2ZOLA

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
273
structure length
258
Chain Sequence
PHSMRYFETAVSRPGEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWMELVETRPAGDGTFQKWASVVVPLQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
total genus 62
structure length 258
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2zolA01
5I74B 5E2UH 3F5WA 3FN9A 1F2QA 4RFEB 1CLYH 1I85A 1FDLH 4KI5F 3BPNB 2EYSA 4JZJC 1HWHB 4AENB 5CS7A 3C6LA 1OHQA 2DQIH 5C92A 5IIEB 3TJHA 4K94L 2CMRL 3D69A 5L88L 2Q8BH 2W0FB 4YNYB 5B39B 1SYSB 2HKFH 1I1YA 1FNLA 1J1PH 3GEWB 4GKSA 1AKJA 4LLDB 4PR5B 1RIHL 2FJFA 1KTLA 2AJZB 3DJ9A 3B3IB 1P7QB 5GJSL 4RQQB 5JDSA 5J6GA 1D5IL 1D9KA 2X1WL 4LSUL 4U6HB 1MWAB 5M95B 3FT3A 4PGDA 5L2KA 2N7AA 3WHXA 1XCQB 1C5BL 2O26U 4QRRE 3NIGE 4Y4KA 5GHWH 3CC5A 4UDTB 1FFRA 5DHVH 4JFED 1ZGLP 4XPAL 5DD1H 4KVNH 4OD1L 5E70A 5CHNA 4PRDB 4K71C 3WBDA 3RPKA 4OZ4A 4DKDC 4FFZH 5E94B 1A3LH 5SWZA 4D94A 1EV2E 2ZUQB 3FQNA 3CNKA 3TM6A 2L0DA 3ZT6A 1FO0L 4DKAA 4S0UC 5DTFA 3BN9C 3S3PA 2YN5A 2AQ2A 1VENA 2V2XB 4OGXH 4TSBH 1IAOA 4KQ4H 3B9KB 3IDGB 5EC2B 3DYPA 1LE9B 2OL3B 4U1SA 2X4NA 5K9QG 4OCRH 3WE6A 1H8SA 2EH7L 1FNSH 3O3EA 3UDWA 2IBZX 4NCDA 3MNZA 3MLUL 4JFDA 3SDYL 2Z92B 3QUZA 2D9QB 1U95B 4ZFZB 1CFQB 1P7KA 2HT4D 3MBXL 3MLZH 4PJHB 2IADA 3WFCL 3FQTA 4CDGC 5BW7A 4NO0D 3LKQB 3KYOB 4R2GD 3FB7A 5F7WC 3HR5A 4NFCA 3KNBB 1EUUA 1DVFD 1C5DB 4G43A 4JRXE 2DIJA 1MCNA 4O9HL 4WNQA 1S7QB 1HQ4A 5D5MB 1U91B 1J87A 3QIWC 5DA4A 4W81A 5GS1C 1Q72H 4U1HA 3TA3B 2B20A 2ED7A 4WU7B 2N1KA 1CF8L 3VDAA 5F89A 1BFVH 1DQDH 2BNRE 4X6FA 2V7NB 1UKQA 3CZFB 4PS4H 4PJBF 3MRPB 3RY6A 5FUOH 2Q6WA 3M1BA 1NSNL 3FQRB 5C0DA 5EIIB 3QRFM 2V5RA 4JZNB 1LMKA 2BY3A 5IVXE 3UYOD 3FHQA 4QXTA 1RJCA 4OCXH 1EO7A 3VGDA 5DSCB 2MFNA 3U9UA 1FYHB 4GG8A 4EUPH 3SKUD 2A74B 1FZMB 1ED3B 3LEYL 1J0HA 4PJHE 3O8XA 4M1CC 3O4OC 2AJYH 4M5ZH 2YD3A 3W11C 2IANA 1NLBL 1VFUA 3HKFA 4M6ML 3MJ8A 4HCRH 3LKOB 5B22A 2FEEI 3RRQA 5HSFA 5FAAA 3T2OA 4OCMC 5D5ME 3JV4A 4OLXH 2J4WH 3O3AB 4K94C 1AXSB 1RUKL 3O6FB 2XRAL 3VFVB 5C0BB 1GIGH 1DLFL 3PQYE 4CW1B 5IESL 4Q6IA 1EFXB 3GSNA 1DBKL 1A7OH 4P46A 4F7TB 4C59B 3OJDB 5F1IA 2CKBA 4EDXA 4QHLA 5IVNA 1I9IL 3NN8A 4WUKL 2AEPL 1YMHB 1H0DA 3CMOH 3FOMB 1UEYA 4WVRA 2HFFB 3I3BA 4PB0H 5CSGA 4EI6A 1NC2A 2YXFA 3FQWA 4Y5YB 3OKEA 5I1IL 1MIML 2FX7H 4PJAF 5FYKL 1K8DA 5FO8A 2FZ3A 3MUGA 3UBXG 1B9ZA 2A77H 4JGUA 1MJ8H 2WSKA 5HDLA 4ZO6A 3X3FH 4XVUC 3WKML 4FP8L 3QIUB 3MOBH 3NABL 5F7DA 3TT1H 1QR4A 3QXUA 5CP7A 3HZMA 3QB7C 1OARL 1CLCA 1UT9A 3JWDL 2J5LC 1A5FH 3RPIA 1BX2B 2R8SH 1OLZA 3K74B 3C09B 4YGAB 4LHUG 3FONB 1RZFH 3HFML 3JWOL 4UAOC 2W0PA 5H94B 1KB5H 4IRSA 2HRPL 1SBSH 3O3BA 1FFPA 1HSAB 1WVZA 3IFPB 15C8L 5E9DB 4BKLA 1I3RA 5D8JH 4DKFH 1VEPA 2QSCH 1BZ9A 2M1KA 4IDJL 4X7TB 4L4TB 1A14L 2J8UF 4JGMA 3BIAX 3EGSB 4DTGL 3B43A 4NKOA 4BQ9A 1SJEB 4S0SD 1MREL 4J7RA 4ZAKA 4GO6B 5J57B 4PJ8D 3T0XA 4UDUA 1A9EA 2A38A 2VXSL 2GW5A 2NR6C 2FX9L 2ZUVA 4LCIL 4DUVA 2LU7A 2FHFA 3TNNB 4I0PC 4UQ3B 2B39A 3AAZB 1AQKL 4L8DB 1NEZB 3VI4E 5FO7A 5F9JB 1WAAF 2IMMA 4RGOL 2ICES 5CJBA 5F71A 2PXYD 4YH6A 4JY6B 4Z0BL 1RIVH 4RDQG 2PNDA 3FRUA 3KPRA 1YNKH 1P84K 1MCSA 4NCC1 4R8WL 4Q9BA 1X7QA 4F9LC 4YXLL 2D7TH 4JHAH 3BKJL 4HFWA 4KKLD 1AC6A 3TF7C 1U8PA 3GM0A 3KGRA 3V5KA 2BY1A 2E27H 4IS6A 4A2LA 4KQ3L 5MENA 4YE4L 4JKKA 4NIKB 2XWTA 3GMOB 2YD8A 4LLAA 4L4TE 1K6QH 1G6RA 2ERJC 3GUTB 3NIFE 4A6YB 3BPOC 1T3FA 4ONFH 4MS8C 2JE8A 4ODHL 4FFVD 4KPHL 2P48B 3UC0H 4YFLF 2XY2A 1ZANH 1AD9B 1SY6H 4HD9A 4MNGA 4YDJA 4MA3A 3AY4C 4OLYL 4DVBA 4QRTB 1H8NA 3EFFB 4KY1L 5FCUH 3QEUA 4IIQA 2VDKL 1OSZB 3T3PF 3D39A 3PGCB 4M6NH 4R7DB 5F9OL 3KPOA 1L7IL 1KCLA 4PJIB 3VFUA 1CLZH 2G75B 5IQ7H 5J11B 3C2AL 4DCQA 1UJ3A 4LGPB 1CGUA 5KBNC 1RURH 2G2RA 1MVUB 2H2SC 4XPHL 4P9MH 2MCPL 1KFAH 1QNZL 3V7MA 5CZXC 4G6KH 5LVEA 1A9BA 5IBLC 3GMLA 4FNLH 3KPMB 3UZQA 3JWDC 3NCJH 1S9XA 4MJ6A 3L3KA 2HH0L 1TZIA 1CZ8L 3K4DA 1BVZA 4G9DB 4ZNCD 3I85A 1DL7L 3DVGA 1IFHL 3VGGA 4PIRF 4E41A 5L6YL 2ATPA 4H88L 3REWA 1JFMA 4XXCA 3RTQA 4ZFGL 1AXTH 1NGZA 4LLVB 5INDB 5I18H 4AM0A 4OGYH 5SV4A 5EBMB 4C83B 1OSPL 4R26H 3ZDZF 3KLSA 3B2VH 1TDQA 1FBIL 3DGGB 3PHOA 4EN3D 4PP2A 4FQXB 5JXED 4O2CA 1R3HB 3CFKA 3LPFA 4M6AA 1LVEA 5EBWB 4X5LA 2P8LB 2BVEA 3EYUH 5C3LD 1IAMA 2CIIB 4EQ2A 2VRAA 4MAYB 3BYTA 2R1WB 1WAAA 1IGJA 4QXUL 2B2XH 2Y5TB 3S35H 1ZOXA 3LB6C 1H15B 3I6KA 3JTTB 2W38A 3OF6D 1A6WL 2CH8A 5CEXB 3HG1B 2YUVA 2ZUWA 4G7VL 5I1CH 5D96C 3LKNA 1BBJB 4X7FC 1G7PB 5JPNA 4XBEH 2DYPB 2EIEA 1EJOH 4ONGH 2F54B 2NXYD 5GRVK 2BOBA 2AVGA 4RDQF 3QSKB 2EZ0D 3C9NA 4KWUA 3QCTH 4P49A 1CDJA 3DYMA 4ZO8A 1C08B 1R3KB 1ZE3C 4U1NB 2I24N 3RVUD 3MLXL 2OZ4A 4JY4B 4LCYA 5BRZA 3TBVA 1CE1L 4I5BB 1F02I 5DJXB 3EYFB 2QHRL 2P5WD 4LL9A 3HI1A 4FOMA 4GAYA 4KFZC 1JUFB 4S1RH 1HINH 4AJ0A 1C5CH 2VDML 5IFJB 3MRQA 1YEIL 1Z9OA 2FSEB 5T1LA 1A3RL 2EIDA 3QHFH 4JO2H 4NRZA 1A7QH 4G8EB 3RL2B 5F72S 2PW1A 1IJ9A 3O4LB 4Y4FA 1T03H 3NAAL 5E6IB 2ID5A 4CVUA 5HHQB 1M05B 1SYVB 2K1MA 4C56D 5ESQB 3UTSD 2WWKO 3BSZH 3MRKA 5K33A 2CUHA 3DROA 3L5JA 3MJGX 1AO7A 4N9GA 4D0DB 4FXKA 1BEYH 4NQEB 1MCCA 1T04A 4WFFE 3EDJA 2JK5B 2RCSL 1DFBH 5FECB 4H26A 1JWUB 3DO7B 4K3JL 4F2MB 5JW4Q 3BVNA 2DQUL 1DBBL 4LMQI 2BY2A 4WFHE 3RWJA 1QSZA 3QQ3B 3FRPA 4XCYB 1O5DT 5FXCH 1EEZB 1G7LB 2VAAA 5I30L 4YDVB 1DDHA 3ELAT 4G9FD 5FOBB 1FGVH 1ZV5A 3HZKA 3L7EA 2B1HL 4OV6F 2AQ1A 5C0JB 3JTSA 4U3HA 1U36A 4FQJL 3VFRA 5D2LF 3MXVL 3OHXA 3MCLH 3KPSB 1YZZA 3AREC 3T4AB 3ARDB 3SE8L 2X44D 5BVPL 5FIEA 1QQDB 5JHDB 2P5ED 4PRPE 3OAZK 5C0AD 4NKIH 5LCVH 5JA9A 5D1XC 3EO0A 3JV6B 3L5HA 3O4LE 2I25N 3NFSH 5I0DA 3PJSA 1RUPH 3X12A 4EKXA 2W65A 3LQAL 1T7WA 5F7MC 5C0CA 4HC1L 4X6CB 4M93C 3T2NH 2HLAA 1KT2B 3FCTA 3KXFB 1UQSB 3TPUA 5KG9A 4U1KA 3DUUA 4NQEE 1OM3L 1EFQA 3C6LD 3H2WA 4ALAL 3TJHD 1YQVL 1NMCC 4P23B 3VH8G 1PSKH 1AKJD 2KDGA 3PV7A 4HHAB 3V0AC 3MROA 3G5XA 1D9KD 5H8DA 3QUMH 1GGTA 3RWFB 4Z5RB 3O3DA 4S10A 5I1GL 1P1ZA 4Y4KD 1BBDH 1E6JH 3AU1A 3MFFB 1Y6NR 3IRPX 1MCLA 1MFCL 5EU6B 5IW6B 1AHWC 3VJ6A 1YEGH 3W39B 3FB8A 4FQLL 2Z8RA 4OQTA 4O00A 5GGQH 2ZUTA 3ZYOA 3KPSE 2Q86A 2ADFL 1GAFH 1ES0B 5GS0L 1IEAB 3QO0B 2AV7B 5SWZD 3LKPA 5JHDE 1RUQL 2I60H 3CCHB 4U6XA 4Y4HC 1IT9H 3P4MB 1G7JA 5LBSH 2W91A 1D5XA 4JPVH 5SWQB 4KTDH 5GJTL 1U8KB 3AM8A 5EU4B 5SWSA 4YDKH 3DURB 1GZQA 3KXFE 4D2NA 4L8SB 3MV9A 4FQHA 3QUZD 1KIPA 1CXEA 1F4XH 4BSVB 4NDMA 3ULUD 1K8IB 1WBYB 4P5TA 4HK0A 5GGRB 3BIKB 4HBCL 3HC3L 4P2QE 3CLFL 4ORGA 1WTGT 3AUVA 1KULA 3FAWA 4ZFFB 1W72L 4OF0A 5MP6H 3QT2A 3BO8B 4HUVB 1Q0YH 3GIVA 3VDCA 3A0OA 4QT5A 5HGBB 2GJZA 1CK0H 3F7YA 2VXTL 4XGZB 5GGVH 3VFNB 4NC0B 5JR1L 3W0WA 3E2HC 4RGNC 4YPGB 2QJDA 5A16A 2YZ8A 1I9RH 2Z31C 3GMPB 4ZNEE 4UMGA 1CBVH 3E8UH 4XVJL 1I4FA 3AB0B 2VABB 5FKAB 4PV9A 4YHOL 2E7MA 5JXAH 2NX5E 1HHIB 4Z7WE 5GGRY 2X7LA 3GMRB 3WFBL 5GXBB 2ADJB 1PYWB 5DXWA 3WS6C 4XAKE 4WY7L 12E8L 3L5XL 1A6UL 3INUH 1U8JA 2FWOA 3L3HB 3L1OH 1UH2A 3BH9B 1X5XA 3MRNB 5DUBA 5F7KC 1R3JA 4M3JA 4OF7A 3KWWB 5KSBF 1KIQB 5DC4B 2BNQD 4LVOC 4JFQA 4IHOA 4N8CH 4K3EH 4GW5A 4JFHD 3WFEH 3ARZA 1M71A 2E7BA 4O2EA 5IB1B 1CICA 4PRAB 4PJ9C 2IFFL 5IK3A 3LQAC 1I7UB 3BI9X 1LO5A 3DI2B 3GMMB 3KDMB 2IALB 2A6JB 1GH7A 4FHBD 4OFIA 1OP3K 4V1DA 3TBTA 1WEJL 4YIQB 5AYUL 1ZK9A 3HB3C 4JHWH 4PLKC 1NCBL 5DRXB 4WUUB 4E42B 3LEXB 1CVSC 3WLBA 3ZKND 4NRYB 3BZEB 1HHHA 4JRYA 4APQA 4M7LH 4GW4B 1QRNB 4P46D 4PRIA 3U0TB 4QRPD 2DN7A 1U3HB 4XX1G 5E99H 3S5LG 3KYKL 1AD0A 1MY7A 5E08H 4K7FA 1KTDB 5IKCB 3VWJC 1S9WA 4M00A 1NC2D 3PHQA 4XVSL 3VD3A 4MWFB 2DQHH 2FGWL 5HHNA 4ZS6C 1EBPA 1M6OB 2IJ0C 4XP9H 3EHBC 3CFCL 4X6DB 5GS0C 4L8SC 4IM8A 3PGFH 1IZJA 4EDWH 1CFBA 3DV6B 2OLDA 4LEXH 1YUHB 1U41A 3DXAD 4OBSA 5JIIA 3O2VL 1EO8L 2IQAB 3MRFB 5E8EA 1G1CA 2P8PB 1MHEB 2YWYA 1NGXA 1UZ6E 2DIAA 3K1KC 1CXLA 2J6EH 2EH8L 3QIBC 1PKOA 3GHEH 2X70B 4JB9L 2NY1B 1JWMA 3T0AA 1H3WM 4JN1L 1I7TA 1P84J 5H37G 4GRLB 3MRBB 1IC5H 2QQLL 3F8UB 4P59L 4UOJA 3G04B 4U6VH 1URLA 5HTSA 2ICWI 2LAAA 2ENSA 4AK1A 4B7IA 5DJ8B 1QFWM 5DQ9A 1YYLH 4L3CB 5L2JA 5HYEA 3EYVA 4HK3J 5JUEL 4NOBA 3WMSA 5I16B 4NQCE 5DQJA 4M9PA 3DVIA 4M1GL 4BSWB 3ROLB 4YHZL 4PRBB 1LGVA 3MOAL 4WWKA 1SEBB 4ODVH 3MRDA 4R7NA 4YLQT 5C0EB 2OXHA 5FM5M 4JVPA 3GMQA 1FORH 4MNQA 4X6DE 4ZTPH 3S4SB 4J12A 1NUGA 5JOFA 4XPTL 5TE6L 5C7XH 1CDIA 2EE9A 4IJ3B 5B8CA 1F3DH 4Y19D 4HWBA 1PJ9A 1YNLH 3QUYA 4OLWL 5KVDL 3TLRA 5KSBA 3IXAA 5ADOH 1MHCB 4X98A 3MRRB 4UIKH 4RRPA 5JIKA 3EO1A 3MXWL 3U7AA 4QHUA 2M26A 2VL4A 2H3NA 4FQCH 3K2UH 3O2WL 3KVQA 3UTTA 4PREA 1NQBA 1PZ5B 1R5VB 3KPRD 1QBML 3CVHA 3X13A 2CDGA 4PJFA 1JGVL 4ZUWB 1R3LA 4WV1A 3EYOB 1XH3A 3PWJA 4ODTH 3FQUB 4YUEH 3SE3C 3K4AA 3QEQB 1CXIA 4FMFA 1CL7H 2CIKA 2IF7A 4WFGD 1A4KB 1U92A 2KUTA 3P2TA 2FATL 3QDME 4N90D 3K46A 2HVJA 3HUJA 4PBVC 3N06B 1QBLH 3THML 1A1MB 4HKJA 1FE8L 2EEBA 1YPZF 2FJHB 5H35B 8FABA 5L9DH 3ILQD 4XVTL 3B6SB 3GJEB 4M7JH 2RGSA 4ONHB 1MRCL 1ZWIB 4DEPC 4X4ME 5KSUB 3SCMA 5IG7A 1K4CA 4DK6A 2NY5H 4JG1L 5EOCH 3JUZA 2GTWB 5DEGB 5TF1H 5I73C 3DMMB 4ENEC 2W9EH 3GO1H 4P4KC 3QUKB 3VI3E 5D6CB 1T5XA 1X5FA 3MLVH 4XRCA 4FZEH 1I7ZB 2XWJB 2VLKD 1OT1A 3D39D 1J8HD 1JYVA 4UNTA 1JZ8A 3T65A 5IROA 1G9NH 3WXWL 2MQCA 5FFLA 3LKRA 4LLYB 1DLHA 4PJ5B 2DLIA 3G08A 4Z7VB 3NA9H 1JNLH 3QEQE 4I4WB 4D9LL 1RHHB 4HXAL 3BQUA 1J1OL 2XPGB 1XF4B 4MXWL 35C8H 3QRGH 1PG7L 2GYSA 3QUMB 3RIAK 4N0FA 3U30C 3LD8C 4NN5B 4L3EA 1TNMA 3HC0A 2BCKB 3H7BB 4K3DH 5IB4A 1NUNB 2CSPA 3QPXL 3ZE1E 3ARGC 1IKFL 3PIQA 2OJZL 3FO0H 1RUMH 4K7PL 4CL7A 4I0CC 2NNAA 1UKTA 2VXUL 3F7VB 3NFPA 3V5HA 2WQRA 3RIFK 3I9GH 1NUFA 2DL9A 3P4OA 3LN9A 4E41D 1S8DA 3RTQD 3MRJB 1VFBA 2MTPA 4AIZB 1F42A 1TCRA 2BSRB 3S36H 3MA7B 3MCKB 5EO9A 1MRFH 4ODWA 4PRHB 1CDGA 1BVKB 1TTUA 4CU6A 2VLMD 3HMXA 4KRPC 3MMEB 5IVZB 2FIKA 2ZSVA 2XZQH 2JELH 3ZE0E 4YR6B 1EERB 3LS4L 4N0UE 1M7XA 4JG0L 3RUGB 4KUCF 2QQNH 1DUYB 1I1AD 2RFXB 3DTXA 1T22A 1SBBA 1JTTA 4J3TA 1DR9A 4ZUSA 1OTUD 4LBEB 3UTZA 1DN2A 4DN3L 4OTXH 3GHBL 1TNNA 1KN2H 1M7DB 5T3ZL 4YWGH 5EULV 4X80H 3TVMC 4RIRB 1DBMH 4NZUH 3VFOA 2XN9A 4FABH 1QTYT 4Z77B 3BYYA 5I76A 4NBZB 4GSDL 3MV7A 4ZS7L 4LRIC 5BV7H 5TFSL 5CILL 4PLNC 5BRZD 2W0KA 5I66B 1S5HA 3N1GC 3PUCA 1WFOA 1FN4A 5EZOL 3SDDC 3LRHA 1JPTH 1UCBL 3PL6D 3WIFB 3RX7A 2QHLA 4PRHE 3A6BH 1IQWL 4G3YH 3QCVL 3NPSB 2VE6A 4XMLH 4BZ1L 3ECBB 3TN0C 3ULVL 2I9TA 4HXBL 2O5YL 3IDIB 5J06A 3H42L 3D3VA 2XYCA 4Y4FD 3CUPB 4QTHA 4NM8L 3SDXE 3RVVC 4F7PB 4CVXA 1EAPA 2H41A 3HMWH 1RI8A 2P8MA 2YA2A 3A6CH 1ERNA 1XZ0A 1AO7D 3BXNB 4LPWA 4ZFOA 3U46A 5D1ZB 4HIHB 4RMSA 4HIEA 3VG0L 5BS0E 2B4CH 2V2TA 4QHNB 5EO1A 2VUOA 4Y2DA 4UI2A 5D72H 1H3PL 3V5DB 1AI1L 4QRUB 4Y5XA 1HCFX 1NBZA 5I1EH 4LF3A 1YY9C 4RMRA 2HYMA 2BSED 1NC4A 1DEEA 3M8OH 2NZ9C 4XPBH 5IFHL 2D0HA 4PTUA 3HZYB 4U2YA 3CSPA 4O02L 1BGXH 4XMKL 4PGEB 4EI5C 1IGYB 3H6JA 3I6LD 2L4OA 3WUZA 3TO4B 1P6FA 2BMKB 3FO1B 3S3SA 5CGTA 4LCWE 3STLA 4BYHA 4TSAL 3OKDA 4NM4H 2RR3A 1N3NB 1O7VA 3SDCB 5IF0B 4NFDA 1QFUL 4MZ2A 3SGEH 4M7ZC 1YJDL 1CU4H 3D18A 4JZJA 1K3IA 4LCCC 5C0CD 1KPUA 4KJYA 4TTDC 2Y36H 3GSQA 4UV7L 2EDLA 1EO5A 2FRGP 3QQ4B 1D6VL 3LIZL 1HYSC 3H9HB 1GSMA 4RISL 1FIGH 2E5EA 3IKCB 4YBLB 3BX7C 3HPLB 2FR4B 3BPLB 4KROB 1OW0C 4HEME 5I1HH 3QXTA 4NSKA 4OLUL 3MJ7A 3T0DA 2YD7A 5J1AB 1KCUH 1JNNL 5EIVA 5EUOF 5DJDB 4FQ1H 1LD9B 4JDZB 4KKAD 4LSVL 1YNTA 1NCAH 3MRCB 1HHKA 3E6HA 2GCYA 4YC2C 2G60L 4PG2C 3TBSA 5C8JA 1EEQA 1HXYB 1LK3H 4XI5C 2ZSWA 4XCEA 5IVXF 1BQHG 1ND0B 4LMQE 4B41A 5EWIH 1BLNA 5F7LB 1RVFL 4XZUB 2RQ8A 5D2NB 1QSFE 4KJWD 3QZWG 4UU9A 4FS0A 3SJVA 4GG6B 1Y0LB 4K8RD 4XTRC 3SKOB 3OKLA 4X0KB 4IMKC 1E27A 3BKCL 1OTTC 4KZEL 1KEMH 4JQIH 3CJJA 5SWSD 1X5ZA 1JVKA 3WNKA 1D5BB 5K9QI 2XV6B 2R4RL 2VR9A 6FABH 1OAXH 4R4NC 4ODSH 3U0PB 1N0LA 3MV9D 4KK8D 2COQA 3GRWL 4P5TD 3PG2A 1G7MB 1RUAL 2EDJA 4CMMB 3ULVC 4S1SL 3MREA 4XP6L 4PBWD 1GC1H 2A9NH 1IEHA 4KJQD 4LSQH 4XCFH 4M62H 3QIWA 4QRRA 1NAMB 3VD9A 1CGWA 1ZKAA 5T5FL 2DLEA 4FXLA 1WC7A 3G5ZA 4MMZC 2YZ1A 3QNZB 3DWTA 3WV0A 2VR5A 4I2XB 5C0IA 3S97C 3WFDL 4OUUA 4M8QB 4UT6H 3VFGH 1KJ2L 2CLRB 1OP5H 3QUXC 4JZOA 4E0RB 2VLJB 1QO3A 1QHPA 4HWEH 4X7SH 3I02B 3GSNH 2ZG3A 4R0LB 2DQDH 2JJWA 4PGZA 5AZEL 4NT6B 2AGJL 3TV3L 2JB6A 4Z7UE 1RFDL 2OBGA 2VDQH 4AENA 4NOFA 3O6ML 5IIEA 3W9DA 1ZLUH 2I27N 1WWCA 4JPWL 5E7FA 1PY9A 2W0FA 4YNYA 5B39A 1B0RA 4XPGL 5DRNA 4QXWA 3GBMH 2CUMA 4PR5A 4N8VG 2BSSB 2AJZA 3B3IA 1MRDH 1P7QA 1YJDC 2YPLB 3ESVF 3LEVL 1CICD 3P30H 1MWAA 3G9AB 4Y8AA 3BPLC 1J1XL 3HNVL 3KPPB 2C4FU 3CLEL 4Z7OE 2ZCKL 1T0NA 3V6FB 3BE1H 4TUOB 3ISWA 1R5IB 4V1DD 1DUZB 4UDTA 3MLSH 3MLPA 2DKSA 3BEVA 1IM3B 3ZYIA 1A0QH 1G7QB 2BNRA 4LAQL 5E94A 1CQKA 1F58L 3SDAC 4I2XE 2NY2B 1OCWH 5F1NB 2NY0B 5SX5H 1XGUA 3ZHLA 4JHBA 4JRYD 1A7RL 2Q1EA 2V2XA 3V6BR 4KZDH 4OLEA 2NXZD 3L3IB 1ZHNA 3B9KA 3IDGA 1S7SA 2VLJE 2YSSB 5EC2A 2LE9A 1R0AL 1MF2L 1LE9A 2OL3A 1PBYA 4YFLI 4HGWB 2AK4B 5FGCB 4M48L 4YHLL 1JPGB 3ROOA 2XQYG 3NOIA 4NQDB 2Z92A 1FO0A 4ZFZA 1CFQA 3JSSA 1N8ZB 4PJHA 1FNEA 3VI4F 5D7LE 2JB5H 4C54A 4X99A 3P9LB 1QA9B 5DJAB 1CCZA 2V17H 1FNFA 4OF3A 3BGMA 1S9VB 3KYOA 1CFNA 4RMTA 2Y7QB 2R39A 5IJVB 5KN5A 3T2PA 1NCWH 4R4FH 4TNWK 3UBXI 3W5NA 1D5ZB 2YPLE 2VDLL 1DQML 4PGCA 3C8KB 4GBXD 5JQ6H 1S7QA 5D5MA 1U91A 4C56B 1NANH 2X4OB 3P0YH 5I1LB 1CLOL 4JANA 4G8IB 4J3VA 4GW1B 4WU7A 2MCG1 2FNBA 1MFEL 3CPLB 1F6AB 2G5BB 2W60A 4LIQH 3VXRD 2A9MH 2VXQH 3PQYA 2CDEB 1HHGB 2V7NA 3CZFA 3MLUH 5KS9B 3P77B 4O4YH 1IGFL 4M1DH 1FSKC 4YXHH 3SKNB 2HVKA 4WI9A 2LTQC 4NNXA 3N1PC 3NIFF 2ZPKH 3ZTJG 5EIIA 1RHFA 4JZNA 1IQDA 5E2UL 3OZ9H 3RVTC 1S7RB 3PWVA 1J18A 4HS3B 2AK4E 1FDLL 5I19H 4UOW0 1CT8B 3TH2T 2MOVA 3VG9C 4PJ7E 4MDJA 3ES6B 4X9FA 2Z35B 4G9FB 3D2UA 5HPMA 4CMHB 2A74A 4WWKD 4NRXB 5IQ9B 2DQIL 4U1LA 4NQDE 2GY5A 1FZMA 1KLUB 1ED3A 2V5YA 4DZ8B 2Q8BL 3UPAA 2SEBA 4MNQD 2HKFL 1G6RH 1J1PL 4POZD 4LNRB 4JKPH 5I71B 1YDPB 5LQBH 2HT3D 2VR4A 1DP0A 3A67L 3ARFB 3EIFA 5C0AB 3QUYD 5JZ7D 1CDCA 3LKOA 4JM4H 1KELH 4GXVH 5EZLA 4HT1H 1A4JA 5GHWL 3IXTB 3RZCD 3VCLB 1L0XA 3IJHB 5DD1L 4KVNL 3X17A 4WTXA 1QFOA 1AXSA 3O6FA 4M4RA 3UZEA 3VXOA 3NCBB 3VFVA 3MV8E 4FFZL 1A3LL 2QADC 3EUUA 4JQXC 4KKCD 2WUBH 5KS9E 4YHKH 2EXWD 1BJ8A 1EFXA 2JJSA 3NIDE 2FLBT 2VDOH 4OGXL 4TSBL 4F7TA 3OJDA 5I15H 4KQ4L 4U1GC 1MEXH 4GKSB 3FOMA 4I9WD 4OCRL 1KLFA 1KTLB 2HFFA 2VERN 2X4UB 3RKPA 4LDEB 5HGHA 1FNSL 1KGCE 5FYLD 4Y5YA 4LFHG 5JLZA 1N5YH 3FT3B 5L2KB 1MLBA 1T83C 1WZMA 1H5BC 2X10A 3MLZL 4ELMB 4N0CD 4Z8FH 2EECA 1KCKA 5CHNB 3SCMD 1XGQB 2IPKB 3AY4A 4P5MB 4OZ4B 1QD0A 3HE7D 1ZTXH 3MJ9A 5DTFB 3TPKA 4QOKB 1HNFA 2DBLH 1LP9F 3DX6A 4EOWH 3QNYB 4U1SB 3WCYA 2FL5B 4MD4A 5HDBE 1BD2B 2QLVB 1BX2A 5A2LH 1BFVL 1DQDL 3MNZB 4JFDB 4PS4L 3T77A 2YMXH 4G8GB 5FUOL 2APTA 5H94A 2IADB 2Y06H 1HSAA 3BQUD 1JCKA 4UT9H 4MD5B 3GSVA 3FB7B 3OX8B 3HR5B 3P3YA 4L3ED 4OCXL 1VADA 2GT9B 4L4TA 4Z95H 5GGUA 2IBBA 4XB7A 3EGSA 4J6RL 4KKBD 1SJEA 5E5UB 1QBAA 4ELME 4FFYH 2AJYL 4M5ZL 3M07A 1RJZB 3TNNA 5F89B 2NY6D 4X6FB 4UQ3A 4GJTB 3AAZA 2OZ4H 5J3HD 4G6JH 4HCRL 1MI5E 4L8DA 1NEZA 3V9FA 2Q6WB 5F9JA 2IPUG 1B6UA 3M1BB 1N0XH 3HI6H 1A1NB 3OR7B 4HQQH 2FIRT 5ICZA 4OLXL 3C08L 4JY6A 2J4WL 3WDJA 4QXTB 1BD2E 3MV11 4IDJH 3EYSH 5E4EC 3IS0X 1TQBB 4ZUVB 3U9UB 5HDQL 4HS6B 1T1YB 1A7OL 1G0YR 4G8GE 4MLIA 3O8XB 1CI5A 3MLTB 2R2BA 2LAGB 5FHAH 3TZVB 2H2PC 3CMOL 4OCLC 3AS1A 4U05A 4PB0L 4OZFG 2HLFC 2IANB 1QZ1A 1RIUH 3RNQB 3MJ8B 3EJZD 2FX7L 1T89C 1X5IA 2XN9D 3WJLA 4MJ5A 1BFTA 2OR9H 3S9DB 4RBPK 3GSWB 2A77L 2FECL 3MV7D 2M2DA 3KR3H 1MJ8L 5FYKU 3E3QE 2JF1A 5D7JC 2FH6A 3X3FL 3PP3H 5KSAC 1JP5A 2B5IC 4AMKH 2WWMC 1VFAA 1RZGB 5CWSB 3X14A 2IH1B 3MOBL 1LILA 4LAJH 1TETH 3QI9B 3TT1L 5LXGH 4HUNB 4B53A 3ARRA 5F1IB 2CKBB 1OSZA 4X6BA 2DQTH 1H0DB 4P99A 2GITA 5BZWB 4R7DA 3SE9H 4EI6B 1A5FL 3N1QC 2G75A 3VD7A 3I3EA 3VMNA 3FQWB 2R8SL 4KXZH 1KPVA 4R9HA 4LVNB 1L7TH 2MJWA 2PR4H 1U3YA 1UG9A 1RZFL 1KB5L 1HSBB 2AEIT 1SBSL 2W0LA 1YEHH 5D8JL 2F53D 4KI5E 4AT6B 4DKFL 2VTFA 2QSCL 4AY0A 3TNMA 3KPMA 4PJDE 4IOIB 5CEZD 2GY7B 4PY8I 4D0CB 2X1XR 4I8DA 4G9DA 1LO0H 3TCLB 4OB5H 1T2JA 3HZMB 1UGNA 1NC4D 1O0VA 1FVEB 2H32A 1QKZH 4X8XA 5IGXH 1LEKA 4ZO7A 4LLVA 5INDA 3DGGA 5E2TH 4IRSB 4HJ0D 4FQXA 5D7KE 5F3HA 4U3XA 1R3HA 5D1XA 2A6IB 1RIVL 3GI9H 1MCOH 4PJBB 1YNKL 2P8LA 2CIIA 4MAYA 3NVQA 3S6CA 1BZ7B 4NC1E 1HN1A 5TDPB 1CL7I 2HH0H 2Y5TA 1T1ZB 4JJHA 2LU4A 3U4BH 2D7TL 5GS2D 4JHAL 5L8LB 1T0PB 4ZAKB 4K8RH 1JI2A 5CEXA 3HG1A 1W8OA 2E27L 1WZLA 4ZTOH 3UEZA 2HT2C 1BBJA 1MCIA 4CKVX 3NZ8B 2Z91A 4KTEH 5C0RH 1SVCP 1K6QL 3UTQB 1C08A 2EIBA 2EXYD 3IDYB 3CK0H 4ONFL 5DD5H 4XNQB 2BOCB 4X9BA 3O0RH 2HWZL 1WZKA 5DJXA 3V0VB 3UC0L 3EYFA 1ZANL 1TQCC 2GQHA 2GTZB 4LLMB 1ONQA 3T0EC 1SY6L 3MRMB 4Y1AB 4UUJB 5EBLB 2BK8A 1I3VA 4JM2C 4NQUA 5J9PA 4HFWB 3FO2B 5FCUL 3NCFB 2EICA 5ISZD 4Z7WF 4GRWH 3UMTA 3MR9B 4G8EA 4M6NL 3RL2A 1TZGH 4IBLT 5MENB 3O4LA 1D7FA 5IQ7L 3VWKB 2XWTB 5E6IA 4Z0XB 5HHQA 1SYVA 4KAQH 5ESQA 4GS7B 2NY3D 1JF5A 3GB7A 4LVNC 1I75A 3DX9A 4HKZB 4WI8A 4P9ML 1KFAL 4NQEA 4G6KL 3ARXA 1JNHB 2JK5A 5KAQF 5FECA 1ZVHA 3DV4B 1A64A 3UZVB 5ETUB 1JWUA 1JZ3A 3EZJB 4FNLL 2ZKHH 4F2MA 2R29H 2WLYA 4PJAB 3NCJL 2P43B 3CXDH 4FQQA 1F6FB 2WV3A 4NKDB 3QQ3A 5I9QB 1EEZA 5JOPD 2I07A 4YFDB 4YDVA 2R9HC 4H1LG 1EGJH 4X8JB 4DCQB 5I18L 4OGYL 4Y1AE 4R26L 1INQB 3TFKA 3B2VL 3BT2H 5DK2A 5J89A 2G2RB 1I8LA 3KPSA 2YK1H 3T4AA 4FQIH 1LEIB 3ARDA 5GGTH 5I6XC 1DQJA 4M8VA 4EJ1C 1QG3A 1YY8B 5JHDA 2Y25A 5CAYB 2OP4H 2CUIA 3BP4A 3EYUL 1ZT1A 1JF1A 1WITA 3TP4A 1EA9C 1NGPH 2VZ1A 2DQUH 1DBBH 4MJ6B 2B2XL 3RX8A 1TZIB 2B0SH 3S35L 4WI5A 3KXFA 5B21A 1UQSA 1MCKA 1TTFA 5I8OH 2GSIA 5I1CL 5F7HA 2J8UB 1UZ6F 1OWWA 5SX4H 1QSEB 4M1CD 1NGZB 4IOFC 4HPYH 4XBEL 1EJOL 5D93C 4ONGL 4P2QA 5BOPA 1KTRL 4P23A 4PJ9A 3W11D 1N7MH 1R5WB 4U7SA 2D4DA 1K9TA 3QCTL 5F9AC 4HHAA 4O2CB 2HAZA 1P7QD 4GKNB 1NCUA 3RWFA 3IKKA 4Z5RA 4OLVH 1JL8A 3BP6A 4BELD 2YRPA 3MFFA 1OGAE 3RGHA 5IW6A 2DD8H 1IGJB 4S1RL 3W39A 1HINL 1C5CL 4XHJC 3S34H 3KJ6H 3HI5H 1P4IH 1DE4A 2CGRH 2BNRD 1ES0A 5A1AA 3T3MF 3QBTB 1IEAA 5F96H 2AV7A 4ZNEA 3QHFL 4JO2L 1A7QL 3DI3B 5EN2B 4GAJH 1OM3H 3H9SB 3CCHA 4TPRH 3P4MA 1T03L 4OZFA 5E0QA 2Q3AA 3B9KD 1U8NB 4NUJA 2BOBB 2HMID 5SWQA 2NX5A 3BSZL 3C9NB 1RJLA 3FT4B 4YHPB 4XNMA 1U8KA 5EU4A 1FQ9C 4JREC 2ZNWA 4MLSA 4P2OC 2DJSA 2VOTA 1BEYL 2ARJQ 1HQRB 2VZVA 4L8SA 3VXUB 4GLRH 3TBVB 1A6ZB 5JTWA 1XGPB 1NDMB 1DFBL 1HH6B 2J8UE 3HI1B 1QSEE 4OIBA 1K8IA 3EJYD 4GAYB 1WBYA 4WO4B 5GGRA 3BIKA 5IB5B 2OCFD 1CDHA 43C9B 5IOPA 4XVUD 3MRQB 4UV4H 5T1LB 1MCPH 4Y16B 4ZFFA 2A2QT 4OBRA 1E4XI 1RZ8A 3BO8A 5JA8B 2PW1B 4HUVA 4L9DA 3TGXA 1REIA 1FGVL 1JBJA 4Y4FB 4HWBH 2BHZA 1HCVA 2P1YA 3MBEC 4IMLB 3MRKB 3TA3D 3MCLL 3V6ZB 2ZZUT 2C5DC 7FABH 4N9GB 3SPVA 3RNKB 5C0NC 3V4UH 1SMAA 3PQYD 3GMPA 5GSRB 2F8VA 1W72A 4HLZH 3UBXB 3CVHH 4NKIL 3H9SE 4H26B 5LCVL 2VABA 5I1KH 1QOKA 3NFSL 4U49A 3LH2H 5FKAA 1RUPL 1MJUH 3BVNB 3F6LA 3RVWD 5A43C 2KPNA 3RWJB 1HHIA 3GMRA 4NBYB 2R69H 4RA0C 2ADJA 3T2NL 2YD4A 4XT1C 2VAAB 2RIKA 2VLLB 2IAMC 4KMQA 3L3HA 3OTTA 1DDHB 4H20H 5TF0A 4HS8H 3VXUE 1F8TH 3ARBC 3D2UD 4K3HA 4G6FB 5FYLH 5IW1B 3RAJH 2L7JA 1KIQA 3HZKB 3VI3F 3L7EB 5EUKB 9CGTA 1PSKL 5F9DC 1RK0B 5IB1A 4PRAA 1Q94B 4LSPH 3H9ZA 1I7UA 2DQEH 3QUML 1FFQA 5F7YC 2UZYB 2X09A 2AV1B 1PDKA 2IALA 3RA7H 1B3JA 4K55A 4YIQA 3EO0B 3WYRA 3HE6B 1BBDL 1E6JL 5K93A 3PJSB 4LPTA 3X12B 4OAWA 1LDPH 1SVZA 2HJLB 3MLYH 1YEGL 3FKUS 1XIWC 5HY9A 5C0CB 5DRXA 3O6FD 4XWOC 4E42A 3LEXA 1VKXB 4KGLA 3SE3A 1GAFL 4YHMH 5KG9B 4FXGB 4U1KB 3BZEA 2EDDA 3DUUB 2I60L 4LOUD 1EFXD 4GW4A 2DLTA 2RHEA 3U0TA 3ZE1F 1IT9L 2MNUA 3EO9H 3W2DH 1U3HA 5LBSL 4JPVL 2R2HB 2ZCHH 4NQCA 4LEOB 4KTDL 3WN5C 5IKCA 5C2BH 5IHLB 4XNZB 2ESVB 4MWFA 4LPUA 1YQ2A 4JFEE 4YDKL 5DMKB 3O3DB 1X5JA 1M6OA 5J12C 1F4XL 4X6DA 2V6HA 4JKWA 1W2KT 1IM9B 5HHPB 3VJ6B 3FB8B 3DV6A 4ZODA 3WLWC 1YUHA 2FJGB 2E3VA 1INEH 3I75A 3MRFA 3QR2A 4NN6B 2E7HA 1MHEA 5C6WH 4RAUB 2X4TB 5MP6L 3M17B 3LKPB 3ZE0F 5DFVD 3ZKSD 5F7FA 4BH7B 3QIUD 1Q0YL 4OGAC 2X70A 4W4OC 1JHLH 4OFYD 4L1DA 1G7JB 1BM3H 1K3ZA 1D5XB 1CK0L 5GGVL 5GSVA 2F58H 4GRLA 3MRBA 3IT8D 1I9RL 3G04A 3WHE0 4X6EB 1CBVL 1K4DA 3BGFC 3E8UL 3QDMA 1MCRA 2R0LH 4NDMB 1EMTH 4UQ2A 5E8OB 5JW3H 1LHZA 4L3CA 4HK0B 1MOEA 1F90H 2B7DT 5JXAL 1NBVH 4NZRH 5HHXH 1JZ6A 4JFXA 3U6RA 1J0IA 4BSWA 1Y6MR 3STBA 4L4TD 3INUL 2ESVE 1ZS8A 1SEBA 2EH8H 3L1OL 3LAFA 4WI7A 2F74B 4X4MA 4JB9H 4PV8B 3V52H 4QT5B 2GJZB 1JE6A 4N8CL 4K3EL 1ZT7B 3WFEL 1EBAA 2CPCA 3W0WB 1KC5H 4O51A 5JNYB 5KZCB 5F1KC 4F8QA 2XQBH 1MHCA 1X4XA 3MRRA 3SDXF 1I4FB 1C8PA 5D2LB 5J13C 5HVFB 4PV9B 1U2HA 2OSLA 1T5WA 43CAB 3RDTB 3VRJB 2X7LB 1PZ5A 4YBHA 1DQTA 5HYSG 4ZUWA 2NQCA 3EYOA 1WT5A 2E8ZA 2HT4C 5IJKC 3MOAH 5DUBB 4WGVB 3QEQA 1BWWA 4M7LL 1A4KA 3ZE2E 1TXKA 3CDFA 4YHYB 4R2GC 3STZA 4JFQB 2IBZY 5E99L 4GW5B 5I1DA 5E08L 1DVFC 3TVMA 1BQLL 4PD4K 3TJEH 5H35A 2FJHA 1LO5B 2DQHL 4Y7MA 3B6SA 2XTJB 1QP1A 2VDNH 4XP9L 1DN0B 4OD2B 4C55A 4KKNA 2IPTH 5CEZH 5KSUA 3PGFL 5BJTA 4EDWL 2XXCB 4LEXL 3P73B 5L0QC 5HGDA 1JGVH 1BF8A 1A7PH 2GTWA 2EDWA 5DEGA 3B2UD 1NGQH 3DMMA 1GGIH 3BGAA 4APQB 2W1NA 4QTIH 2J6EL 4MCZB 1T66D 3QUKA 3GSXA 3GHEL 1PEWA 4PRIB 2MQ3A 3TIDB 1GL4B 1NANI 2FD6H 3TN0A 4R97C 5D2LE 1I7ZA 2XWJA 4NNYA 4HWNA 2EDFA 1OPGH 5CD5D 3CFEB 1IC5L 4Z6AT 4N0UA 4LU5H 5J8OA 4U6VL 5HHNB 5IHUH 2GJ6B 2XIDA 4PJ5A 2C3VA 2UY6A 4M7LT 4BQ8A 3BOVA 3ULVF 4I4WA 4F57H 1RHHA 1YYLL 1MFNA 2XPGA 1XF4A 1IVLA 5GS2H 5KOMC 4TUKH 3C2SA 4MJIB 3KYNA 1E4KC 4U0RB 4UINH 4TTGA 3OQ3B 5E8EB 2BCKA 3H7BA 1WF5A 3RL1B 1NGXB 3HAEH 2C7UB 2DICA 2XG4A 4ODVL 1OLLA 4MJ4A 2XTJE 1UH3A 2ZUYA 1FORL 4ZTPL 1TPXC 3QP3A 1MCJA 4OM0H 5C7XL 1IGCH 1SJXA 3X3GH 4KI1A 4AIZA 1YNLL 2HJFA 2BSRA 1P9MC 5ADOL 3MCKA 2AXGB 4PRHA 4UIKL 1BVKA 3VMOA 5DUPH 4FQXD 3P11H 1T0MA 4FQCL 3K2UL 5D1XD 3MC0A 3MMEA 1J0JA 4F7MA 2HKHH 5L8KB 3G6AA 4OKVB 1TIUA 1T1XA 2XICA 3RDTC 3SKJH 4HJGB 4RGMB 3SDXA 3DSFH 4LCCA 3UX9B 4MAYD 4ODTL 3RUGA 3MRDB 4YUEL 4R7NB 2GJ6E 1KACB 1CL7L 4F15C 1DUYA 3GMQB 3NPZB 3MLRH 5JOFB 5DVOA 1WCQA 4QXGH 5KVFH 1QBLL 3HG1D 3VFPB 4WFFD 5KJRH 4MJIE 3LDBC 3WUWG 3MNWB 1M7DA 4JEGB 2DYPD 2Q8AH 3SQOH 4H5SB 5L9DL 3QUYB 5KSBB 3PV6B 3UYPA 3IXAB 4OV5A 1JTOA 4M7JL 3WNOA 2D7QA 1AJ7H 3FFDB 1FL6A 1JFQH 4LSTH 2AK1H 3GSRA 2H3NB 3UTTB 3GNMH 3IB4A 3CVHB 3X13B 2NTSP 2NY5L 5EOCL 3OAYK 1R3LB 4KK9C 2EDQA 3BW9B 4TULH 5E6YA 4QWWD 5CKGA 3PWJB 4N1HB 2EYRA 5TF1L 1ZLWH 1G84A 2R23A 2W9EL 3GO1L 3FTGB 5C86A 3WIFA 4ISVB 3VXSB 3V4VH 3MLVL 2HVJB 1U3JA 3KPQB 4LCWA 4FZEL 4X9GA 3JVGC 1GGYA 4Z7UF 1EVTC 3VH8B 3FOLB 2UWEE 1NL0H 4IMKA 3O4LD 3IDIA 3ZKQD 1G9NL 3KPNB 4XBPB 3CUPA 1P2CA 3R4DA 5E6ID 4U3CA 4F7PA 3B5HA 4PJ8C 3NA9L 1JNLL 3QXDA 4M4PA 3BXNA 4HIHA 3DHJA 1RK1A 35C8L 3QRGL 4BUHA 1K4CB 1ZA3B 5ESAA 1GGUA 4NQED 4QHNA 5L7XH 4KGJA 5CIPB 4MA1C 3V5DA 5IHZA 2DM7A 1VEOA 4K3DL 4XWGH 4QRUA 1BZQK 1E4WH 5F6HJ 4N1EA 3G9VA 2PXYC 4PY8J 1IZKA 3FO0L 1RUML 1OAZH 1MIEH 4CVWA 5ITFA 5FF6B 3QCVH 2AJ3A 3S37H 1CN4A 3I9GL 3SBWC 2JJTC 3T65B 1MWAH 3UAJD 1JRHH 4LLQB 4LNVA 1OD9A 3LKRB 4KKLC 4PGEA 4ZYKB 3U83A 3S36L 1JI1A 3TFKD 4AIXA 1MRFL 5MI0B 4HIIA 1RPQA 3KPSD 2GIYA 3BQUB 3LV3A 3QUXA 3ARDD 2BMKA 3FO1A 3PABB 3F12B 1AR1C 2AAVA 1G9MH 4N0FB 5JHDD 1JYXA 1QSFA 1N3NA 4L3EB 3SDCA 2MHAB 3WEXA 1IARB 2XZQL 2BRQA 3HC0B 2JELL 1FRGH 1INDH 2NW3B 2FO4A 4RA3A 2UY7A 2V9QA 2QQNL 2R2EB 4AEHH 4FFVC 1IRAY 1UM5H 2NNAB 2OL3H 1RU9H 3KXFD 3QQ4A 3P4OB 5DEZA 4OTXL 4R3SB 4BK4A 3H9HA 1LQSR 1KN2L 4YWGL 2VL5B 1VESA 1VFBB 3VGHA 3IKCA 4X80L 1DBML 4P23D 3ARVA 4NZUL 3MNVA 4PJ9D 5EO9B 3HPLA 4FABL 3PWUA 2FR4A 5JOEA 5J1AA 4LASH 4OFKA 3L5WB 4J23A 5BV7L 5DJDA 2ZSVB 1IAIH 1LD9A 3HB3D 2HFEB 4JDZA 2PTTB 3MRCA 4LLWA 4PLKD 1QVOA 5EU6D 1IAKB 4ODUA 1HXYA 3EYQC 1ND0A 3A6BL 4G3YL 4ZUSB 4XMLL 5DD6B 4PJ7F 4XZUA 2D2OA 4KXZI 4D8PA 4NJAH 3TO2B 1Y0LA 3OB0H 3L3JB 1S7WA 3SKOA 2E7LE 4NHCH 5BVJB 1ZLVK 3VFOB 5IHBA 2NY5C 1V5JA 3HMWL 4DGVH 3A6CL 4Z7UA 4XAKD 4HW6A 2P5WE 1D5BA 1YPZB 1CDYA 2B4CL 4GXUM 1GPOH 2ZUSA 4G42B 2OJEB 3BN3B 1S5HB 4Z7NE 4QGTA 5D72L 2A6DA 4HMDA 4EN3C 5I1EL 1I1FB 5JXEC 4CMMA 4JFPB 5EDXA 4NN7B 5C0FB 1G9NC 5IB3B 3HZVB 3M8OL 4XPBL 2CJUH 3LOWA 1AGCA 1NAMA 4FG6C 5FKPA 4URTB 2BXYA 3BRDA 3QAZB 3BFOA 3S5LB 4G8FA 4LVHB 2I9TB 2ZCLH 4WHYH 3D3VB 3K8LA 1CFVH 1BGXL 3F7RA 3LMJH 5HJ3A 3QNZA 1ZA6A 3BKCH 1T21B 4I2XA 3U46B 4M8QA 4YHNB 1A47A 5F7EH 4HIEB 4L9LC 4M5YH 3WO4B 1T7YA 4OJFH 2JIXB 4XBGB 4DVRH 4EUPG 1U8QB 5EO1B 4NM4L 2NXYC 4E0RA 2VLJA 4Y2DB 3MGTB 5CZKA 3P0GB 3S35X 1A6AB 2EZ0C 1CU4L 1NBZB 3I02A 4CADB 1RUAH 5I75B 4LF3B 2YD5A 2E7LC 4S1SH 3RVUC 4NT6A 4M3KB 3UP1A 4KK6D 1NC4B 3NGBB 1DEEB 4PP1C 2Y36L 2CO6B 4JO1H 3LPGA 1AGEB 1FL5A 3BAEH 4YDLB 3FMGH 1KJ2A 2P44B 4PTUB 3BKMH 4J8RA 4M6OH 3ZSSA 1FIGL 5DZLA 1ACYH 2BSSA 3ULUL 5FB8B 1W0VB 5JW4N 2YPLA 5HDBF 3RWDB 5I1HL 3K80A 1KCUL 2H6PA 2JLLA 4EQ3A 3KPPA 5T1KB 3OKDB 3V6FA 4FQ1L 4TUOA 1R5IA 4XX1E 5DRZB 5E95B 4AQ1B 1NCAL 3BP5B 3OG6B 1G7QA 3MJ9H 3NFNA 1NMBH 3BWUC 4QF1B 3SY0A 3G5VB 1LK3L 4JZJB 4DGYH 2Y5EA 5GRJH 3GSQB 5F1NA 5EWIL 2YA0A 4L8CB 3H3KA 1KJVA 2CO7B 1A1OB 1X3DA 3BEWA 5DJYA 3IDMB 4XP5H 5JHLH 5E8PA 3L3IA 1YECH 1QRND 2YSSA 3ZKXC 3BJ91 5EO0B 1U3HD 4JKMA 5BV7C 5J7CC 1QPPA 3T1FB 1F00I 1N59A 4NQCD 3WIHA 2AK4A 2DDQH 1KEML 4JQIL 3MJ7B 1H5BA 5FUCE 3HNVH 2EE3A 4NQDA 6FABL 1OAXL 4ODSL 1N8ZA 1YNTB 4F7CA 4KUZL 4K71B 2VISB 1HHKB 3IVKB 3TBSB 5C8JB 5SWZE 3P9LA 1QA9A 3T0VA 4V2BA 1S9VA 2Y7QA 5F93C 4XCEB 1JYNA 4C4KT 5IJVA 2GFBB 2IG2H 1GC1L 2A9NL 4Y5VC 2AS5M 1D5ZA 2CKNA 3GBNH 4LSQL 4XCFL 2A6KB 1BLNB 3LZFH 4M62L 3SGKA 4NHUE 2G9HA 2VZTA 1J0KA 3C8KA 1AXIB 3KJ4C 5BOZG 3SJVB 3KHQA 3EBAA 5I1LA 2X4OA 2B4CC 2NY1D 3D9AH 3OKLB 1G0XA 5E6ZA 3Q6GH 2V7HB 4R4BB 3V7AG 1UWEH 4G8IA 1U8IB 2J1KA 4GW1A 1I85C 3BJLA 3CPLA 3MV8A 3K81A 1U6AH 3QG7H 4XC1H 1OGTB 4GRLD 2CDEA 1HHGA 2X4PB 4KK5D 5KS9A 3VFGL 3P77A 4UT6L 4LKXB 1J5OH 3TJHC 4F7EB 3RWCA 5IMKB 1VSCA 2Z8VC 2VZUA 3QDMD 4HWEL 4X7SL 3GSNL 2DQDL 2WP3T 2C4FT 4PD4J 3RVXD 1FJ1B 1NKOA 1D9KC 3MREB 4X5XB 4L4VB 1P4LA 5E00A 2VDLH 2X4QB 5MHSD 3HC4H 3ARQA 2VDQL 3QIWB 4PJCE 4QRRB 4Y4KC 5SX4I 5FUCC 5BMFH 5GS1B 5IQ9A 4NRXA 1V7MH 2MMXA 2BFVH 4DZ8A 1ZGLB 4KRLB 3G5ZB 3GBML 2XQYK 1J0ZA 2C3GA 4A6YH 4LNRA 3WS3A 1MFEH 1YDPA 4GOSA 2DIBA 1QR1B 1MRDL 5C0IB 1UACH 4N5UA 3KS0J 3P30L 1K2DB 2P42B 2APVA 5CUSH 1JWSB 1FL3B 1KJMB 3DRTA 1KPRB 5ITBH 3BE1L 3IXTA 3MLSL 1MJ7H 3D1MC 4KRPD 3MOQA 1LO3H 1A0QL 1X5YA 3U7WH 4B7LA 3SO3C 2NMSA 1I8IB 4PG9A 3GM8A 2DI9A 3FN0H 4TSCH 2JB6B 1CIUA 1OCWL 2GUOA 2BNQE 4PJDF 3O4OB 1V7NH 3QEQD 2WIIA 3W9DB 3WJJA 1BAFH 1FLRH 2NPLX 2XFXA 3C5ZC 4KZDL 4WJ5B 2XZCH 1T2QH 3RKDD 1B0RB 5DRNB 1TVBB 3MX0A 2X4UA 1HILB 4UB0H 4ETQB 3OJMB 3TVMD 1T89A 4JRXB 4L4VE 3A67H 3I6GB 3SGJC 5ACZB 4JM2F 3MRHB 3UJIH 4HLJA 4AH2A 1T0NB 1WFUA 5F7UA 4ELMA 4L1HA 3BEVB 2JB5L 5DGQA 5D7JA 4PPTA 3DVFA 1XGQA 4PY7B 3W82A 4OFPA 2V17L 3VXNB 5KSAA 2IPKA 3Q3GB 2BNRB 3DGCR 2J2ZA 4P5MA 5EUOB 1NCWL 4R4FL 4QRPE 2CRIA 3RY6C 1XGUB 3WSQH 3DMMD 3F62A 2GSGB 1FG9C 1H3GA 5JQ6L 1CGSH 1MAJA 4QOKA 1CTOA 3UPRA 1ZHNB 4V3EB 3NH7H 1S7SB 4IRJB 1WBZB 1A22B 5B38A 3P0YL 3RGVC 5IVXB 3QNYA 2FL5A 3IU3B 1BD2A 1BOGB 2CD0A 1UZ8A 4LIQL 2A9ML 2VXQL 1PW3A 5DJ6A 2F19L 3ROOB 5AZ2H 5TH2A 4O4YL 4M1DL 4G8GA 4YXHL 3CU7A 1FO0B 4I13B 4PJ5D 1X5LA 1FAKT 1GC1C 3DXAE 4R6UA 1FNEB 4TVPE 5HI3D 2ZPKL 3B83A 1JZ2A 2K3TA 4OIAA 4CAGA 4X99B 4GQ9H 4MD5A 3OZ9L 3BGMB 1CFNB 2YPKB 3OX8A 3VD5A 3BD3A 5KN5B 1BREA 5I19L 4JR9H 2GT9A 4UZGA 4PGCB 1LO2H 4J1UB 4B50A 5IEHA 1KG0B 2J5LB 1TITA 1LE5A 1J7VR 4GFTB 1G6RL 4JANB 4LGSB 2XNAB 3ZKNC 1RJZA 4JKPL 3BRGC 3E3QA 3EAKA 2W60B 3BZDA 5LQBL 1FC2D 3PQYB 4U1IA 1LEGB 4MGXA 5C09B 4Q6IC 4UAOB 5EUOE 4MZ3A 1P5VA 4P46C 4YHIB 4X7DC 2HVKB 2CK0H 4JM4L 1KELL 4GXVL 4HT1L 4NNXB 4F58H 1A1NA 2IEPA 3OR7A 4PRHD 3NCMA 4AZ8A 3QCUH 3TYGH 4UOW1 2ADIB 1IQDB 3GIZH 1BF2A 4D3CH 3PWVB 5FA3B 5LAXB 2IGFH 3VXPB 2XOTA 4MDJB 2WUBL 4ZUVA 4YHKL 1A6TB 3B5TA 4J6RH 3RJQB 3D2UB 5HPMB 4HG4K 3J8F7 4HS6A 3S7GA 1T1YA 4DJMA 4U1LB 4HCRA 2VDOL 2AEQH 3B8YA 3NZHH 2D0GA 5I15L 3C60C 3QPQD 3G6JF 3MLTA 2SEBB 4Y19E 3TZVA 1NCDH 1MEXL 3ILPB 5K9OA 3GJFK 4I0PB 5TQ0H 4RSVA 4BZ2H 1HYSD 3DARA 4Q6YA 4PJDA 4RMUA 1N5YL 3RNQA 2XWBB 3HS0B 5EZLB 3ZL4H 1A4JB 3HNTH 3C08H 4Z8FL 3DYOA 5CJOH 3F6IA 3GSWA 3VXOB 4TNWF 2X2YA 5DEFB 1P4BH 3BD4A 3N1MC 3RWIA 5C09E 1ZTXL 1RZGA 5CWSA 2IH1A 5HDQH 1RZKH 3QI9A 5FO9B 1K5NA 1B88A 1OB1B 3QXAB 2DBLL 5BZWA 4EOWL 4N0YH 2RAMA 4MNHA 4IRJC 5HGHB 3IU4H 2ERJB 2IPUK 5JLZB 2HTLD 2DF3A 1EK3A 1MLBB 1FV1A 3BPOB 2YMXL 4F33A 1OTTD 2Q76B 3TWCH 3VGFA 1HSBA 2Y06L 1RULH 4Y89A 4CUCA 5D1ZD 4R4ND 4UT9L 1UVQB 4AT6A 3QWRA 2X41A 5IR1A 4Z95L 1FCGA 4IOIA 1BQHB 4L5FH 1S5IH 3L3OB 4D0CA 2Y9RT 2VLKE 1J8HE 1MAMH 3TCLA 1KB5A 3QG6B 3HPJA 3DX6B 4FFYL 1FVEA 3QZWB 4MA7H 3JZ7A 4MD4B 5CINH 1UC6A 5B3JE 1I3UA 3ZYJA 3T77B 2OZ4L 3B4NA 4G6JL 5IT2H 3IFOB 2MWCA 5F9WC 2OR8A 4JDTH 5L8JB 3JBG7 1N0XL 3HI6L 4NWTH 2YUZA 4C57C 4HQQL 2DAVA 5JW5A 4QHKI 3TO4D 2A6IA 3GSVB 2HJKB 4PJBA 1QSFD 3SDCD 5LWYH 5T3XD 1VADB 4NC2B 3EYSL 5GGUB 5KVGH 3O9WB 1BZ7A 1AGDB 5TDPA 5ACMA 4ZOCA 5GGSB 1MSPA 5JIPA 1T1ZA 5C08B 4LRNH 5FHAL 5M7QA 5DURD 3K2MC 4O58H 1CD9B 3OKKB 5ID1B 2EO1A 3PDDA 4JE4B 3NZ8A 1RIUL 2QSVA 5JPMB 3AROA 2ARJA 4P9HH 3UTQA 4PTTA 3UTPE 4KROD 2OR9L 5ICZB 1I8MA 1IMHC 4FQ2H 2BY0A 3IS1X 5FYKE 4XNQA 4I0KA 2BOCA 4U7KA 3V0VA 3Q48A 1YEJH 3KR3L 1SJHB 2GTZA 4LLMA 1F5WA 1UJ3C 4UTAH 3MRMA 4Y1AA 4UUJA 4AMKL 5EBLA 1N4XH 2BSTB 1XMWA 4OM1H 3WO3B 1TETL 3DVNB 5LXGL 3FO2A 3HTLX 3UYRH 2O93L 4HBQA 5D96B 5GGSY 2R2BB 3MR9A 1ULVA 2DQTL 4YFEA 1EH9A 3SE9L 1YC8A 3LQZB 3OKYA 4U2ZA 4AIOA 1QHOA 5DVNA 4N8VB 3VWKA 2NTFA 4Z0XA 1L7TL 2PYEB 4FTVB 4P2OA 1QLFA 2PR4L 3IAGC 4HKZA 4MJ5B 5C08E 2Z0BA 5ENWB 1YEHL 2HFGH 1JGLL 3SE4A 4XXCC 3RTQC 2HWZH 1JNHA 1IL1B 4PJEB 5TPWH 3DV4A 2NY4B 4Q7DA 5ETUA 1VFAB 3EOAA 4PJAA 3X14B 4PDCE 4XH2B 3U1SH 1F11B 3O11A 4NKDA 1LO0L 1U8MA 4OB5L 4X6BB 3VE0B 3VGAC 2GITB 5E5RB 5F70A 1QKZL 5IGXL 2Y23A 4QRQB 4X8JA 1OGAA 1CS6A 3HR6A 4RNRA 1KPVB 2DQJH 2HRLA 1AO7E 5FYJD 1INQA 1I1AC 5F6IC 1WJ3A 2X4RA 1LP9B 5E2TL 4YZFE 1OTUC 2OTWB 1LEIA 3OWEA 4GUPA 5EG6C 1YY8A 1Z5LB 1S78D 1WV7T 3GI9L 1MCOL 2GAZB 3MPCA 5AAWA 5ID0A 3TNMB 2VLJD 5JQHC 2ZNXA 4NPYB 3Q6FB 2WINA 2V9RA 3U4BL 2PYEE 4FTVE 1NFDE 3O9WC 2NYYD 4OUOA 3I50H 4K8RL 1XF5A 2F5AH 3ARBA 4ZUTA 2H32B 5D70H 3JWOC 2D7NA 1F2XK 4ZTOL 2J8UA 1LEKB 1QSEA 3VFSB 4PJEE 3AREB 4KTEL 1HZHH 5C0RL 2NW2B 3PL6C 4ZD3H 4JVWA 2B8OT 2BVOB 5EA0H 1R5WA 1KOAA 1Z2KA 1RZ7H 4OT1H 5F3HB 2C26A 3BKYH 2OTUB 2YPLD 3CK0L 4GKNA 3O2DH 2ORBH 5D1XB 5DD5L 1CGXA 5F1OB 2CR3A 4WFEE 5E2JA 5KSVA 3O0RL 3ZKMD 1HKLH 4M93B 5J1SC 3FT2B 5JORB 3JWNC 3TPUE 3UO1H 1LP9E 3Q2CA 5J4MA 5EOTB 4JFFB 2WZPD 2NY2D 5EN2A 2NY0D 3H9SA 1TZGL 1NMCB 4LK4A 3ZO0A 5FCSH 2AKRA 2Z91B 4HUUB 4LSRH 1U8NA 3GFUA 5D7SH 1P7HL 4HUXA 1G1YA 4KAQL 2UUDK 5MEPA 3FT4A 1HYRC 4YHPA 4HZLB 2AK4D 1BOYA 5KW9H 4MYWB 1GJIA 1HQRA 3O6KH 4X4YA 3VXUA 1FVCB 1A6ZA 1AHWB 3OR6A 4NQDD 1XGPA 1NDMA 1HH6A 1ONQB 2R56H 2ZKHL 4WO4A 2R29L 4NKQB 5IB5A 5J9PB 2NY4C 4LPVA 3CXDL 43C9A 3D48R 4P5KA 5DMIH 2YA1A 3CFIC 5DWUH 4KDVA 4KTYA 5DGRA 4Y16A 7CGTA 4Y4HB 4PRPB 4U33A 4H25A 1EGJL 4TN9A 1T20B 1JRHI 2CLZB 1U8LA 3QDHA 5C71A 1QYGH 2H26B 3GGWB 5SWSE 1CG9B 1EDQA 2FCBA 3ZE2F 4IMLA 3BT2L 1HEZA 3GB7B 3UROR 3H8NA 3V6ZA 3NCYS 3DX9B 2YK1L 3F58L 4FQIL 3RNKA 5GGTL 5HHVH 3VDBA 4MXQA 5GSRA 4WEMB 4JFFE 4JKLA 4U6YB 3UBXA 4ERSH 4CN1A 5TE4H 4C4KO 2OP4L 1JTPA 4BFIB 2JTDA 3FO9A 1NGPL 5DC0A 4MB3A 3NA4A 4QGYA 4WTZG 3O41B 2B0SL 4FQQB 3BMWA 1KGCD 1NFIB 4K9EH 3R1GH 4JFEA 2DI7A 2I07B 5I8OL 2VLLA 1AQDB 1Q9LB 4GRWE 3CFBB 4QRSA 5IW1A 2BDNH 1KCGC 4HPYL 1EX0A 5EUKA 5DO2D 5DLMH 3E2HB 4RGNB 5HVGB 1N7ML 1RK0A 4OZGF 5DK2B 1C12B 2Z31B 4LHUA 5C07E 3GBLA 1Q94A 1DQJB 2RJMA 4I18B 4XP1H 4MB4A 2X42A 4Q0XH 2WP3O 4YK4C 3ARFD 2AV1A 1IAII 5DD3H 4OLVL 4K8RC 1RD6A 5MEQA 3BP4B 1X5GA 1ZT1B 1JF1B 3HE6A 1JK8B 4OZHF 2DD8L 2HJLA 4RFNC 1CD8A 3TBYB 1MFAH 2Z93B 3S34L 3KJ6L 5K59E 4NQSB 3IFNL 3HI5L 1P4IL 2CGRL 1VKXA 4FZ8H 4YO0A 3HHRB 4FXGA 5F96L 1LK2A 2ARWA 4NQXA 1BQSA 2GSIB 4GAJL 4LVOB 5D6DA 4P5TC 3CDGA 4P2RB 4CJ1A 4TPRL 2H2PD 3W9EA 4P2QB 3BZFA 1DVFA 4PJ9B 2R2HA 4LEOA 1MJJA 3OJVC 4V1DE 2ESVA 5DMKA 5L2KD 3QWQB 4WI4A 3MV01 3OAZH 3BP6B 1IM9A 5HHPA 5FDWB 4N5EA 4RGNE 4HUMB 2FJGA 3ALXA 4CVZB 1DE4B 5E24E 4HAGA 4UV4L 4RAUA 2YD6A 1MCPL 2AJUH 2X4TA 1UKSA 2J12B 3M17A 4L29A 5GRYA 4BH7A 5TDOB 5DZNA 3RI5F 5HHMB 5FGSA 4QOKD 4X4XB 3IF1B 4HWBL 4OZFB 5HVWA 4NUJB 3VWJB 2APFA 5B3NA 2NX5B 4NZJA 4Z7WB 1VACA 1RJLB 1BD2D 3DBXB 4XNMB 4P3DB 7FABL 2HTKD 2YRLA 4S2SA 3V4UL 1JGDB 4H0GA 4JFDD 4HG4J 4X6EA 3WDHA 4CGTA 4WW2C 4QY8B 2O5XH 2V2WA 3CVHL 4G8GD 3NACH 5E8OA 5I1KL 5DQDH 4P2RE 3LH2L 3ARTA 1MJUL 2R2CA 5FDYA 5ACLA 1AGBB 2EC8A 5IMOB 1CICC 5IOPB 2HG5B 3PDOB 5FM4A 3RHWF 2R69L 5FV2A 1ORSB 5CJXA 1YMMB 1S7XB 2K9UA 4WCYH 3QIBB 1IKNA 5AD0B 1BIHA 3EOTH 5FM8A 5JMOC 1S9KC 3T2QA 3K0WA 4JJ5A 1RZ8B 4H20L 1PEZA 4HS8L 1F8TL 3PNWA 5FYLL 3QYCA 3RAJL 2F74A 4PV8A 3VXRE 4LVEA 2UZIH 1ZVSB 5DUMH 2BZDA 1FNAA 3BZ4A 5DA0B 4X5WB 1ZT7A 5HYFA 4U1JA 3SPVB 5JNYA 2DMCA 5KANG 1P9MA 1L6XA 3L3GB 4LSPL 4OCSH 2UWEF 3RBGA 2DQEL 2NXZC 1A6VH 1W72B 3L7FB 1UYWL 4I18C 5AUMB 3RA7L 5D2LA 3FQXB 5HHME 3HN3A 1SEQH 5DJZB 1LDPL 3MLYL 2Y4SA 43CAA 2AXFB 3RDTA 3FB5B 3VRJA 2N7BA 2WBJB 5HGAB 1BJ1J 2DQCH 4TVSa 4YHML 3L9RA 1HIMH 2KL6A 1N64H 5IW3A 4EBQH 4AQOA 3OKNB 1MFBH 4MNQE 2D31B 5ALBH 1ADQA 3V0WL 5EFIA 3FFCB 3EO9L 3W2DL 2EKJA 5KVEH 1VGKA 3O8XD 2HT2D 3OGOE 4RMVA 1VPOH 3TZVD 2ZCHL 3MRLB 4KI5D 1CYGA 3CD4A 1UWXK 1UB6B 5C2BL 2IAND 4HUWA 2R1XB 1YMME 4GBXC 4I48A 4H8WH 3EZ8A 1DN0A 4OD2A 1NLDH 3AXLB 4LARH 4OAWB 4I3SH 3TH3T 2BC4A 2BX5A 3UJJH 1UH4A 2OI9C 1SHMA 2BVQB 5HY9B 1DTUA 3P73A 5FK9A 1C7TA 1FYTB 1INEL 4YEEA 1LO4H 1CWVA 2IWGA 4MCZA 1M7IB 3QI9D 1TJGH 3JVGA 3X11B 3TIDA 1JHLL 1BM3L 3FB6B 5FYLE 5C6TH 4NQCB 2F58L 5F44A 3NCYP 1BQLH 1IEBB 1L9MA 1XCTA 3UJTH 3CFEA 4M61A 2DJUA 4PJ8A 3N1FC 4WWKC 2FB4H 2GJ6A 1BECA 3PXJA 4DEPB 2CLVB 1L0QA 1OP3H 5T3XH 2IQ9H 4ODXB 2R0LL 5JW3L 1EMTL 3FFCE 4POZC 1VEMA 5DRWB 2ENYA 5B8CC 4ZOAA 1F90L 2XA8H 4MJIA 3MUJA 1MQKH 5E1AB 1NBVL 4NZRL 5HHXL 5I73B 3I75B 3QWRD 2PCPB 5JZ7C 4P4KB 3RL1A 1OAQH 2C7UA 5FGBA 3RZCC 1Q9OB 4HWZA 3V95A 1DBAH 4Q74A 3V52L 3NCCB 2JJTA 4BQBA 5BQ7A 1ZLSH 3HCVA 5GSVB 2O61A 4XMPH 1KC5L 4WV1C 4UT7H 1C7SA 2EXWC 1FYTE 5IBTH 3EDDA 2XQBL 2JCCF 2VDPH 4AG4H 1K4DB 2AXGA 3QDMB 4UQ2B 4YGVA 4IRSD 4ZSOB 5F21B 3U30B 2QTEA 3LD8B 1FFNB 5ALCH 1FH5H 2UWEA 3T3ME 2BRRH 3RWHB 4JFXB 4OKVA 3U6RB 3ARGB 4BQCA 4HJGA 4MVBA 2WBJC 4Z7NF 1ZS8B 1ZHBB 4N0CC 1GCFA 1D3CA 3D87B 4BQ6A 4NP4H 3SCMC 1EZVX 4H1LB 4ZAKD 3QO1B 3VFPA 5TDNB 5GIRA 3HE7C 1U8OB 4O51B 2O5ZH 4WI6A 3MNWA 3AVEA 3TJEL 4ZFOL 4H5SA 2VN4A 5B4MC 3PV6A 2VDNL 1JZ7A 2DKUA 3P4LA 1UA6H 4KRPB 2IPTL 4JAMB 3FFDA 5CEZL 3PWPB 2FHBA 2OSLB 1T5WB 5DS8A 4YEFA 3EDFA 5IROC 4P3WA 5I1JH 3B9VA 1A7PL 3T8XA 3BW9A 3RFZC 3ZHKA 3WFHB 4XHJD 3MYJA 4Y1AD 1NAMH 1NGQL 1GGIL 4QTIL 3FTGA 5FUZH 2QBWA 3ZDXF 5CGYD 3S96B 4ZG1A 4ISVA 5FYJH 3VXSA 1NCNA 2EDYA 2FD6L 1BFOA 1NDGA 4ZSOE 3STZB 3KPQA 5I1DB 1FAIH 3VH8A 3TVMB 3FOLA 4YAQA 4DAGH 1OPGL 5MEND 4KKBC 4HMEA 3KPNA 4XBPA 3VWKD 5ADPH 3REVA 4LU5L 4FFEX 1QFHA 5IHUL 4MAUH 3RY5A 5DT1H 3WNNA 4LSSH 1IGTA 1QEWA 4P2OD 4F57L 4LP5A 1R6VA 3MV7E 5BJTB 4AEIH 2P24A 4GH7B 4Y0GA 1ZA3A 3B9AA 2NY6C 4TUKL 4HFUH 4PYHA 1X5AA 3SDDB 3H3PH 5HGDB 4UINL 4EN3A 3DETD 5JXEA 5CIPA 3L5IA 1EHLH 1FG2B 5HYIA 2X5PA 3GSXB 2WIMA 2MPAH 5HHOB 5CKAA 5KTEH 4LLUA 3TN0B 5FF6A 4NNYB 4OM0L 1IGCL 3PWPE 4KHXH 5DK0A 2VLRB 4Q9RH 5A3ID 3MACH 3X3GL 3OF6A 4N0UB 2YUXA 4OCWH 1H8OA 3GDBA 4GAGH 4LLQA 4ZYKA 2C3VB 3MTRA 4MD0B 5IFAH 3JV5A 2F53E 2EIZA 4G7YH 4ZMAT 5DUPL 1BIIA 3A6OA 3PABA 3BPCA 1UJTA 3F12A 3P11L 4QHKJ 3U9PH 2P47B 2C3HA 1QUNA 5GRUH 1WIOA 3KYNB 3IDNB 4JPKH 2MHAA 2HKHL 1CXHA 4KRMB 1U93B 4BFEA 1OAUH 3EJZC 2E7LA 4LPCA 3SKJL 2NW3A 3DSFL 1V8HA 3OMZA 4UBDD 2P5WA 2R2EA 4BFGA 3CVIH 3MLRL 5BO1L 1EPFA 4QXGL 3ARBD 3AGVA 5KVFL 3WIHH 4Z18A 5KJRL 4OI8A 1D5MB 4R3SA 4EZMA 5FYJU 4EI5B 2KQNA 1QSED 1RJYB 2Q8AL 2VL5A 1F3JB 3SQOL 2HJFB 1HH9B 2AJXH 4ZXBC 4N1CA 2PO6C 4NFBA 1AJ7L 4YPJA 5BXFB 3QEHB 5HHOE 1JFQL 1MCEA 4LSTL 2AK1L 1T0MB 1JMZA 1ZEAL 1I8KB 3L5WA 4M7ZB 4F7MB 2AP2A 3GNML 2VLRE 3G6AB 2HFEA 1T1XB 2PTTA 2AQ3A 4TULL 3SDXB 5F3BA 3QDJB 4KMTH 4LCCB 1X4ZA 1IAKA 4NWUH 2AI0H 1QFWH 3LKSB 3JUYA 1NJ9A 2XY1A 3V4VL 5BS0B 3S88H 2DQGH 5DD6A 4NNPH 1MAKA 2YC1B 3OG4B 3H9SD 1L0YA 4PJCF 1NL0L 3TH4T 1EXUB 3TYFB 4Y5XC 3TO2A 3L3JA 5BVJA 5EBGA 3R06B 4PUBH 4OV5B 1IGMH 2EDBA 3VRIB 2YKLH 1FL6B 4J4PA 3R8QA 3QQNA 4S1QH 3GSRB 2FECI 4OQ1A 1YPZA 1H3TA 4YC2B 3VXUD 2WQ8A 5L7XL 4G42A 2OJEA 4ETYA 3WLWD 5ISZE 2EYRB 4XWGL 4MSWB 4HJ0C 1E4WL 4WO4D 4U7MA 2R23B 1I1FA 2D0FA 1XF2B 5DFWH 3IJYB 4JFPA 5A2IH 1J88A 2ZJSH 5C0FA 2OMBA 5IB3A 3HZVA 1OAZL 1W0WB 1MIEL 4LCWB 5T1LD 1MFDH 4YDIH 4Y16D 3S37L 4PJXE 1YC7A 2PTUA 5HVHC 3S5LA 4Q2ZA 5CEYB 1MWAL 1P2CB 1JRHL 2VNCA 3QDJE 1JF6A 2I26N 2E9WA 3F65A 1T21A 5DZOA 3QXDB 3NTCH 4NJ9H 4YHNA 1RK1B 4W6YB 4MXQD 2JIXA 4XBGA 5ESAB 1G9ML 4ZO9A 1U8QA 1GHFH 4CNIB 3MGTA 5CZVH 3DIFA 1A6AA 1DSFH 1A02N 1FRGL 2VAJA 4PB9H 2VDRH 3IJSB 5IHZB 1INDL 5JOPE 4HX1A 5DC9B 3OXRB 4CADA 2EXYC 3DECA 1Z3GH 5E2VL 5ITFB 2L7UA 4AEHL 3V6OA 1UM5L 2AJ3B 1AGEA 1RU9L 2OL3L 1FGNH 1WISA 1YN6B 4G6FD 5E03A 2UYLB 4OKDA 1XFPA 4F9PA 1HK6A 2EE2A 5D71H 5T3ZE 5T33H 2JJVA 3VFWA 5FB8A 1W0VA 4HIIB 4LHUD 4TOYH 1KBGH 3LV3B 3QFJE 3QUXB 3RWDA 3VXQB 2Y1VA 4NHUA 4LASL 2N4IA 5T1KA 1QSFB 3N50A 1ITCA 3P0VH 3WEXB 1IAIL 2ED9A 5DRZA 3BP5A 3HE6D 2NY3C 5CLTA 2FO4B 1ZSDB 4QF1A 3G5VA 5T1DH 2I9LB 4AEFA 3TT3H 4LDOB 5DURB 3CDYA 3C5ZA 4L8CA 1PY4A 1A1OA 2ITCB 3IDMA 4NJAL 5EO0A 3ULVE 4NHCL 3T1FA 3MNVB 4JFOA 3ULUH 1HXMB 3PWUB 3U0WL 4DGVL 3SGJA 2X1PA 4JGJA 1CQYA 4PJCA 3ULSB 1KXQE 2ESVD 3CX5K 1GPOL 3OKOB 1L4IA 3KYMA 4LLWB 5HYSB 2VISA 1QVOB 2AABH 1IM9D 3IVKA 1AY1H 4ODUB 1ZT4A 3SDAB 3KPLA 4N5ED 2BERA 4BUGA 2GFBA 4DN4H 4AYFA 2CJUL 2A6KA 4GMSH 1Y18A 4HKXB 1KJ3H 1A7BA 3LSOA 3VD4A 5E2WH 3RP1A 3RGVA 4D8PB 4Z76A 2ZCLL 5C0GA 5GZND 3U4EA 1I7RB 1P53A 5I74C 4NO5B 1S7WB 1CFVL 2V7HA 4R4BA 1U8IA 3LMJL 2EDEA 3BPNC 1XGRA 4Z7UB 1OGTA 2X4PA 1JHKH 4HAFA 4XCCH 4UIMA 4LKXA 2BNQA 5F7EL 4M5YL 4DVRL 4OJFL 4ZUUA 4F7EA 5FA4A 3MRIA 5IMKA 3ET9F 2LABA 3L95A 4KUZH 2A6DB 1EVUA 3VRLE 1FJ1A 1Q1JH 1ZHLB 1U58A 4FFWD 4X5XA 4L4VA 4MDIB 5A2JH 2X4QA 1AE6H 4JO1L 5DJ0A 2VKXA 1AGCB 3BAEL 5FKPB 3FMGL 5GS1A 3BKML 1X5HA 4G8FB 4M6OL 1ZGLA 4HIJB 1G9MC 5HJ3B 1ACYL 5BCAA 1PFCA 1ZA6B 3QFDB 1C16B 1FSKB 2ZUQC 1QR1A 3W0WD 4QRPA 1K2DA 2AW2A 5KZCD 2LTQB 4WDIA 1JWSA 4HH9B 1FL3A 1KJMA 1KPRA 3B9KC 1WSST 5CJQH 5AG8A 2HMIC 1A3QA 4N9OB 1N6VA 4LSDA 3CFDB 5DHYB 3V79C 4W68A 1V3JA 1XEDA 1TJHL 2Z8WC 3MZGB 3MJ9L 5I8CB 4NGHH 1NMBL 4O5LH 3VG9B 2XACC 1E28B 1I8IA 3RDTD 2CKBH 4DGYL 5CCKH 4RCAA 4G6AD 2VIRA 5MEOB 5GRJL 5IM7B 1FL5B 5JIHA 2CQVA 1KJ2B 3C60A 3EJYC 3BDBA 1NBYB 3DXAA 1F6LL 5GS3A 4J8RB 4XP5L 5JHLL 1MH5B 5D7LB 4WJ5A 1YECL 1TVBA 3K8MA 4DWHA 1ZHKB 5HYJB 1HILA 3FRPG 1CE6A 5CLWA 4ETQA 1CFSA 2DDQL 4JRXA 32C2A 2H6PB 3I6GA 5B3JF 5HYQA 1KB9K 5ACZA 3MRHA 4HK3N 3LN4A 2XTJD 4WHDA 3AS0A 5MERA 3TA3C 4QHMB 4YBQD 3NFNB 1FC1A 5C0BE 4PY7A 4TQEH 3SY0B 2QADB 5D1QB 2Q87A 3VXNA 3Q3GA 4KK9D 4D9QE 5EUOA 3ARYA 1P6AB 2IG2L 2UZXB 3GBNL 3QWOB 4WWID 3LZFL 4M43H 4OCYH 1N2RB 1KJVB 4I3RH 4U1GB 2GSGA 4APQD 3BEWB 5DJYB 3MGOB 5E8PB 1ITBB 3RVWC 1DCLA 2BXZA 2CXKA 3QDGB 4IRJA 4PRID 1WBZA 3WUWB 3WNLA 3D9AL 5IVXA 3OJ2C 1FLTX 3Q6GL 4I1NB 4K23H 5FV1L 1UWEL 1N59B 3EDEA 4BJLA 3IU3A 1BOGA 5IB2B 1U6AL 3QG7L 4PJ7B 1I3GH 2E9IA 2ILLA 1BMGA 4XC1L 1H5BB 2OX5A 3BP7B 1IC7H 1J5OL 1N26A 5C9JB 4AEEA 2GJ6D 1Q0XH 2FGZA 3WXVH 3VU2A 1GGCH 4RWHA 4F7CB 4Y19A 2VSDA 3OSKA 2FLRT 2BHYA 2QQKH 5E8DH 2YPKA 4MJID 5DDHB 1HI6B 5HYJE 3MO1B 3FZUD 2EYTB 3F7PC 3L6FA 1V3MA 3HC4L 2PW2B 2G9HB 4QCIA 5BMFL 1V7ML 1R24A 5DD0H 4J1UA 2BFVL 4J3WA 2DTSA 1KG0A 3T4YB 2EC9U 3O6FC 5GZOD 2XNAA 4A6YL 3MV8B 2EDOA 1UACL 1P69B 2F19H 1LEGA 5C09A 4LOUC 4S1DD 5DVMA 2JJSC 5CUSL 4R90H 4YHIA 3RWCB 3DO3A 1ZMYA 5E9DE 5ITBL 4LDLB 4FMKA 1AR1D 3PE9A 4MMXC 1MJ7L 1XR9A 5CD3A 3IETB 1LO3L 3QDGE 2ADIA 4FRWA 3U7WL 2CXGA 5IMMB 3HLAB 1XAUA 5FA3A 3QJHB 5LAXA 1NGWB 4MCYB 4C58B 4Y5YC 2YHGA 1P4LB 5E00B 4TSCL 4Z9KB 3FN0L 1HHJB 3VXPA 1X5KA 1A6TA 2KH2B 1H3UA 4MVBD 1U0QA 1XGYH 3H0TB 3OPZH 3TBWB 1V7NL 4NQVB 3VW3H 1BAFL 1FLRL 2ICWB 2XZCL 1T2QL 3ILPA 5CBEB 4I0PA 3WS3B 3SOBH 3ARSA 4UB0L 3D0VA 1KN4H 5HD8D 1YYMH 3BWAA 4RAVB 5DFVC 3QIUC 1MHHB 4S0TD 2XWBA 1CVRA 3KLHC 3DRTB 1KF9B 2VLKA 3UJIL 3HS0A 1J8HA 3GMNB 4GRMB 4LKCB 3QQ9D 2E7CA 2NLJB 5ANMB 3KG5A 3CGTA 4YZFF 1FZOA 1MCBA 1S7VA 5EOQH 5E4EB 4F9LA 5EB9A 3UTTD 4PG9B 3T04D 5DEFA 3C09C 1JZ5A 5D1QC 2GUOB 3EYQD 3ERYA 3WSQL 1F4AA 3TF7A 5FO9A 1BVLA 2WIIB 1CGSL 2XFXB 1FNGB 3OAUH 3NH7L 1OB1A 3G5YB 3QXAA 4H0IA 5I8KH 3VXSD 1NFDF 1XR8B 5DHVB 2W59A 1OWRM 1PVHA 2E9BA 1GVIA 2GEEA 5AZ2L 3EW3B 4Z7QF 4ESKA 4PJEF 1LNUB 5EORH 4AH2B 3SHSA 4MS8A 2JKXA 2Q76A 3BHBB 1T4KA 2YEZA 1MNUH 2GK2A 4M7KL 4F3FB 4NUGL 4KDWA 2KBGA 5CBAB 5D7JB 4GQ9L 4K07A 3CX2A 5KSAB 1UVQA 2B5IB 1YEEH 3MLWH 2C4XA 3MRGB 4WEBH 2W9DH 4HV8B 4JR9L 5HI4C 1KIRB 1MI5B 4XPFH 1BQHA