB 3C60A 3PL6D 4P2RA 3HNSL 3ZT6A 4GRLA 4OAWB 4IRJC 1S7SA 2ADGB 4FMKA 1H3GA 3HZYB 3M1BB 3P73B 3BP5B 3LS4L 4XPTH 4GAYA 1NGYB 2AQ1A 4MXWH 1NLDL 1IJ9A 3MR9B 4KHTH 3H9SE 2ZPKH 2EDDA 3C6LD 2FIKA 1RZJC 4QRRD 3QP3A 1BHGA 4NQVB 1QFOA 4B41A 1UENA 3G08A 3TBVB 5KANI 5D7LE 1F3DH 1C5CH 5J1AA 4JFFD 5FECA 2GSIA 4YLQT 1D5MA 4YBLC 2BOBB 1MJUL 1FYTD 4ZPVB 1FNHA 3CFKB 3UTSD 4OFYD 4DN3H 4NJAH 1Q38A 3C5JA 3V0VB 2BY1A 3AGVA 4J7RA 3MRBA 1RIVH 4PG9B 4XCEB 5H37H 2PETA 4TNWK 2FB4H 2X4RB 4NGHL 4HKJB 5DD5L 3SDAC 5EDXA 3VXOB 3NTCH 3QNZB 1JPGB 3UTTB 3SE3A 4C4KT 4M3KB 1EHLH 2WZPD 5CGYD 5D2NC 3HZMB 3H3PH 2UWEA 4I18B 3FMGH 1G7QB 3TVMC 3LKPA 3SE9H 1HHJB 2VKWA 3MOBL 1UB5A 3B2UD 3SY0A 3WL9B 4QRSA 4POYA 3PUCA 1KB9J 5FUOH 5KJRL 1D5BA 3KPRB 1P4BH 1EHAA 3BP4B 3T0WA 5MEOA 4NJ9L 4DOHE 2WM0A 1I9JH 1CFNB 2NLJA 1JMXA 4U1LB 4OGAC 5FUZH 3RIAF 3RQ3A 1VSCA 4OT1H 2X44D 4PJ5E 2Z4QA 3QPQD 1NH6A 4IMKC 4TOYH 5E8OB 4Z5RB 5IESH 4ZOBA 1T80A 2NY2D 1QVOA 1TZIB 2FGWL 2B8OT 4JQXC 4BZ1L 4NO2A 4KI5C 4M02A 1ZMYA 4WFGE 3N0PB 4K3GA 4JHBA 3MV8B 3QH3A 1T3FB 1K8IB 2VXQL 4ODUB 5F7EL 1AXTH 4LMQE 3ES6B 2VSDA 4GKOA 1LO5B 4LEXL 4U7SA 4MJ5B 2X70B 1RZIB 4P5TC 2O61B 5GGVH 5CZVH 3BUYB 1EIBA 3P77B 3TGXA 1WV7T 2CPCA 5JR1H 3VWJD 5JMOC 4QRRB 5JDSA 3OZ9H 4LLYA 1E6JH 1XF4B 2GK0A 3CFEA 4LLVB 3BOVA 3D6GA 4MA3B 2J4WH 3MV01 1RZGA 2Z0BA 3RWFB 3ZT7A 5SWSE 4HGMA 3RAJH 4XCFH 1UJ3B 4JREB 3QEQB 1KB5B 5ADPL 4TSAH 3FQRA 5AZEH 4HIJB 2P1YA 3I6GB 3N9GH 2CD0A 1N2RA 1S7TA 1ZGLA 4JZNB 4ZUSB 5J13C 1D5XB 4P23B 3S35X 4QHLA 1I8IB 3X3GL 4X5WB 3CVHH 3JV4B 7FABH 2XG4A 3U1SH 3OGCA 3HUJE 4FZ8L 2CLZA 1NAML 3FOLA 4OZHA 1YC8A 5T3XD 1S7QB 3RL2B 4BKLA 5GRUH 3ARDB 4K07A 4OD2A 5ERWB 3MA7B 5C0EA 1JYXA 4PFEA 4H25B 4GKSB 2VDKL 1V7NH 1BGXL 3MNWB 5JPMB 4RFEB 2EDLA 2WBWB 4MD0A 4Y5YC 5DEZA 2JELL 1G6RB 5D6DA 2OR9H 2IBZX 2Q86B 2BVPB 3RA7H 4PBWD 2BSSB 5C8JB 3LKQA 5I1GH 1HOCA 2E7LC 5CIPB 3RGHA 1DUYA 5IMOB 3GJFA 5AUMA 2QADD 5EU5B 3S3PA 3S36L 3U82B 4YO0B 3QA3A 4JN2A 1HILB 4GKNA 4MLSA 4FQXC 4O2FB 2VQUA 4J8RB 3U9PH 1G7HA 2AJXH 1U8PA 2IPTH 4ZPTA 3DTXB 3F12A 1MJJB 3HC3H 4WEBL 4L1DA 1MHEA 3CLFH 3I50H 4H88H 2HFGH 3QUMB 3RWJB 3SGDI 2BNRB 4C83B 3UDWA 3KGRA 2I60H 3QEHA 3X12A 3LN5A 4YPGB 3QFDB 4JO4H 3QPXH 3DVNB 4WDIA 4IOIB 3RVVC 3VXMA 4KDTA 3WJJA 3RY5A 4N0FA 1IKFH 2CXGA 1XGPB 2D7TL 2VMFA 3GIZH 4JQXA 4LKCA 2W65A 4J4PD 4OF3A 1B2WL 3NMEA 4PTUA 4ZNEA 2X4TB 3CFCL 1BEYH 4ZTOL 2W92A 1HINL 4XPFL 4Y8DC 4XMLL 5ADOH 4DTGL 1T2QL 2R4RL 4UILH 4ISVB 2IAMC 5C6TL 2VDRH 4WEMB 1NFDF 2W9EL 1PQZA 1SY6H 4M93B 4LDLB 4KZEL 2Y4SA 2Y5TB 2F8XC 3VXRB 1G7JA 4LAQL 1QYGH 2ICWI 1MQKL 1HQ4B 1UWEH 4KRPC 4YX2L 1U3YA 4DTGH 3IJYA 4BFIB 4Z7VB 5T1KA 4NQXA 4JO3H 1AQDB 4ZTOH 2F15A 1G7LB 3VXPB 3ULVL 4BFGA 2H32B 4LGSB 4BA8A 3F7VB 3QIUD 1XT5A 1AGCB 1QFUL 4WW2C 5E2WL 3UP1A 3T1WA 3OKEA 3TVMD 4HDIA 1T22B 3W39B 1V3LA 4Y88A 3OR6B 3T3ME 5L8KB 1QLRA 4R4BB 4HH9B 5DLML 5EO1B 4AZ8A 5DJ2A 4JFFE 4OBRA 5L7XL 5GJSL 4MJ2A 4Y4HB 4OZGF 2J6EH 2P47B 5ISZA 4MA1B 4L4VE 4ZNEE 5F3BB 4Z7NF 2FX7H 4O2CB 3I84A 4JFFB 3PGDA 1FZOA 4LHUG 4ODBD 2GITB 4P2RD 2J8UE 4MDIB 1NDGA 1EO8L 3QIWB 1BD2D 3QEGL 3NN8A 4TSCH 3FT2A 4J3SA 4BH7B 4OI9A 1NCDL 3DXAB 1RZFL 1OP5H 3R06A 1S7UB 1JV5B 2VAAB 1DUZB 5J89A 4PJ9D 1TTFA 1ZA3B 1KN4H 4NOFA 4TN9A 4PV9A 2XQYG 3LMJL 4HCRL 1KLGB 4KY1H 3O3EA 1MAML 3QCTL 4TUJB 4EVNA 4JFDE 4KROC 5HSFA 4CU6A 5IEKA 5HGDB 5F1NB 3D48R 3H2WA 1F4AA 4FQ2H 2NXZC 1P7KA 4H20L 1UG9A 3WIHL 2A9NL 4QCIA 5ESQA 3RVXC 4ELME 4X8JA 4YEFA 1DTUA 2GY7B 4OFKA 4NBYB 4WRLA 1V7NL 4GAGH 5DFTA 1XF2B 4YHNB 2GEEA 4NM8L 1P9MC 1U9KA 2NY2C 4ZS7H 4YZFE 3TP4A 3IJHB 2VXUL 4XP4L 1DQMH 4YBQD 5I8OH 5I0ZA 2NY0B 4XHJC 4NCC2 4ENEC 1Y0LB 5E2UL 2H26B 4S1QH 4G6FB 4S1QL 4MA7H 3MRGB 5CZKA 2NCMA 3ULVC 1J0ZA 3QIWA 5EFIB 3DRQA 4CMHB 3L7FB 4EI5D 4LARL 1LD9A 3EYVB 5K9JH 2ITCB 4KUZL 4Z7UF 4NWUL 5DJ0B 4NNYA 3N9GL 3R1GH 4YDJA 3RU8H 2ESVA 3RVWC 1QG3A 1PX4A 2K7PA 3SDDB 2J12B 4KKCC 5HYJD 3TYFA 2A9MH 1DE4B 5D1XB 5EU7C 2CKBB 3RAJL 2VZOA 1MNUL 3M8OH 4N5EA 4JY6B 3ZYJA 4KQ4H 4I48A 3S36X 3NIFF 1BBJA 3FN0L 4NO3B 5T1MB 1WFTA 4W68A 3UEZA 5FCSH 1MY5A 4L9LB 4TPRL 2AEWA 1RIHH 4JKWA 3BQUA 2Q8BH 3UO1H 1TNMA 3EGSA 2J2ZA 4GW5B 1R5WB 3MRIB 5E5RB 2FNBA 2Q76A 1BFOA 5T33L 2VR5A 4HKZB 1KC5L 3B2VH 3AAZB 3BN9C 4LQ1A 4J3XA 2Q6WB 1QLEL 4UT7H 4J1UB 2GK2A 4KHXH 5CUSL 5B4MD 3BRFA 4TUOB 1VENA 4Q0XH 1N59A 3RVUC 2APXA 1YC7A 1BM3H 1YNTA 2XNAA 3A67L 4KAQH 1RZ8A 4Q9QL 1GGIL 2W60A 4PJCB 1QFUH 4X98A 3VXMB 4JM2A 1KG0A 3CH8A 4LIQE 4LP4A 4D0BA 3BW9A 4JFEE 4PJGE 4DGVL 3X14B 4I4WA 1L7IH 2I26N 3G6JB 4R90L 4UUJA 1CL7H 1RUQL 4U6VH 4ERSH 1ZT4B 5FUCC 5I1HL 1UZ6E 3G5ZB 2ZSVB 2JCCF 3ZL4H 5CAYB 5C6TH 1JF6A 3X14A 1MSPA 3DUUB 1J0YA 1QBMH 5D7SH 5E00B 4TTDD 3H9SB 4NZJA 2F54B 3R4DA 5EU5A 3OB0H 2Z35B 1BLNB 5IVZA 4OLYL 2ILLA 2A73A 4G9FE 1HOCB 1H5BC 3DUSA 1NEUA 4MNHB 5EG6C 3U36A 4XPHL 3O81A 2WLZA 5J13B 3TC9A 3KLHD 4N5UA 2ZCHL 3VFWA 1JMZA 2MPAH 3MRPB 4G9FB 4YDLC 3GSUA 4KGJA 5DJAA 1UADC 2H6PA 2CDGA 5ALBL 5FF6A 1BOYA 2VQTA 2FX8L 4HKZA 1TPXC 3B4NA 2OJEB 2HRPL 4HZLB 3CUPB 1JGUH 1BM3L 1N3NA 3ARDA 3RKDD 4F9PA 1IT9H 2EH8L 5F9JA 1U41A 3BQUB 3KS0H 4OD1H 4GBXD 4L8SA 1J87A 2FL5B 3BGFC 5JXAH 4FQ1L 4JFOB 2KL6A 2JCCB 3VXTA 1FHGA 4MXQD 1MCSA 3VD3A 5JXED 4HF5H 5F96H 3P0YH 4XNXH 2D0HA 1S78C 2P8PA 3CX5J 4H1LA 2JKXA 4ZFGL 4JZNA 4S1RL 2FJGB 4QHKI 2YPVH 2VZVA 4PRHD 3BPCA 3U9UA 1WGOA 5I1GL 3QUXA 1HHGB 3W0WD 3M07A 3A6BH 5D1XA 4K55A 3CIQA 3IAQA 1P9MA 4X6CE 5F7LB 1JGDA 1HEZA 2O5YL 1FNSH 2AV7B 4FP8H 1DQTA 4N1EA 1GSMA 4PLKC 4NQDB 1DL7H 3MJ8A 2PO6A 4QNPE 1MCPH 5ACMA 3BZEA 4Y4KC 4G8IB 4PRAA 4P4KD 2AI0H 2CDEA 1N6QL 4P2OC 4J4PC 1S7WB 1YECH 2AI0L 1N6QH 3U7AA 3OTTA 1UEYA 4QOKD 1XZ0A 3BAEL 4ODXA 2HJLB 2AK1H 3U1SL 3CSYA 1KCSH 1ODAA 4K3JL 1P4LA 4MVBD 2H3NB 1YYLL 5IB3B 2H1PL 1JF1B 3LEXA 1YJDH 4M61B 3KYKL 1O0VA 2VRAA 2V17H 3JV5A 3S88L 1JFQL 3N06B 4WEUD 3NACH 2XPGB 5KANG 2ORBH 1RUQH 4U6VL 1NC4D 5C0JA 1P7KB 3DO7B 3DWTA 1A1MB 2BVYA 5EZJA 4LQFH 5JHDB 2ZOKA 3RGVB 4WFFD 3QZWG 2EE6A 3MACL 3WIIH 2VDLL 1CFNA 4OZGB 3G6AA 1SVZA 1EEZA 5C7XH 4JCLA 4KFZC 5GRWA 2V9QA 4F58H 1A4KA 4HEPG 3TBWB 4PY8I 3G5VB 4RAVB 2C1PB 3EFDH 4HZAA 2V7NB 4PJAB 1SM3L 1HHGA 3QUXB 5TQ0H 2NNAA 2G2RA 3FT2B 1IQDB 1ZSDB 2BNUA 3MLWL 2AJZB 4BH7A 4EQ2A 3U4EB 2LQRA 3LKPB 3C2AL 1TQBC 3AS2A 4NP4L 2C26A 1CU4L 1D5IL 3NAAH 4I18A 2P8PB 1Z9LA 2PNDA 4WWKA 1RUKL 3QCTH 3RY6C 3PGDB 3SDXE 3MRHB 2QQQA 3JWOH 3DGGA 4UTBH 3V95A 1K8DA 2D9CA 2HP4A 1X5GA 4Y4HA 1OVZA 3SKNB 3RWGA 3SCMD 1U8KB 4N68A 1LDSA 1VA9A 2ESVE 3HI6H 2N7AA 2RCSH 3P40A 4PG9A 2A6DB 2WUCL 1QLRB 4XPAH 9CGTA 4PJXF 4KJWC 1OTUD 1UACH 4I2XA 2H6PB 4U1JA 2QR0B 3EHBD 3T09A 3MRPA 1HH6B 2YPLD 2MOVA 5T1KB 4KKLC 5T5FL 4DGIL 1O7SA 5BVJB 4JY5L 4S2SA 5CCKL 3GSQB 3VH8B 1UCTA 1F4XL 2VLJB 1QLFA 2MKLC 1OTSC 5FYKE 2WANA 3DUUA 1WK0A 5CSBA 1A47A 4YXLH 1I7ZB 4PJ9B 1N4XL 4Y16C 1NGYA 4NIKB 2ITDA 4OM0H 1LEKB 4NQDD 1W0VB 4U1MA 4RGOL 5F9DC 4HMDA 3BVNB 4PGBA 4LAQH 4P2RB 3UJIH 4U1NA 4N0FB 4D0BB 1U91A 4D8PA 1ZHKA 5JHDD 2D7PA 2OTPA 4I0KA 5EA0H 1MFDH 4WW1B 2BDNL 1C1EH 8FABB 1HINH 3CVHB 1OD7A 4BK4A 4QRRE 4TUOA 4U1MB 1M71B 2OR7A 3E6FB 1YEFH 1NGPL 5IJVA 1MUJB 2GW5A 3EDKA 4PGCB 3AAZA 5AG9A 5FM5O 4XAWH 4Z8FL 1E4KA 4GKNB 4XMPL 4OZGE 5HHOE 4I0PA 4KRPD 4EI6A 1BBDH 1QFWH 1R24B 3QJHA 2HJKB 1F45A 5MI0C 3A6OA 1U92A 3NZ8A 4G59A 1OF2B 3V4PH 3U30B 1I85C 5IBTH 3X3FH 4XP1H 4X4ME 4HWEH 3RU8L 4KDTC 3QUMH 3BE1H 2YD4A 4ORZC 1JI2A 1EVTC 4MNQD 3DX6B 4HC1H 2R15A 1UXWA 3ARFB 2PXYD 2J6EL 2YZ1A 5HHQB 1CFQB 1QR1A 4WGWB 5J1SC 2ZNXA 3UTPD 1XF3A 2J8UA 1DQQB 5KG9A 3LPFA 4GRLC 2ESVB 2LV4A 1MFCH 5IFJA 2NY3C 4NKDB 2HKHL 4L3AA 4WUKH 4PS4H 3DMMB 5DD1H 1A3LL 5C3TA 1SMOA 4GS7B 4HHAB 1U6AH 3DYMA 1D6EB 2FBOJ 1DFBL 5EFIA 3ULVD 4XH2A 3NFSH 3WIHH 1IAII 1S3KH 2AJZA 1IM3A 3I6GA 1A3RL 5JQ6L 2PUQT 3FQTB 1C16B 4QWWC 2WMPA 5KN5B 4P49A 3TBWA 3D85D 1OARH 1JP5A 3MLSH 2XXMB 4XMLH 5ADOL 5C71A 3WHE0 4NRZA 2DM3A 4HUVA 5I30L 1MLBA 2YUXA 3MQIA 3G6JF 1TJGH 1OD9A 3EHBC 4JFDB 4FZEL 4WI9A 1A1MA 1CFBA 2D7NA 3H7BB 1OTUC 5H37G 4Z7OE 2DL2A 4WWKC 4YHML 3G6DL 1BQHA 3OMZA 1GGCL 5JA8B 1RZKC 3X11B 3H8NA 3P77A 4K71C 5K93A 1TMCB 5EU7E 2O61A 4X5XB 1P4LB 1RMFL 4LLWA 3RNKA 3FZUD 3LKSA 1DUZA 4YZFF 3CSGA 3QBTB 1KCRL 3QIBA 1G6VK 3PQYD 1NGWA 1KPRB 2QQKH 4PRPD 1YN6A 1ZE3C 2BNQB 5D2NA 1YDPB 3EUUA 3E2HA 3EBAA 4QTIL 4TRPL 1TENA 2V2WA 1EGJL 1Q0YL 3D2UA 3QXAB 3U7YH 3KWWB 3BZEB 3RIFF 4WI6A 3MJ8B 5D1XD 3EDFA 3BDBA 5ANME 4ZFFA 1IGCH 3AROA 3KXFB 4OLVH 5F1KC 4HS8L 4JRYA 3IDJB 3H9HB 1D5BB 1N7ML 3ZE2F 1WZMA 1J0JA 4WU7B 3RI5F 1RI8A 1K3ZA 1ACYL 3EKCA 4P59L 4BZ1H 3FQUA 3MUGB 4LIQL 1JN6A 4QRTB 3ZYOA 4WFFE 4JAMA 3W39A 3V5HB 4EDWL 3OXRA 3I02B 2MHAB 3GMPA 4U1KA 4N9GA 1RZ7H 1GPOL 3QFJE 3TO4B 4P9HH 1MJ8H 1B6DA 3LKOA 5DEFB 5EOCJ 3V0WH 3S4SA 3W11D 2APVA 2XKUA 3KPSD 4HPOH 5DD1L 3VWJC 5KSBA 3MYJA 3WNMA 1MFCL 1CE6B 1KNOB 2DS4A 4F7TA 1F4XH 2X4RA 5GQBA 1FL6A 5DYOA 2FIRT 2HT4C 1MEXH 4OZFG 3LN9A 2XZCH 3QO0A 3WD5L 5KVEH 1UZ6F 1U3JA 5HGBB 3X3GH 3QUKA 4PJ7F 2AS5M 1X4YA 5AYUL 4MA8H 4PJGF 1VFOA 2HRLA 4IRSD 4Y8AA 1D5MB 3QDJD 3C60C 5GGRA 2DQJH 4PLKD 1FC2D 2BSRA 5DURD 4WEBH 4JPKL 3IAPA 2HFFA 1L8JA 1KYOK 2D2OA 3G08B 3TBVA 1D7FA 4HFUH 3IFLH 3HLAA 2Z35A 3DXAD 2IEPA 1VDGA 2R4SH 3SO5A 3O3AB 1Q8MA 1ZVSA 3C8KA 3INUH 5LGKA 4OLXH 3ILPB 4CVXB 2X4NA 1PEWA 4D0CA 5KVFL 1EPFA 3G5ZA 1AD9A 5IB5A 3IGAB 3BZ4B 4XWOC 1E6JL 2E6JA 1C7SA 3BH8A 4Q2ZA 4HCRA 1MHEB 3NIDF 3D0VB 1A6AA 1S7SB 3DTXA 3NCFB 4G9DB 1U8PB 1KJMA 4LOUC 4NQSB 4UT9H 4OAWA 1TTUA 1ZLVH 3UPAA 1G9MC 3O6FD 2B2XH 4Y4FB 4URTB 2EDHA 3QXVA 1RVFL 4O00A 1NCTA 4AL8L 5MERA 3K80A 1AP2B 5TFSH 4TNVK 1MFDL 2X4SA 4ALAL 3HC4L 1OSZB 5FGRA 3DPBA 5HYFA 2DIAA 2ICCA 2GYSA 2IQ9L 3VXSD 4PJAF 4R7DA 3E2HC 3FRPA 1MWAB 5D6CB 3T0AA 3VXUD 5IESL 1W72L 3ULVF 3REWA 4OQTH 1KIPB 3HNSH 5JZ7C 1RQ5A 1SVCP 1EEUA 4QF1A 2Y25A 4LDOB 3BQUD 5ERWA 1BVLB 5KJRH 5T1LA 1AIFA 3B83A 1WFOA 1TCRA 1LE9A 5ITBL 3ZSSA 4WI2A 5FO8A 4YAQB 3VFRA 2ZUYA 3F7YB 4DGIH 3UX9B 2YKLL 3VXRE 4X7TA 2E9BA 3BPNC 1HKFA 3BKMH 5HY9A 4GKZB 4F33B 4PJGA 4LSSH 3RZWA 4I3SH 5GS0C 2XTJB 2GJZB 1F8TH 4UDTB 5FYKD 4RA0C 1FNLA 4PJ7A 4Y5XB 5DXWA 5FGCE 5DS8A 2FB4L 4XNMB 1T5WB 3TYFB 5CZVL 4PBVC 4X6CB 4N8CL 4FMFA 1RK1B 2R56H 3HC0B 3QIBD 2VXQH 5F7EH 3QYCA 4PJ8A 2BFVH 1S5IH 4RAUB 5EULV 1MJUH 1M05A 4CVUA 3MLVL 4OCWH 5C08D 3VWKB 1NCAL 3PWUA 4KRNA 1RUPH 4YGVA 5TE7L 1ZOXA 3ZO0A 5CSZB 5C0AD 1Q0YH 2D7OA 5IROC 2ZNWA 1J9CT 5HD8D 2R0ZH 5FUZL 3TFKC 1FJ1B 2G5BB 1I8KB 1K2DB 1FRGL 4YXKL 3N85L 5TJWK 1WBZB 2YC1A 3ULSB 4LSUH 1N64L 4N0UA 4M5YH 1XF2A 3VDAA 3QUZB 4K8RC 4NZUL 5C7XL 3TT3H 3VGGA 3G5XA 3GSRA 1S7VB 5F88B 1U3HB 5HD8C 3GRWH 3CZFA 2Z4QB 1BPVA 4OI7A 3V7AG 3P4MB 2ZSWA 2QJDA 1X6LA 1KCLA 3WNNA 4L8BA 5AYUH 5JLZA 3B9DA 5ID0A 1BIIA 4ZTPL 3TJEH 4KRPB 5ACLA 3G5XB 4UOW0 1E0OB 2ZP0T 1JV5A 1OGAE 1UJ3C 4JREC 1MCWW 1HHIA 1FFNA 1VGEH 1S9YA 1D6VH 4LLQB 1X5IA 1J88A 2ICWJ 3MA9L 4NDMB 4OGYL 2JIXB 1EJ6A 2EEDA 2AEPH 1H3TA 3FQNB 1GC1H 1KJ2A 4OD3L 4M7KH 4R90H 3V0WL 4F7EB 2DTML 3U7WH 3VXOA 4PUBL 2X4QB 1A6WL 3HMWL 1KCVH 4GG6F 2YMXH 1GGBH 3WFDH 1QRNA 5DQJB 2FEEI 5I8CB 3VG0H 1KOAA 4EXPX 4HH9A 2MMXA 3IDXH 4R4BA 1FZMB 3QXDB 3KLSA 4XI5D 2XQYK 5DRZA 3IXAA 5C08A 4G8GB 3PWLA 4GS7C 1CT8A 4P4KA 2B5IC 3ZKMC 5DK0A 1QRKA 1GHFL 2PF6A 4KK6D 1GAFL 2IF7A 3B8SA 1FVEA 3FQXB 1H15B 2DMCA 4G8GE 2JB5H 5E2VH 4Z7VA 5KOMC 1MF2H 2XTJE 5DHVH 3NH7H 2Y7QA 2FEEL 5DRXA 1JFMA 3LKRB 5FDWB 5CBEB 4DVRH 1NGZB 5C0FA 3VXRA 4X7TB 1F90H 2Y5TA 3S3JA 3HKFA 3SO3B 2HN7B 4JKPL 2IJ0C 3F7YA 5E2JA 4F9PC 4KV5E 2WP3O 5CILL 3LV3B 3CMGA 5ALBH 1NCBH 1LE9B 1Z0NA 1AIFB 2BX5A 1V3MA 5DO2C 5AZ2L 1UH4A 2OZ4H 4JDZB 4TQEH 3VRIA 4XAWL 3R8QA 4HLZG 4KQ4L 3ARSA 4GSDH 4HBCL 1XGPA 2HFEB 5HGGS 1FORH 1WC7B 4L3EA 1K9TA 4X6EA 3MRRA 3QNYB 1G6RH 1KIRB 3E3QC 5DQ9A 5E4EB 2OI9A 3EW3B 3MXVH 1X4ZA 1Y18B 2E7HA 5LGHL 2YXMA 3VXRD 3EYUL 3Q1SL 5BV7B 1Q9WA 2DQDL 4ZUVA 5GRZA 3VXUA 1UJTA 1YN7A 3TNNB 2CLVA 2IGFH 4JLRB 1P2CB 1TJHH 1MJJA 4YHYC 4ZODA 2D0FA 4XC1L 4ZO7A 1NBVH 3UTSA 1J1PH 4O2FA 4HV8B 3VG9B 2VLRA 3D0VA 4KXZI 5IFHH 2YPLA 2N56A 1UM6H 2FJHA 2R23B 3FJTA 1TZGL 4AJ0A 4RDQF 4ZYKA 2IAMB 2YZ8A 1JZ2A 1AD9B 4Z78B 4LRIA 3VXUE 4X6DF 4G6KL 5C0AB 3V6ZB 4Z7WA 3ERYA 1MPAH 4EUPB 4LPCA 3O3AA 5CUSH 5CCKH 2GTZA 2B7DT 4P3CH 2K9UA 2R69L 3P0VH 2W0LA 4X0KB 2FR4A 2C3XA 2DQIL 2HFFB 4TTGA 3KG5A 3KYMA 1X5HA 3KR3L 2OJZL 3AS1A 3MGTA 4Z95L 2HLFC 4H25A 2VZ1A 3WN5B 2DBLH 4WI8A 4XZUB 4EI5B 1NC2A 1KPUB 1JWSA 1KFAH 3QDMD 1TDQA 1CFVL 4GAFB 1NAMA 5IQ9A 5HGHA 4DUWA 1E6OH 1F58L 3NPZB 4CJ0A 3IRPX 3T0EE 1YYMH 4JQIH 1NFIB 1YEKH 1YYML 3HAEG 4JQIL 3HG1A 2DIJA 4MA1C 4N0YH 2VTFA 5F7MC 5HPMA 3J8F7 5CIPH 5DMIH 1PG7W 1CFVH 3NOIA 2W9DH 3FKUS 4NN6B 4XMPH 3HFML 4M62L 1ZGLB 4KGLA 4PTTB 4YC2C 4YIQB 3O3DA 2HWZL 1NCBL 5I71C 1GIGH 1YNKH 4KMTH 5D1ZD 3WDHA 4WO4C 2A9ML 1R3IH 3SBWA 3IXAB 5C08B 5TQ0L 3OKDA 5C92A 4X6DE 1DP0A 3P4NA 4XGZA 1WWBX 3WNPA 1DLHB 4HX1A 5F72S 4B53A 5EA0L 4GMTL 1DVFD 5ILTH 3FO9B 4LARH 4CMMA 3TIDB 5IFAL 2DI7A 5IJKC 4EDXA 2JB5L 1TLKA 3EAKA 2HMID 1FPTL 3SE8L 1TXKA 3MRNA 4RFOL 2H32H 1H5BB 3BDXA 3UBXI 5EUOA 5IFAH 2EDKA 3O6FB 1T3FA 1KPRA 2AAVA 4R96B 1MHHB 4Q7DA 4ZQKB 3GSVB 2PW2A 5CEXB 1KCVL 5INDA 1JHKL 2XN9B 1J8KA 3QWOB 4LLWB 3RNKB 1W72A 3U7WL 4OF7A 2ZCLH 4J6RL 4X5XA 2NY5H 2N4IA 3MRNB 3QEUA 1EEYB 3U6RB 5LAXA 2K7QA 5FV1L 5DHYA 4N8VG 4DOHB 4XC3L 3HHRB 1YA5A 1UVQA 4PJ5B 4CMMB 4IDLA 3WFBH 2X10A 5MENB 4YR6B 3OKYA 4K7FB 5C6WH 2PW1A 2D03H 3QPXL 1QOKA 5DTFB 2NY3D 4M5ZH 4K3HA 5LGJB 1RK0A 4J3TA 5ETUA 1KIQA 5MENE 3RGVD 1IILE 4K94H 3UYRH 1I8KA 1LP9F 1U58A 1Q1JL 1CGXA 1FFPB 2F9BT 3MRMA 4CNIA 4OSUH 1KFAL 3QNZA 1AI1L 2FATL 4QRPE 2DWEA 2DWDB 4Y5XC 4UNVA 1IL1A 1LO2L 3HRZB 4WI5A 4OLEA 1MF2L 5J3HD 3PXJA 3SN6N 1TNNA 3IT8D 4HHAA 1E4XI 4BQ9A 2EYTB 5GISL 2VLKA 1A6ZB 2WY3A 1FO0L 4HJGB 4XNQA 5D8JL 2VWEE 1R0AL 3JWDH 3V0VA 2R0ZL 4D94A 1A02N 4FQXA 1L4IA 5I1JL 3CFKA 3S7GA 1JWSB 3IDMA 4HKBA 3LH2H 1MFBH 1WBYA 3WN5A 3ULVH 2FBJL 3GBLA 5HHQA 4RQQB 3T2NH 5J1AB 2VDKH 3PWJA 1UCBH 2J1KA 4X7FC 5HHNB 2E7LA 5IHUH 4F33A 2R0LH 3VGFA 1J1PL 2MPAL 4KJPC 5HY9B 3O6LH 1ZXQA 2MWCA 1NJ9A 5T3XH 3QDHA 5ITFB 1D9KB 4JFXB 5GGTA 3VFRB 5FA3B 4E5XB 5EZLB 1INDL 3B9KB 4HIXH 1XAUA 3QZWB 2ED8A 3CDCA 1KCSL 4JO2H 4BZYA 3BP5A 2VIRB 4JVPA 3P73A 4ODVH 2QADB 3MLZH 2EC9T 2W0FB 4XB8A 3QDJA 5C07A 1NUFA 1MCBA 5J7CC 1ITBB 3FFCD 5GPRA 1A7RL 3UTSB 3UZQA 2A83B 4LF3A 5F3HA 3CDGA 4GW4A 2WWKO 3RL1A 5A2FA 3LRGA 3LZFL 4P57B 2A6KA 1CL7L 5EU4B 1E4XH 1J1OH 3GBNL 5ALCH 5ITBH 3Q48A 1IBGL 1UWGH 3K2MC 2BP3A 3BWUC 1A1OB 3OAYH 4MB4A 4K94C 2EIDA 4LFHG 4BQBA 1LK3H 2J3SA 2J4WL 3O41B 1DN0B 5TDNA 5EBMA 3HMXH 2FWOA 5TQ2L 3QWRA 4U1NB 2A83A 3ECBA 2EYSA 1T4KA 3RRQA 3ARXA 5JR1L 1WTGT 3PJSB 1CE1L 3QI9D 1X5AA 4YDLB 1A6AB 3VRIB 3RWHA 3WO4C 3KNBB 5CJQH 1AE6H 2XWBA 3RBGA 4LEXH 1HDMB 3QZWA 1TPXB 3VFPB 4HPYH 1MRDL 1DVFB 3BZFB 5T33H 1ROWA 1OTTC 2CIKB 3ILPA 4OD1L 1D9KA 4JFXA 1QBLL 2RAMA 4PP1D 1RVFH 4AL8H 1E28B 3C6SB 2FGWH 2IADB 4HGKC 3VXNB 3GSQA 4L4VD 5F7KC 1IEAB 3VH8A 5F89A 5C09A 1U8OB 2JJUA 5DRXB 3AU1B 5E8NB 3PGCA 3GMLA 3MRCA 2GSGB 1CIDA 4GUPA 4YNYA 3MRQA 4RQQA 4NJ9H 1PDKA 4HKBB 5F21B 3DRTA 3UYOD 4P4KB 5DJXA 3P4LA 4NNPL 2RHEA 1FG2B 2W0KA 1QSFA 5FUOL 3IKKA 4YDVA 5D5MB 5FUCE 1T5XB 4LCUB 1PKQE 4QTHB 5I8EB 3ARRA 4HG4J 4PIRF 3RUGB 1K8DB 5EZOH 5KSBB 2BSTB 5F6IC 1MCIA 4CADA 3E3QE 4X6BA 2KQMA 1FFPA 4CNIB 5BV7L 3MRLA 4RFOH 2NW2A 3DX9B 3PIQB 1S9YB 3D87B 4GRWF 4KVCL 4OBSA 4RDQG 4OZFA 2VITB 1IQDA 1ZSDA 2C3GA 5C0BA 3OF6D 3H42H 4LSRH 4XNUH 3HPLB 3C5ZB 2PW1B 2EH7L 3QUYA 4I5BB 3G5VA 4JRYB 1DBJL 2PTVA 3VW3H 4RMSA 3VFMB 4ZFFB 3OBAA 3S4SG 3ALWA 3MLYL 4HT1L 4PGEA 2P5ED 1T1ZA 1A6TB 4K7PL 4GW1A 1U3HA 1T1YB 5D2LF 2OBGA 3H9ZA 2OS7A 4X9BA 4JE4B 5H94A 1A6UH 4K2UH 3LEVL 4M6MH 3FO1B 4ZUWB 3RY6A 1ZLVK 3S35L 4GQ9H 5D96C 2YC1B 3O4LE 5DMIL 1GCFA 4IMLA 1K2DA 5JPNA 3OHXA 2OL3A 4N8CH 1T1WB 1UM5H 2J5LC 3RX8A 4OUUB 1XZ0B 3DSFL 2YD6A 4FXKA 3SHSA 3QCVH 4ZNCD 1MRFH 2NY7L 3IJSA 3FTGB 4IS6B 4XCYB 4EDXB 2OK0L 5DMKB 2NY6D 1VEOA 5HI5D 3BXNA 2M8XA 2V2TB 3WKML 2P8MA 3FT3A 5EPMB 3TLRA 5CD3A 1EFXB 2EDTA 3MC0A 4KXZH 1BVKB 3HCVA 3IU3B 3QRGL 5FO7B 2YKLH 3WJLA 1OLLA 2AV7A 1BWWA 1MREL 3FQWB 4U31A 3K4AA 2HVKB 3FQTA 4QRQA 3O3DB 5DS8B 5JIPA 5LWYH 2H2PD 2JCCE 3N1FC 5BW7A 5KSAA 2XQBH 3LSOB 1XIWB 2VZSA 3FB8A 5DJCA 4CW1A 4Z6AT 3HUJF 4F57L 3U4AA 4S0TD 3ZHLA 3WLWD 2FZ3A 2HYMA 4MXQA 1FIGL 1RUAH 2HT3D 5FGCB 3D5OF 1JI1A 1DQLL 1NAMB 5IQ9B 1AGDB 2IG2H 3CUPA 1KPUA 2PO6C 1S3KL 3GMRA 1NUDA 4U3XA 4UILL 4IEFB 2VC2L 1R3JA 4HIIA 2CRIA 4L4JA 4LCWB 3RKPA 3BX7C 1U6AL 2A9NH 5CEZD 3BSZH 4G9FA 4GG8A 5BVPH 4PS4L 2FHCA 4LHQB 3VFWB 3X13A 1ZLWK 3MCLH 4P9ML 1S9KC 2OTWA 3BRGC 3ZYIA 1AO7A 2Z8RA 4WCYH 3V6BR 2AEQH 2WBJC 4Z7UA 1VPOH 1BLNA 3VFVA 4OFYA 1CYGA 1H9VA 5D1QB 3TN0B 2IFGA 4JKPH 5DJDA 2ZSVA 5HDLA 3QDJE 5DQDL 3MLXH 1R3HA 4HWNA 1DEEA 4QXUL 1NQBA 4M03A 4GRWE 3AREC 3E6FA 3VFUB 3U9PL 4PG2C 5GRJH 4PP8C 2IMMA 1X5KA 3SCMA 2AJSL 8FABA 5I6XB 2NMSA 5HYQB 4QNPF 3TO4C 5DEGB 4JPIB 2W60B 3ET9F 3U30C 1SEQH 2EKJA 1TETH 3MNZB 5D2NE 4OGXL 2F8OA 1IMHC 4X83A 1MH5B 1ZA6A 5LBSL 1T66C 2F58H 4MD4A 4UOW1 4XXDA 4OTXL 2PTTB 4Q74A 4JDVB 4LLDB 1MAKA 2VH5H 4DKFH 4ORGB 1GGBL 3WFDL 2CRZA 3TA3D 1XGQB 4IDJL 3QUKB 4U6YA 3BIAX 1X7QA 1L0XA 1JJUA 4Y4HC 4JANB 3TNMA 1QKZH 1XGUA 4I77H 2ZUQB 1BFOB 3V0AC 5ENWA 2HKHH 1UXSA 4MAUL 3O4OC 1VFBA 2FO4A 3RVVD 1YEIH 5C0BD 3I9GH 4PRDB 3OV6A 2Y7QB 2GTWB 1N7MH 4R6UA 3V8CA 4HKXB 3NFPA 3S4SB 3RDTC 1IGCL 4PR5A 4GAJL 3HE7D 2APTA 2XQBL 2E7LE 2G9HA 3FB5B 2R1YB 3R0NA 2XKNA 1I1CA 1FC1A 4I48B 1NEZB 1B0GA 3FB7B 1SJXA 5BS0E 5CGYC 1U8HB 4TSAL 4O51B 2XKSA 3H9HA 2NXZB 3MMEA 4K8RL 4Z7OF 3KXFA 2HLAA 5DJZA 1KACB 4P5MA 5MHSE 5JOFB 3U46A 1KJ2B 1BZ9B 5GZND 4C55A 4P2YA 2FJFB 1Y6KR 4L4TB 3IXTB 3SDXA 2J8UF 3WS3A 2VQ1A 3W81A 4FTVA 3E2HB 3RTQC 3QR2A 1W0WA 4U1SB 1GOHA 1YEKL 4YUEH 1FL5A 1CTOA 4FQLL 3STLA 4F7CB 4Z7VF 2EDWA 1P6AB 3G04B 1NCAH 4EZMA 4PRHA 4DZ8A 3THMH 3BGMB 3DURB 3D9AH 4OLWL 1G9NL 3ARBD 3N1GC 1IVLA 5TGBB 4KJQC 1FFOB 5SWSA 2FH6A 4IRJB 1FIGH 2E9JA 4OFIA 3IDYC 3D69B 4QCIB 5F7HA 4UMGA 4NUJB 5J9PB 5JA9A 1S7VA 4JFDA 5F88A 4QXGL 4YQXL 3MNVB 4HUMB 3C5SA 5DUML 2CH8A 3BUTA 2V7HB 3QJFB 2DLIA 3TFKD 3NPSB 3BPLB 2NY4B 5FYJD 5IR1A 4AENA 1C16A 3IVKB 1D5ZB 1UQSB 1WAAE 2ENYA 4FXGB 3MBEA 3L3KA 4NHCH 2ZUWA 1RJLA 3TT1L 3FMGL 4NHUB 4UV7L 4W6WB 1WT5A 2X1WL 4JFYA 2CDEB 4MDIA 2E5EA 4DZBA 4APQB 1AR1C 3FRUA 3K1KC 1N0XL 2YHGA 4PJBF 1M7DA 4JFFA 5FB8B 1BZ9A 1A6VH 4HXAL 4MAYD 2DYPD 4FFYL 4IJ3B 4L3CB 3Q1SH 4TSBH 1CVRA 5IFJB 2HT4D 2VN4A 2DQCH 4U49A 5D5MF 5KG9B 4H5SA 2VR4A 5HHME 5K9KA 4XNMA 4G8EB 4KK5C 4AQOA 1CVSC 1XR9B 3JWOL 1PW3A 1KJ2L 1NBZA 4RWYH 1B4RA 4TVPH 4MJ6B 2DL9A 1UM4L 1A8JH 2LVEA 3BYYA 1CD1B 4JFOA 1CD9B 4I3RH 4M43L 4FP8L 5DA4A 4Y5VA 1I1AB 1NKRA 2OL3H 4FQXD 4F7PB 2HJKA 1LVEA 3MLYH 4HT1H 5T1KD 4DVRL 3EFDL 3RX5A 3BKYH 3T3MF 3IDGA 3OKNA 5E08H 4F58L 4AM0B 4PRID 3C5ZD 4PGZA 1JPST 4ELMF 4OCMC 2WWKT 2R4SL 4PGCA 1GHFH 4X6FB 3MACH 4ZMAT 1NMBL 4LLDA 3SJVE 2W91A 3HAEH 1XCQA 4P23D 5DD0H 4JPKH 1A7PH 2UVEA 5B39B 3AY4C 3EJZD 5DI8A 5KSUB 4UDUB 4EOWL 3VFSB 1WCBA 2J88L 2F54A 1FNAA 1AP2A 5L2KA 5I2IA 4M8QB 3MOBH 1CQYA 5F1OB 2AK1L 3SE9L 4NNXA 4HSQA 1NCCH 1EX0A 2ID5A 1VGKA 2R29L 3A6CL 1I1YB 4OGYH 1VGKB 1MVUB 4K9EL 5GZNC 3IGAA 4N0UE 1S9XB 3RZCD 3O8XB 4BQCA 1KG0B 1INDH 2ADIA 1WCBB 4PJDF 4QWWD 3IS1X 4N0CC 4GLRI 1UGNA 2O5YH 5CIPA 1QUNA 3F65A 1OLZA 1OT2A 5DI8B 2KPNA 5IB2A 1EVUA 5C8JA 4JKMA 3PQYA 3GSOB 1ED3B 1FV1B 4XBGA 4ZUUB 1GOFA 3UBXB 4IHOA 3QFJB 5CBAB 5HGAB 4GG8B 3L3GB 5ICYA 4XNXL 1V8HA 4RFEA 3FONA 3QRFM 1B4JH 1KCGC 2FBJH 1V3JA 4QRPD 3MA7A 4KAQL 3UTZA 3PE9A 1FDLL 4Z0XA 4YXKH 3RWGB 3ARDC 3CNKA 2X6MA 4ZXBD 1PKQB 5EU6B 1DQDH 5E99L 3RUGE 3FHQA 3QDMB 1DBMH 3JV4A 3TCLB 1IEHA 1FL3B 5DUBA 3ZDXE 2EXYD 2MHAA 3QDME 4OKVA 1KLFA 1GZQA 3MBEC 3TBSB 4PB0H 2ZCHH 3SEPA 5C0BE 3OJVC 2BVQA 2CKBA 5E2TH 1U8JA 3VCLB 4X6CF 1FNEB 3HG1D 4BFBD 4WU7A 3D3VB 3QEQA 5SX4I 3IDJA 4RZCA 4UIMB 5JOEA 1E4WL 5C0ND 4HS3A 4M5ZL 1BVKA 4JRYE 4NZRL 5IW1B 3G6AB 3F62A 5BJTB 1ZVHA 1OAXH 4IMKA 4LSSL 3CK0H 5EZJB 2YA2A 2DYPB 5EC2A 1XF4A 4UNTA 4HIHA 4IS6A 4XCYA 1MNUH 3M8OL 1YPZB 1OAQL 4ZDHB 2V2XB 1S8DA 3QUXC 2R0LL 3QIBB 4UQ3A 5HJ3B 2GJ6D 4MJ5A 3NA9L 2E7BA 3PP4H 3O4LA 3ES6A 2VB5A 1G0DA 2UZIH 4G6JL 5E95B 35C8H 5IR1B 3LB6C 3O4LB 3P4OA 2OSLB 4ONOA 1G9EA 4G6AD 1T2JA 3HI5H 3TVMA 3FO1A 4EI5C 2DQFB 1GH7A 2XT1B 4OCXH 3CXDH 4XVTH 3UTTD 1FO0H 5C0NC 5F7UA 2EC8A 5F1NA 2CO6B 1R3LA 1KTLA 1OAKL 1Q9OA 3K4ZA 4LCIH 5J6HB 1MLBB 4I0PD 3ZE1E 5JMRA 5TGBA 5IW1A 2ZZUT 1VFMA 3O3EB 2WW8A 1E4KC 1AO7D 3GMOB 4F7MA 3QUYB 3RJDA 4HJJH 2PKDA 3SY0B 1P1ZB 1FL5B 3HR5A 3ZKMD 4Y89A 3P30H 2DN7A 1BFSA 4HW6A 2NW2B 3LHPH 4NFDA 4XH2B 3TM6A 3HZMA 4NKQB 3C09B 4WWID 3VXTB 5FDYA 1LO4H 3TWCL 5L9DH 2FL5A 3VXMD 2DQGH 5CKGA 1K4CA 2A74B 4PJ9C 4R8WH 2AGJH 3ARFD 2VXTL 1N3NB 4KUCD 1GXEA 2GCYA 4HZLA 1YEHL 1BZQK 1QR1B 3V52L 4Z77B 2AXFB 3CMOH 3MJ6A 1T22A 2BDNH 3KDMB 1KN2L 2HVJB 3OKEB 5EIQA 4L9DA 4LCCB 5K9JL 4O58L 5GSRA 2QSVA 4M8VA 3DIFB 4Y1AD 2EEAA 1FV1A 1IFHL 3L1OH 3SOBL 3KR3H 3NFPB 4WW2F 1EDQA 3WCYA 5IB2B 1SEBB 3B5TA 3DHMA 4PJIF 2QV2A 1ZAGA 3JV6B 5FKAB 3NZ8B 5IVZB