2ZOLA

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
273
structure length
258
Chain Sequence
PHSMRYFETAVSRPGEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 62
structure length 258
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zolA01
5DDHA 1YPZA 5IVOA 5FK9B 1A6WH 4Z0XB 1CU4L 4M8QA 4C55A 2Z31C 1EERB 4X4YB 1FYTA 1CR9L 1MCNA 3OXRB 2A9ML 4H8WL 2BVEA 4JKKA 2CD0A 4KK9C 4M48H 2DQUH 1A4KA 4NGHH 4U6VL 3VD4A 5CZXD 1F4WH 2HT4C 2X1OA 4I1NB 1YQVH 4WW1B 3QUYD 4AL8H 1DTUA 4LVEA 1HCVA 1OGTB 1ZE3C 1EK3A 3PGDB 3KYNB 4XTRC 4G8FA 4Y5YA 3L7EA 3O4LE 1TDQA 3QJFB 5FHAH 1I1YB 1DEEB 4LHUG 3VXMA 2CXGA 2VZ3A 4TTDC 4KH2A 4DKFH 4G8EB 1D6VH 1YDPB 1RUPH 5MEPA 3TF7A 3T04D 2P5WE 5H2BB 3PQYD 2YUVA 1B0WA 2YPVL 3CVHB 5FDYA 4OLXH 4LQ1A 3S37L 1YECL 2DLEA 3O6LH 4V1DA 3TN0B 1S7SB 2VE6B 3UXFA 4APQA 4BSWA 5E8EA 2A0LD 4P4RB 1LDPH 4L9DA 3T8XB 5A2IH 3PNWB 4ZUVB 1IEBA 5KVFL 5KSAB 4M62L 1QLRB 4PJHE 1RJCA 4LSSH 1NC4D 3I3BA 4GAYA 1CD0A 4D0CA 4X5XB 4UDTA 4MAYB 2GSGA 3EOYG 4POZD 3AS0A 3D2UB 2FWOB 4OZHA 1WISA 2NLJB 1P6AB 3NABL 1J1OL 1HHJA 3INUL 4NIKB 3S3JA 3DURB 4HCRA 3QUMA 3GRWL 2DQGL 3GO1L 3GMRA 5CINL 4J8RA 3VFMA 2UY7A 4G5ZH 1DQQA 4HH9A 4XCNA 5ESVB 1MQ8A 3HZYA 43C9A 1IQDA 3KLAB 4FQJH 2AGJL 4IOIA 2D0FA 1YN7A 1EGJA 3HC0A 5IIEA 3IDNB 2FO1A 3QEGL 4YHNB 1JYWA 5JIPA 1NJ9B 1T7YA 2DBLL 4XZUA 4XPHL 3FB7B 4OZFA 2VKXA 1NCNA 2A83A 3I75B 4OCRH 3U82B 4DK6A 3TJHA 5I30H 3BOVA 4MNHA 2ZG3A 1WCBB 2EECA 4AM0A 2QTEA 4J3XA 2XG5A 4X5LA 1J1PH 5K9OB 4MXQA 4HGWA 3B9KC 4P57A 1XF2B 4KQ3H 2W38A 4M9PA 5DVNA 3ULVL 1J8KA 2WIIA 4L3CA 4Z95H 5GRXG 3DO7B 4IRSB 4LMQI 2FSEA 1C7SA 1QFOA 1YEGH 4KRMB 4ORGA 4TSCL 5FKPB 1MCBA 4F57L 1FAIL 4S1SH 2MQ0A 1DSFL 3GIZL 4M6OL 3T0AA 5KS9F 2ZUQB 2OJEA 2VL4A 3JTTB 2GAZB 2W60B 5IMMA 5D7SH 3BZ4B 3S96A 4DAGH 4D9QE 4HBCH 4NP4L 4X7FC 2EXWC 4LNRA 5LGHH 3IGAA 1YC8A 3FFCE 4NKMA 1KEMH 4HULB 2YD1A 2G60L 4WTWA 5EC1A 1FZKB 3FCTA 2HMIC 2VXQL 4K2UH 4NFBA 4PTUA 2DM7A 3GMNA 3RX7A 1YPZE 4AY0A 3QJHB 4N1CA 1WIUA 3C5JA 2Z35B 5EIVA 3VFSB 4XRCA 3VH8A 1DN2A 1PG7X 1N3NB 3WHXA 4HDIB 1Y0LA 5CGYC 3NACL 3PWLB 1FYTE 3TZVB 3M8OH 5DUMH 3DJ9A 4MSWA 3HC3L 4B7LA 2YD3A 4XMPL 3E2HA 1MCRA 5EBWB 3IDMB 3A67H 1XIWC 3WFBL 3DETD 3WHE1 4YBHA 4NKQB 4WEMB 4X0KB 4HKBA 3AB0C 1S5HA 3HE7C 1NBQA 3GB7A 4Y2DB 4JY5H 3S5LA 3U2SB 3KXFA 1QP1A 3QUYA 1EZVY 1L0XA 4R2GD 3RU8L 3VXME 4CMHB 2GJ6B 2C3HA 1KTDA 1UWEH 1NC2D 3VFTB 3C5ZD 3ARVA 4P3CH 4JKLA 3D18B 3NIFF 1EH9A 3QFDA 4ZXBD 2HWZH 4LSQH 5JXEC 3TPUB 5GGTH 4CJ0A 4PGBA 4V1DE 4DKAA 1CGYA 3BP6A 4OZIF 2I9LB 1IL1B 3PQYA 3O4OB 5EU5A 3UJIH 4MXVE 4L8SC 3AY4C 1TZGH 1U8MB 4NJAL 1E4KA 4Y89A 2AJXL 1ITCA 1JF5A 2HVJA 4JQXC 4YAQB 4I18C 2FZ3B 5C0FA 1W72L 4KI5F 4UB0L 5C70A 4OZHE 1CU4H 1U58A 1KTLB 3QULB 3BW9A 2DQEL 3WFDL 4DK3A 4X7DC 4ODXB 1U8JA 2BFVL 2VZSA 4O51A 1CR9H 2UYLA 2YBRA 5D93B 4H8WH 5CGMA 1A6UL 4U6VH 5GSRA 2GITB 5DRXB 3GSQB 2B2XL 3A6BL 2APBA 3GJFK 5TPWH 3RPKA 4ELKB 2B4CC 4TUOA 1KJ2H 3T3ME 5JUEL 4DGIL 5DHYB 5I18L 2OSLA 4UBDC 1GZQA 2X4RA 5CEZD 2GQHA 2Q7NA 1A02N 4WIQA 2HT3C 3SGKC 1C7TA 1BOYA 2HRLA 1PFCA 3DX9A 2YA0A 4XBGA 4NN6B 3CFBA 4JFFB 2VR9A 1BAFH 2XIDA 4N1EA 4JREC 1T1YB 4HX1B 3V7AG 3MFFB 3P4LA 4U0RC 4YK4B 1IEAA 1FRGL 4GRWB 5E8PA 1NEZA 1BF2A 3TGXA 5EU4B 4OQ1A 1MCOH 4L8DB 4DFHA 2YPLB 1NFIA 1JHTB 1G1YA 4GKZA 1HE7A 2X2YA 3N1MC 4JZJC 1FO0B 2YC1A 1A1NB 4M62H 4MCYA 1EEYB 1NUGA 4CW1A 4BA8A 5KANI 4PV9B 1G6RB 2H26A 5C09D 1F5WA 3B2VL 2CSPA 5CAYB 3NABH 4OI9A 2YEZA 1J1OH 2DIAA 3MLZL 4JY4B 3FO1B 4R97B 1CFSB 2FHBA 3GRWH 2DQGH 4Q58C 3GO1H 1WUNT 2YUXA 5CINH 5F7MC 1H0DA 1XGPB 2XZAH 1WQVT 3CX5J 1UZ8B 2HKFL 2IMNA 3PL6B 1A3LH 1H3XA 5HI4C 1HQ4B 1J8HB 4R7DB 4N8CL 4EI5D 3GMQA 2BRQA 2IG2L 4HWBL 2AGJH 3MZTA 4M00A 3TBSB 2WWMD 1J11A 3GMLB 4BH8A 2MQCA 3QEGH 1U8KB 1Q94B 4QRSB 1UKTA 1YA5A 4G42B 5ALBH 5EO0A 3P9WB 2RAMA 2XNAB 4K23L 1WAAF 4I3GA 4YIQA 2ZUSA 1FVEA 4QRUB 3OAUL 4ODWA 3FZUD 4I5BB 3FKUS 4OLEA 4PB9H 2D4FA 4F9PA 2IBZY 4IEFB 4FRWA 1ETZB 1YMHB 1DQJB 3LKNA 5C0AB 1YNKL 2AXGA 4HIEA 4RFEB 3FFDB 3QO1A 4XPAH 2P8MB 4P59H 3QI9B 3MO1B 5JOPE 5AUMA 5I2IA 3OKDA 1GZPA 4PJEA 1YJDC 2XYCA 3WKNA 2W0PA 1HEZA 3DV6B 3H3BC 3KXFE 2XZQL 1CFBA 2RFXA 1FAIH 1AKJB 3BSZH 1DSFH 3NA9H 4GRLC 1TLKA 4OLUL 4OT1H 1UADC 5J9PB 1C5DB 1DQLL 3QNZA 1U2CA 3DMMC 3RWDB 1UXWB 4NP4H 3PQYE 3PHSA 3RVXD 3BKJL 5AG9A 2IMMA 1DBBL 2ZOLA 4GW1A 4ONHA 1T5XA 1QO3B 1PG7L 2V2XB 4RZCA 3HG1B 4AH2B 2J6EH 4PJIF 5F70A 3PUCA 2HJLB 5EG6C 2DM2A 4OIAA 3CXDL 3U4BL 3FQUA 3SDDC 1R3JA 2EDLA 4RA3A 1MCJA 2BNQD 1K8DA 5CEYB 5B39A 5HGHA 4K3EL 4PPTA 5DURD 3ZT7A 3GI9H 4MA3A 1MFBL 4PV8A 3SGJC 4IIQB 2AP2A 3EJYD 3HC3H 3OKKB 4XMPH 1BBJA 3OKMB 1HHGB 3JV5A 5DFVD 1WZKA 1RZKL 2G9HA 5GGRA 1NDGA 3KYOA 2NY2B 2APXA 3NFNA 5FM8A 2IBZX 1BQHG 1WBYA 3GSUA 4H5SA 4OLZH 2A6IA 3MCLH 3ZKQD 2X44D 1BQUA 2DD8L 1E4WH 2YUWA 4JLRA 4Y4FC 3OKEB 3E3QC 4PLKD 4LSPL 4X7EC 2C26A 2OL3L 4XGZA 3FO9B 3IETA 5IBTH 3FO2A 4F37F 2ICCA 5I71B 5D1XB 2YMXL 3VGAB 5T1MA 4P5MA 2R29L 2P46B 5GGUB 2OTUB 3EW3B 4TVPE 1REIA 3GSNB 3B3IB 4HUKB 4NJAH 3F7VA 2AJXH 4XAKE 4JVUA 4QCIB 2YK1L 1AHWC 1B9ZA 3TEUA 3RZCD 3C6LC 5EOQH 3LQAC 3O2WL 4AIXA 4Z7UF 1RHHA 3LQAH 2PCPA 3D69B 5TDNA 4L3EB 1W72H 4BK5A 5JQ6L 5I8OL 3DRQB 3QUKB 2DQEH 3LEVH 3WLBB 4NFDA 4F2MA 4X9IA 4M6ML 1CE6A 5C09A 1ZLSL 1A6UH 1BOGA 4LCCC 2EZ0D 5ESQB 3A6BH 3DYMA 5ELIA 1V05A 4LEXL 2IADB 4U33A 4HC1A 5ID0B 1I1FB 4KXZH 4AK1A 3DGGB 3MLWH 3EOAB 2AW2A 3SOBL 3WNLA 4M93C 1TJHH 1OGTA 4M43H 3TO4B 4ZO8A 3MRFB 3NBNA 3D25B 1S7VB 3RY6A 43CAB 3I6KB 3WNNA 5DJYA 1HI6B 1TZHA 1IGIL 4PRDB 2GCYA 3WSQH 5B21A 1LQSR 4XNMB 3RTQD 4XNXH 4O58L 4AEEA 4EI5A 1MRFL 5ACZA 3LHPL 2P4AB 2VDNH 4IS6B 3SO3C 5IHUL 1FRGH 1QG3A 4P3DA 5H2BA 4MA8L 5E95B 4NQTA 3WJJA 2CKBA 3T0EB 2R1WA 3W5MA 3WKML 3UTZB 4DEPB 1S7SA 4HAFA 5SWQA 3STZA 4ENED 2GI7A 4KJQD 4YDJA 3LS4H 4MQSB 3PP4L 1NGYA 4PJXA 5J3HD 3LS5H 2XQYG 4LLAA 4HCRL 4PJEE 3RNQB 3QUML 3WE6B 1T03L 4FHBD 2E27L 2VL5B 3EJJX 2PTTB 3B2VH 2A77L 1AC0A 3MLTA 1ACYH 4GAGL 3HZVB 3MLZH 3L3KB 2D0GA 3W39B 2DLFL 4ZPTB 5KG9B 2A6KA 3NCYS 2BXYA 4ELMF 3LAFA 5IMLA 3QDGB 3QAZC 4PJ7F 4QGTA 4I9WE 4PJ9D 1EGJL 1EFXD 1JRHL 4FQCL 5L0QB 4FQQA 3X12B 3F7YB 4N5UA 1BD2D 2VDKL 2V2TB 1LGVA 1LEGB 4G80B 4KKLD 2AXFB 1I8IA 2LAAA 2OMNA 5ETUB 5FDWA 1MLCB 4N8CH 4LDLB 2W9DL 3JZ7A 2IG2H 5JLZA 4HWBH 3IDJA 1U2HA 3RWFA 2W9LA 4WWKD 2OK0H 5LG1A 5KAQG 4CMMA 3QWRA 4NO5B 2R0KL 2FEEI 5FGBA 3JWOC 4HUWB 3FB5A 1D5XA 4LARL 2GW5A 3RUGF 5MP6H 4M1GL 5DSCB 3I75A 3NN8B 3VFPA 3FL7A 4J3SA 4ZG1A 3CH8A 1WCBA 1WTGT 3AAZA 2CH8A 3MSPA 4MHHI 2C9AA 4OSUL 3CFEA 1DLFH 3T08A 4W4OC 1HHHB 4GMSL 1WFTA 4LCYB 1HHKB 2IPUG 3VD7A 5IW1A 1FAKT 4JGJA 3UO1L 1KG0A 3DUSB 3ZE0E 1NCWL 4KKBD 2DKSA 4WY7L 1K4CB 1SYSB 2ADGB 2P24A 4GOSA 5FB8A 1DQLH 4YFDB 1U3HD 4XP4H 5EOTB 1KXQE 2QQNL 3NZ8B 4YGAB 4PGDB 4HPYL 4XNQA 2WUBH 1PJ9A 3LN9A 4GXUM 1GSMA 4GG8B 3BKJH 4U1HB 2IH1B 5CEXB 4FTVD 1DBBH 2J5LC 3BMVA 3EYVA 4HF5L 4Z77A 1PG7H 1I7ZB 1H5BC 3EGSA 5IHZB 4Y4HD 1MH5A 5FHBH 5JHDD 5IOPB 2E6JA 3PV6A 5IBUG 5J0BA 5I6XC 3U4BH 1IGML 2JELL 1J0KA 4MQ7B 5M7QA 3U1SL 5DF0A 4ALAL 2LABA 1X5HA 1F4HA 5HSFA 1HKLH 4K3EH 2V2WA 5EOCJ 5J1AA 3PWLA 4LSDA 5BO1H 5JO5A 5I1LB 2DQJH 2VAJA 4X6CF 5DHVA 1CLOL 4F9LC 4Z76B 2ZP0T 3ZZ1A 1FN4B 1UCBL 4L4TB 1D9KD 5I17B 2H8PA 4KK5D 2X4PA 3MOBH 5F89A 1KCVH 3JXAA 4KK6C 1N59A 2DD8H 4AG4L 1K6QL 4YBLB 1DANU 2AABH 2ZOKA 3KPPB 3MGAA 4OF8A 4P48A 2ED9A 3QIUC 4YXLL 4Y4KD 5F3HB 4Q97A 3I6LD 4MXWH 4GRMB 4Y5VC 3WFZA 2AEPL 3ARBA 1JRHI 3D18A 2J3SA 2XKNB 5GGSA 3SBWC 4PRHD 4HUVA 4WW2A 5ESAB 3V2AR 4OTXH 2R29H 4KK8D 1Y6KR 1N7ML 1N0XL 4HZLB 4JAMA 1IL1A 4XBPA 1CICC 1NC4B 1ZWIB 5J6HB 1JGDB 3V0VA 3I2CH 4PJXE 2CLZA 1YN6B 1S9XB 1UENA 2AJ3B 3O2WH 4EZMA 3BAEL 3FQXB 1OT1A 4QXUH 5JQ6H 5I8OH 2YHGA 4XB7A 1CT8A 4PG9A 1KIRB 1NBVL 4PJBF 5F8QC 1ZLSH 1JPTL 1MJ8L 2OTWA 4EDWL 3TBTB 3ZDXF 2GITA 3CLFH 4LEXH 3SJVD 3WV0A 1JGLH 5F7DB 4JFOB 5HGDA 5HYSA 2BHUA 1PBYA 4U6YA 2PETA 4WVRA 3GUTB 3SOBH 5I8EB 2CUMA 3U83A 3WFEL 4U1KA 1BD2A 4JJHA 4GG6B 1IGIH 3PABB 2C3VB 3IKKA 2Y06H 3O81A 2R1YB 2R69L 4JFHD 4O58H 4TVPL 3QRGL 3LHPH 2ESVB 4P2OB 1Z9SA 4PP1D 4HS8L 2A38A 2Z8RA 4IMLA 4JZOB 4NZUL 5D2NC 3WJLC 3P4OA 4L3AA 4OIIL 2M8XA 4BQCA 1KENL 1DBML 3QZWA 2DWDA 4C83B 1JHTA 5CHNA 1KN4L 2FH8A 3CSYA 3SE4A 1WTLA 3PP4H 5SX4I 1AI1L 4FN0A 2UWEA 4PRBA 4H1LH 1WLHA 4X9HA 1TVBB 1AGEB 1T03H 2J8HA 1JPST 4U3CA 3VXUB 3W11C 2E27H 3CU7A 5E00A 1U8LB 4QRQB 2R39A 5D1QC 5SWZD 2MMXA 2A77H 4A2MA 4GAGH 3U6RB 5L2JB 5AAWA 1PGRB 2EDRA 3GGWA 1HCFX 1IAMA 3RIAK 3FO1A 1KPVB 1AY1H 1UWGL 3IT8D 5KN5B 1A22B 3H8NA 3JTSB 4ODHH 5D7KE 4FQCH 4GLRI 2RIKA 5ALCL 3CXHK 1AGCA 1UZ8A 5KVDL 3T4AB 1YEDB 3O6FB 3QIBC 2IAMB 3F65A 4NT6A 2W65B 5C6PB 1A5FL 1YEFL 1H3TA 2PN5A 2W9DH 3D9AL 4X7TB 3ZDZE 4JQVA 2E9BA 4LOUD 2C5DC 2R0KH 2VZ1A 3KLHC 5DJ6B 5IF0A 2VMFA 5HDBE 1DVFC 2Y5TA 1JI1A 1QEWB 3KPRA 1JWSA 5JHDA 1YY8B 4DWHA 1IBGL 2XZCH 3KS0J 1CGSH 4M1GH 6FABL 2CUIA 4JO3H 4QRUA 5EC2A 5D9SA 5JW5B 4IHOB 1WIOA 3CD4A 4WV1B 4KV5E 3MOQA 5CJBA 3TNMB 4B41A 4OSUH 3UYRL 2JJVA 3WN5C 5JOFB 1F3DH 2P8MA 5F96L 1LEKA 4R2GB 4EXPX 1NANH 1OWRM 3LB6D 5ISZA 1NC2B 2JIXD 4ERSH 1UCTA 3C5ZB 1D9KA 4PJDA 1OAYL 1UM4L 3MJ7B 3UO1H 4JDTH 1CGXA 1I8KB 1LILA 1Q9LA 4LCUA 4XHQA 1NCWH 4ZXBB 4WY7H 1AKJA 4JFZL 3D6GA 3OKLA 3BVNB 4UU9B 4S1DC 2QSVA 4UMGA 2QQNH 1ZLWH 4PRIA 1A7PL 4XCYB 5F1KC 4JFEA 4HPYH 2QL1A 1LK3L 1UXWA 4L8CB 1VEMA 1J0ZA 3M45A 3NCCB 1V7NL 3QXDB 1G9NC 1KFAL 1WIPA 2QSCH 3VXTB 2ERJB 3GJFA 3UTSD 1I75A 1DLHB 2KUTA 3OKNB 4DVBA 4MB5A 3QXWA 4LAQL 4OZGB 5BVPL 3CDYA 2D7OA 4FA8A 5DK0B 3LRGA 3RQ3A 5IESL 4ALAH 2FECL 5J56B 1OGAD 2QR0B 4LEOA 5ITFB 2OQJB 3BN3B 3DHMA 5DR5L 4P99A 3D3VA 8FABA 5CJ8A 5DFTA 3FB8A 1CL7I 3BGMA 1BREA 1QSZA 3P77A 3OAZH 1Z5LA 2AK4D 2W1NA 2X4OB 3H3PL 1PX3A 2N56A 5E03A 1ZHLB 1BD2E 1EXUB 2XZZA 4EVNA 1K6QH 5ICXB 2DMCA 4JKPL 2W0FB 5L2KA 5A2JH 4N9GA 1KCRL 4YXLH 1OVZA 3BP7B 2I9TA 2DL9A 2J4WL 5CD3A 3IFOB 5GIRA 4KDWA 3ARZA 3I3DA 1J18A 3LVEA 4XPTL 2RBLA 3VFNB 4F7EB 4NJ9H 1XF4A 4DGYL 2F58L 1MWAB 1NGPL 2H6PB 1RZGB 5A2KH 2GTZB 3FO9A 3T77A 3BO8B 5CP3H 3VXNA 5EN2A 1N7MH 1N0XH 5FO7B 4XMKL 5DEGA 3RVTD 2EKSB 4XNZB 5LWYL 4KUZL 2UWEE 1M6OB 4KRLB 5JZ7D 2BVPA 3NFPB 4FMKA 5B3NA 3K74B 4OCNC 3X13A 1YC7A 4PLNC 3BAEH 5D7JC 3K4DA 2F74B 4DVRL 4HC1L 4YPGA 1HYSC 4UTAH 4QY8A 4CADB 5EO1B 4JDVA 3CLEL 3MRLB 2A6DB 1NBVH 4BSVB 4FOMA 2AS5M 5DQDL 1JPTH 4EDWH 3NIDF 1Y18A 3HE6C 4UV7L 4OLYL 3VFWB 4QTIL 5CFHA 3C60C 2N7BA 1FNGA 3QCTL 1I1FA 4NWTL 4PJGA 1IKFL 3VI4F 1OP3K 3K0WA 3THML 2CKBL 2DTML 3NFSL 2MQ3A 1IAKB 4G7VH 3WFEH 3AFLA 3LEXA 1MHHA 4FP8H 1HYRC 4PRDA 2R69H 4G6AC 3L5WA 2QKIA 3WDJA 2FD6L 4JFYA 4TVPH 3MRDA 4LRNL 1CFQA 1WFNA 3PXHA 4K07A 4YHML 3KPRE 2D7QA 5JHDE 2BVOB 1RD6A 1WBZB 3PJSB 4NZUH 5GZOC 3T65B 4OIIH 3VI3E 1D5MA 1KENH 1T4KB 4WU5A 3TP4A 1DBMH 4MNQA 3V5HB 2ARWA 3BWAB 5D5MB 1CIUA 1CF8L 2NY0C 3QPXL 2F5AH 3SE3A 1AI1H 4TOYH 1SMAA 4U6XB 1E4XH 4YDLC 1DUYA 1TJIH 5GRYA 4HKZA 1P1ZB 4IRZL 5B4MC 5ISZE 2FECI 2NXYC 4N8VB 1MHCA 3P9LA 4H1LG 3TC9A 4TSAL 5TF1L 2X40A 3HZVA 3MJGX 1WGOA 4YGVA 5EZOL 2ZG2A 5EFIB 1FZMA 1VDGA 1UWGH 4JO2L 3S35X 1JNNL 3TA3D 2EIZB 4PRIE 3SDAD 1XGRB 1ODAA 4MDJB 1SJHA 4JFEE 5ALCH 2FB4L 3PWUA 3OR6B 4WGWB 3VXOB 5E94B 1OAQL 3UBXG 5KVGL 2FJHB 4F8TA 2VLRD 4OB5L 2AI0H 5F97E 3TYGL 1E28A 4HUUB 1OAKH 2VC2L 3MJ9A 2Z4QB 5DT1L 4HIIB 3DGCR 1N6VA 3KWWB 2BNRD 2BNQB 5E6YA 4GXVL 4CL7A 5D7IA 2HG5B 4Q7DA 1J05B 3UTSA 4KJYA 5BS0B 1KB5H 2FH6A 5BZDA 1NLDL 2CDGA 4HUWA 1EPFA 4NKOB 2MCPL 2VLKA 5JQHC 1CVRA 5IBLD 3VFVA 5L6YH 4JRXB 3D3VE 4NQCD 1F6FB 5C0RL 1MI5B 4ZTOL 2J8UB 2QEJA 1OGAA 4OCXL 1LP9F 4GRWF 1WT5A 3EFFB 2DRUA 4KHTH 3IFNH 1G7JB 3IXTB 1W8OA 3BFOA 1U8OA 5F96H 1PLGL 2R1XB 2Y23A 4R6UA 5FAAA 3RDTB 1IJ9A 2EE3A 5MEQA 1UM4H 3P73A 4YQXL 1F3JB 5L2KE 1P7QD 3T4YA 3HAEG 2AK4A 1BJ1J 3QUZD 2O61B 1Y6NR 2X9XA 1K4CA 5IFJA 1U92A 1YEJH 3BEVB 4LCIL 3PDDA 1A7PH 2WWKT 2Z93B 1QBAA 4BFIA 4V2CB 4C54A 5I1IH 3WUWB 5KSBB 1I9RL 1H8NA 4NPYA 4HK0B 4K8RL 2ZWLT 3QUXC 1UVQB 2X1XR 2RCSL 1V7NH 4XNUH 4ZAKC 4JPIA 5FF6B 4Y5XB 3RZCB 2EC8A 2G5BB 3K2MC 3TH2T 1A6ZA 5L9DL 1XF5A 1IILE 5ID1B 5BVPH 3WYRA 4DTGH 3OJDB 1G84A 1B0RA 4JEGB 3RI5F 4LPVA 1DR9A 2EEDA 2UY6A 5DMYA 2Q6WA 4ZSOB 1CXEA 1NAMB 1JHLL 3BISA 5IK3A 3FRPA 1B4JH 5FYKD 3ERYA 1KLUA 4JB9H 4MJIB 3W9DA 4FG6C 4PJGE 3SO5A 5GRWA 4EN3D 1FLTX 4G8IB 4K71B 2VDRL 3HNSL 2ZG1A 3OGOE 4LLWA 3RTQB 2NZ9D 4JKPH 4O4YL 3PE9A 2AKRA 1P7HL 2DI7A 4JANB 1ZA6B 2J4WH 5E6IC 3ILQC 5F7WC 5F3HA 3MRNA 2VDOL 2C1OA 4CVZA 4AIZA 1F11A 1LMKA 4XPTH 3TJEL 5AD0A 2NW2B 3VDAA 2F58H 3FQTA 3IKCB 1CLYH 4LVNB 4MNQE 2CO6B 2N4IA 3T2PA 4XMKH 5KW9L 4UUJB 1T7WA 2CIIB 4TRPH 5DMKA 1G7PA 3QDJB 5DJXB 1ZWIA 2GY7B 3QHFH 4QHMB 5FYJD 3KPLB 4AQOA 1CVSC 3SCMD 4G3YL 1NLBH 1S9XA 1HOCB 4YDIL 3CFKA 2BSTB 3WIHH 5D6DC 1J1XL 4DVRH 2NY4B 3IJHB 1OD7A 2V17L 3FQXA 3LQZA 5F9AC 5LBSH 4U1SB 5DJ2A 2PXYD 2FLRT 3EYQD 1BPVA 4PJ9B 1EFXB 1Z2KA 3BQUB 3ZKXB 4JDZA 4UV7H 3GIVA 1D3CA 2VAAB 5DD3L 5D71L 2HTKC 3EUUA 4TNWF 3STLA 3QCTH 4NWTH 3TA3A 1IKFH 3CJJA 3SDAA 5HD8D 3THMH 2CKBH 3NFSH 1P6FA 3CVHH 3MJ8B 4R26H 4WWKB 2Z31B 1CDYA 1LE9A 1XF3B 3P30H 3FT4B 4MS8A 3C2AL 2VLRA 4UIMB 1EHXA 2FD6H 4O02H 5B38A 3RPIB 4G9FD 4LRNH 5D7IE 1QNZL 5KSAC 5ABDE 5HI5D 4YHMH 3UTSE 3DRTB 4YX2L 3V79C 5CILL 3UTOA 1BFSA 2VLKE 1CXFA 5LCVH 1RURH 4JO1L 4MAYC 3WIFB 1EVTC 1OGAE 3EHBD 3QB7C 3SDYH 4KI1A 1FNAA 4NNXA 1A2YA 4P46A 3LRSA 1CF8H 2KQMA 2WV3A 3QPXH 4NQCA 5DQ9B 4RMUA 5C0BA 1YPZF 3ROLA 3MR9A 4OQTA 5DWUL 5LQBL 1MFEL 1LO4L 3FT3B 4PLJD 3QWQB 3S35L 4LSUL 5DJ0A 5E56A 2AK4E 3U7YH 5BZWB 1Q9OA 1EO8H 1U3HB 2H32A 4S2SB 3MC0A 3L5XH 1G7LB 1JZ4A 3BKML 15C8L 3B83A 5HHOD 1BVLA 5EZOH 2ARJQ 1P7QA 4JO2H 5DZLA 1TQBB 1DE4B 1FFOA 3HN3A 1AR1D 1BMGA 4R0LA 4RAUA 3WXVL 1EEZA 1FL3B 4DZBB 3ALXA 5DRZB 3JTSA 4GKSA 4PRPA 1S7QB 4FTVB 1JPFB 1NUNB 4OFPA 5D72H 2BNUB 1OAQH 5KVGH 1K5NB 1MQKL 1E4JA 5T1DH 2CPCA 4OB5H 4X6EA 3N1FC 4Y4HB 3O6FA 3G6JA 1L0YA 3RWCB 2VC2H 1CG9A 5DT1H 1FDLL 1CFTB 1AE6H 4LHUD 3LKRB 5T1LA 1KCSL 2IC2A 3HZMB 3E8UH 2EXYC 1A7NL 4OUOA 1BFVL 1RU9L 2MCPH 4I48A 2ORBL 4GO6B 5C08D 1QR4A 2JLLA 5F1IA 3FO0L 1HSBB 2X1PA 1KBGL 5C0RH 3ZL4L 1CWVA 2QADB 4X5WA 5GRVK 5GSVB 4R90L 1F13A 5IB2A 4IHOA 5TFSH 1W2KT 4N0CD 1RMFL 2A73B 5IWLA 3N85L 2ZUQC 1B3JA 4RNRB 4UIKL 3ZHLA 3CUPB 3G5XB 3P11H 3L5IA 4E42B 1PLGH 2P42B 2NR6D 1JGVL 3MPCA 4JHBA 1JK8A 1IAIM 3UEZA 5BW7A 1I7RB 2WINA 4Y4KB 4YQXH 2NY3C 2P7TA 2FX9L 3DBXB 3R1GL 2HFFB 3AMLA 4UDUA 1I8KA 3G6DH 5EA0L 2OP4L 4EDXB 4LU5L 1BIIA 3HLAA 4JM2B 4XP9H 4P23D 4PRHB 1RJLB 4H0IA 1GIGL 2EEBA 4LLYA 4G6FB 4ZFOB 2B8OT 1RZ8A 2VDLL 3KJ6H 5A2FA 1FC2D 4OV6F 4I2XB 5K9QG 4YDKL 1O5DT 1OL0A 1OTTC 1YNTB 3EOTL 4LP5A 1I9RH 4JFXA 4K8RH 4NSKB 5DA0B 2Z92A 4N5EC 2BSSB 5CKGA 5EZLB 3PHOB 1JWMA 1F4AA 1ZA3B 4FFVD 4LSRL 5DTFB 2APFA 1T80A 1EO7A 4ZUWA 2VZUA 5CUSH 3SKMA 3MRCA 3L6FA 5DK0A 1UJ3C 5B3JF 3SCMA 2VIRB 2IALB 4U1IB 4XPFL 4Y2DC 3TO2B 4O2EA 2D3VA 3EO0A 1JHLH 5CMAB 3SJVB 2VTFA 3BI9X 3V6ZB 5INCA 4CMHC 1G7HA 1R0AL 4Q9QL 5DLMH 4GW5B 3SPVB 4L4VB 3S4SB 1MY5A 3DV4B 1KELL 3BPNB 2B5IB 3BPCA 5B8CA 4KFZC 3BMWA 5BMFL 1T20A 5GJTL 1FGVH 2X4OA 4X4ZA 2HP4A 3MRKB 3QQ9C 4O4YH 2VLRE 2FYYA 3O4OC 4KPHH 5GGVY 3CZFA 1UM5L 1KJMA 3GSVA 4YDVB 2IFFH 1SVZA 5CD5C 5CBAB 1ORSA 3KPMA 3OJMB 1QFUL 3OX8B 1IAII 3G04B 3UJJH 2YKLH 4G9FA 3B6SB 1IAOB 4R4BA 4P3WA 1WJ3A 4RRPG 2L7JA 3O8XB 2K1MA 4LLDA 4I8DA 1A21A 5F7UA 2ENSA 2OJZH 5DXWA 4LPYA 4ZQKA 4NQCE 5C0BE 3AM8A 1KB9K 5SWZB 1B0GB 4G3YH 5DGQA 5TJWK 5GS2H 2IPUK 1ZSDB 4PJCB 1WBXB 5I66B 2PNDA 5KOMC 1A7OH 5SX5H 3MNZB 4LAJH 1BVZA 3C08H 1T2QL 3K46A 4OGAD 4Z7NF 2BP3A 3EJZC 1BZ9A 4PGJA 1GOGA 5IB4B 4NN6C 3RL1B 5FCUL 4QHLA 3RBGA 4PRPE 4NC2B 3K80A 3RGVD 5DD3H 4HUNB 4I18B 4M4PA 4YK4C 2V7HB 2PR4L 4POUB 1S7TB 4MQXC 3ULSB 4NQUA 2XACC 3B8YA 4GRWH 5DVLA 3QPQC 4C59B 5E8OA 5H94A 4D0BA 3C2AH 4KVCL 3GMOB 1QNZH 5HHNB 4M7LT 2HKHL 2DYPB 4WFGD 3PWPD 3N50A 3O45B 3NZHL 5CILH 5FV2A 3QQ4A 1AJ7L 2FIKB 1HSAA 3MV8D 1X5JA 3MYJA 5F88B 4LHUA 3QG6A 3L3OA 4GBXB 3BXNB 1QSVA 2X9WA 1G6RH 3DVIA 2R0WH 3RVUD 4PJ8D 3V5HA 4Z7QF 4NRYA 4PGZA 3S6CA 5T5FL 3SKNB 4HWZA 4A6YA 4QHKI 2JIXB 1NSNH 3FB6A 3ZYJA 5JIIA 1A1MA 4U0RB 2DB8A 3AXLB 3L3HB 5DWUH 5LQBH 4N0CA 3M17B 4KROB 4P2RA 2DLIA 2E7CA 4WTZG 4XWOC 1KIUA 4XHJC 3S35H 4LSUH 1R3IL 2P8LA 3ZE1E 1QFWM 3PL6C 1YY9D 4R7NA 1JV5B 2VB5A 3VXSD 3BIAX 4JZJB 3BKMH 15C8H 5AZ2L 1K3IA 2ZUYA 4QNPE 1INDL 1W0WA 2WLYA 2W91A 3PP3H 1LK2A 4NO3B 5EFIA 1UC6A 3MJ9L 5GISL 4ZFFB 4Z78B 3W81A 5IMKA 3FN0L 4P23A 5KSUB 1DQML 4PY8I 1TETL 4QRPD 1MQKH 3ROOB 3DSFL 4MWFB 3V4UL 5E94A 5IKCB 1BEYH 4KK9D 2ADJA 5GGRY 5BV7B 3OKYA 2Z91B 1Q9WA 1VADB 3OR7B 3UPCA 1HQRA 4OGZA 3LPFA 3WD5H 3B8SA 2P5EA 3NTCL 3IDXH 5FA3A 3HPJA 3QI9C 4XTRD 4GG6F 5EUOA 5KZCB 1LD9A 1M7XA 1KCSH 3ARFC 1A7NH 1RU9H 4WFED 1FHGA 2ORBH 4GH7B 3X14B 1INQB 1P2CB 3VFOB 3FO0H 2WLZA 4TTDD 4K94L 2Y6SD 5BVJA 3ZL4H 4J3WA 2JJSC 3MRJB 4R90H 2ATKA 5FFLA 3N85H 3MRRA 4UIKH 3ARDB 2CLRA 4H25A 2AQ2A 4NUJA 1J87A 1JGVH 4XWGL 4ZPVA 1NEUA 4BFEA 1ZHNB 2ARJA 3QBTB 4MDIB 5GPRA 3R1GH 1KPRB 1BWWA 4Q6YA 4PBXA 5C0GA 4LU5H 1BVKB 3SY0A 4PGCA 1F8TH 4KZEL 1I7TA 2YXFA 4NQEB 4LFHD 1T1XB 1U6AL 2ITCB 2VDLH 4RMTA 4CDHA 4KQ4H 5I1DB 2BSRB 4NZRL 1HIMH 3BP4A 3BZFB 2IQAB 3N1GC 3EOTH 1TCRA 4N0UB 1QFWI 5IROA 3H9HA 4LLMA 3TVMD 1HWGB 5E2JA 5GRZA 2MSPA 1JCKA 3ULUF 3V8OA 5JPNA 4QRTB 3TYFB 4IIQC 1OT2A 1MELA 3GBML 4FXLA 4OUUA 4LSRH 1HH9A 2H1PL 1MSPA 5GS1A 3RIFF 4U1NA 2JJTA 4E9LA 2FX8L 2EYTB 3MBED 2WY3A 2NY2C 2C1PA 3Q3GB 4XPFH 3WO4C 3WS3B 3SGEI 5KVMC 4RBPH 4RMSA 3FONA 4XT1C 1R0AH 3AREB 3K2UL 1VA9A 4Q9QH 2DQCH 3I02B 5BRZA 3PF2A 2H2PD 1M4KA 4MGXA 4ZUTA 1KELH 3HCVA 2KZ1B 1C16A 5BMFH 4HV8A 5GJTH 5I71C 3LN5A 5D1XC 2DM3A 4HT1L 2MPAL 4RX4D 3U0WH 3IXAA 5AEAA 1IM3A 1A1OA 3DYOA 4EQ2A 3GSNH 3OKOB 1R3KB 1RK0B 2AV1B 2ICWI 1BIHA 1QFUH 1Z6JT 4LLVB 1GPOL 4J1UA 1U3JA 4OAWA 1AGDB 4PY7B 4JRYD 5DC4B 1JTPA 1KXTB 1ZLUH 3UAJC 4IOFC 2A74A 1CGTA 4M1CD 3LN4B 4DKEL 5I1GL 4Y4FB 2ADFH 4HLZH 1RAMA 3QIWD 2R4RL 4NUGL 5TQ0L 3KYMA 5MERB 4Y5YC 4S11A 5F7FA 1ED3B 3DOSA 2QQQA 3D39D 1IZJA 4PJ8A 3KPLA 4P9HL 4BZ1L 2XFXB 4P2RE 2HN7A 4UNVA 4OZ4B 4FZEH 1V8HA 1TFHA 4PIRF 4NN7B 4EUPB 3CFCH 3TO4C 4OZGF 1VGEH 1T2QH 1AGFB 2G2RA 4U31A 2XTJB 3QXVA 1C5BH 4HMDA 5FCUH 3VXSA 3MA7B 3ECBB 3FOMB 5D1ZD 1BECA 1I85A 4BM7A 4PP2B 4DCQB 2JB6A 4MJ6B 1U93A 4HG4J 5JXAL 2PR4H 2ZCLL 3KHQA 4CAGA 3T0EC 2LAGB 3ZE0F 2BNRB 1LE5B 2Z31A 4DEPC 3MRHA 1XIWD 4Z8FH 5E5RB 1R5WA 1W8NA 2P5EE 4Q9RL 3KDMA 2HKHH 5HHMD 4ZOCA 4W6WB 3HMWL 5DD6B 5EUOE 3FAWA 2Y36H 1ND0A 2MKWA 2X4NB 3NZHH 4OQTL 4MJ2A 4ETQB 3HI5L 1T21B 4NQXB 1PYWA 2E9WA 4MD4B 5IMOB 3ES6B 3MRIA 1NMAL 2Q76A 5HY9B 3U4EA 4NHUA 2FL5B 4F7MA 3NCYP 3O41A 1DN0B 1MPAL 1RIVL 1WWWX 3ZSTA 1ES0B 2V6HA 1QSFD 1F97A 4U1MB 5EBMB 5JXED 3VD3A 1EMTH 3UPRB 3ESVF 1RV6X 2IH3B 3SO3B 5T3ZE 1VFOA 2EDEA 3QUZB 4HFWA 2O26U 1I3RA 5L0QC 1R3IH 3PHQA 2ATPA 2Q86B 1DDHB 2ITDB 4BKLA 1X6LA 1LVEA 5JW4R 5AZ2H 1ZMYA 2X4QB 3TIDA 1ORQB 2L4OA 5FUCE 2IAND 1FZOB 5GISH 4NN5B 4HHAB 2NW3B 3FN0H 4YO0A 4RCAA 3L3JB 5AWNL 4QRRD 1XMWA 1J0HA 1S7QA 1TETH 4PB0L 1FZJA 3G5VB 2D4DA 3KJ4C 4GUPA 5HJ3A 5DD5L 1QRND 4LSVL 5BJTA 4NM4L 3IVKA 3AU1B 5DJZA 3VXQA 5HYIA 1AD9B 4X98B 3NTCH 3D0LA 4OCSL 3S3PA 3DHJA 1QLEH 3LKRA 3HI6L 5T5NF 3ORJA 3GSXA 3T1FA 3HZMA 2VQUA 32C2B 4K94C 1IGFL 2YD6A 4RMWA 3HUJA 4J4PC 4K94H 3CAFA 4J6RL 3HTLX 1W0VA 3CDCA 3I50H 1L9NA 4EN3B 5BRZE 1U8QA 3QG7L 3PWNB 4I77H 4XWGH 1UXSB 4E42A 5D5MF 1E6OH 1AO7D 2VDPL 3QDMD 4LLUB 2DQHL 2R0LL 4OI8A 1QOKA 2NCMA 3N0PB 5TGBA 3MNVA 1QKZL 3S34L 4KZEH 4WI4A 4RX4A 1L4IA 1U6AH 4WUUD 3B9KA 4NZRH 3QCUH 4L9LA 4E41B 3MLXL 3J8F7 1KEGL 1T22A 1XGUA 1NGXA 3IAQA 5EU7C 4YE4L 2WBJD 2I60H 5EPMB 4B0MM 5HHXL 1PZ5A 4ONFH 1J12A 1RUML 3QEHA 4P4KB 1T3FA 3O9WD 2BVUA 1TZIA 1OARL 4GAJL 4JRYA 1LQVA 4FQHA 5CZXC 3QDJE 1FPTL 2CLVA 1FE8H 3T2OA 3HKFA 5C9JA 2R2HB 1VFAA 3QIWA 2PXYB 1VACA 2ZNWA 2XXMB 4NM8H 4QHUA 4UOW0 2OMBA 4L8BA 1OW0C 5IEHB 5IB1A 4NKDB 3FTGA 5DRWB 1F6AA 1NFDA 5EH1A 1A6VL 3O6MH 4U6HA 3OL2A 2OLDA 3SDCD 4IRJD 1LO3L 5CGTA 1CQKA 1H5BB 1BFOB 2X1QA 3VXSE 3K2UH 2O5YL 4XC3L 3VXRD 5CIPB 3QXAA 2BMKA 1AP2A 2J8UF 4ZUSB 2A0LC 1KCUL 1LHZA 3QCVL 1MWAL 5DJCA 3MUGB 1R3LB 4M1DL 4HT1H 4RGND 4MX7A 2MPAH 3Q0HA 4UQ2B 5CWSB 4YUEH 2EDDA 5IB5A 3ULVD 2CDEB 3CFJA 3UTTD 3I9GH 1XIWA 2ZUVA 1BQHA 4POZC 3Q5YA 1IMHC 4HIHB 1IZKA 3EYFA 4JVWA 4MJ5B 1NDMA 4P5KB 5AZEL 1PX4A 3HE7A 1ACZA 4MD0B 5HHMA 3LPGA 4GRLD 4WFEE 4IMKC 1CXIA 1FJ1B 4OF5A 3V7AE 4DKEH 5I1GH 4QO1A 4MA7L 5TQ0H 3BDBA 3BRDA 4K7PY 3NIGE 1OB1B 5FUZL 4YHPA 3VGGA 4BZ1H 2BVQA 4N8PA 3EDDA 2FATL 5GGTA 5JXEA 3V95A 1NUFA 5HHOB 2EH7H 3QXUA 4AENA 1KJVB 4FQLH 4OCLC 5FGRA 1CDIA 1FG2B 4YR6A 5BQ7A 1YUHA 2GEEA 4L8SA 1AQDB 4EI6B 3QDAA 3AY4A 5HVHB 3CFDA 3LH2L 4FQ1L 3SDDD 1QBLH 1BBDH 4NKIL 4O00A 2PTUA 5I1EL 2DIBA 4JQXA 2OS7A 4NYLA 1OP9A 1UEMA 4P2OC 3KNBA 1NGZB 2IANA 1NBZB 4G43A 1NMCC 1NCCL 5CP7B 4X99B 2V7HA 3W2DL 2NX5D 4QRRA 5DS8A 1MUJA 1UGNA 3RWGB 4HK3N 1X5GA 5I1HL 2AJZA 4QXWA 3BKYL 3RVWD 4Z5RA 1UH3A 3BHBA 4XXDA 3S3SA 2NY1D 3R06A 3MCKA 3GMOA 5C08B 2UZXB 4X83A 1QRNA 1VGKA 3HMWH 4X6DA 2YD7A 4FFEX 4PYHA 1KJ2A 4LASL 3IJSB 4WU7B 2VQ1B 3CU1A 4G8GD 3HUJE 4QXTB 3HI5H 5DQJB 5C07D 4ZFZB 3IDUA 1NMAH 1QVOA 4Y88A 1ZHBA 4PJFA 4X6FB 1JNHB 1MPAH 5GQBA 5L88L 3LV3A 1OLLA 4D3CH 5C0EB 2EE2A 3AROA 5D70H 1YYLH 2GY5A 4P9MH 4H0HB 1QR1B 5A43C 1JUFA 3ULUC 3ULUH 2GUOA 1BZ7B 1YEIL 2OR7A 3EO1B 3OAZK 1OPGL 5F1SA 2WNGA 1SJEA 5ADPL 3T2QA 5D2LA 3PG2A 2VSDA 4JZJA 3C6LD 3DTXA 2QJDA 3LKOB 4CJ1A 4Z7WB 4F9PC 1XCTA 3ME0A 1XGTB 1EX0A 1D6EB 1WSST 3LPWA 4LCWD 3LKQA 4QOKD 1S9YB 4JJ5A 2VO5A 1KNOB 1NPUA 5D1QB 1P4LA 4WUUA 5HHPB 1SYVA 2VR4A 4ISVA 5JNYA 4JRYE 1BGXH 5C2UB 5HPMB 1I3GL 5DD5H 4D94A 1SVCP 3DETC 3TESA 3KPSD 4KTEL 4LF3B 4WV1C 4ZS6D 3V8CA 3VWKD 4DN4H 5C0CB 4M3KB 2FEDC 3UBXB 3I84A 4HKJB 2IPKB 4OCSH 3BKCL 3TNNA 8CGTA 3PWVB 4EXKA 4R2GC 4RMVA 1RIHL 4KKCD 4YXHL 1IGFH 4Z0BL 5T3ZL 1NFDE 4P2CG 5I1AB 4KTDL 1BJ8A 3C5ZC 3ABZA 1VFBA 3RVVD 1UG9A 4ZXBC 1RHFA 1ZT1B 1DFBH 2UWEF 5TDPB 1OLZA 3H3KA 5F6HI 1BHGA 4OLVL 1VKXA 5HVFB 1DL7L 5CS7A 5JORB 4Q2ZB 1RZJL 4RGOH 3U0TB 2VDPH 4NQDB 2E7LC 4M5ZH 3OF6D 1ZANH 4M61A 3GMPB 1N5AB 2R0LH 4QT5B 5FUOL 2HJFB 1KTRL 1CLZL 4PREB 4FQXD 1KPRA 3KPOA 1Q0XL 3JSSA 4MA1C 5KSVA 1H8OA 3S34H 2G5RA 1FFPB 3EKCA 4HPOL 3I85A 4P2QD 2ERJC 4HS6B 4K3JL 3H0TB 4LKXA 1TNNA 2BY0A 3MLXH 4WO4D 1KEGH 2YA1A 4JE4B 3K8LA 3VCLB 5EUKB 5ACLA 5HHXH 3RFZC 1T04B 3S8WA 1FV1B 1A9EA 3LMJL 1G9ML 1RZFL 2F54D 2FO4A 1CD9B 4GAJH 1I1RA 4HS3B 1T1ZB 4GRLA 1FPTH 5F1NA 3V6FA 2DICA 5DEFA 1JP5A 1YEHH 3BIBX 3H9SB 5CEZH 1CFNA 3DMMA 1OSZA 3MRGA 2YUZA 4NNYA 2PO6D 1IC5H 4PG2C 3V9FA 1A6VH 4FFYH 4D9LL 5F9JB 4Q6IA 3WS3A 3OPZH 4XC3H 2J6EA 2J1KA 2GK0A 1BX2A 3LQMA 3WBDA 2VWEC 2CDFA 5EB9A 2IANE 1IGYB 4U2YA 5HGAB 2AV7B 4O9HL 2C3WA 1X44A 4PJDF 3SGDI 1VHPA 3SDDA 3VG9B 1FL5B 2ADIB 1MWAH 3O3DA 5IVXB 3H2WA 4WI2A 4S1QL 4DKDC 1HXMA 3PWPB 3U4AA 3HR5B 4FQPA 5HBBA 2X5PA 4FFZL 3QEQD 1O7SA 4XNZC 3TBYA 3MV8B 1QRNE 4X6DE 3BN9D 3ESUF 4JO4H 1B90A 1ZOXA 5DYOB 2BC4B 1JMXA 2XKSA 1RUKL 3PDGA 5AYUH 5TH2A 5E99L 3WDIA 5HYJB 4PJFE 5MEOB 5A3ID 3U9UA 5ICYA 3LEYH 2QHRH 4F58L 5HHQA 5C07A 1XCQA 4MA7H 3WL9A 3GNML 2W59A 3E3QA 3G6AA 4J12A 1IM9B 5FUZH 1O0VA 1RK1A 3T3PE 2CGRL 1M71A 4MCZB 2FATH 3IB4A 3QNXA 3RL2B 4EI5C 4JVPA 1JPGB 2HJKB 1A6WL 1KLGB 4R4FH 5DK3A 3WJJC 1RJZA 2WWMC 2PW2A 2VRAA 4NC1C 3MTRA 3IAPA 3AMKA 1H15B 3OXSA 4NQSB 3LH2H 2D9QB 4QRPB 1GGTA 4M48L 4NKIH 4DOHE 1J7VR 1AHWA 4QF1A 3C6LA 5D7JB 2FJGB 3O11A 4LGSB 5EIIB 3UMTA 1W72A 3FZUC 4WUUE 4AL8L 3W2DH 1M7DA 5C6TH 1I4FA 4YC2B 2GJJA 4LCWA 3UZVB 1X7QA 3BKYH 1OHQA 2KL6A 5DUBB 2UV3A 4JRWA 4WI9A 4LCCA 3LKPA 4KK6D 2DLHA 2E3VA 1D6VL 1RUPL 3L3IB 3C60B 1EAPB 3KPSA 1ZLVH 1A6AB 3HB3D 3VWKA 3FFCD 1E27A 3QIUD 3VE0A 1UQSB 5JPMA 4C4KO 2I26N 3O6LL 4Z7VB 1KF9B 3BT2L 2NNAA 2ZSVB 4NO2A 2QV2A 3FQWB 2GT9A 3JV6B 3SDXB 5LGJA 3VRIA 4B53A 2JKXA 5IUSA 4JFQB 3BUTA 5DI8B 2UVFA 4X9FA 5SV4A 3TBWA 5I0DA 1MRDL 3RVXC 1YEIH 5A16B 5IVZA 3HS0A 3TT1H 5KS9A 2GFBB 1NL0L 1CICD 2X4TB 1FYTD 3I6GA 4MVBD 1T7ZA 2PYFB 5ADPH 2H9GB 1MCDA 2ITDA 3IU3A 4KU1A 1XFPA 1HH6A 5FO8A 2P49B 3OF6A 3SQOL 1IRAY 4PJCF 2B1AH 2X4SB 4LBEA 4P5TB 4PP8C 1DBJH 3WHE0 1JWUA 3TVMB 3O3AB 4M7KL 2NW3A 2O5XH 5IEKA 2DTSA 1Q38A 3K8MA 5EOCH 3C09C 3MMEB 4P2QA 3H7BB 5I8KL 4WNQB 3TCLA 3VXMD 5DJDA 4G5ZL 4OD1H 1G7QA 2I27N 3GSOA 1I3GH 2OI9B 4S0SD 3HNTL 5DFVC 2AERT 4KTEH 2F54A 3FQRB 3MBEB 4PGEA 3FT2A 4FQJL 1S9VB 4NO0D 4KGJA 3G08B 3ILPA 4RQQB 2N1KA 4G6KH 5E9DA 4V1DD 2X4UA 4AYFA 1JPSL 3Q48A 4APQD 4Z7OE 4KVNL 5T3ZH 4X6CB 3RDTC 4KTDH 1TTGA 4XVTL 1T89C 4PLKC 1WC7B 5F6IB 4HWBA 4O2FA 1PW3A 2LE9A 1R5VB 1TMCA 3MV9B 4HGMA 1DL7H 1PQZA 1RZJH 1A0QH 4PJHA 2W0KA 5E0QA 3CC5A 3DROB 3MV7D 4ZFOL 1UM6H 3JWDC 3JWDH 1OTUD 4N68A 5FUOH 1UYWH 1S8DA 1YEGL 1CLZH 3EOBB 4JN2B 3PWJB 5SWSB 1NCDH 3PGCA 4S1SL 4Y5XC 3RZCC 4OCYH 2HYMA 3KPNA 1B6DA 2D7TL 4PJ5A 3WEXB 4E5XB 3W11D 2XPGB 4H20L 4WI6A 2DKUA 4OZIA 4V2BA 3D0VB 4W4OA 3QEQA 4DAGL 2XI9A 3UTQA 3V5DB 4E41A 1DUZB 2P8PB 5CSBA 5TQ2H 1RZFH 1VESA 2YRPA 1N2RA 3BEWA 5GS0L 4TTGA 3VXPA 3D39B 1I1AB 5C07E 1HHIB 1FNEA 4JQIH 1JNLL 3S88H 3E3QE 2XY1A 1KEML 1ONQA 1WZMA 1NAMH 2PW1B 1GGBH 5C0NC 3DYPA 3QNYB 3BDXA 1JZ2A 4KRNA 3NCBB 3MRBA 5EU6B 4K71C 3GSWA 3RZWA 5A40E 4ZAKB 3RTQC 4D9LH 5F3BB 4NHCH 4X8JB 3QFJD 4MXQD 1HKFA 3JV4A 5D1ZB 5E5MA 4WI7A 5DUML 1DVFD 4LKCA 2VH5L 4F3FB 1R3HA 4AT6A 1EHLH 2QHLA 3ZT6A 5C0IA 3OMZA 2Y7QA 2BCKB 3ALPA 5HYFA 4ENEC 1JFQH 1IGTA 1R5IA 4HJ0D 2C3XA 1PY4A 2V9TA 4LCWE 4LVNC 3CCHB 1VPOL 4X6BB 1UFUA 1SM3L 4S1QH 5C7XH 5J3HC 5I16B 2ZSWA 4FFZH 4PR5B 3MCG1 4ONOA 1FNHA 5FGCB 4L1DA 4F9LA 3X3GL 3KPSE 5E2VL 1LDSA 1RUKH 4UQ3B 2C3GA 1QSFB 4ODUB 1FH5L 4XX1G 2E7HA 4F58H 1EEQA 4S1DD 3CH1B 3QIUA 3MJ6A 3GNMH 2HRPL 1QFHA 2YRZA 1A6PA 4PJ9C 1MCIA 3ZKXC 4Y5VA 2CGRH 4AEHL 3WS6C 2D9CA 4J3OC 4KKLC 3I3EA 3MUY1 5KS9E 3SBWA 1CZ8L 1NCBL 1KPUB 2XWTA 4TNVK 5CLTA 5GRVL 1EHAA 4WWKC 2E6PA 4KGLA 1JYNA 1CICA 4MVBA 3HPLA 1QSEA 4H26B 4UT6H 4RIRA 5JOPD 2D0HA 2G75A 2J12B 3KS0H 3VFUB 3V4PL 4P2QE 5T5NG 4GW4B 5TPWL 5F7EL 3KXFD 1AD0A 1KJ2L 2B4CL 1RJYB 5EO9B 2SEBB 3SQBA 3V5KB 1IC4H 2VXUH 1M7IA 4HIJA 5HPOA 5C0JB 3DIFB 1P5UA 1AC6A 2F54E 4BQ9A 3L9RA 3DX8A 3IF1B 4PRAB 1SEBB 5H35A 2BOCB 3UCRA 1BAFL 1I3VA 4U1JB 1WAAA 2CRZA 4NRZB 5E9DE 3P4NB 4GQ9L 4O2CA 1ZS8A 1M05B 3MACH 4DZ8B 1UACH 2EYSB 4NO0A 1U8PB 4KKBC 4NQVA 3W0WA 1AGBB 2R0ZL 1MCCA 2R4SL 3BT2H 1XR9B 1MCOL 2VITA 4F7CB 5F44A 4OGXH 4GKOA 4N8VG 3ZMRA 1U3HC 5FYLE 1RZIA 4JFDD 2IEPA 4YLQT 3EDJA 4FXKB 3ARWA 1R24A 1AO7B 1T0MA 1D5ZB 3QDMB 5FOJA 4B7IA 1CK0L 1PKQB 1TQBC 4RAVA 2XN9A 5DZOA 3VA2C 1MRDH 4LPUA 1QR1A 3VWJB 5D2NA 5IQ9A 3WJLA 3P9MB 4TUJB 1NL0H 1SY6A 4NZTH 3HZKB 3NIFE 4NBYB 2DQFB 4GKNB 3U36B 5IB3B 3MV7A 3TH3T 4Y4HC 4PRNA 3SQOH 4I0PB 4PJ5E 3FRUB 2WBJB 4OZIE 1ZK9A 4KJPD 4H1LA 5T1KA 2FJFB 3GM0A 3QEQE 4M7KH 2KKQA 3O9WB 4E41E 3U0PB 5INDA 5HGGS 1NGWB 5I8KH 2XZAL 4KKNA 1UB5A 1JGEA 1KNOA 4CNIB 1A3LL 3C9NB 1AFVH 5D7LA 4PJIA 1YQ2A 5E8NA 1NCTA 3HNTH 3GSRB 2QADC 1D9KC 1ZHKA 3D85A 5J6GA 2H3NB 5IG7A 5EBGA 1F2XK 3SKOA 3F6IA 3O2VH 3QEUB 3WFCL 1RZ7H 3UBXA 1LO0L 2DWEA 3BUYA 5KJRH 1JPSH 5ALBL 3SDCB 4IRJB 4KVNH 1MCHA 3OGCA 4XVTH 4Y4KC 3REWB 3VXRB 3QIBA 4TVPD 1EIBA 3U46B 4JPKL 2OCFD 4OKVB 4F33B 5SX5K 4PB9L 1QA9B 4XAKD 5FO9A 4JM2C 5TDPA 3QFJA 3QR2A 2FGWL 3HI1B 5CCKH 1A64A 3REVA 3P3YA 4XPBL 4P59L 4XPAL 1JNJA 4RGNB 1DVFA 4KK8C 3U30C 3MREA 1S3KL 1YJDL 1OD9A 3MROB 3BH8B 1L9MA 3UTTB 5JDSB 3W9EA 2ZUXA 1T5WB 3NAAH 2QSTA 3HMXA 3WUWG 3WXWH 1K4DA 1VFUA 3BSZL 3NA9L 2NXYD 2V7NB 3FQNA 2D7TH 4OT1L 4MNGA 2EC9T 4YNYA 4H20H 1C12A 2R2EA 3WN5A 2Z9TA 4RWHA 3HHRB 5EBLB 3HAEA 1J86A 3RY4A 4RFNB 2NY3B 5GS0C 3IYLW 4WTXA 3ZTNH 3G6JF 5GS0H 3O3EB 3MNWB 3TIEA 4LLQA 1DEDA 3MGOA 4K7FB 4D0DA 3B9AA 1JNLH 4Z7UA 3QRFM 2F53A 2VLJD 2J6EL 3H42L 1N8ZA 3M1BA 3E6HB 2VISB 4G9DA 4N90E 3UYPA 2YD4A 2JCCF 4XNYL 1VEOA 2EDFA 4HUMB 3BPNC 2B5IC 3BZEB 1IKNC 3RWJA 3VMNA 3DX6A 3N9GL 4BH7A 2X7LB 2CIKB 1TPXC 3GI9L 3L7FB 1QSEE 3QO0B 3DXAB 2XWJB 1ZAGA 4PP1C 4YFLI 1G7MB 2VH5H 3E6FB 4UAOB 4XCEB 3RBSA 5IV2A 2NX5B 4LVOB 1H9VA 3C6SB 3PP3K 1E6JH 4HXBL 1UJ3B 1Q9KA 4ZMAT 4OLZL 3MCLL 1VPOH 1V3JA 4ZOAA 1SM3H 2NY1B 1MFAH 3O8XC 1FIGL 2ZCHL 5BOPA 1E4WL 5I1KH 3IFPA 5K9JL 4G7YH 4KKAD 3MRPA 1WAAE 2PF6A 4XVUC 2XICA 3X3GH 4I9WD 3AUVA 1GC1C 2Q7YA 5E2VH 3TFKC 3ARRA 1ZGLB 3BP5B 3DVNA 2OR9H 3W0WE 4W4NA 3C5SB 5IR1B 1ITBB 2VDQL 5IBTL 3IJYA 1FH5H 3QWOB 1HXYA 5F7LB 4OGYL 1WICA 1FFNB 1XZ0A 5EZJA 2HRPH 4Q74A 2F5BL 4YHIB 1YMMA 2VXTH 2XN9E 2VLLA 5IM7B 1IM9A 1A47A 3DX7B 4M03A 4AEHH 4JFDA 3P0VL 5D2NE 4HJGB 4Y19D 3ARGD 3FHAA 5EOQL 3LQAL 1CGVA 1CZ8H 5CP3A 2HVKA 2ICEA 3J7HA 1KT2A 2R2BB 1NCBH 3MV7E 3Q6FB 2E7BA 5DD1H 1JPGA 4FQ2L 4QHNA 4ELMA 4S1RL 5C86A 4LOUC 3LEVL 2B20A 4PJ7A 3OQ3B 3MGTA 2AVGA 3L95B 4ZUUA 3F5WA 4QOKB 5DRNA 1KIPB 1ZGLM 3H9YA 5ICZB 4PJAF 3V4PH 1MHEB 1OSPL 4X4XA 3UP1A 1A4JA 1QD0A 5FECB 5F7EH 4MMXC 2VJXA 2B4CH 3HRPA 3IDIB 3QA3B 3MLWL 1KIQB 4OCWL 2Y4SA 2DS4A 2HFEA 5D7LE 4PJIE 1TJHL 4M43L 1T1WB 4OD2B 5DJ8B 4GBXC 3W82A 1LNUA 5DMJB 3CDGA 1P7KB 2IBBA 5IJVB 6CGTA 5CJOH 4R3SB 3WSQL 3OHXB 4YFEA 2Z0BA 4I3SL 2CRIA 4Y16B 4LVHB 3LB6C 4XNXL 3TBVB 3RUGA 1MLBB 4JY6B 3HE6A 4GQ9H 5E24E 3RWIA 4TNWK 3HRZB 2VDNL 2YSSA 4WDIA 5DD0H 1EZVX 1Q1JH 1BJ1H 3C60A 1QHOA 1LP9B 4HGKC 5E1AB 4KROC 4M8VA 3RIAF 2R0ZH 5MENE 3ARUA 1PEWA 2R4SH 4N0FB 5E5UB 5I8CB 5E6ID 3ILQD 2EYRA 5MENB 4R96A 1U8HB 3LS4L 3QFJE 4CVXA 4C56D 4RBPK 1CK0H 4YH6A 2NQCA 3TWCH 3LS5L 4RFOH 3RNKB 4FQXB 4L29B 1S7RB 1PVHA 1LO5A 2RHEA 3GM8A 1G7IB 1ACYL 4RSVA 1U95B 5BV7C 4WO4B 5HTSA 5BV7H 1EVUA 1LEIB 4MNGE 3RWEB 2FR4B 2Q3AA 3O4LB 3R0NA 1XGQA 4GXUN 2VR5A 3O3AA 1M1SA 1EDQA 4QTHB 4F7TA 5DK2B 4D8PA 3DVGB 4HLJA 2NTFA 3F6LA 2P5WB 2VABB 1ZLUK 4Z7UE 5AG8A 1QLFB 4WUKH 3UJTH 4WHTB 1AXSA 3VRJA 1X4ZA 2F53E 1S9WA 5LXGL 1U0QA 5HGBB 5D6CB 3CPLB 1S7XA 5FYLL 2OK0L 2PO6B 2W07A 3WFCH 3ARDC 1LO0H 3B2UC 3GMMA 1U91B 4RQQA 3DNKA 3L3DA 3JVGC 3LKSB 1NBYA 4WWID 3TN0D 2BSED 3JWOL 2VLJA 1J88A 5JOEA 1FVCA 4TPRH 5MP6L 2WAHA 4U1LB 2I5YL 4ZDHA 2DIJA 4JPKH 1MCPL 4I4WA 4F7PA 1WFUA 1MVUA 1A9BB 1HNFA 5A1AA 4UILH 1S78D 2FGWH 1HILA 4XPBH 3BIKB 5HXMA 5J1TC 1MCEA 1GOHA 4HK3J 1KB5A 4YHLH 1DLFL 3ARFB 2J8OA 1S9KC 5D8JH 3L3GB 5DJAA 3ZHDA 1S3KH 3RVTC 1YJDH 3W5NA 4Y7MA 4JZNA 5K59E 1BLNB 3KPQB 2X41A 1CXKA 1A14L 3QH3B 5JZ7C 4FQIH 1MCQA 1D5BA 4BFGA 4NDMA 4R4ND 1QQDB 3NPSB 4MD5B 1QUNA 2MHAB 3MBXL 5EU3B 2XWBA 5CBEA 5F71A 1T2XA 4XP4L 4ODBD 1OF2A 4KXZI 5LAXA 5HYJE 5C8JA 3G5ZA 1FL6A 2WUBL 4F15B 3O3BA 2FIRT 1ADQH 4Z7WF 1RFDL 2DDQH 3VMPA 4QWWD 1YMME 3QWRD 5E2WL 5C0DB 2QQKH 3LSOA 4HKXA 3AREC 4JFDE 2LVEA 1HN1A 3P4MA 5EUOF 1A3QA 3H42H 5FHBL 1AIFA 2VNCA 5ENWA 5KTEL 4XNYH 4HUXB 3PDOB 4HD9A 1FBIL 4PJBA 1GGYA 1S7UB 4ELME 3S4SG 2GJZB 3N9GH 3QUXA 4M7JH 3ARGA 4Y19A 4PJ7E 5TE4H 4QYOA 1HKLL 1IGJA 1X5ZA 4Y1AB 4MB4A 1NQBA 5BO1L 1TTUA 3F58L 2DQJL 4JCMA 3CMOH 3MA9L 1ZEAL 2EO9A 4ZYKB 3DUUA 2C7UA 4HXBH 4JFPA 1T0NB 4E0RA 1E0OB 4IRSD 3MOBL 1I8MA 1HDMA 4OV5A 1KCVL 3VGBA 3WO4B 1FIGH 2ZCHH 3G5YA 3VFRA 4N0YH 5IFAH 2AABL 5K9JH 4NRXB 1I9JH 3ARTA 5ERWB 1TVHB 2QLVB 1FNLA 1U8NA 3RUGE 3FFCB 5D7KD 4MXWL 1AH1A 2JK5B 2HLAB 3NA4A 4BFBD 2OL3B 1ZT4A 1CD1A 1K8IB 2VDQH 3IDGB 4PTTB 3QT2A 2PYEA 1IE5A 3BH9A 4XXCC 1ERNA 4OTXL 1VB9A 4OGYH 1U3YA 4NN7C 1YPZB 5DDHB 1GAFH 3DPBA 4HMCA 3SDAC 3OB0H 5FA4A 2F5BH 3FOLA 1MJJA 4M8QB 5IVNA 5E6IA 2XTJC 2Q87A 3I2CL 1FGNH 2NXZB 4M5YH 1FYTB 3QQ3A 3O6KH 4K8RD 3P0VH 4RRPA 1A4KB 4C56A 1A6TA 5ANMA 4QXUL 4FQ2H 3TZVD 5FK9A 4S1RH 1QFPA 4Z0XA 2FX7L 4D9RE 4X4YA 4Y5YB 3L7EB 4WHDA 3OXRA 1OSPH 2NYYC 5AYQA 3CLFL 1JGLL 3WIHA 4Y2DD 4OCWH 4WW1A 5MEPB 3V5KA 1KLFA 3PGDA 3KYNA 4AZ8A 3ARBD 4V1DB 3GK8H 1ZGLP 3QJFA 1I1YA 1DEEA 2E8ZA 2R15A 2Y06L 4APQB 5E8EB 4BSWB 5IP4A 4I3SH 2D7PA 5IVXF 3VMOA 4G8EA 1IEBB 1YDPA 2K7PA 2HAZA 2EDYA 2VLJE 3QQ9D 4S10A 1IEHA 3G9AB 4WFHE 3T09A 3QUZC 3UC0H 3CVHA 2L7UA 4U7MA 4GAYB 4D0CB 1SY6L 4KTYA 2O5ZL 3TN0A 3L5JA 4UDTB 2VE6A 2GSGB 3IDYB 2E9IA 4F7CA 5CD5D 4P4RA 3UROR 2YA2A 3T8XA 4OZHB 3PNWA 4ZUVA 1XH3B 5KSAA 5EORH 1HHJB 1PKQA 1QLRA 4NN5C 3UZQA 2VOTA 4OKDA 2E9JA 3QUMB 4X5XA 4MAYA 4WJ5B 5IT2H 2AXJA 3GMRB 3OZ9H 4NC0B 1GGUA 3RHWF 3VGDA 3D2UA 2DQFA 4J8RB 3VFMB 4BSJA 2FWOA 5IB3A 1CDCA 4X7CC 4NOFA 1DQQB 2NLJA 1EJOL 2AQ1A 4HH9B 1LO2H 5GS2D 4XCNB 25C8H 3HZYB 1AY1L 4WTZA 4EBQL 43C9B 2W0LA 3DURA 2FJFA 1P53A 4ODHL 3R0MA 1RSFA 1FSKB 4IOIB 3ZKNC 1YN7B 3BGFC 3HC0B 5IIEB 1H3WM 2VN7A 1F42A 5MHSD 4CKVX 4XZUB 4OZFB 1BQSA 5FYKH 5ESVA 3P2TA 3GBNL 2DOCA 1WWBX 2A83B 3GKZA 4K3DL 5LXGH 5J4MA 2ZZUT 2BHZA 4EN3C 4MNHB 5FYLH 3OBAA 3KLAA 4QGYA 3CX5K 5E7FA 4MQXD 4JKMA 1I8LA 3IDNA 4J23A 4PJBE 5CKAA 2NZ9C 5T33L 2AEQH 2E7MA 3JWOH 3QPQD 4YHNA 4HGWB 1II4E 4Y19E 1NJ9A 4URTB 3FB7A 3SN6N 3KJ4B 4PLOB 2I5YH 2XZCL 1CGSL 4P57B 4JO3L 1MCPH 2WIIB 4G6JH 4L3CB 3EDEA 2FSEB 1EFQA 3HMXL 4ORGB 5J57B 4Z7VF 5K9OA 2OJEB 4P0DA 2DLGA 3QYCA 1I9EA 3F7QA 1P84J 5IMMB 3SDXF 1XF2A 3VD5A 3S96B 1F6LL 4ERSL 3MROA 3F62A 3UDWC 3DO7A 1A14H 1QTYT 4IRSA 5JW3H 4JDTL 5JDSA 4P4KC 4LNRB 3IGAB 5FYJH 4LIQH 3SCMC 5FKPA 4NKMB 3MBXH 2LU4A 1T0PB 2F8VA 2V7NA 3JTTA 4KI5C 4XHJD 3ET9F 1V7ML 5EC1B 3FCTB 2GAZA 2W60A 3BZ4A 4PTUB 1H3VA 2Z8WC 2PXYC 3FMGL 2PYEE 2HT2C 3EYQC 3GMNB 2P44B 1RFDH 3C5JB 3GHBL 4XRCB 3VH8B 5E2WH 1JMZA 3WHXB 1Y0LB 2QSCL 1G9NL 3KPRD 1FZKA 4ODSH 5GJSL 4MSWB 1C1EH 4C56E 5KTEH 3E2HB 5CIPH 5ANME 2IBGA 1FBIH 1FORL 3QJHA 2Z35A 3VFSA 4UV4H 4N5EA 1Q0YL 4OCMC 1S5HB 1N3NA 3GB7B 2XQBH 4HDIA 4TSBH 4LMQE 5HI5C 3F58H 3S5LB 3TZVA 2XWJA 3KXFB 3MA9H 1ZEAH 3QUYB 1YEEH 3P0YL 4WFFE 4HIXH 5EBWA 1KTDB 3IDMA 5ISZD 2CQVA 2F15A 1J10A 3EHBC 3QFDB 5IFHL 4X0KA 1AKJD 4Y2DA 4PGBB 3U2SA 4YEEA 3BP6B 3QISA 2GJ6A 3PQYB 4PRID 3MLPA 5EU5B 3VFTA 2K9UA 4JFED 4ESKA 4PLJC 2VKWA 4B50A 5JR1L 1XR8B 4NJ9L 3B9DA 5CJXC 3TPUA 3TV3L 2HVJB 3DLQR 3ZKMD 3V6BR 2EDWA 5C0FB 3ZDYF 3MUHL 2I9LA 4Z6AT 3HG1D 1UH4A 1U58B 3BW9B 2X89D 1C5CH 1JFMA 1U8JB 1PKQE 5HVHC 4EUPG 4O51B 3OG4B 2YBRB 4RGMB 1U8MA 5I76B 3ZE2F 3ZYOA 5GSRB 4XMLL 4YAQA 4YHYB 2FZ3A 2HH0H 3D3VD 4UTAL 4TUOB 1DQTA 1ZT7B 2OSLB 1KTLA 3QULA 1GZQB 1J0YA 1Z9LA 2X4RB 2BXZA 2FX7H 4ODXA 1QACA 4XH2B 5JW4N 3U7WL 1RULH 1WWAX 1F02I 3DX9B 2NY2D 4XBGB 1NKRA 3MX0A 5DRXA 3CFBB 3GSQA 4ZTPH 1NANI 1VCAA 4ELKA 5FECA 3IDIA 3RY5A 5L2KD 5CJQH 4LRIC 5DHYA 1IEAB 4TULL 3BPOB 3MRMB 4G7VL 35C8H 5E8PB 1NEZB 4XPGL 5I74C 2DJSA 4UOW1 4FP8L 4XP6H 1T83C 1NFIB 1MEXL 1MREL 2H41A 4JFFA 4GKZB 4KJWD 1DCLA 1I1CA 3LDBB 1T1YA 4HX1A 2YC1B 5D1XD 3MFFA 1NMCB 2LVCA 2LTQB 4MCYB 3KLDA 3S37X 4CW1B 2A1WL 2XXCB 2R9HD 1SY6H 2O5ZH 5EU4A 2AJVH 4L8DA 4UNTA 2YPLA 4JR9L 2H26B 3V0WL 3IS1X 1TNMA 4U05A 2YEZB 1FO0A 2F5AL 4TOYL 5DO2D 1A1NA 1KN2H 4L3ED 1E4XL 5I73B 1TJIL 4N9OB 4JPWH 1SQ2N 3F12B 1EEYA 3RNKA 1ZVSB 4Q0XL 1HZHH 4PV9A 5HDQH 1H0DB 1G6RA 4FFVC 1EJOH 1BFTA 2AJSH 4JY4A 3C87A 3MLVL 4GT7A 1LEIA 4M7LH 5E2UL 3GMQB 4EBQH 2FR4A 3OG6B 1CFSA 5B22A 4LPWA 1TJGL 3N1PC 2W9EH 4BH8B 1XGPA 1LWRA 1ZVYA 5HHVH 3PL6A 5EO0B 5E4EB 4O5LH 12E8H 2AI0L 4YIQB 3VW3L 3GBNH 1HQ4A 1J8HA 4R7DA 1FVEB 4K3DH 5KVEH 4ODWB 1OAKL 1FFQA 1EBPA 3TBSA 2JTDA 3T0ED 3LKNB 3GMLA 5T33H 2AXGB 4HIEB 4MNQD 1KB5L 1U8KA 1Q94A 5GHWL 3C8KB 4FS0A 4QRSA 4G42A 5DGRA 4TQEH 3WUZA 2XNAA 5AUMB 3NIDE 5I2IB 3OKDB 4GSDL 4PJEB 2YPKB 3GKWH 4M6AA 2DI9A 5L6YL 4DUWA 3NVQA 1HEZB 3QP3A 5DC0A 4I5BA 1L7IL 5DHXB 3HMXH 3VI4E 2M26A 5C0AA 1ETZA 1YMHA 1DQJA 3IFNL 4KHTL 4CDGC 4RFEA 3FFDA 3V6OC 3WNMA 1NFKA 5F7NC 3QI9A 3MO1A 4DQOL 3QNZB 3HAEH 1XT5A 5D2LF 4OLWL 1X5AA 3DV6A 2JJTC 4YFLF 5M95B 2GJ6E 2JJSA 1OAUL 2V5SA 4QKXB 1JE6A 2ZOLB 4GW1B 4ONHB 1FQ9C 4EIZC 1P84K 1T5XB 5JA9A 5J9PA 1YEJL 1V7MH 1C5DA 4RZCB 3TPUE 3FMGH 2EDKA 5CSGA 3RWDA 5I1IL 1ZLVK 4MAUL 3FQUB 3GHBH 1R3JB 2CKNA 4MA1B 4XNUL 3RGVC 1K8DB 1CXHA 1G9NH 5B39B 5HGHB 4MA3B 1PG7W 5GJSH 3WDHA 1QO3A 1U3ZA 4CUCA 4PV8B 2V2XA 3HG1A 4AH2A 1BBJB 1I3UA 2VLKD 2X89A 1JHKH 2HJLA 1IT9L 3H9ZA 4DTGL 1FORH 1MRCL 2GK2A 3A0OA 2DL2A 2G9HB 5GGRB 3VG9C 1NDGB 1Q0YH 3KYOB 3EZ8A 3NFNB 3GSUB 4H5SB 1WBYB 5CEYA 5TF0A 2A6IB 2E6QA 4J3VA 3JUYA 2BERA 4IIQA 1O7VA 2ZUTA 3B5GA 3OKKA 1B4JL 1EAJA 3GFUA 3P0YH 3OKMA 1MFNA 1HHGA 4JLRB 1OM3L 4K9EC 3CNKA 4JB9L 1XAUA 4K9EH 3IRPX 2HLFD 1T0NA 2Q8BL 3ALWA 3Q6GH 4M4RA 5IFHH 2D7NA 4XGZB 3LZFH 3RVUC 1C8PA 5C1MB 3IETB 3FO2B 2BK8A 2HTLC 5MHSE 4UTBH 3KGRA 4P5MB 4JFFE 3OKEA 3OTTA 4BUHA 4BK4A 2R23B 5JR1H 3ULVF 3AC0A 1A3RH 3F7VB 4W81A 4GRWE 1K8IA 1QPXA 3TV3H 1CLYL 2OTPA 5D1XA 1RHHB 3GBLA 2PCPB 4PDCE 2YPLE 1C08B 2VZTA 4ACPA 5GGUA 1OOAA 3WIIH 2OTUA 4TRPL 3GHEL 3GSNA 4F2MB 3WO3B 5BCAA 3QHFL 3B3IA 5F1OB 2I07B 4NZDA 1OP5K 1CE6B 2DQTL 5C09B 2WMPA 4QCIA 1NLBL 4XMLH 1BOGB 4Z7OF 3WIHL 1CS6A 3D69A 4L3EA 5DZNA 5LBSL 3DRQA 3H6JA 3QUKA 2YS4A 4YC2C 4H88H 3WLBA 2PTVA 5KOVC 3X17A 4QHKJ 3U7WH 2AEIT 4L4TD 5DJYB 2B7DT 1TZHB 2GCYB 1UZ6E 2YD9A 3IU4L 1MFDH 5ESQA 3CDFA 4AIOA 4EI5B 1EO5A 2Y6SC 5ACZB 2IADA 2WSKA 5ID0A 4BQ6A 3DGGA 3EOAA 5MI0B 4P3DB 4TULH 4HFUL 3CVHL 4R26L 1J8HE 3TO4A 2CKBB 4XPGH 3MRFA 3D25A 1S7VA 2EE9A 2VLME 43CAA 3P30L 2R1WB 3I6KA 1HI6A 5SWQB 1MEXH 1MREH 3STZB 5K9QI 4O02L 4FFWD 4XNMA 4PYGA 1SBBA 4YDJB 2APTA 1OQXA 3P0GB 4IS6A 1NGYB 4PY8J 1X6NA 4PJXB 2A1WH 1G0YR 5I9QB 2DMBA 5LCVL 1RURL 1X5LA 3T0EA 1XEDA 3RJDA 4C58B 3UTZA 4NOBA 2OZ4A 4JR9H 5BXFB 3SDYL 3MV11 3V0WH 4JKWA 2IJ0C 4XI5D 3MLTB 5C0AE 3AGVA 4P5TC 1XH3A 4L1HA 4ZO6A 2A6KB 3TVMC 3RNQA 5IMLB 3SKJH 1VSCA 3WE6A 3KR3L 4Q0XH 2HFGL 5H37G 3ZLQC 2VL5A 4FQQB 3U7YL 4WJ5A 3OAYK 2PTTA 4AEFA 1EO8L 3L5XL 1I8IB 3WNPA 2OI9C 5FDWB 3MLVH 3L3KA 3W39A 5E2UH 4ZPTA 5KG9A 3MBEC 2XRAH 5JLZB 3QHZL 3IDJB 3QDGA 3DARA 3RWFB 4CMMB 5FOBB 4OF7A 1TJGH 5D72L 4WRLA 3F7YA 3X12A 2V2TA 4MS8D 1LEGA 5T1DL 4G80A 2AXFA 3FB5B 1Z3GL 1D5XB 2CK2A 5ETUA 2Y5EA 5L8LB 3VW3H 1MLCA 3U9PH 4LHQB 5F6IC 2H2PC 3CSBA 4OFYA 2OM5A 1X5YA 2ESVD 4P2OD 3HG1E 2VDMH 1N26A 3VFPB 1H3GA 3AAZB 4NO5A 2X70B 3C09B 1AE6L 5DURB 3T2NL 4KZDL 5GHWH 2LQRA 3CFEB 3E8UL 4P46D 1KC5L 7FABL 2BY3A 4GSDH 3C2SA 4L9LC 5IW1B 2DKMA 4Y1AE 5C0BD 2A9NL 5DSCA 1L7IH 3NN8A 1KG0B 2F19H 2P47B 5TFSL 5JHLL 1ROWA 2NY5L 1TIUA 1KUMA 1MAMH 4WI5A 3P11L 2P24B 4YZFF 3VXUD 1DANT 2EDBA 5FB8B 4DQOH 4M1CC 1HHHA 3DUHA 4LPCA 4LCYA 1HHKA 4OJFH 4OLWH 3QIWC 4J4PA 3ZKSD 4RA0C 5F93C 4XNQB 1PAMA 1OAUH 1I1AC 3SHSA 3G6DL 3DUSA 2P48B 3U7AA 3GZKA 4XP9L 4PRPD 3ULUD 1SYSA 2ADGA 5IGXL 3EYVB 4MZ2A 4Z77B 3TPKA 1NUDA 5EOTA 3E1F1 3KJ6L 3EGSB 4TVSa 1MH5B 3NZ8A 3MLRL 3O6FD 3PV6B 2IAMD 4PGDA 4MAUH 3K81A 2FCBA 2ZCKH 4WEBH 4YEFA 4GG8A 4MQTB 1QPPA 4U1HA 2IH1A 4UT9L 5CEXA 3JUZA 5T1LD 5D1ZC 2V2WB 2ICWJ 5J1AB 2LFGA 5JO5B 1I7ZA 1DBKL 5IHZA 3MUJA 5IOPA 5DHVB 3AS2A 1IT9H 1BJMA 4L3EE 1MRCH 5CUSL 1L6ZA 4MQ7A 2H8PB 2X4PB 5F89B 5IW3A 4M6NL 2H2SC 2FEDD 1N59B 5I1LA 2ZOKB 1B6UA 4PJHF 3EZJB 5DLML 1OM3H 3S7GA 3RGHA 5J12C 4Z76A 1FN4A 4L4TA 1URLA 2Q8BH 5I17A 3PGFL 3ARBB 1OW0A 1PEZA 1Z0NA 2EDQA 4OFKA 2JB5H 4RISH 5GGSB 1FGVL 3STBA 4HUVB 4WW2B 1OTSC 3KPPA 1A7RH 2RR3A 4BUGA 4KPHL 5IQ7H 3Q1SL 4JAMB 4XBPB 4GRMA 2IFFL 3V0VB 2CLZB 2XKNA 1XR8A 3UJJL 1WCQA 4F8QA 2YKLL 1GGCH 3T0EE 2RB8A 4MZ3A 3CK0H 4CGTA 1KV3A 5ESAA 1KYOJ 3RKDD 4HZLA 2MJWA 2OJZL 2Z8VC 2D31B 3GHEH 1CT8B 1XF1A 3X11B 1NC4A 4KRPD 4PG9B 5J6HA 1F4XL 1JGDA 5JW4Q 4H8WC 2DQTH 2A9MH 5I76A 1YN6A 3KPTA 4JM4L 2OTWB 2AJ3A 3VGEA 3LOWA 5HGDB 5HYSB 1P9MC 3NCFB 4IMKA 5FIEA 2D7MA 1A7OL 1ZT7A 4U6YB 1MVFA 3C08L 1KIRA 3KYKL 4X4MA 4U1KB 4XH2A 1BD2B 3QDGE 3IU4H 4R8WL 3TBTA 4HBQA 5F7DA 5T3XE 4JFOA 1PD6A 5IHBA 1GOFA 5J13C 3GUTA 4HFUH 5I8EA 4IMLB 3P4OB 2YPVH 2AJYL 3MRMA 1CCZA 2EDTA 4Y8AA 2WBWB 3S37H 1YECH 5B3JE 3MLUL 4GG6A 3PABA 2C3VA 3QZWB 2DWDB 2R1YA 5CHNB 3K3QA 1FO0L 1GHFL 3CSYB 1N4XL 2ESVA 4P2OA 5KVFH 5IJKC 2UWEB 4PRBB 4Q9BA 3VWJC 4JZOA 2DJ4A 3O2DL 1G6RL 5E00B 2R0WL 4IM8A 4WHCA 4C83A 5ILTL 2HA1A 4I0PC 4LFHG 1NSNL 2WBJC 3GGWB 3INUH 1JZ6A 3IFLL 3ZT5A 3F12A 3O9WC 1TVBA 1AGEA 1EA9C 3KR3H 1YZZA 2HFGH 3VXUA 1ZVSA 1U8LA 4QRQA 3K4AA 1AGCB 3U6RA 5GXBB 4NT6B 5L2JA 1KPVA 2WQRA 3QHZH 5KN5A 3EIFA 2K7QA 4MLSA 1BQLL 5IF0B 1WK0A 5F72S 3SDCC 4IRJC 2Y5TB 5GZND 3KPRB 1AXIB 1JWSB 1Z3GH 1BEYL 3T4AA 1YEDA 3DECA 1XGYL 5JHDB 2DBLH 1RPQA 4X9GA 4XPHH 2IAMA 2W65A 4PBVC 3ARXA 1HK6A 5EC2B 4X7TA 5D9SB 3WD5L 3LRHA 3IDXL 5DJ6A 4Z7NE 3T2NH 5EU7E 4RGNC 3WLWC 1HWHB 4KZDH 5AAMA 1T7VA 2VXSL 1DJSA 1MCSA 1QEWA 1KC5H 2CK0L 7FABH 1LEKB 3C8KA 5FCSH 4J7RA 1YY8A 2YZ8A 5ISZB 3ULVC 2YPKA 4MXVF 2A9NH 3ULVH 2ZNXA 1D9KB 4PJDB 5JW5A 1W0YT 1SJXA 4WV1A 1Q9LB 2IGFL 4LCUB 5JHLH 2NY5C 4TSCH 2NY5H 3TNMA 4F57H 4P2RD 4CVWA 4L4TE 3GIZH 4M6OH 2K3TA 3OKLB 3RX8A 5JOFA 4OZHF 4PRIB 1NC2A 4WGVB 4RFNC 1X5KA 3C5ZA 4JFEB 3MJ7A 2FHFA 4ZXBA 5HDOA 1EBAA 5IGXH 1F8TL 1Z9OA 3BVNA 4UU9A 4Q6IC 1X5IA 3GJFB 2G60H 4KQ4L 3T3MF 2VXQH 3U30B 4Z7QE 3MLRH 1HIML 4X8XA 4DVBB 4XCYA 2UZYB 2E7LA 4L8CA 1T66D 4HH8A 4UT9H 1RQ5A 2P5ED 4LEOB 3QXDA 1Z9MA 2OXHA