2ZOLA

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
273
structure length
258
Chain Sequence
PHSMRYFETAVSRPGEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 62
structure length 258
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zolA01
3H3PH 1FZOA 2R56L 1F8TL 4GW1A 5F9DC 1QYGL 3DX7B 1QLFB 1JGEB 4O2EB 4N8VA 3PDDA 4LPWA 5GGRY 5HGBB 4AL8L 3ZMRA 3Q0HA 1A6UL 2BX5A 1PZ5A 4FFWC 4OZIF 1TCMA 2VUYA 3CFIC 3HUJB 4TSBH 2GYSA 5HDQH 5DVOA 4YBLB 4ZS6C 1BEYL 3SKJH 1M6OB 3U2SA 2FEEI 3LH2L 2OZ4A 1J8HB 3RGVA 2VLJD 3QIUA 2OTUA 1Q94B 4GKOA 5ALBL 1CI5A 1YNKH 2BHUA 5EO0A 4KHTL 4G59A 4PJ5E 4Y19D 4LKCB 3JV4A 1HHHA 4X7TA 1NLBH 3NFNB 1ZA6A 1MRCH 2HTLD 3KXFA 3MNZB 4YEFA 3RAJH 5EZLB 4RNRA 2UWEB 1NCBL 2NW3B 1CZ8H 5EU6E 2PTTA 1G0XA 1MCNA 3ARGC 4JY4A 1MH5A 3GNMH 1IRAY 4PJEF 1LE5B 1GGIL 5F1IB 4JDVA 1K3ZA 1KIQB 1JNNH 1G7LB 1ACYL 2XWBB 4RRPA 4UTAH 3REWB 2P5WB 3SE9H 2BVTA 1GSMA 1U8JB 5GZOD 3O3BA 5GZND 4HMDA 2AK4E 3EJYD 4IRSD 5IBTH 4OQ1A 4OD2B 3GBML 3VXOA 5D8JH 3EYVA 1YMHB 2NR6D 4HC1A 1TITA 4MB5A 3BW9A 1P7QA 2ZPKL 5DT1H 4B41A 5CBEB 4NO0B 3O0RL 3DXAD 4MXWL 2C3GA 3EYSH 5BMFL 4HG4K 2Q8BL 3LKQB 1EO8L 4Z7WA 2JF1A 4P23B 4G9FB 3C6LC 2PXYB 3ARBD 4ENED 2ZSWB 5J56B 5GRUH 3ZE0E 1D5BB 1T80A 1AHWA 1JWUA 3QXVA 3FTGB 5IBLD 3D0LA 1NCTA 5KG9B 1YPZE 4WFGD 1K4CB 1EGJA 1F3RB 4QHLA 1ACZA 5E6IA 3LOWA 5ID1B 2BOCA 4KV5E 5CSZB 4M61B 3AROA 3CFJA 4N5ED 1DQDL 4HS6A 3SPVA 3TBWB 1N59A 3O81A 4TTDC 5J12B 1ZEAH 4HIEA 4I3RH 4V2CB 5IVOA 4JG0L 3FFCD 4QRPB 2IANE 4O51B 1FZMB 4MX7A 4PPTA 5IQ7L 5I8EA 5FKPB 1BF2A 2NXYB 1CLZL 5K9JL 1WIPA 4MS8A 5A16A 1MOEA 3Q48A 4S10A 1U58B 2R0ZL 3IDUA 1B0WA 1WIOA 3GSOA 4JRXD 4P5TA 3PL6B 4L8CB 4CBPA 1YJDH 2H8PA 1F4HA 4K3EL 2H1PH 1D5XB 4EUPA 3ZT6A 4MD0A 3Q5OA 3ES6B 2XZCL 2DQTH 2EKSA 2M1KA 1DBKH 2X4TA 3OHXB 4K7PX 2CDEA 3VDAA 5LKNA 4DKAA 2Z31D 4W70A 4YHLL 1I4FA 5F88B 3S36H 2BY2A 5ALCH 3TNMA 3MLRH 1FGNH 4C59B 1XF1A 2FYYA 1PQZA 5D6DA 4YEEA 4KGJA 5IJVB 5F72S 1GH7A 5GGSA 3THMH 5CEZE 2JCCA 4PY8J 3B8SA 4MJIB 5FECB 3RWDB 2VLJA 4XPTH 1F00I 3DUUB 4O2CB 3UTSE 4JRYE 5EBWB 5EUOF 1SY6H 5ILTH 4Y19A 5BV7H 4F9PC 5C0BB 2F58H 2BVOA 4W81A 3H8NA 2WBWB 3EDJA 2JB6B 1P2CA 2HT4C 1UFUA 5B38G 1WFUA 4P9HL 5FDWA 3BUYB 2DQUH 3BZFA 3OXSA 3KS0H 5TGBA 4OZHA 3VXMD 4G8EB 3BSZL 3UX9B 2IGFL 4U1NA 3FB8B 3CIQA 3LS5L 2ZSVB 4ODWA 4JLRB 5F9JA 3T3PF 5IMLA 2VIRA 2P5EB 2Z92A 1MEXH 5TF0A 3DV4B 4KKBD 4XMKH 5JHDB 3LS4L 3JWOH 4QRSB 3H7LA 1ORQA 4GG6F 4QHNA 4PGBB 5FO8B 5J1TC 2VZTA 4IRSA 1IFHL 1J1OH 3AS1A 3R0MA 4XWOC 3VXSD 5FO9B 1II4E 5C0DA 3CC5A 1QRNE 4Y88A 4NNXA 3V0VB 3WNMA 4YFLF 3WL9B 2FLRT 5E2JA 1NCAH 3L1OH 4LSTL 5FAAA 1EBAA 1I9IH 3K8MA 3ARBA 3MCKA 4K2UH 3CMGA 1QVOB 2F19L 4LLUB 1B4JL 2Y36H 2ARJQ 4P99A 4BK5A 1OPGH 4M48H 4EDWH 1FRGL 4H1LH 5TQ0H 3MJ6A 4DQOL 3MBEB 4OV5A 2ZCHH 2HT2C 3PJSA 4MZ2A 1M71A 3BFOA 3PGFL 1G6RA 2P43B 3BRFA 1G7MA 4OLEA 5I19L 2D4DA 9CGTA 4HPOH 2Y07H 5DVKA 3PDOB 3W0WB 1PKQA 1ADQH 4JJ5A 5D2NA 5IR1B 2F74A 1FLRH 3OB0K 1GL4B 4X5WA 2DWEA 3FFCA 3RWHA 5TF1L 3WDHA 5KSBE 1PYWA 1AJ7L 2P24B 3OX8A 1WWBX 2DQFB 4WVRA 4P48A 1VEOA 1MJ8H 3L5JA 4JRXA 4NM8L 4CW1A 3QUXC 1DBML 4PLJC 1P4LB 3FN3A 4PJHA 4HGWB 5I9QB 3G6JF 4NN7B 3FT4A 4P3CL 2GY7B 1P6AB 1TCRA 3SCMD 3OPZL 4PJXB 2CO7B 3G6AA 3TH2T 3MRRA 4IMKC 5E2TL 5TPWL 3V52H 1FORH 3V4VL 4LP5A 4X0KB 1KLUA 2DJ4A 6CGTA 3C5ZD 3SBWC 2GUOA 2Z31A 1IKNC 4HX1A 4NYLB 1YEIH 1DQML 3RWFA 4XCEB 5L6YL 5EB9A 1D5IH 1F97A 2FWOB 4EDXB 3S35L 5E2WH 5L8JB 2X4NA 4XH2B 5CJ8A 1DUYA 3GMMB 2RAMA 4AY0A 4Y4HB 3VFMA 5INCA 3QG7L 4LRIC 2XICA 4JFED 1OAYH 1M4KA 1T1ZA 2AJZB 2HP4A 4L3CA 4MDIA 5TDNA 5E00A 4LCYB 3CFCL 3ULUE 2PNDA 4FTVB 4LARL 3WE6B 3B6SA 3OKOA 3M07A 1T5WA 5FV2A 3M1BB 5EO9A 3VFTB 1YEHH 1EX0A 2DQEH 1JNHA 2N1KA 3VXMA 4X4YA 5JQ6H 3D39B 1FG9C 3BISA 2OZ4L 5I8CB 5TE7H 4LOUD 1XF5A 2EZ0D 4PP8C 1NC4A 3UZQA 3D18B 4WCYH 5B38A 3N1PC 3SDAD 5I66A 3ARSA 2BSSB 4R2GD 3PWUA 1FV1B 3CK0H 4YQXL 4Q7DA 3KAAA 3SDXF 5DQDL 3UBXI 4JHBA 5JR1L 4OZIE 3MMEA 4XBPA 2A83A 1D9KD 3WV0A 4X5XB 1AO7E 2Q76A 4DVBA 3HI6L 3JSSA 3QDGB 1KJ3L 4N8CH 5C6TL 1QR1A 1NAMB 4XBEH 2VLKD 4N8PA 2QHRH 2QL1A 2ZNWA 3QFDA 4FXLA 4ZFZA 5B22A 1FFOB 4KY1H 1JPSH 4PRDB 4UTBH 3F7VA 5DRWA 1Q38A 1RZKC 5D5MF 2VKWA 3TN0B 1BREA 3BP4B 3G5YA 3G5ZA 4EN3B 2QBWA 4UT6L 1U8HB 4DWHA 4PUBH 5I73C 5ID0B 4PJEE 4BSWB 4TNVK 4HC1L 1WC7A 3CDFA 3W39B 3OGCA 2VDQL 4OGYL 4BKLA 1F3JB 4RMWA 3I6LE 5B8CA 5CJ5A 2DLFL 2AEQL 5JUEH 4F37F 3DO7A 4GRLB 2MQCA 2ADFH 5C0RH 1A7NH 3MRBA 3S9DB 3FN0L 5DS8A 3MA9H 3VXTA 1JPGA 3AU1B 4H1LG 3GSRA 2DQJL 4LSSH 2J7LA 2EDNA 2ICEA 2NLJA 4U1GC 1HH6B 3MRLB 4IIQC 4UV7H 4QNPF 3NN8B 4HJJH 3MV7E 1MQKH 1WGOA 4MDJB 5DJ6B 2V5SA 1X5LA 2EDDA 3TIDA 3WYRA 1C7SA 3AMLA 3SCMA 1I85C 1T0MA 4N1HB 5C6WH 3MRCB 4G9DB 1QFUL 4HEPG 3MR9A 4S0TD 2ZUSA 4K3JH 2H6PA 3B9KC 5BW7A 3D87B 4GMSH 2PN5A 5CHNA 3QXWA 2FHFA 1Q72L 2OS7A 2VLRB 5B3NA 2CGRL 4TRPL 1T20A 1C08B 4TULH 1I8KA 3JTTA 4YGAB 3WLWD 4JFEA 4OB5H 3DURA 2HKHH 1WK0A 2DWDB 2J8HA 2ZUXA 1A7QH 1YQVH 2OM5A 1PKOA 1N5AA 3GUTB 5C0CD 1NLDH 1MAMH 2B4CC 3HCVB 3D69B 5KSAB 2MKWA 4PB9L 4JFFB 3MGOA 5BVJB 4LCWB 3D85B 2KUTA 4KUCF 4RMQA 2R0WL 2YPKA 1J0JA 1MFEH 3O8XB 2LAAA 3BVNA 4GKSB 4FZEL 2HJKA 3NH7H 2QTEA 1WJ3A 4WV1A 4KUZH 2BP3A 2Q6WA 3BRDA 3SDAA 4PTUB 2O61B 1ZLUH 2OL3A 1OTUD 3MACH 1CK0L 4LCCB 1L9MA 2D3VA 1SY6A 2WWKT 5FGRA 4FQ1H 3WIFA 3I02A 1CD1B 3IJYA 4N0UB 1JZ6A 1L0QA 3FCTB 3P77B 5HBBA 7CGTA 3MUZ1 1FVDA 4RAUB 3DSNA 4DEPC 4X7EC 3H9SB 3K2MC 1AQKH 3HAEB 2GTWA 3D48R 5GJSL 4HWBH 4TUOB 5EUOE 4ZG1A 2R1YA 4PRHB 3EGSA 4P46D 1EBPA 4LSUH 3DLQR 4I0PD 1T21A 3RVWC 4XC1H 4X4MA 3PNWA 4MXQA 4NRZA 4LDOB 3F58H 2GSGA 1F42A 5DJYA 4QOKE 4YHYB 3BGFC 1T7VA 4U6XB 4C4KO 4ZDHB 3OKYA 3A6BL 1GGUA 1B2WH 2L7JA 3T3PE 1A7PL 4LSPL 2I07B 4TOYL 3QCUH 5HHMD 5CFHA 4WGWB 5I30H 4OCWH 1GAFL 3EO9H 1UM6H 2VDOL 1ETZB 1SVCP 4GG6E 1R3JB 5E7FA 2NXZB 4G3YL 5GJTL 3F8UB 3WD5L 3P4NB 4RIRB 4X98A 3TGXA 1DBJH 2ZG2A 4CVXB 4NZJA 4UT7L 4R9HA 1KIPA 4LLDA 5MERB 2DQIH 2EYSB 1LEIA 3PV6B 3T4YA 4XPAH 1YEGH 4H1LA 4TNVF 4KKLC 1C1EL 1VA9A 5E9DB 3QA3A 1KTDB 3BKJH 4NQCB 2WLZA 5F21B 1A6AA 3PGCA 3SO3B 1KEML 2XQBL 1LE9A 3K0WA 2YMXH 4JZJA 5DMKA 5C1MB 2VL5B 3BO8B 3EO1B 3G6DL 4KK5D 5FKAB 2YEZA 1OW0A 2IQ9L 5BRZE 2LV4A 5E95B 5DA0B 3ILQC 4OJFH 2EDFA 5IWLC 1QSFB 1JMXA 1ZOXA 4DKEL 1BOGB 2YOCA 1HYSD 1I1AD 1YDPA 3CX5K 3VWKD 4QRQB 3OSKA 1ND0A 4ERSL 5DFVD 3HE7D 2CKBH 2DQCH 4GRMA 4OLXH 1JYVA 1Z0NA 5GHWL 2XZAH 4QXGL 5F97E 5T33H 1MNUH 2PYEA 2QV2A 4JFDD 2PCPA 4UQ2B 3DROB 2HFGL 5C0CA 4P2QB 5DGRA 1KEGL 1D5ZB 1NAKL 5ESVA 3ZTNH 5SWQB 3V5DB 3WCYA 4FP8L 5C6PB 1U95A 3GMPB 2CLRA 1H8OA 4QRRA 3VGDA 3PWJB 4XNYL 5CEZL 3G6JE 5AEAA 5GGQL 2CD0A 1KLFA 4Z95H 4HBCL 1QFWL 4WWKB 3L9RB 4ETYA 2D7QA 2UYLA 1OAZL 2X44D 5CZXD 4LLMA 4JQIH 5DJZB 3HN3A 3RPIB 5EC1A 4IMLA 2APBA 1J5OL 2DF3A 3IRZA 1XIWC 3KPPB 3LEVH 3LRHA 2HN7A 2YRLA 4LAJH 4X9BA 3NZ8A 4P46A 1V7NH 1HDMB 4WI5A 3GMQB 1OB1A 3QPXH 1Z3GH 2NTSP 3RDTC 2WW8A 5FYKU 2WLYA 1NLBL 1FL3A 3ALXA 4KDTC 1F4YL 4LLYA 2PO6D 4PJCA 3RAJL 1N7MH 2YWYA 3WS6A 1T3FA 4M7KH 5L9DH 4MCYB 3LSOB 2R0KH 4MQXC 3GNML 2AJVH 3UTZA 2F5AL 3FO9A 4PGCB 5HHMA 4ELMB 1EZVX 2ID5A 3RJDA 4PS4H 1FGVL 5HD8C 1YY8B 4K3DL 5EFIB 2DI9A 4G42B 2AEIT 3JTSA 2DI8A 3QAZC 3RHWK 3WLBA 5ACLA 4KMQA 3HHRB 5T5NF 3SDXE 2P48B 2W65B 4HS3B 4C54A 1HCVA 2W07A 5IF0A 5AZEH 1T1YB 1V3MA 4L29B 4V3EB 5IBTL 5KSUA 1A1MB 4KJWC 5ENWA 3RWEB 4MJ2A 1I3UA 2SEBB 2AABH 5D8JL 3MA7B 2XN9E 3O6KH 1WSST 4K55A 1MREH 1NANI 4FXKA 1JPST 3S97C 2B8OT 2YXMA 4M1GL 1PD6A 35C8H 1OCWL 5CSGA 4O00A 4KXZI 5D5ME 1S9VA 1UXSB 4J3UA 1QFWI 1MHCA 4HGMA 4ZFOA 2E9IA 4OQTH 5BS0B 4NC1C 2QADD 3WKNA 3LVEA 4Y2DA 5DMIL 1G7PB 2BDNH 3CSBA 1ZHNB 2F53D 5JMOC 1I7RA 1CR9H 4ZUVB 2O5YH 4M9OA 2YPLE 2DL9A 3Q2CA 1I1AA 4PJ7B 1I1FA 1RV6X 2BNUB 4MSWA 2OBGA 3A67H 2VITB 4WW2A 4AH2A 3ARFB 2VKXA 4GG8A 4P49A 5GRVL 1R5IB 3RTQB 3BAEL 5ADOL 5D1QB 4JPWL 4JFDA 4HD9A 3FFDA 4OCXL 4GKZA 3QWRA 2OQJA 3CPLA 2D7NA 3QQ4B 4R7DA 4QNPE 4Y4KC 5BZDA 3TVMA 4I9WD 1BIHA 5IB1A 4K7PH 1JK8A 1QSEA 1K5NB 1NEUA 5EU3A 1RD6A 4YWGH 4RSVA 3T09A 2IG2L 2EKJA 2CDGA 2X1XR 4EEEA 2FEDD 1OP5K 3WKML 3NCBB 1AQDB 1BAFL 4YHML 2D7TH 1NCNA 3PQYB 4LVHB 1XGYL 1HHIA 4FS0A 3U0TA 1X5XA 1EFXB 1A5FH 2OTWA 2NY4C 3H3KA 4I4WA 3ULUL 1YNLL 1HWGB 3HE6B 5DTFB 3GZKA 2WANA 1DEDA 5E8NB 4MA1B 5FOBA 2NW2B 4AENB 3WIHH 2A6DB 2JELH 4BSVB 1P4BH 5C07A 1FGNL 4WHTB 4P2RE 1OQXA 2L7UA 3N1MC 4AMKL 5KSVA 3WNLA 1LO4L 4JFPA 1HEZA 3GMRA 2E9WA 3VXRB 1EMTH 3IKCB 3W9DA 2Q3ZA 1JRHL 4PJBA 2FJFA 2OL3L 3PWVA 1SY6L 4MJ5A 3SQOL 3JVGA 2Y7QB 4G6FD 2DD8H 2Q7YB 4QHUB 2DS4A 4WFHE 4P23C 1NBYB 4K94L 3JWDC 1U42A 5DRXA 3IDYC 2Q87A 4KJQD 4R4ND 3KG5A 2ED9A 2XY2A 3NFSH 4HWBA 3DV6A 3CFEB 4U1SA 4FNLL 5GGVH 2NY3D 5D72H 5GIRA 2NY5L 1T1WB 4JN2B 5CWSA 5EU4B 4G8GE 4MWFA 3SE3A 5EBLA 3SJVB 5F7MC 4XCFL 5DD3H 1J11A 1QBAA 2XQYK 4RQQA 1VFBA 4PB0L 2YUVA 5ETUB 5IB3B 3VXUE 2X09A 2DAVA 3QUML 4F7CA 2Y6SD 4YHPB 4WUUB 1I9IL 3UC0H 3QIWB 4XTRD 4U0QB 1FN4B 2VDPH 1V3KA 3LRGA 4LF3B 4Y0GA 4EXPX 3RHWF 4XNXL 1IC7H 1RJZB 4P9ML 4K2UL 2F53A 2Y36L 5EOCJ 5BZWA 4GW1B 4EDWL 4RFOL 3KYKL 4N8VB 5TQ0L 3WEXA 5GS3A 3EJZC 4GH7B 4L9LA 3BQUA 1JV5B 3WFHA 4O02L 3QQ9C 1HSBA 2PR4L 4OLYH 4F3FA 4QXUH 4KWUA 1W0VA 3QHFL 5A3IC 1AXTH 1X6LA 4WTZG 1JRHI 4OUOA 4FFWD 3U2SB 4X4XB 3RGVB 3LEXA 1XGUA 3QIUB 2OTUB 4OCRH 5MEOA 4NPYA 1FLRL 1GOHA 4TQEL 2X1WL 4KRPC 5LXGH 5EO0B 1ZLSH 3JV4B 4HIXH 1HHHB 4X7TB 3SGEI 4KGLA 1UC6A 3EDKA 4Q9BA 3Q6FA 3X3GH 4RNRB 1F4XH 3CVIH 1QR4A 3QFJA 2PTTB 4JY4B 1MH5B 4ONGL 1RIUH 2WWMC 4WU5A 5EOCL 4IRJC 1MRDL 2X70A 4JDVB 5DVLA 5JHLL 3ARGD 3VG9B 3CX2A 1E4WH 1FORL 3OV6A 5F9AC 2HRPH 1MVFA 2JJVA 1XGQA 5KS9A 3BIKB 1QUNA 5EBMA 5CZVH 3LB6C 3O3BB 1AGCA 3OXRA 2D7OA 1P9MC 2ERJB 5D71L 5I1IH 3MUY1 3WSQH 3EYVB 4MNQD 2HVKA 3C2SA 2W9DH 2WM0A 3BW9B 4NNPH 4NZTH 1LO0L 1J0ZA 2BNRE 1JCKA 3F5WB 4Q9RH 1WIUA 1DVFD 3QUKA 4PJ8D 3TT3H 4OUUA 4OLWL 3K2UH 3QDMB 4Z7WB 3MLPA 2VN4A 4Y5VC 5BO1L 1INEH 3BKCL 2J6EA 5JW5A 3P3YA 3PHSA 5K9QI 4HEME 4M1DH 3HMXH 1AHWB 1JWUB 3C6LD 1BJ1J 5D1XA 5SWSE 4XVTH 3EO0A 5KAQG 3D0LB 1QNZH 3MBEC 4KVCH 4MQ7A 5MI0B 5F1NA 4NNYA 3MV9B 1JFQL 4NKOA 4QHLB 4OF3A 1Q9OA 2BOCB 1J87A 4M03A 3VG0H 2FATH 4OF0A 3CFJB 1E4JA 4HS6B 3AAZA 3SPVB 4TSCL 4WIQA 1F3DJ 1NCCL 1OQOA 4HIEB 4QYOA 4YK4B 4TTDD 4N8CL 5B39B 4NJAH 3C9NA 3NAAH 4MX7B 3QO1A 4XBEL 5I8EB 3UTQA 3VW3H 1UA6L 3E1F1 4QHMA 4WWID 2OI9C 5CBAB 5CS7A 2CQVA 2EICA 3HI5H 4P5TB 3GSOB 1RHFA 3FRUA 3T2NH 2H8PB 4HUKB 4UOW0 4XAWH 1JHKL 1N6QL 4MD0B 3FQUA 3E3QA 3MRIA 3DX8B 3QPQC 1E0OB 4PUBL 2H3NA 2EKSB 3HRZA 4XZUA 4HH8A 2X4TB 2CDEB 2BVQA 1I4FB 1U3HC 2J5LB 3TNMB 5BVPL 2FYYB 1PQZB 2NNAA 5JUEL 4CVWA 2OK0H 1TVHA 3GGWA 3IT8D 2JCCB 1DQJA 4MAYB 2VLJB 4Z7VA 1XGPA 2DTMH 3SOBH 4G6AD 2VERN 4OQTA 3V7AG 1A1OA 4KPHH 2VXQH 3V9FA 1KACB 2APVA 2BVOB 2MKLC 2A9NH 1IZKA 5ITFA 5DWUL 4WTZA 1S9WA 4NGHL 3BKYL 1AI1H 5FDWB 3VXPA 5EU6B 3BZFB 3OXSB 4KK6C 5TGBB 4OZHB 4OFDA 5E2UL 1GIGL 3ARGA 3BWAA 3VFSA 2A9MH 1NGZB 4ODWB 5F9JB 4J8RA 4YDVA 1QOKA 1INDH 1UJ3C 2Z92B 4ZNCD 5D1ZC 5HDOA 4ACPA 5FCUH 4OF8A 3STLA 2GIYA 1ZVYA 3P0VH 1S7UA 1YMMD 3U48A 1U8KA 4QHNB 1JE6A 4IRSB 1LP9A 5CUSL 2EC8A 2AK4B 3QJHA 4PRAA 5E99L 5T5FH 4MNQA 3RY4A 4KZDH 5C0DB 3CC5B 4TUKH 2VZVA 4GBXC 4NFDA 4OB5L 4UIMB 43C9A 2EIDA 4NNXB 4HFWA 1A7QL 2BVPA 1PAMA 2GCYA 1A6WH 3TN0C 2E8YA 5FYKE 2NQCA 5E2VH 1IQWH 2OSLB 3MCKB 3DXAE 1NUGA 1BFTA 4S1SL 2R2HA 1HQ4B 3I2CL 3C6LA 2DQDH 1CGYA 2XFXA 1QSVA 3FO2A 5L2KD 1IGMH 1MSPA 2CMRL 3HPLA 3UTTD 1EV2E 5E94B 2EECA 3IDNB 1YPZB 4OV5B 2X89D 3X17A 5CD5D 2EIBA 3V0WL 4D2NA 1M71B 2V9TA 1G6RB 1G7MB 2HT2D 1CDBA 2VDLH 4U49A 1LO2H 4NZDA 1PKQB 4JJ5B 5D2NB 2YWZA 1KYOK 2XY1A 4M93C 2DWEB 3FFCB 3MLYH 3RWHB 5HSFA 5ESAA 3OX8B 4M7JH 1Y0LB 1JPTH 1MFNA 3EUUA 4JRXB 4J3WA 1GOGA 5J11C 3MNVA 1FJ1A 5EPMA 1UM5L 1FFRA 1TCRB 5CEXA 3QUXD 3SGKA 4ZTOL 3F58L 3MRRB 1I9RL 3ME0A 5I1KH 1F4AA 5C08D 3B5HA 3MRHA 4OIBA 1KLUB 2BVYA 2VDMH 4PGJA 2APTA 2B4CH 2GUOB 2Z31B 4HX1B 1LO3H 2C4FT 1BFOA 4FQIH 3LQZA 3RWFB 3QCUL 12E8H 5CAYB 1UM6L 2CIKA 2X4NB 3UDWC 3MLZH 1DUYB 4ONFH 4V1DA 5INCB 5KZCD 2Z35A 1NMBL 2R2BA 1T1ZB 4JRYB 4OI8A 4XVUC 4JM2B 4L3CB 4MDIB 2EDQA 5E00B 3WXVH 3FZUC 1J0HA 4GQ9H 5DJDA 1JNLL 4XPHL 1D6VL 4F9PA 3GI8H 1I8MA 1LEGA 3B6SB 3OKOB 4FFEX 1T5WB 3GM8A 1VADA 2R9HC 3LN5A 7FABH 5EO9B 3D3VD 3T0EC 4ZSOE 2HTKC 5IK3A 4EIGB 3ULVC 3VXMB 1JNHB 4X4YB 4LPCA 3BKJL 4EI6A 4XP9H 5I1JL 2QSVA 1NCWL 3C09B 5IBUB 1XF5B 2B0SH 1NC4B 4HF5H 4MHHI 4X6CF 1BM3L 4ZMAT 2AVGA 4YDLB 3LQAC 5I66B 4NQTA 1YYMH 2GI7A 3QDJA 4EI5C 5D93B 3GMOA 3PWUB 1UKTA 2AV1A 3ALPA 1UVQB 3CMOL 3QEGH 4HPYL 1CYGA 4EJ1C 4Z76A 3MMEB 3BDYL 2A83B 1KCSH 5I16A 4LU5H 4OV6F 2Q76B 4DVBB 4ZD3H 4BQ9A 4LPVA 4Q6IB 1A64A 3IF1A 5T33L 4Y5XC 3VXSE 2GJ6D 4JCLA 4ZFZB 2NX5D 1Z9MA 3F7VB 3B9VA 1JUFB 2VWEE 5DRWB 5FGCE 4LNRA 3G5YB 2XG5A 3BIAX 1YN7A 3DGGA 1RZ8A 4D3CH 5L2KA 5J1SC 1EAPA 4OKVA 1WC7B 4MB4A 3OGCB 4WU7A 4BKLB 5B8CB 4B7IA 3N9GL 3QEQE 1UCTA 3DO7B 4NUGH 3MRBB 5DVNA 4X7FC 1Q1JL 5DS8B 5HVHB 3VXTB 1QSZA 1JPGB 2J6EL 3GSRB 2NMSA 5F9WB 1JGDA 2NLJB 1T4KA 4G6MH 4YDJB 1H8SA 1HKFA 3E6HA 4ZS7H 5I0ZA 2LFGA 3HTLX 3TEUA 3DX9A 4CAGA 4Y4FD 3HMXA 1JHLL 3MQIA 1NGQH 2AK1H 1MCQA 4EOWH 3SE8L 5F6IB 3TIDB 3SCMB 2BHYA 3QUXA 1IT9H 4HGKC 4PGDA 1MCIA 3IXTA 2R8SH 2V5YA 3T1WA 3NA9H 1T0MB 3MJ9A 5C08A 3QT2A 5EZJA 4F7TA 1I3RA 5I15H 3C5SA 1U8PA 3V6BR 4IMKA 4M7KL 2H6PB 2R4RH 3SBWA 1FYTD 1IKNA 2Q7NA 4IDLA 2J4WH 3CVHH 4JY5L 1T20B 3FQRA 2A2QT 1RZJH 2C1PA 3JTTB 4JFEB 4RGMB 1KJ2A 2FL5B 5HDBF 3WFBL 1NL0L 4YLQT 3DURB 2DB8A 4LRIA 5AZEL 4GS7C 5HY9A 5GGUA 5FIEA 1N5AB 1NBVH 3HC3H 4X8JA 3D3VA 3ARDC 1MREL 3MGOB 4NJ9H 2EH7H 1UWEH 4K71B 2EYTA 4NCC2 1QBML 35C8L 2YPKB 4D0DA 2HT3C 3BVNB 2HJKB 4ZFGL 2QJDA 4WV1B 3BZ4B 4X9HA 2G75B 1V05A 2VXVL 3MPCA 2B1HH 3SDAB 3X11A 2VL4A 4TUJA 4FQXB 3P9MA 1T04A 2FIRT 1CWVA 2OL3B 5LGJA 4WRLA 2NY7L 3WIFB 3I02B 5TFSH 3IJYB 2E6JA 3NIDF 4XHJC 1UACL 1R5WA 1FVDB 4DFHA 4F57H 3VDCA 4MA3A 3VD9A 3QCVH 1MI5D 1G9MH 5DD1H 5JLZA 3A67L 4NUJA 4R97C 1E4XH 2GTWB 1E4KC 3PV7A 2FJGA 1IM9D 3D9AL 3OJ2C 3KPRE 3IFNH 3QB7C 2V17L 3CCHA 4XPBL 1A7RL 1UWXK 1T21B 2IPTL 4K7PL 2VLKE 3PNWB 1I1YA 4NRZB 1TJHL 5IW1A 3RVXC 2GSGB 5DJYB 3RVWD 1IGTA 1WVZA 2DQGH 3MLTA 3UPAA 5EWIL 4D9RD 1X5HA 5ICYA 4JN1H 4NM4H 4P0DA 2CRMA 3L7EA 3MV8D 1X7QA 2YSSA 1BQLH 2E7LC 4MB3A 4WNQA 2F5BL 3DOSA 3QUMB 5DZOA 4DGIL 3GO1L 3SO5A 4I1NB 1P4BL 5DC9B 4X98B 1C5DA 1RUQL 5ANME 4Y4FA 2VXSL 4LLDB 1IC5H 4IIQA 2IPUG 1LEIB 4HH9A 4GMTH 3RI5K 2YZ8A 2ICWJ 3T4YB 3MCLH 3MCG1 1M7XA 3WFZA 2FNBA 1X4YA 3QA3B 5KVFH 4HZLA 4U2YA 4Y1AE 4YDKH 1CLOL 4XCCL 2XRAH 1A6AB 3PGCB 2BXYA 4S1QH 4OZGA 1I85A 4J3TA 1LE9B 5GS0C 5DMKB 1YEKH 4XPGH 3T1FA 2IF7A 4S1RH 1FYTA 1G9NH 3QUZD 4RX4D 3B9KA 3MXVL 5I71C 5J6GB 4WHDA 3AM8C 3RWGA 1YDPB 3ILQD 1ND0B 1KELL 3AMKA 4LPYA 4GRMB 4QHKI 4LHUG 2PYEB 4CRPA 2PCPB 5C0CB 3D25A 4APQB 1JN6A 1ZGLP 4JHZA 1UB5A 2V9RA 4J3XA 5DD3L 5ESVB 3J7HA 1U95B 3L7FA 2CLRB 5JO5B 3F62A 5I6XB 4QTIL 4QRRB 3GSXA 1S3KH 2OP4L 1BWWA 1IGCL 3QG6B 1DQLL 4LHUD 4J6RH 4PJIA 2JJSC 1UWGH 4NQEE 3UC0L 1YY9C 2IAMD 2VDPL 4GAYA 5JA9A 4XVJH 2CRZA 5I1EL 1Y6NR 4KKAD 2UYLB 4LLMB 1N6VA 1ZHKA 2WSKA 4NQDD 5EC1B 5FUCC 5J7CC 5FK9A 2YPVH 2VZ3A 4YC2C 1MI5A 5TQ2H 3TV3H 3NPZB 3N06B 5T1DL 4OGXL 4C4KT 4IRZH 3VFPB 4E41E 1RUPH 4XB7A 4PJAF 4CVZA 1F90H 4Q97A 3NZ8B 1XIWD 4D9LL 4P46B 2X1QA 1OB1B 1HNGA 4L4TA 2GFBA 3ZKNC 3MXWL 1JTPA 2X1PA 3BGMA 1JGVH 4FN0A 4R26H 4GKNA 4HIXL 1TLKA 4PJCB 4LLYB 4XP6L 4RFEA 3X3GL 1WBZA 4DZ8A 1T3FB 3U46A 3HNSL 2YRPA 3GSWA 3UTZB 1CFVL 1ODAA 2PW2A 3HMWL 5I18L 2ZOKB 4QRTA 4X6CE 1A3RH 2W9EH 3QNZA 3R06A 4D8PA 4LLQA 3ROLA 3JTSB 2FX7L 3WLBB 5DD5L 4OLZH 4Z18A 5IHLB 2D0GA 5FYKL 4DAGH 3EYOA 3ZYZA 3EYQC 3EDFA 5C0AE 3H7BA 2ICWI 3TIEA 4PG9A 5ITBH 2FX9H 5KSUB 5ENWB 3HLAA 2AJYH 3LMJL 4M6NH 4R6UA 3WSQL 5I1IL 3JTCA 1MIEH 5A40E 4ZO9A 4OFYD 4WHCA 5JPMA 2W9DL 2X4OB 2VC2L 3GIVA 1UM4H 3ZDXF 1N4XH 1S9VB 4C56A 2ZKHL 1FFPA 3OZ9H 1R3IH 1MHCB 2O5XH 5EBGA 2HFEA 2H45A 1FAIL 5KVDH 1U8NB 1INEL 4XCYA 5HI5C 3QUZA 3GSQA 4RX4A 4Y2DB 5DUML 1BF8A 2HJFA 1LWRA 3HMXL 1I7RB 1P5VA 4PRPE 3RWIA 4XVTL 1MJUL 1QNZL 2KPNA 1N5YL 1MFDL 1H9VA 1DEEA 1I1AB 2I26N 3MV01 5IWLA 3NOIA 4YFEA 5CGTA 3SGDI 2K3TA 4MSWB 3EFFA 3MJ9L 3EOTL 4AH2B 3TO4C 4GG8B 3VG0L 5CEYA 4MNGA 5GRJL 2FATL 4HWNA 4JFDB 5C71A 1H15A 3FFDB 4GKZB 2OQJB 1ZT7A 3CPLB 5TE6H 4R7DB 1J8HD 1JWMB 2I25N 5BZDB 3W2DH 3TVMB 1KGCD 4GRWB 5IB1B 2E7BA 1K4DA 3ARRA 1JK8B 1QSEB 5EU3B 1P7KA 2XACC 4GQPH 2CDGB 5KW9H 4LHUA 3UZEA 1BECA 2F8VA 1GZPB 1HH9B 1DQTA 3D2UB 1AXSA 3CVHA 1A4KA 1KJ2L 4RDQG 2YK1H 1KXQE 1MFBH 3D5OF 1HHIB 1AR1D 2J88H 3U0TB 3SDCC 1I9JL 2OTWB 4NQDA 4P59H 2P4AB 4I4WB 4DVRH 3DMMC 1CGSH 2NY4D 1U3ZA 3L3GA 2P5WD 5FOBB 3AB0C 3FAWA 3NCYS 3B3IA 5C07B 3EBAA 5KSVB 4P2OC 3QP3A 2D0HA 2YZ1A 2XXMB 3ARUA 4JFPB 1IGYA 5HDBE 1XIWA 1IBGL 1HEZB 3GMRB 3QDHA 5MEPA 3W9DB 4R7NA 4PJBB 1OARH 2FJFB 3PWVB 4HIHA 4OZ4A 5KAQF 1CF8H 2AEPH 4QWWC 3N1GC 4MJ5B 3S35X 3L3OA 4KPHL 3WFEH 2HVJA 5E70A 1EHLL 4BH7B 3RDTA 3NCMA 4NO0D 3MRFA 2GT9A 4URTB 3RU8L 3QI9C 5CIPH 3BKMH 1RUKH 4KQ3L 1JBJA 1DDHA 4KDTA 1MPAL 4X6BA 5DRXB 5JOFA 4P23D 1AI1L 3V95A 1U8QA 3GI9L 5HI3D 2PXYD 3FO1A 4H88H 3MRQA 5D7IF 5MI0C 2BNQD 4L4VA 5SWZE 2GQHA 1P53A 4U6YA 3H6JA 1YEJH 2YKLH 4LCUA 3VFUA 3RVVC 5JDJA 3DV6B 3BOVA 1GGBL 4M5ZL 4U1SB 3SDXB 1RZKL 4Z7UA 5GIRB 3VFOA 4PJFA 3X3FH 5CWSB 3U9UA 4MWFB 5EBLB 4RWHA 4OFYA 2XN9B 4K8RH 1N8ZA 4TUKL 2X1OA 2Y06H 4RQQB 4XNZC 4MCZA 3MRPA 3PXJA 4QRPD 3U4BH 3V6OC 3DUHA 5IVNA 4Z8FL 4F7CB 3IRPX 1JF1A 3VFGH 1CGWA 5D5MB 4LASH 1EXUA 1FCGA 3E6FA 4WY7H 5A2JH 2VXUL 4RMTA 3PL6D 1VERA 5HHQA 4NKMA 1GZQA 1WUNT 3QEUA 2F53B 3RX5A 3FB7A 3NGBB 3E2HC 5BZWB 2DQDL 1JGEA 3WEXB 2V5TA 2YPLB 4L9LB 3BQUB 3ARZA 1U9KA 1DQQA 4Y7MA 3WFHB 1X5FA 3CD4A 1BZ7A 2EDHA 1HSBB 3HUJA 3EJZD 4FQHA 4K23H 4MAYC 1MVUA 4TVPL 3UO1L 4DTGH 1A6PA 1W0VB 3QQ9D 3B4NA 3E8UH 3T8XA 4MJID 4JKWA 2VDLL 3LEXB 1XGUB 3MLUL 5F96L 2VDRH 5MEOB 4NWTL 4NPYB 5A3ID 3KLDA 3O6ML 4Y4KA 5HYJE 1ZLWK 2W91A 2JJUA 4AQ1B 4M7JL 3MNZA 2UWEA 3Q6FB 4H20H 4I9WE 4UU9A 4JQVC 3QFJB 3W9EA 4F8QA 1RK0A 3S3JA 1JYXA 5C09E 5T1LD 1NAMH 3O2DH 4WU5B 2X70B 4GW4A 5I1KL 1QLEH 2WWMD 5HVGB 3U7WL 1X5JA 1MLCA 2VDML 3REWA 2P5WA 2B4CL 4R90L 5FV1L 4Z0BL 3EYUL 5JHDD 1XGQB 5KS9B 1K8IA 1SHMA 5EBMB 1ZANH 3A6CL 3QSKB 5C0GA 1AGCB 3OXRB 4OD2A 1FCCA 3MOBH 1NUDA 3MLZL 2XZZA 3LB6D 2HVKB 1BVKA 3GB7A 2OCFD 2OR8A 2YUWA 1LK3H 5GGRA 1TETH 4KKCD 1SMOA 5LG1A 5EOQH 3QUKB 1KIUA 2GKIA 2K9UA 4LP4A 4OUUB 2FSEA 4FQLH 4MJ4A 7FABL 2Q8AL 4P23A 5IB5A 4O9HH 5JW5B 4XP9L 2KH2B 4DOHB 2BNQA 4AG4H 4FRWA 5D1XB 3EO0B 3KHQA 4S11A 4MQ7B 3REVB 4JANB 5F1NB 4NNYB 1F2XK 3RWJA 4RA0C 2NY3B 3MBED 1YYML 3RUGA 3FQTA 1Q9OB 2E7CA 5J9PB 3ALWA 1XT5A 2IMMA 3LEYL 3AAZB 3ARYA 2NZ9C 1AC0A 2W59A 4IOSD 1A6TA 4NKIL 2KL6A 2HAZA 3N1FC 4YGVB 4PJAE 4QYOB 3QULA 4P5MA 2XPGB 4QRPA 1JFMA 1H0DA 3U1SL 3C9NB 2PUQT 3QO1B 4XWGH 3UTQB 4QHMB 1RJYB 2NCMA 1EA9C 1U58A 2K7PA 3PL6A 3FRUB 2CK2A 1IAIH 4G80B 3ZYIA 2A0LC 1D5XA 2X9YA 5EU5B 3FQUB 3A0OA 4U31A 4BFBD 4D3CL 2AJXL 2H3NB 3U4EA 1JGUH 1PG7W 3HRZB 2H2SC 4U1MB 4YH6A 5C0JA 4TNWK 1SBSH 2BVQB 5HYFA 3U0WL 3ULVH 1P4IH 2FIKA 1SM3H 1CLYL 1MFCL 2NNAB 3MBXL 4K8RD 3GGWB 4KZEH 1MHEA 4D94A 2F8XC 1DANU 1DQJB 1U3HD 4MJIA 5D2LF 3M8OH 5AWNH 2EEAA 4Z7VB 4J7RA 1XGPB 2OR9H 5GQBA 2J8UA 4Y4HD 4JM2C 4JZNA 2O5ZL 5KJRL 4ODHH 4M43L 1X5ZA 3LQAH 1NEZG 1ZGLA 1A1OB 4YHKH 3DPBA 4JO4H 2AGJH 2X4UA 1U3JA 2RBLA 3KPQA 1ED3A 1S9WB 3ZDXE 2A1WH 5MHSE 1BX2A 3AXLA 5T1LA 3HAEH 3VXPB 4J3VA 3C2AL 4PP1C 2HFTA 1IT9L 5BQ7A 3MLWH 2R8SL 3ARGB 3NA9L 3BWAB 5D96C 3VFSB 5IHUH 5I15L 4KK6D 4IRJA 4J8RB 4YDVB 4JB9L 4YDLC 4NHCL 2DM3A 4XP1L 5IEKA 2FB4H 4Z77B 4RGOL 2WUCL 5FUOL 2R4RL 1F4WH 1FBIH 3BRGC 1S7UB 5DA4A 3BE1L 4CDGC 1NPUA 1U8KB 5D1ZD 5HHVH 4I48B 1LP9B 4M6OL 1J86A 1T7WA 3OF6D 3QJHB 3LKSA 2PW1B 4PRAB 4MNQB 1MCOH 1JVKA 4KJYA 4Q6IC 1P9MA 1QQDA 2CXGA 1FSKC 3QDGD 43C9B 4HFWB 5E5UB 5HHPA 5I1LA 2BVPB 1DL7H 4MAUH 4M6ML 3FHQA 2GCYB 5GS2H 5FYJH 3IKKA 3HC3L 3PWPD 1A4JA 3V4PH 3ZDZF 4OD3H 1CG9A 3C60C 3IDIA 4NJ9L 1UWEL 1AD9A 3TN0D 2B1AL 2R2HB 3G08A 4DW2L 4Y5VA 4QCIA 4EZMA 5JXAL 2R56H 1F8TH 4U3XA 2XFXB 3FO2B 1LILA 3F7PC 4I0KA 2VISA 4JFZL 3WJJC 1YECH 3HPLB 5B4MC 1A6UH 2B1HL 3MBEA 1T7XA 5GGSY 1C7TA 2EXYC 3TPKA 1BEYH 4LFHG 3LH2H 4JDTL 3PDOA 5CIPA 3B9EA 5ALBH 4NP4L 1RUML 2WIIA 4KHTH 2XTJE 5ESAB 5INDB 2EDEA 2QR0A 5EULV 5K59F 3EFDH 2BY3A 1NCBH 3CH8A 4LFHD 1ZXQA 3KYMA 1BGXL 1ZTXL 3IFNL 3MNVB 5EPMB 4QT5A 3TM6A 3PDGA 3L5IA 4CMMA 5CEXB 4PJXA 1QACA 1EUUA 3TP4A 1ZLVH 4S0UC 2CLVA 3MRHB 1ACYH 1G0YR 2ICWB 5D7IE 3T77A 1DE4A 2X4QA 3MV11 2IBGA 4FFVC 2APWA 4PRIE 4AIZA 1U92A 1CXFA 3LQZB 3LQMA 3ZKXC 1S5HA 1U3HA 5DI8A 1HHGB 2CIKB 3GBMH 4I3SL 5F7NC 1UYWH 3CJJA 4V1DB 2QQLH 2Z35B 3GBLA 2R2BB 1BJ8A 3ULUC 3O0RH 5DJDB 5MENE 2X42A 5BMFH 5D9SA 4GMTL 1LEGB 4XVUD 1I8MB 2XKSA 1EO8H 1BBDL 3FZUD 3M1BA 1VADB 5KSAD 4PJGA 4LCWD 1NEZA 1OVZA 2PTUA 4EI6B 2R9HD 2QQNL 4YDKL 5I8CA 5FYLE 3ULVD 2HTKD 5T3ZL 1WZMA 2R1WA 3O8XD 3SN6N 4FQXC 3ABZA 2LU3A 1YEKL 1UJ3A 1FHGA 5I74C 2BSSA 3QDJB 5D1ZA 3HAEG 1H3PL 3MJ7A 3IDGA 3HC0A 3FMGL 1CFSA 1DQDH 4X6DF 1Z6JT 4K94C 4Z76B 2DM2A 2WUBH 2LAGB 2DKMA 1KFAL 1YMME 5DVMA 4JG0H 3QDGA 1O7VA 2HH0L 3H9SD 3O2DA 5IQ7H 4GBXA 1CLZH 5K9JH 5D7SL 1KCRL 2R0ZH 2WWKO 3IDXL 1JPFA 3PWPA 1OY3B 3RNKA 1FFOA 3HB3C 1QRKA 1NCDH 2VN7A 1CT8A 2IQAA 4K3EH 3OJVC 4PP2A 1FG2B 2ATPA 2VQUA 3VD3A 4JVPA 2IFFL 4LNRB 3TN0A 3QIBC 3BP4A 5JQHC 1YQ2A 4PLNC 2NY5C 4TYUA 4L3ED 1YN7B 3DGGB 1RZ8B 3LHPL 1L0XA 5L2KB 2ZCKH 1EAPB 4BSWA 4OKVB 4J6RL 4YXKH 1MCPL 3W39A 5I75C 2NY6C 4WU7B 4B0MM 4YHLH 1MCFA 2HG5A 3EAKA 4I2XE 4AEHL 1T6VN 4HWEH 5M94B 4LDEB 5E56A 1OHQA 1G1CA 3I6KA 3UTTE 1D7FA 5E8EA 2NXZD 3JWDL 5TQ2L 5GS2D 3TV3L 4L8DB 5FYJD 5C92A 4HWZA 1JGDB 1T4KB 5J3HD 3E6HB 1KPRB 4LSDA 3DX9B 3QNYA 2FJHA 4MDJA 3QBTB 3I9GL 2BOBB 5A2FA 3B5GA 4P9HH 3QUXB 4PGDB 3IXTB 3BSZH 1U91A 5CINL 3DYMA 2IGFH 4NQCD 3LS5H 4G9DA 5D7KD 5EIQA 5C08B 4U1KA 5EZJB 3TYGL 4F7TB 1I3RB 5IVXF 3C5SB 3QHZH 1U8PB 4LAQL 2C1OA 1UADC 2AEWA 3JUYA 4LBEB 5DZLA 3O45A 3B43A 5HPMA 3ET9F 5IEHA 1X4ZA 3VE0A 1IFHH 1OAKL 2FHCA 4DAGL 2EIZA 5KZCB 1W8NA 5DLML 4NHUA 1KJ2B 4IJ3C 4U1JB 3ISWA 1BHGA 1XGRA 3VFNA 3UXFA 4APQC 2VR5A 4YPGA 4HK0A 5HY9B 5GGUB 2W0KA 4LSTH 2V5RA 2BSTA 3HCVA 4P2QD 5IM7A 3D3VB 1CLCA 1PX3A 5ISZD 4B7LA 1OGAA 5FO7B 4JVWA 4XNQA 1NSNL 1WFTA 3IB4A 2EYTB 2F19H 3ARDD 1T0PB 4OSUL 3T0EA 2BCKA 5HHOA 1B4JH 4D0DB 4FG6C 1FRGH 1I3GL 3TC9A 1ZV5A 4DQOH 2H26A 4WWKD 2HT3D 4TUJB 4DKFL 2O61A 3P9MB 1T04B 5LGJB 5IMOB 3PGFH 4NBZB 2P45B 4CJ1A 4YHZL 4EI5A 5I19H 3WBDA 3FCTA 3CZJA 1FE8L 4LL9A 1R5WB 5JXED 5IFHL 4MA3B 4XPFL 3LY6A 3PP4L 1BD2E 5D2LE 1F45A 4JREC 2VRAA 4HMEA 4XHJD 5TF1H 3SKNB 5JLZB 3PWNA 1AJ7H 4NQVB 2XA8H 2I60L 3MODL 4WI7A 1CBVL 2Y5EA 1S5IL 1CXHA 4TUOA 4LSQL 2CUIA 1KB9J 2FJGB 3OKMB 3LPWA 4NM8H 1DBMH 4Y5XA 1SJHA 5ICXA 4CN4A 1GRWA 4P3CH 1WEJL 5EG6C 3O4LE 3OPZH 4W4NA 1I1YB 3GM0A 2GJ6E 5IW1B 1H3UA 2LVEA 4L3EA 4M02A 5E2TH 3V4VH 5F7EL 4U6XA 5L8LB 1C8PA 2NX5E 1DUZA 5HYEA 4RZCB 3MLTB 1CL7I 3WNOA 5I73B 1MRFL 4IOFC 4ODVL 1DQMH 3UTPD 5L6YH 4P59L 3L7EB 3S35H 5D7LE 4DVRL 3TPUE 5DO2D 4WNQB 3HG1D 4B5EA 1SJVA 1A0QL 3B8YA 3QG7H 1NQBA 3P4NA 4OAWA 3NFPB 1U41A 1C5DB 4JFOA 4C83A 4CVXA 1QHPA 4XNUL 4U1GB 5C8JA 4IIQB 4HH9B 1LD9A 1SVZA 4RWYL 3HNTL 1WITA 3O2VL 4HZLB 4C57C 1A8JH 4U3HA 2OZ4H 2WAHA 4ODXA 3BKML 4JFHE 4OZGB 1ZHLA 1H3XA 3ARWA 3VMNA 4N9OB 2D7PA 3OJDA 4WI6A 3T1FB 1FYTB 1JZ8A 3B9KB 4YQXH 2DLHA 1KJVA 4XI5C 5DQDH 4V3DB 5JR1H 5J1AA 4U6VL 1FP5A 3HRPA 4DJMA 2KBGA 4ZODA 2ENSA 3RWGB 1EDQA 3HI6H 1LEKA 2X4PA 4RGNE 4S1DC 5D7JC 2Y5TA 3ARFD 3IU4H 2OJEA 3H0TA 1JGLL 2DMKA 3X3FL 5CP7B 3DROA 2ESVA 3D25B 1A3LL 5ISZA 1JN6B 1S8DB 4PJDA 1UB5B 4HMCA 3V5DA 5IIEA 5K59E 3GMPA 5H37H 3MYZA 3L7FB 1ROWA 3KYAA 3ARDA 5J4MA 3BMWA 3GSXB 1KENL 5C86A 5GSRA 4QGYA 4HC1H 4U4BA 2VDQH 3RY5A 4OGYH 4GAYB 3AS2A 3RVTC 1IAOA 1RFDL 3PQYD 1MCWM 1AIFA 1EFXD 2AEQH 4RA3A 1ZHKB 1P1ZA 4PRBA 1X5GA 3FJTA 4GAJL 1MIMH 3SGJC 3HE6D 3FN0H 2AXGA 5FK9B 2VQ1A 1WT5C 4YUEL 2Y1VA 5LCVL 3FT2A 3KLHC 3MRDB 1MCHA 2ICES 5JA8B 3DJ9A 4N0CC 2GJJA 4CVZB 5E5RB 3F12A 5ICZA 3VXRD 5F7WC 3VCLA 4H25A 1OLZA 1KJMA 4L4TB 1E4KA 2GFBB 3UBXG 3KVQA 1KN4L 4M4RA 4GKNB 2Y25A 4Q2ZA 1A6VL 2MPAL 1QFUH 2N4IA 3IJHA 3HI1A 4RFEB 2R29L 2GAZA 3U46B 3GSWB 3O2DL 2PW2B 3CDYA 5DJCB 1MCCA 1Q72H 2CGRH 1JL8A 4TRPH 1YY8A 3HG1A 3R06B 4D8PB 1T83A 4LLQB 3ROLB 1SEQL 2E6PA 2E7LA 2A74A 3EHBD 3EYOB 4X6DE 1E6JH 3MV8E 3O6LL 4HS3A 2PF6A 2UZIL 1ZANL 3H7BB 4Y2OA 4KK8C 4PG9B 3VI4F 3EYQD 3UYOD 5ANMB 3RWEA 2UZXB 2SEBA 3HLAB 2IH1A 3V5KA 1GVIA 2AS5M 4FMFA 4PB9H 4XX1G 3D0VA 5JPMB 3GIVB 2R0WH 2BRRL 1NFDA 4Y1AB 3UTOA 4GJTB 5EOQL 4C56B 4FZEH 4WUUD 1CDCA 3DETD 3QIWD 2HFEB 3C5JA 4XCYB 1IEBA 4RFNC 3ZDYF 1G9EA 3GSQB 1PVHA 3ZHLA 1CK0H 3GRWA 4GAGL 4ZUVA 3RWIB 5HXMA 3KPLA 4JO1L 4D0CB 3CLFH 1BQSA 3TJHC 2YR3A 3EFFB 3AM8A 2MTPA 3ARFA 4CJ0A 5CEYB 1R5IA 4MNGB 5GJSH 5HI4C 1H15B 4J3SA 5C0EB 1W72L 1T0NA 1ZT7B 1W0YT 4KDVA 3RGVD 1YEFL 1XH3A 4QKXB 1EIBA 1K4DB 3KNBB 1P7KB 2KZWA 3Q5TA 5IJKC 4LPTA 3BD5A 4R4BA 2DDQH 4KRNA 4LHUB 1NC2D 2DOCA 1VSCA 2YN3A 3GFUA 3KJ6L 1AXSB 1A4KB 1OP3H 2JJSA 3GJFH 4LSPH 1IAIL 5E6YA 4MVBC 4WFEE 4IS6A 5H37G 1GAFH 3OAZH 4HKXA 1ZS8A 2VDOH 1JGUL 5IHZA 3MLSL 4ELKA 1JI1A 3SDCD 5T1MB 4G3YH 3L3GB 5GJTH 3WD5H 4AENA 1SBSL 2A6DA 4BSVA 2F54E 1MUJA 3B3IB 4WHTA 2YUZA 3JUZA 5FYLL 4UT7H 2A73B 2JJWA 3NPSC 1IGYB 1INQA 1XIWB 4HLZG 2FZ3A 5FXCH 3U7AA 2OR9L 4P2OD 5MEPB 1JZ3A 4MLSA 4R7NB 2FEEL 4OZ4B 1C1EH 1IILE 3O6FC 1Q8MA 2HVJB 2Q7YA 5IFAL 3U6RA 3RDTB 2ZZUT 3MRFB 2GT9B 4QWWD 1R3KA 1ZSDA 4WJ5A 1KEMH 2FBOJ 2XQBH 1IM3A 3ZYOA 4FABL 3QDMD 1DDHB 4X6BB 3S34L 3IAPA 2DYPD 4JAMA 1U8QB 3AGVA 3UBXA 1MCJA 2IQ9H 2MCPH 3FO1B 3MRQB 5KVEL 4L4VB 5IHUL 4QXTB 5IOPA 4MA8H 4JFYB 5EA0L 4U6YB 4DKEH 3OMZA 1LQSR 3VFUB 4K3HA 3MV9D 3QAZB 4ERSH 5B39G 4HKJA 4XMLL 3RVVD 2AJUL 3VFOB 5GHWH 1X5AA 4QXGH 5TDPA 3U9UB 4FXGA 2V5MA 2H2PC 2HFGH 1NAKH 5DC4B 4BQCA 4P4RA 1PG7L 1N8ZB 5LQBL 1MAJA 2YD3A 4LVEA 4MCZB 1NANH 3ZKQD 5E8PA 3NACL 4XNYH 5CEZH 1CD0A 1TTGA 3UJIH 1JF1B 4MAUL 3TBTB 4KXZH 1EXUB 4HBCH 1QFWH 3E6FB 4P5TD 2NY1C 5HHQB 3V4UL 1RJZA 4NKMB 4OLUL 3TESA 1JF6A 1OAZH 3GIZL 4YBQC 3QEUB 2VAAA 3FB7B 4P5KA 3RL2A 3L3DA 2ZOLA 1YECL 1J5OH 1JV5A 1DQQB 3WXWH 4QTHB 3MO1A 1BZ7B 4FQHB 1MVUB 3DVGA 5EORH 3TO4A 4NKDA 3T8XB 4IEFB 4X4XA 4MAYD 4PBWD 1GGYA 3KLAA 5EUKA 3TO2A 1Q9LA 1T6WA 1RURL 4Y4KB 3VU2A 4OLVH 2DMCA 4NO5A 4ZUTA 5JZ7C 3F7YA 1EVUA 3DVIA 1NC2A 4ZUWB 4R96A 4PJ5D 1J8HE 3QHTC 1FFNA 1F4YH 3EFDL 1KTRL 1KGCE 3O9WC 4UU9B 3V5HB 2QHLA 3W9EB 3HS0A 4HFUH 1RK0B 4R3SB 2F5AH 1NFIA 3OAYH 4KMLB 5EU6D 4BZYA 5CJOL 5IVXA 1FGVH 1KT2A 4KJPD 1FIGL 4GW4B 4K3DH 2VJXA 1K8DB 3SDCA 2NY4B 1MLCB 1BQUA 3DMMA 2IALA 4JO3L 1M7IA 3BIKA 1K8IB 4G6JL 5C0GB 4E5XA 1OAXL 4LHQB 2VDKH 2OXHA 2AK4D 4M7ZC 1UYWL 4P2OA 5GS1C 2QQLL 1BVKB 3GB7B 1Q9WA 3EYFA 1NBZA 5GGRB 1H3TA 1OSPL 2E7MA 4M1GH 3VXQA 1OCWH 2ZJSH 3IGAA 3F5WA 3U30C 2VO5A 5IKCA 4OT1H 3GSVA 2FSEB 3QDMA 4PV8B 3X14B 3QI9A 2DYPA 2D03H 3MGAA 1AKJB 5IB5B 3G04A 2UY7A 5DMIH 2ZUTA 4PGEA 3IDYB 4PDCE 2BNQB 3OG4B 3TCLA 1PLGL 5AAMA 3U9PL 3F6IA 4X6EA 4HT1L 4G9FE 3VA6A 5C2UB 3DHMA 3MV9A 1QBLL 3RWJB 4NC0B 4O58L 1FDLL 4U1LA 3RUGB 3FQTB 5ADOH 3BAEH 3QQNA 1S7SB 4JPWH 3TWCH 4OCXH 2WUBL 1A6TB 3VRJA 3QULB 5DGQA 4P5MB 2X4RA 5B39A 2IG2H 3IJSA 1IAKA 1H0DB 2EDTA 2JKXA 5CBAA 1HIML 4JPKL 4A6YL 3WKMH 3V6OA 5KTEL 4ORGA 1BAFH 4YHMH 3MJ8A 1NCDL 2HKFH 1I7ZA 4HAGA 1XGYH 1RHHB 4ZOAA 1F2QA 2I9LA 2VLLA 1TJIH 2IPKA 2VDNL 3DX8A 3ULUH 1YNLH 3FQNA 4P4KB 4F7PA 2ZCKL 3LKRA 3U4EB 2A0LD 3C87A 3PHOA 4YXKL 2EDLA 1M7DA 5C0JB 4FFZL 1LDPH 4JG1L 3B83A 4L3AA 2CIIA 1UKSA 1A1NA 1DFBL 2H2SD 2FIKB 3RY6C 4JKPL 4HWEL 4AMKH 1KB5L 1LO4H 3A6OA 1MHEB 3MZTA 4MAYA 5CEZD 1JRHH 3VI4E 5GS0L 2OL3H 2J8UB 4JZNB 5AZ2L 3GRWL 4OCSH 3NCJH 3SQOH 1ZGLB 4Q0XL 2AV7A 5CGYC 4JRYD 4LLVA 4JM2D 4PJ5A 2X4UB 5IBUG 4KRPB 5TJWK 2G2RA 3SGEH 2ZUQC 1ED3B 3KPQB 2YD8A 4LIQE 4K94H 4TSAL 1BX2B 3AXLB 4JO2L 5T1LB 1AGDA 2HTLC 5EU6A 4HCRA 4XP5H 5BQ7B 3LKPA 1HKLH 1LO5B 5C0BE 5C09B 4JQVA 1S9KC 4M6AA 4W6XB 1NGZA 1IAIM 2YS4A 4PP1D 4L4JA 3ZDYE 5DMYA 4IRJB 3QHZL 1VGKB 5ACMA 3IETA 3P40A 5IEKB 1NC4D 3S37X 1ES0A 4FNLH 2J12B 2HYMA 1WAAF 1RULL 4OCNC 3LKOA 2P5EE 2C7UA 2NY5H 2F9BT 2AK4A 2IH3A 3IAGC 5JHDE 4AM0A 3LKSB 3QZWA 3WN5C 3K8LA 3STZA 4RAVA 4KJYB 2YRZA 4XCFH 5GZNC 1AD0A 1MHHA 1QQDB 2OJZL 3EJYC 4F37K 4NCC1 4Y16C 3IYLW 5EN2A 4UIMA 4PB0H 3GJFA 4F9LC 1QRND 5HHPB 2NR6C 4YHNA 3QUMH 5I1LB 3U83A 2I9TB 1OM3L 4KHXL 1N26A 3KPOA 1IMHC 2A6KA 4C58B 3BPOC 4DGYH 1A4JB 1UQSA 5L2JA 1CG9B 2EIEA 1BFVL 5IVZA 3O3EB 4XNXH 2OSLA 3IDIB 3OL2A 4P9MH 5T3XE 3RIAF 1AD9B 3L3JA 1HQ4A 3G08B 4UUJA 4Y5VB 4N5UA 3WHE0 4QCIB 5BOPA 4UOJA 3K46A 1GXEA 3ARBC 4RFOH 4ENEC 2VISB 3KYKH 2I5YH 1AP2B 3P9LA 3OBAA 2B5IC 5E94A 3IDNA 2Z91A 4YXHL 1YPZA 5IBLC 4O02H 4NZUL 2J3SA 1T03H 4HUVA 3RX7A 2PR4H 5DRNA 5B4MD 3P9WB 1F02I 3QHFH 1E27A 2EXYD 1NH6A 3IXAA 3WDIA 5CIPB 2D2OA 5DRZA 2MFNA 4NZRL 3DARA 5C3TA 3WNKA 4N5EC 4TQEH 2WIIB 4XXCC 2H9GA 2XA8L 3LD8C 1Y0LA 5E03A 2IANA 2QR0B 3W0WE 3DYOA 3K4DA 1N0XL 3KYMB 1H3WM 2YA1A 1HSAA 2OI9B 4LVOB 2ZCLL 4QT5B 4ONGH 4CMMB 5EOCH 1MRDH 2X2YA 2ADJA 5JHLH 1DSFL 3DX6A 2CLVB 3OKDA 1KCUL 4CMHC 1QA9A 4U1IA 3T77B 1DE4B 2X4QB 1VPOL 3MOAL 3VGBA 1V7MH 4AIZB 1U92B 4HDIB 1CDUA 5E5MB 3P0YL 3BPLC 1S5HB 1U3HB 4FFVD 5DI8B 1KC5H 4ZTPH 4Z7NF 5D71H 1F58L 2VSDA 1CGTA 1ORSA 3PP3H 3UTSA 4JRYA 4JM2A 3V79C 1LO0H 2BC4A 2PYFA 2V2XA 4EIZC 2P8LA 2QSTA 1FPTL 5D9SB 4OLWH 3ULUD 5DHYA 1L7IL 1RVFH 5BO1H 3BKCH 5A2LH 1N64L 1R6VA 4PJGB 5I1GL 4KI5F 1NEZB 2YD6A 5DR5L 4FTVE 1DLFL 1CICC 5J6HA 2BSRA 2R1WB 1Z9LA 3UYRL 4LNVA 1JFQH 4HAFA 1UJ3B 3D39E 1PEWA 3TBYA 4DK6A 4M62H 5A43C 4FQXD 5D1ZB 1XZ0A 1MF2L 4E0RB 2XI9A 3MJ7B 3IDGB 4KKBC 1UVQA 2Z8VC 3HC0B 3I3DA 5C7XL 5EZIL 1CFSB 4ELMF 4TSCH 5CCKL 1A3QA 1NCCH 3U36A 3SY0A 3BESR 3FB6A 1NGYB 1WF5A 4HLJA 1AO7D 2HLFD 4CNIA 1QRNA 4Q6IA 3WFCL 5JIPA 3IU4L 1UB6A 4GBXB 1UA6H 5TDOA 3PWPB 1JPFB 4PD4J 4HUUA 3RNKB 2VWEC 2IEPA 1CT8B 1JUFA 2IQAB 4J3OC 1N0LA 4PP2B 2ATPB 5F7YC 5GGVY 1N6QH 1JHKH 4MXQD 1BJ1H 3HB3D 4ZXBB 3C60A 3DWTA 4MGXA 1CXKA 2ZUVA 4OFVA 1YC7A 3QIBD 1K9TA 5DQ9A 1KBGH 4YNYA 2V2WA 2X7LB 1YYLL 5EU7E 1P5UA 5I1AA 2HG5B 2EO1A 3WJJA 2NY6D 5BVPH 1JP5A 3GSUA 2R2EB 1F3DH 3I6KB 1MIML 4X80H 3N85H 1YUHB 3FB5A 5K9QG 5E8EB 3B2UC 3RWCA 1MCKA 3O41A 3ZLQC 2MOVA 3MTRA 4HWZB 1G84A 4PJ7F 4QY8B 1CD8A 1QPXA 2VOTA 4YDJA 4ZO6A 4M93B 5KSBA 1YN6A 3KJ4C 3SDDC 3QNYB 1MELA 2FJHB 5DWUH 5JW4R 3MV7D 2G9HA 3CU1A 4NGHH 3BKYH 3WFDL 1RK1A 1RZGB 5IT2L 4XT1C 5J11B 5E2UH 3KYOB 1GIGH 1U91B 2IWGA 4U1KB 4YXLL 1GPOH 4NQSA 4GRWH 3QUYC 2R69H 3OGOE 4U2ZA 3MREA 3UPCA 2C1OB 3OJMB 3ZKSD 1WCBB 5HJ3A 2H32H 3C5ZC 3O45B 1YEEL 5CJXC 5HPMB 5IEHB 3VE0B 4OIAA 5CUSH 2VE6A 1S9YA 1SJEA 4XB8A 3DSFH 5E99H 5DD0L 3Q1SH 5SX5K 3SDYL 2EIZB 1KCVL 3OKLA 2FL5A 3BD4A 4NHUB 1E6JL 2V7NB 2VLRE 4DZBB 1NUNB 1XGRB 3VFNB 4YPGB 4HK0B 3LDBC 3T0AA 2PYED 2Z8RA 5AAWA 5DUPL 2BSTB 4W4OC 1YJDC 3VFVA 5IM7B 4APQD 3FO0H 1KG0A 1KN2L 1OGAB 4Z5RA 2WY3A 5JW4M 4XNQB 2F15A 4LVNC 2UUDK 1FNGA 4HV8A 5C2BL 4S1SH 1G1YA 3I2CH 4QRRD 3T0EB 5GPRA 3VFWA 2BCKB 5HHOB 2GK0A 3MYJB 4KAQL 2D9CA 2CMRH 4JFFE 2H26B 3BZ4A 3B9AA 4LCWE 3GK8H 2G75A 1CU4L 4LOUC 1TPXC 4FQXA 2EZ0C 4XC3L 3V0WH 4RBPK 3K1DA 1J1XH 4EI5B 1IKFH 1N6UA 1X6NA 3CLFL 4DN3H 4R2GC 4HCRL 4OZIA 1QPPA 1AO7A 1I3VA 5BV7C 1XMWA 5DEFA 3PWNB 1D9KC 1VCAA 4N0UE 5BXFA 4OGAC 4M5YL 3T2OA 1KULA 3KWWA 2ED8A 1EEZA 4Y5XB 1KXVC 3PF2A 2AKRB 1SJHB 5ICXB 1WZLA 1EH9A 5F6HJ 3IVKA 3H9SE 1UM5H 1OL0A 5F71A 4GSDL 4ZTOH 2DDQL 4L3EB 4PRHE 1I9RH 2OTPA 4NBXB 3QIBA 1DUZB 4QOKD 4PJEA 4G5ZL 3WS3A 2X6MA 4FA8A 1NGWA 4OCLC 2OXGA 4I77L 3ZO0A 2FO1A 3ZT5A 5GRZA 2EXWC 1WAAE 2LU7A 3QUMA 1S78D 2I27N 3CH1A 4OAWB 1NMBH 4U7KA 4JFOB 4C83B 1DBAH 3C08L 4Q58C 1JNLH 3KPTA 4XPHH 1D6VH 5C8JB 3MV7A 1LD9B 2MHAA 4FFYL 4N90E 3H42L 4WUKL 2UZYB 43CAA 5FB8A 4POZD 1FLTX 5I1JH 1NCWH 3BD3A 4N0YL 5DMGD 4ODXB 5ERWA 1ZHLB 1OAQL 4FHBD 4K9EL 2FECL 1BM3H 3QYCA 4R4FL 5E9DE 3ROOA 4NQCE 5IESL 3OJDB 4J23A 4LCIL 2BFVL 5D7KE 4Y2DD 2MCPL 1R24A 4XMPL 3S4SG 1PSKL 1OT1A 3CMOH 4HPYH 4MA8L 1KJVB 4KTEL 4P3DA 5J1AB 5J6GA 3BDYH 5DK0A 1L6ZA 3EKCA 1VFOA 4XI5D 3BH8A 3NA4A 1T2XA 4HUWA 1LEKB 2WBJB 2X4PB 3SHSA 2AJSH 4FQPA 2YA2A 3V2AR 4UNVA 3KHOA 2Y5TB 1QSFE 4U0RC 3OQ3B 2OJEB 1CFQA 3WLWC 3H0TB 1TQBC 4JPIA 2PTVA 3OB0H 3QWRD 4APQA 2ESVB 4K7FA 4GS7B 4F2MB 5ISZB 3JWNC 4PJDB 2AAVA 5IIEB 1BIIA 2C3VB 3TVMD 1QFOA 2YN5A 5JO5A 3K4ZA 4IDJH 1QSED 2DBJA 3ARDB 2GW5A 2ICCA 3QG6A 4MJ6A 3UJIL 4P2QE 5GSRB 3D2UD 5HYIA 5LGHL 1R3LA 1MWAA 1IAOB 4X8XA 5DJ0A 1AIFB 4Z7WF 3N9GH 1P1ZB 5DURD 3RVTD 1I8LC 4LLWA 4PRBB 4X7SL 4GW5A 4LIQL 4NWUL 3DI2B 1WBYA 3LIZH 1Q1JH 2AXGB 1Q0XL 2J6EH 2VQ1B 1OTTD 2AI0L 4JQXC 5HVWA 3FT2B 3WXWL 4Z7NE 3P4OA 2IMNA 3EDDA 5C07D 3VFPA 1I1RA 4MHHG 5F6HI 3HKFA 5EORL 3KLHD 2CSPA 1ONQA 3F12B 5EUOA 4R97B 1JHLH 5ICZB 3VCLB 4N0CD 4H25B 3SE8H 1A7OL 1WTLA 1KJMB 4OD1L 4UT9L 2IBZY 4OLVL 3O4LB 4Q2ZB 1YEDA 1EERB 4KI5E 2FECI 3IJHB 4I0PC 4QOKA 4DCQA 3HI1B 2GAZB 5CILH 1GHFL 4HFUL 3QRFM 1FVCA 3BN3B 3FRPG 2ZOKA 4V2BA 2VYRE 1KUMA 4U1HA 1CXIA 4JY5H 3HG1B 3RX8A 3ZL4H 5D7LB 1OTSD 3CU7A 3RKDC 1EO5A 4GG6A 2A74B 5FOJA 4ELME 1A14L 2Q3AA 3WFBH 1NL0H 1F6FB 4Y8DC 3BP6A 2YXFA 4GXVL 2VDKL 2IH1B 3V5KB 4KK8D 2JCCF 3TFKC 4KRMB 2XN9D 3T0VA 3D0VB 2R4SL 2X4OA 3BPNC 1QBMH 4HJGA 2ZJSL 1NFDB 2H41A 1RQ5A 4OT1L 4MD5A 4ZFGH 2D03L 1U8NA 2R1XA 2VXVH 1A7BA 3C5JB 1HK6A 1IEBB 3D1MC 4LQFL 2HJLA 5BRZA 2NY7H 5CJBA 3KPLB 3X13A 4OZHF 5BS0E 5GRYA 5I71B 5LAXA 1UACH 3G5VA 4YHIA 4OI7A 1MY7A 2YPLD 2IJ0C 2NZIA 4JGUA 3BQUD 4KRLB 3TJHD 5JIIA 4PBVC 2K7QA 3VWKC 3S4SA 4UOW1 4PJ7E 3TWCL 1CE6A 5D7JA 3HE7C 3D9AH 5DXWA 1T0NB 1JWMA 2V17H 1XH3B 4XPBH 1A7RH 1XR8A 5MEQA 2IPTH 4L8SC 2COQA 1TJHH 2DKUA 2VSCA 4R4BB 1H5BC 2H32A 4ZNEE 1GZPA 1TFHA 3G6JA 1HH9A 3D2UA 1UKQA 5EWIH 5I76A 2HKFL 2WV3A 3T08A 3QFJD 5JW4N 4N1CA 4YIQA 4EVNA 4KDWA 1TJIL 1WV7T 4IS6B 1O5DT 4WO4C 4BH8A 1Z9SA 4LSRL 4HKXB 4OIIL 1KTLA 1ZS8B 2F5BH 1TMCA 2DM7A 5IHZB 4ELKB 3I84A 5CZXC 1RZ7L 1LDPL 3JV0A 3SGJA 4DGIH 1SYSB 3GO1H 2RQ8A 2FLBT 2JK5A 1MUJB 4YC2B 4NO2A 1AGBB 1WT5A 1RUQH 4EBQL 5M7QA 1EO7A 4HSQA 4XXDA 2VXSH 3T0WA 1INQB 2UVEA 3Q5YA 4N0CA 2FZ3B 4CADA 5KVGL 2NYYD 4X9FA 3S37H 4OCSL 3NCJL 4OM0L 3U4AA 3VJ6A 1FZJA 4PR5A 4BH7A 1V3JA 3OKEB 3U6RB 1CLOH 1NDMB 4XCCH 3VXRE 1R3KB 1ZSDB 4WJ5B 1IM3B 4WFHD 5F9OL 4O4YH 4P57A 3VGAC 4KUCD 4JAMB 4RMVA 2D7MA 4XP5L 3S7GA 2PO6C 1HKLL 2VLMD 3UBXB 4N0RA 3GHBL 1FYHB 4PJHF 3MXVH 2FX8H 3RA7L 1EZVY 5IOPB 1RIHL 5D1XD 1HI6A 2ADIB 25C8L 1D6EA 1KELH 3SDXA 1JIBA 3FRPA 4HKJB 5I17A 4E9LA 3V0AC 2XTLA 5CMAA 3ARQA 4ZQKA 3ETBF 5TDPB 4FXGB 2XT1B 5F7DB 4G8GD 2XN9A 4P4RB 2AP2A 3BXNA 2H2PD 3KPSE 5KOMC 4QTIH 5JOPE 5E8PB 1IC4L 2OP4H 1T66C 3SJVE 1IGCH 2BY1A 1DQLH 4L5FH 1U8LB 4UINL 4UBDD 3VXUD 1AFVL 5D5MA 4DGYL 3UJJH 4LPUA 3BDXA 2DMBA 3OAUL 1S7RA 1C5CL 5CLTA 5I1EH 5E4EC 4P4KC 3EDEA 1M05A 2VAAB 4N9GA 1OOAA 3TCXA 2NY1D 4WUUE 4P5KB 3RL2B 4PFEA 3L3DB 4YBQD 2ZOLB 3UZVB 1BZQK 3TZVB 4XX1E 2I5YL 2YPLA 3NTCH 4PRNA 5JNYA 1T03L 1FH5H 4WFFD 3TJHA 5T1DH 4OGXH 5H35B 3MO1B 4D9QE 3SGDH 1UCBL 5AG8A 3DVGB 1EUTA 4R0LC 3TO4B 4NKDB 4D9LH 5KANI 3KLAB 4ZS6D 5EUKB 3TO2B 4CN1A 3MXWH 1Q9LB 5IG7B 5BJTA 4NO5B 4ZUTB 4EQ2A 3F7YB 2EDBA 1WZKA 5GSVA 1NC2B 1EEYB 3QH3B 4R96B 1FFNB 2X40A 5IJKA 4XP6H 5F89B 3GKZA 3HZKA 4HXBL 4PREA 4GT7A 3HNSH 3ERYA 3HS0B 2HA1A 4HKZA 1XF3A 1CFVH 3HMWH 5I18H 1NFIB 1QFWM 3RNQB 5IVXB 2AXJA 3KXFE 1KT2B 4QRUB 1QHOA 5E8DH 3VRIA 1KPVA 1DR9A 4MVBA 3SDCB 2FX7H 5DD5H 5F3HA 5HTSA 4F80A 5FYKH 2O93L 3DMMB 2IALB 5JTWA 1M7IB 1P84K 1V7ML 1CVRA 3O3DA 4J12A 1VKXB 3AB0B 3ILPA 4P2RA 2CKNA 4E5XB 1KC5L 3S96A 4ZTPL 3LMJH 1MWAL 4P2OB 2GSIB 4X99A 4YBHA 4M7LL 4M3JA 3R8BB 1Q9WB 1EJOL 3EYFB 2RGSA 1NBZB 4QLRA 2APFA 2VC2H 4GO6B 4PJ9C 3VXQB 3IGAB 4CKVX 5IKCB 2ZKHH 2EO9A 3GSVB 4G8IA 3QI9B 1FAIH 5ABDE 2DYPB 1RVFL 2E27L 1NKOA 4YR6A 1JHTA 3G04B 5DUMH 5SX4I 4PGEB 3MROA 3CFKA 2QKIA 3TCLB 1MJUH 3QCTL 1VENA 4R4NC 4Z7WE 1LK2A 4X6EB 1N5YH 1MFDH 3REVA 4JANA 5T1KA 3H9HB 3GMNA 5ADPL 3ZSTA 1U2CA 4M62L 2ARJA 3MJ9H 4GLRI 4U1LB 3EOTH 1TNNA 3MOQA 5J9PA 1OP9A 3MLXL 5GRJH 4FQQA 2P47B 4G8GA 3VRJB 4YGVA 4BFIA 4OM1H 2XPGA 3BEWA 2X4RB 4UAOC 3O4OC 3OR6A 3P30H 2RR3A 3IJSB 1IAKB 1L7TL 5FUZL 2D9QB 3VXUA 1RJYA 4XNZB 4LVOC 4UILL 1KJ2H 1RI8A 4ORGB 3TBVA 4MNHA 3MJ8B 1QFPA 4OCYH 4NN6C 1I7ZB 4G80A 2I9LB 2Y6SC 4U7SA 2VLLB 1I9JH 5EU5A 4XTRC 2IPKB 2XV6B 3FQNB 5T5NG 4HG4J 4F7PB 3LKRB 1VGEL 3PHOB 1ITCA 4U1MA 1M7DB 1KBGL 5DFWH 3E2HB 2FO4A 3QRGL 3M45A 3TBSA 1CDIA 2CIIB 1A1NB 1FO0A 2P8PA 4H5SA 5KBNC 2DTSA 3LZFL 4X80L 3N85L 1IBGH 1AH1A 4HZAA 5HYQA 5L7XL 4JFXA 4LHJB 2V2TA 1AE6L 4V1DD 4DUVA 1NMAL 2AV7B 1EHLH 2JCCE 3KDMA 4LLVB 4PJ5B 1CE1L 5DJ2A 4OTXL 2VLJE 3RU8H 1DCLA 2G2RB 4KQ3H 2BJML 5CGYD 4YX2H 1FAKT 5HHXL 1MPAH 1B4RA 4Y19E 1B88A 1AGDB 3O9WA 2E8ZA 3GI9H 3IU3A 3LKPB 2HT4D 2NY2C 5F3BA 3TLRA 1GPOL 5HDLA 2R69L 3BT2L 3IETB 5DYOA 4Z77A 1MHPH 4JKLA 2KKQA 4Y5YB 1GGBH 4OZHE 1ES0B 4M5ZH 1DP0A 1Z2KA 1RZKH 1CDJA 3O3AA 3B9DA 3OG6B 3QDJD 1FZKA 2RIKA 3TT1L 3LKOB 4I48A 2C7UB 5CP3H 2IH3B 3DSFL 1JZ5A 1ZWIA 2PW1A 4AM0B 3QZWB 1KNOA 3Q1SL 4F15C 1NGPL 3STZB 4RAVB 4FQ2H 1AD0B 1MHHB 1EVTC 5GS1A 5EN2B 3BMVA 1KCLA 4XWOD 3RL1B 3GJFB 4Z8FH 1EHAA 3EOBA 4YHNB 1TQCC 3RJQB 3RBGA 4Y16D 2BNRA 3KPOB 2A6KB 1UQSB 1RUAL 2KQMA 2VXUH 3FO0L 5L2JB 2DIJA 5IVZB 1N3NA 4ZXBC 4BFGA 1Y6KR 1DVFC 5FYKD 1ZT1A 3LKNA 4PJ8C 1OP5H 3L3JB 4UUJB 4ALAL 1FC1A 1GCFA 3O2WL 4YFLI 4F58L 1B3JA 32C2A 5SWSA 4UIKL 1FL6A 3P9LB 4IBLT 4AEIH 3GK8L 2Z91B 4AYFA 2EE9A 2RCSL 4HUVB 4TVPH 4PV9A 5DRNB 3STBA 3UO1H 1J1XL 2FR4A 4JR9L 4WFGE 1IKFL 4DN3L 4TPRH 5FHBL 1E27B 3IXAB 3MLUH 3GSNH 5F96H 5DRZB 4NWTH 3U82B 3X12A 2XTJC 3IDMB 3O6MH 2H9GB 1TDQA 5INDA 3C8DA 2IFGA 2IANB 3HPJA 1H3VA 1O0VA 1PKQE 5D2NE 1HSAB 3FFCE 6FABL 5I8OL 1JF5A 4Z6AT 5E24E 5E08L 3WUWG 4PLJD 4LLAA 2ADJB 5GGTL 3DX6B 3T65A 4JRXE 3OKDB 4YFDB 3U7WH 4PJHE 1QA9B 2ICWA 4U1IB 3SGKC 4R90H 4Z0BH 3EYUH 3L5WA 5JW3L 2FGWL 3VFRA 1HHJA 3A6CH 2QSCL 4ZFFA 4MZ3A 2W0FB 4BSJA 2VZOA 1KCKA 1HHGA 2ZP0T 1ZLUK 3RY6A 2ZG1A 3FOLA 1BVLA 4XCNA 1ZK9A 1ORSB 4FZ8H 3RZCC 3V6FA 1AGFB 3UTSB 1ZVSA 1HZHH 1DBAL 2BC4B 2PYFB 2V2XB 4J1UA 4E42A 2HWZL 2P8LB 4G6AC 2MWCA 4JKMA 1JZ7A 5DHYB 2Q8AH 4RCAA 3JV5A 2JTDA 3SE4C 4M4PA 2GJZA 5CKAA 3INUL 4W6YB 3FONB 5J6HB 3BPCA 1B0RA 2BSRB 1NMCC 1KTKE 1Q0YL 5D96B 1CICD 3S88L 2AXFA 3VXME 4PJCF 2XWJA 3TBYB 1OGTA 1NDGA 2R23A 1XZ0B 4G7YL 5F1SA 3GKWL 4DGVL 3LEYH 4UMGA 3RFZC 1S7QA 1ZT4A 4NKIH 5AUMA 3U36B 1HXMA 3MLVL 5FHAL 3SY0B 3FB6B 3WN5A 4W6WB 4CNIB 1QRNB 2AJSL 4NSKA 2EE2A 3U1SH 1UB6B 4LRNL 4Y16A 1FSKB 1OD9A 3CLEH 4BZ2L 4F9LA 5TDOB 1PY4A 2GY5A 3R4DA 2BSED 4HUUB 3VD5A 1J8KA 1DBBL 1FG2A 2D31A 2JE8A 4IDJL 4ZOBA 3DXAA 3C60B 4Z78A 5EIIB 1MCSA 2AJXH 2ARWA 5DQ9B 4YNYB 3DRQA 1MFAL 2VAJA 2V2WB 5I1AB 3U0WH 1CLYH 1MFCH 3MBXH 5MP6L 3GSUB 3QEQD 3LIZL 3FB5B 5CD5C 5DHVH 4NT6A 5FFLA 3L5XH 3RWCB 5KJRH 5DEGB 2O5ZH 3O41B 4L8DA 4G8FA 2XKNA 4M43H 1T2QL 1WZ1L 2YC1A 4I13B 4P3WA 3B2UD 3ZE2F 4QEGA 4N5EA 4PBXA 1KPRA 1YN6B 3LRSB 2IC2A 5JDSA 4PG2C 5KSBB 4RISH 2X05A 4WW2F 4XXCA 5C70A 3U79A 1PZUB 4HIJB 5JIKA 2BOBA 2G9HB 4I18B 5B21A 1CN4A 1RK1B 1TENA 3SDDD 4DK3A 3C2AH 3IAQA 1T1XA 2BMKA 3EZJB 3MX0A 3SQBA 4GRWF 4Z7OE 1GGCH 2CJUL 4JB9H 4TVPD 1HILA 4NHCH 4NQSB 4XP1H 3NZHL 5CILL 3MREB 4RGOH 2WUCH 5FUOH 5IFJB 4WI3A 4LBEA 1DTUA 5HJ3B 3BE1H 1TJGL 3QUYD 2JIXD 3WUWA 3P0GB 1FNSL 3B9KD 2XOTA 4M6OH 1RIVH 1J0KA 2DM4A 3ZL4L 2VE6B 4DFIA 2FGZA 1S9YB 1SJEB 3ORJA 1RU9L 2WBJC 4JZOA 4HK3J 3SKMA 3ZKXB 3V6ZA 4DN4H 3OKLB 4PY8I 3CXDL 1RMFL 2E7HA 4U1JA 4H0HB 3KR3L 4M6MH 4PYGA 3AY4C 1PBYA 5EZOL 3BIBX 5BOZG 1KXTB 4JFEE 3BEVA 4QHKJ 5H2BA 2B7DT 4GAFB 3VFVB 1KG0B 5FO7A 4Z5RB 1FO0L 3P11L 4YAQA 1FNGB 4HV8B 4ZSOA 2E9JA 1BJMA 2B1AH 3PGDB 4PJBF 4DW2H 4CL7A 3VFWB 5JXAH 2GK0B 1CICA 4JFZH 1PG7X 2RJMA 2XQYG 3MFFB 15C8L 5FCSH 5EC2B 5DK2A 5IMOA 5I74B 4LMQE 1F13A 5AYUH 4JDTH 4OZIB 4UDUB 4EQ3A 4NP4H 1AO7B 1RUMH 3SKNA 2ADGA 4H0GA 5DEFB 4NQVA 5BXFB 3MZGB 3OKMA 3VXSA 2VH5L 3KWWB 1EEZB 1VB9A 1BGXH 1QKZL 1ZTXH 4OGAD 4JPVL 4L4TD 4TVSa 3IVKB 3KPRD 4ISVA 1BPVA 3QIBB 3EJJX 4GUPA 4WTXA 4PJEB 2NY0C 4RZCA 3WS3B 1XF4A 1NGWB 5CP3A 1EHXA 4X4ME 4NO3B 1CGVA 3CAFA 5I75B 2NY6B 4Q9QL 3EIFA 4B53A 3BHBA 3QEQA 1E6OH 4G43A 4I3SH 4ODSL 1TIUA 5IROC 3SEPA 5HGAA 5KN5A 1UH4A 4JE4B 2C26A 3CH1B 4G6KL 2EXWD 1KLGA 4L9DA 3NFPA 3CDCA 3JBG7 1JZ2A 2EDOA 2KDGA 3MV7B 4F8TA 1BBDH 4OZFH 1IGFL 2MHAB 3SDDA 5FA3A 2DI7A 4HUNB 5FGSA 3S37L 43CAB 5FB8B 4Y4FC 1J05A 2QQNH 5EDXA 4KKLD 1TVBA 4XRCA 5T3ZH 4Y1AD 1UZ6F 5ERWB 4ETQA 1EGJL 4C56D 1TZHA 2YD1A 3VWJC 4O4YL 1T22A 3ROOB 3QUYA 3T4AA 3GSNA 2JIXA 4ZYKA 1H3PH 2FX8L 1R24B 1I7UB 3FMGH 3C5ZA 4P3DB 5CJXA 5DK0B 2DQHH 5K9KA 2M8XA 2RHEA 1KFAH