1T0NA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
total genus 74
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0nA01
3HZYA 1XGYH 3ZMRA 1JK8B 1NGPH 4HJJL 3R4DA 4RAUB 1DEEB 1PJ9A 1VKXA 4XCNA 4UIMA 1CF8H 2IAND 3SE3A 4G6AD 1QSFA 2P8MA 2FYYA 2F58H 2FATL 4JFFD 5GGTA 4K9EL 2JLLA 3E0GA 4DVRH 2ZCKL 3RX8A 3MLUL 4D94A 4H1LH 5C6PB 1TMCA 4AT6B 2FJHA 3BPNC 43C9B 4PRNA 2YC1A 5I75B 3FOMA 3PNWB 3BP7B 5I18H 4JM2D 3F6LA 5E0QA 2YBRB 3VFUB 2VKWA 2VRAA 2X4NB 5C0AB 4Z7WF 3AS0A 1D5ZA 3CH1B 4RGOL 3KPRE 3L3DA 1MH5A 2XN9A 1UB5A 4M62L 5C07D 4XMPH 1T2JA 4LVOC 1X5GA 5GRZA 4M43L 5IEKB 1RV6X 4JDZA 5L2JA 3U9PH 1FNEA 3IAQA 1ZTXL 1B88A 1CL7L 5IFHH 4QTIL 1DJSA 4QRPE 1IKFL 4XPGL 1MJUH 4HFUH 4PP2A 2V7HA 5H37H 2D4FA 3GO1L 1NC2A 4KTDH 1MY5A 1KIQB 1WC7A 2UUDK 2NR6C 3C60B 5D7SL 5C0RH 1IM9D 2Z93A 4M4RA 3WNOA 1UM6L 4MCYB 2AP2A 5ACZA 2GYSA 3HNTH 3MBEC 1QZ1A 4QRQA 4Y19A 1JUFB 4DUXA 1MHPL 5IR1B 1XF2A 3AS1A 4J3OC 4PJDE 2DD8H 4HZLB 4PRPA 3FQTB 4Y4HD 1DQML 5E2TL 4KU1A 3KXFB 4NYLA 5F9DC 1T22A 4WW2A 1CK0H 2HFEA 4MJ5A 1UM5L 4TNWK 5LKNA 3BKML 1TQCC 5D1ZA 2D7NA 1WFTA 5F6HI 1QA9B 4YO0A 3ARBB 2CIIA 1QSVA 5IG7B 4XNZC 4JKKA 1T1ZA 5DJAB 3ZHLA 2OSLA 3WJJA 1K8IB 2RFXA 4UTAL 1CD9B 4YNYB 3LKQA 2R39A 5CKGA 3HC3H 2MMXA 5JPMA 5CJOH 1WTGT 1RIVH 2OZ4A 4N8VG 4NRZB 5D72H 3LZFL 4N1HB 3ZE1F 4OLWH 3IXTA 2VLRD 4P49A 4PJ9C 1CQKA 4JFHD 1IC4L 4Q9QH 3MRDB 3UTTA 4G6JH 2BOCB 2XTJD 1BECA 1A7OH 5K9OA 1IAOB 5C9JA 2EE2A 3OKOB 5IUSA 5JR1L 1S7UA 4N8CH 5TQ2H 1ZA3B 1N59A 2OI9C 2QQKH 4OFIA 2X9YA 1FC2D 4XCFH 3UTSE 4XBPA 4WWID 1I3RB 3KLAB 1H0DA 2ZKHH 4BZ2L 5D2NC 1ETZA 1LVEA 4ODVH 1NL0L 3B43A 4X6CF 2Q3ZA 4O5LH 3VFNB 1A1MA 4FMFA 1UB6A 1H3PH 1JHKL 5DDHB 4ZUVA 1N6QH 1KN4L 1CDUA 3GSNA 3LQAL 1YEIH 5TE4L 3G6JB 1NFKA 2GJ6A 5TDNA 4ONGL 4FP8H 3VXUA 1UACL 5DQ9A 2CRIA 4Z76B 1G7QA 1KIPB 4M7JH 2MCPL 2E7MA 2YS4A 1QSFD 1YNTB 3KYOA 5KW9L 2VR4A 3O3EA 3ARDB 4U1MA 4I48B 4QXTA 1DFBL 4MA1B 3MRMA 5ENWA 1XCTB 1S7QB 4LDLB 3Q3GA 2D31B 3BYTA 4P0DA 1GHFH 4PFEA 1K6QH 1R3KA 4K7PX 2DI7A 3PDDA 2Y06H 1XF4A 5HYJA 2V2TA 3G04A 5E99L 5C09E 4N8VB 1SYSB 1HDMA 3PHOB 1D9KC 1LO3H 4MCZA 5B38A 4DW2L 3P2TA 4GRWE 1G6RA 4LNRB 2XN9D 5H8DA 1OLLA 4MA8H 5IGXL 1KJVB 3RBSA 4PRBA 4OJFH 4QXUL 3IKCB 3WFZA 3RDTA 1VGKB 1QHPA 5I6XB 1OGAB 2YD2A 1FIGH 2X42A 3TT1L 4H8WC 4NQVB 3EOAB 1PZ5B 5H2BA 4PJGE 4TTDD 4XNXH 1MAML 1DBAH 1NC2D 2OQJB 3AAZB 1TZIA 4S2SA 4AEFA 4JKLA 1EHXA 1A14H 4ZS6D 2BVPA 4G8FB 1W0YT 2YZ8A 3M1BB 4PJ9A 4RAVA 4Q6YA 1ZOXA 1IGIH 4LIQH 4Y19D 1SJEB 1LQSR 1ZLSH 5BZWA 5BJTA 3HFML 4L4TE 5MP6L 4PRPD 1XFPA 5DEFA 1U6AH 2R0LH 2RCSH 2W0KA 3LKRA 4XNYH 3HUJB 3BDBA 3SE9L 1T4KA 1YEEL 4BFIA 5D1ZD 1FVDA 5D2NA 3F6IA 3AUVA 1EEYA 2GSIB 4U6YA 5ERWB 2ZG3A 3ZSSA 1UQSA 2DIBA 4UB0H 4DCQB 1U42A 4XVTH 1BZ9A 1A22B 1IAIL 4LU5L 4O58L 4OM0H 3DRQB 1TVBB 5E24E 5IOPB 2FH6A 5BVJA 4DFIA 4I9WD 2X09A 4HIIA 2NY4B 5D71L 1P7QB 2LVCA 1KIUA 4KHXL 4NNPH 3BXNA 3UJTH 2LVEA 4QCIB 4XWOC 3IFOB 3LMJH 1OVZA 1WFUA 5D1QC 5DJDB 1D5BA 5F9JA 4QHMB 2E8ZA 3DSFH 3UTTD 5I9QC 1IGFH 1MFDH 2VLKA 2A6IA 1JE6A 1VGEL 3BP4A 3U36A 5C0BE 4HKZB 3MLXL 4Y16A 4DUVA 4LLYB 1D9KA 3L6FA 1B4RA 7CGTA 2P8PA 4E0RA 4X9FA 4KH2A 2RGSA 5HYQA 1AGBB 3PP4L 4EDWH 3BEVA 3UC0H 3EYOA 4UNTA 3NFPB 4D3CH 1KPVB 1IAKB 2P45B 4PB9H 1ORSB 1I7UB 4N90E 1EV2E 4ZUSB 4QEGA 1IILE 4JFZH 4HLZH 4YX2H 5BQ7B 3FOLA 3QDME 1I1FB 2E7CA 3UBXA 3FB5A 5LBSH 2GJ6D 2QEJA 3HNVL 5JMOC 5GSRB 3VXUD 1KNOA 1UA6H 2NR6D 4HULB 3I50H 5AWNH 5I0ZA 3OKDA 1CLYL 4XT1C 2WQ8A 4UOJA 3ELAT 2OYPA 3CNKA 1P2CB 5DGRA 4L9LC 4YHLL 3MBED 2UY6A 4ZUUA 3TCXA 3S37H 2WUCH 3EIFA 4M6MH 5E8PA 3PWPB 5H35A 4F7MB 4BSWA 3W0WE 5HYJD 3FQXA 1SY6H 4RFOH 1JYXA 3UXFA 3QNYA 1OPGH 1S7XA 4FQHA 5DSCA 1IC1A 1XGYL 2YMXH 1I1YB 4YK4B 4NCDA 1AKJB 1IARB 3WFDH 3CSYB 4TSCH 3MV7B 1CF8L 5JXAH 3O3DA 3ECBA 4X7SH 4GS7B 4D0BB 3HLAB 5ANMA 2NCMA 3KJ6H 1OAYL 2OL3B 2F58L 3OKLA 1CGXA 5D7KD 5HJ3A 4Y5VC 4DVRL 3G5ZA 1U3ZA 4TNWF 5L2KD 1RZ8A 1KTKE 2GK0B 3QIBC 3KS0J 1KTRL 5F1IA 5E94B 5HGDB 4KZEH 4XAKE 3SCMC 1CU4L 3TO4B 2R0ZH 3EFFA 4PJ9D 5EFIB 4ZSOB 3N1MC 4HIJB 4N0FA 4NNXB 5GISH 3FQNB 2F15A 4KKNA 2VWEE 5GGRA 1FL6A 4DQOL 4TSBL 1E6OL 1FNSL 3ZE0F 1ZGLP 3X12A 4HS3A 2XV6B 3T2PA 4EQ3A 3S36X 1JFQL 3ILQC 3BPCA 1FZKB 1NCBL 3LQZA 4I2XA 4OUOA 4G42B 2NY6C 4LCCA 3QAZB 4HJGB 3STLB 4OCRL 4OCNC 1MJUL 4HFUL 4QNPF 4R97B 4M5ZH 4LMQI 3B8YA 1J05A 4XVUC 1NCWH 5F9WB 1T04B 1LEIA 2LTQC 2UWEA 4GKZA 4NM8H 4HIEA 4OZFH 4YGAB 4YC2C 1XGUA 4YFLI 3GSVA 1A02N 2P5EB 1CGYA 5CWSA 2DD8L 1YY9C 4NN6B 3DLQR 1TJHL 1I1RA 4U6HB 3QI9C 3E6FA 1MWAB 2DLTA 5CGTA 1AI1H 5C6WH 2VLKD 5MHSD 4JFXA 1NFDB 1MNUH 3N85L 5INDA 3RTQC 1FGNL 5C0EA 1VFAA 3SQBA 2ADFH 2YEZA 3L3KA 1D9KD 2PTTB 4GXUN 1NGYB 3MFGB 3BQUB 4TVPE 3NIGF 4NT6B 1EGJA 5ILTL 3WS6A 5HDQH 3F7QA 5JQHC 1DP0A 5CJOL 3MJ7A 1FQ9C 1RIVL 3PABA 4NN7C 4OFDA 3EFDL 1C5CH 3F12A 3QIWC 3GMQB 5D72L 3CCHB 3GJFK 1KTDB 4NRXA 3DJ9A 4Q9QL 5HHMA 3MV01 1BVLA 4G6JL 3SO3C 5GGVY 1A7OL 3LKNA 4XP5H 3BT2L 1GPOH 1FPTH 1CLOL 2ITDB 1YN6B 3KLHC 4N8CL 5TQ2L 3UAJC 4NHUE 1DE4B 1OAQH 4QKXB 4LKCB 4P4KB 3RQ3A 3RGVC 3NZ8A 2CKBL 4WEMB 2ZKHL 4MLSA 4ODVL 4K94H 3B2VH 4QT5A 1UZ6F 5E5RB 1NBYA 3C8DA 4O5LL 4G80A 5D6CB 1ZWIA 3P4MA 3EYVB 1U8QB 1WZMA 4AEIL 2AEQL 3BN9D 1N6QL 1S7WA 3V9FA 4PGBA 4F9LA 1A7QH 1T20A 5DURD 1V7NL 3R06A 2O5YH 1YJDH 4FP8L 3ARSA 2PCPA 3OR7A 4JO3H 1JRHH 4I3RL 2IADB 4QWWD 1UKSA 3RWDB 4V1DB 4AYFA 1BBJB 2FJGA 3PV6A 1Q1JH 4JFOA 4HUUA 2E27L 3ZE2F 1GHFL 5DK0A 1FE8L 1K6QL 2R1XA 3L3JA 2VSCA 5EA0H 1TCRB 4CU8A 4B41A 3LVEA 4LLMA 1X3DA 5D1QD 2PXYB 1CDHA 3U4EA 3U0PA 5JNYA 2I27N 3WMSA 1S7TB 4I5BB 1F58H 4U7SA 3AXLB 4NO2A 4EN3C 4M4PA 4PGEB 5FECB 2EZ0C 3X17A 2BNQA 3M8OH 3QUXB 4Y4KA 1KXVC 4MA8L 1CGVA 2GUOA 1ES0B 2HMID 1ZSDA 4Y1AE 1PLGL 3H42H 3JVGC 4NCC2 5C2BL 5E08H 5I1JH 1GOFA 4CVWA 4QHKI 1H9VA 1MFEH 4KK8C 1DBAL 3HS0A 3P40A 4EVNB 2CIKB 3FZUC 1A6AB 3GBML 1A14L 1OP5K 4OV5B 4P23B 3EOTL 2JJVA 3WD5H 1IGIL 1EO5A 1PQZB 3CLEL 5J0BA 3E1F1 1U8MB 4X99B 4MJIE 5MERB 1ZHBA 3VXSB 3P0GB 1A6UH 4R7DA 1BQSA 4Z95H 4CMMB 3NMEA 4MQXC 3Q5OA 2R0LL 2RCSL 2R0KH 1AGDA 3R8BB 2H8PA 4XNYL 4D9LH 5SWZA 1NEZG 4NQDA 3QRFM 3RGVA 4E5XA 4QF1A 3S4SA 1I9RH 4QXWA 1OSPH 5DK3A 2YPLA 1P4IH 2F53A 1C1EH 2ZZUT 4X6BB 4FXGB 4UB0L 3Q5TA 5CD3B 4XVTL 3V52H 5T33H 4BA8A 3JV6B 1TTUA 4PJEE 5I8EB 2IEPA 3WL9B 2ORBH 3ROLA 1ED3A 4PJHB 4WTZG 4GG8A 4OKDA 2JF1A 1W72H 3LPGA 4YGVB 3EYSH 2XI9A 1YEDA 4OM1H 5IVZA 1I3GH 3LMJL 5F3BA 1IE5A 5MEQA 4RFEA 5IMOA 4YHOH 3DSFL 3D85B 3DX9A 4JDTH 1IGFL 5IMLA 2FJFB 4JCMA 3WE6B 3IYLW 4HFWB 2ICWI 3U1SH 5HGGS 4QRSB 1IQDB 4JGUA 4MDIB 4EN3A 4NO0B 3QPQD 3GMNB 4W4NA 3MOBH 3OHXA 3TNNA 3EJZC 1WBZA 4PPTA 4MNHB 4D3CL 3ILQD 5DUMH 1OQOA 5TE7H 1A7NH 4YX2L 1J0IA 3KPRA 2NY6D 1NEZB 4G8GB 4DTGH 1J5OL 5LBSL 4K3DH 5BMFH 4XVUD 3VI4E 2E7LE 1V3KA 4JJ5B 2EYRB 3HA0A 3TN0C 4QRPA 4OIIH 4PJAB 2A9NH 2XICA 4U2ZA 2GITA 4HK3N 1UADC 3VGGA 4S1QH 3IJYB 3VXME 5F93C 5SX4I 1J8HA 3GMPA 1X7QA 3S37L 1NSNH 1A8JH 1YY9D 3MYJB 2ZCHH 2APWA 2FHFA 2XQBH 5E8OB 1UWXH 3VFVA 3INUL 4RFOL 1ZKAA 1K4CB 3S97C 2CLVA 3QI9D 5J12B 2D7MA 4PJDA 1RJYB 2YMXL 2Z4QB 1BQHG 1LP9B 2ZOLA 3GBLA 3EW3B 3KPSD 4AEEA 4JGJA 2V7NB 5CEYA 3WFDL 2FX8L 5F7NC 2L7JA 4M1CC 4UAOB 5CZKA 4JFPB 4K8RH 1J18A 4X7SL 3NFNA 2DQDL 2YUXA 4JM2F 4BSVB 4RISH 4F7TA 2EXWC 1BZ7A 1R3JA 3GIZL 4FQQA 1T1XB 1M6OA 1U36A 1TVHB 5TH2B 1LE5B 3QIWD 3QDGB 2Y07H 4JJHA 2R0ZL 2P44B 1HSBB 2DQTH 1FORL 1T0NB 3IS0X 4OZIB 3MUZ1 4MAUH 5GISL 5BS0B 4OQTL 3MJ9A 4Z0XB 1H8NA 4XAWH 4HEPG 3TFKC 4NOBA 4LQFH 2C9AA 3KLHD 1N3NB 1OCWH 3LHPH 3UAJD 3MRJA 4NC0B 3BUTA 3MRNB 5D7LB 1K3IA 3DX7A 1M05A 4NQDD 1AIFB 3RGVD 1G7HA 1UC6A 1YA5A 1T0MA 3DX8B 3VD4A 5GGSY 1KPRB 4K7FA 2ADJB 3V4VL 4R7NB 2I9TA 2F53D 4JRYB 3QIUA 3MFFA 3ZKQD 5EUOE 1JF5A 3UYPA 3DHJA 1R3HB 3UTSA 1NLDH 3GMLA 2LU3A 4XPAL 4PIRF 1BQHB 3WV0A 4NM8L 1YYMH 2F54D 3G5VA 2YPKB 5E1AB 3JBG7 3MRQB 4L3CB 2Y9RT 3TN0A 3VGBA 3N9GH 1HXMA 3V6BR 3V4UH 4KC3B 4ODBD 1A6PA 4HH8A 3G5XA 3LH2H 3H3PH 3JTTA 4R9HA 2EDBA 4AM0B 1AI1L 3BH9A 1HHGA 3J7HA 4JY6B 5INCA 5JORB 1NGXA 2PW1B 4YEFA 5IK3B 3GSRB 2Z35A 1OD9A 5GXBB 4EN3D 3LSOB 3CJJA 4P2QE 1T03H 4ZPVA 2EZ0D 4HGWB 3UPAA 1QSEB 2X4QB 4L5FH 5J8OA 5C09A 4PGZA 1KG0A 1OTUC 1FDLH 4IRJB 2O26U 4M3KB 3T65A 4G6ML 5T3ZD 2DICA 1KCLA 5FGCE 3KPRD 4Z7WB 4OT1H 1A7PH 1UFUA 2VH5H 2YD9A 1MRCL 4KK8D 4GH7B 3UEZA 1N6UA 3B2UC 3ARXA 3TA3C 4NNYA 4GG6A 4JHWH 5IM7A 2CLZA 5TQ0H 2ZUWA 3NABL 3RRQA 1GPOL 4PJGA 4ZFOB 4DN4H 3NA4A 3HB3C 3T1WA 4P9HH 3CDCA 3SDCB 1OAQL 3ARFA 3H6JA 1JPSH 2WIIA 4U3XA 3ES6A 2AXGA 4MQXD 4ZAKB 5IJKC 1T80A 3FHQA 4RRPA 4UDUA 1IGYA 1S7SB 4K94L 5J11C 4AG4H 3AU1A 1G0XA 1S5HA 4PB0H 4L4TA 4X80L 1RAMA 3IAGC 4YEEA 2EDRA 4P2RB 3L5HA 3LY6A 4G8IA 4HCRL 1A7QL 3KPMA 5DRZB 5FYKD 1P69B 1P6FA 1I8IA 1U8PA 4JO3L 1JRHL 5D9SA 1L6ZA 4KJQD 2Y72A 1EAJA 4MXVE 2P24A 1CZ8H 5LGJA 3QB7C 4XBGB 1FZJA 4CMHC 1J12A 1D5XA 3SJVB 3P9LB 3W81A 3ZTNH 5CSZA 5EA0L 1VFUA 4LOUD 5FYJH 4PREA 3FO2B 1CTOA 1B6UA 1M4KA 5IHUH 1F58L 3EKCA 1CR9H 3HI6H 3MRCB 4PRAB 2BHYA 3DVNB 3KPPA 5B21A 5CIPA 4GQ9L 3TBVB 4D2NA 1MCDA 2FD6H 3CFJB 2IALB 2BC4B 5DJ6A 1NAMB 3H42L 3EJZD 3QWQB 1QLFA 3JZ7A 1I3VA 2VWEC 3NIDF 2FB4L 3HAEG 1XR8B 3QO1B 5JW4N 3LDBC 5E08L 2D03L 2AKRB 5C0BA 1WBYA 3MO1B 2AJXH 3WXWH 1B2WL 1MFEL 25C8H 5IBTH 2X1QA 4U1LA 1R5IB 3QA3B 1KENH 4LIQE 3UTSD 2HVJB 5EDXA 3T2QA 2WBJB 5AZ2L 4O51B 3WD5L 2HTLC 2BNRB 1ZEAH 4LPUA 4U1JA 3Q1SH 5EIQA 5DFVC 5DRNB 3TA3A 4XHQA 3TN0D 4AEHH 3QDMA 3OF6A 1A6UL 2HT2D 1MIEH 4KKLC 5DJ8A 3ZHKA 2R0KL 2JB6A 1GRWA 3WSQH 4Y4FB 4LRNL 2ICEB 5IFAH 3EYFB 4D8PB 3O9WC 5HHOE 2BVQA 5FOJA 2HFGH 3KYMA 1H3TA 1HQ4B 1OSPL 3V6FB 1P4IL 1C1EL 1XIWC 3LS4H 1BM3H 3L3HB 2ICWB 1DEDA 1ERNA 4WGVB 1KJ2B 5T33L 4GUPB 2Z91B 2EC9T 3W0WA 5J9PA 2EYTA 2C3VA 2FCBA 4XGZA 1QLRB 4M1CD 5C09D 4YXHL 3L7EA 4XNQB 4LEOB 4WTXA 1AC0A 3NTCH 4LASH 4YDIH 2OK0H 2EXWD 4HV8A 4ZPTA 4LARH 3S9DB 3IDMA 5J13B 4YBLB 1E4XI 3HAEB 2OTUA 3OKNB 4OM1L 1I3GL 3SKMB 1FNHA 1U8LB 4J1UB 4GKSB 3QPXH 4EI5B 2OS7A 4YHOL 4JDTL 4KY1H 3TGXA 3QEQE 2UZIL 4XX1G 4NP4H 3U1SL 2VL4A 1YPZE 4I13B 1KELL 5DVLA 4FS0A 2ICES 4NFBA 5I74B 3X3GH 4APQC 3MOBL 2X4TB 3S7GA 3MSPA 4DN3L 3D69B 4IDJL 3TIDA 2VOTA 5D5ME 5FDWA 1SM3L 3HRZB 3CFDA 4NZUH 3OTTA 2VL5A 5TE7L 1E28A 4L4TD 5C3TA 1RJZB 2OTWB 3WFBH 1Y0LB 3CZJA 4X7TA 3QJHB 1I4FA 5BMFL 4P59H 4V2BA 4OI8A 4MSWA 5J6HA 5ITBH 1MLBA 2RJMA 4OIIL 2A9NL 1AE6H 3DGGB 3CFEA 5CGMA 4GRLC 1ZHNB 5JA9A 4H25B 5HSFA 3V2AR 1NSNL 4OZGF 3WKNA 1U2HA 4JLRB 4DZ8A 3KJ4C 3U6RA 2XQBL 3CUPB 4CRPA 4PJCF 3SPVA 3O9WA 3FB8A 3MR9B 4K3GA 2Z0BA 5AD0B 1FSKC 5DJ0B 5BV7B 1G7PB 5EC1A 5B3JE 2DB8A 5EZLB 4KROB 2BOBB 5JHDE 5E2JA 1XIWA 2HN7A 2JB5L 3PP3H 1FL5A 1G9ML 4LPTA 2IG2H 2W07A 4C83A 5GZNC 4OKVA 1LDSA 1JGLH 5A40E 4L8SC 1YECL 3RGHA 2YWZA 4LVNB 4RBPK 5D7IF 1OY3B 1MCQA 1XGQA 3GSXA 1AXTH 2H6PB 4RGNC 1MJ7H 4N90D 5HYIA 4MAUL 1QBLH 4KI5E 3TA3D 5E5MA 3RBGA 2ADIB 3QDMD 3OF6D 4XAWL 2OR8A 3TPUE 3MLRL 5K9JL 3N1QC 3BIKA 3HB3D 1OCWL 3LHPL 1N64H 3BHBA 1ZHLA 2HJLB 1VENA 4L1HA 3GMMA 4APQA 5GSVA 5IJVB 1XCQA 3O11A 5KZCD 4K71B 4JZOA 1O0VA 3HHRB 5EU3B 2E6JA 3VFPA 3MGTB 1SJHA 4KK6C 5JW4Q 2QR0B 4P5TC 2R2CA 1NCUA 2WSKA 5FA4B 4NHUA 1YEFL 3MRPA 2A77H 3S35H 2BVTA 1NLDL 5J3HD 3W0WD 1LK3L 3B9KB 3MLZH 3BZFA 4N0UB 3RVWC 3SDYL 3T4AB 4WU7B 1U41A 1C12B 4M7ZC 3N9GL 3UJIH 1JGUL 5A16B 3KPNA 3T77A 1FAKT 3LH2L 5D1XC 2ENSA 5HDBE 3VU2A 3U0TA 1YMHB 5DHVH 4LLWB 4ETQA 2BXZA 4LAQL 3ULUE 1FNGA 1G7LB 3VXNA 4M7KL 4XP9L 2HJKB 1HHIB 3U7YH 4FABH 5M7QA 4P2CG 4KUZH 1BJ1H 3O3BA 4NKMB 5GGVH 4XAKD 4YZFE 5I73C 5F96H 3C5SB 2DBJA 4L5FL 3NPSB 3HE6A 3VA2C 1BOGB 5T1LB 1ITBB 4GAFB 1RD6A 1W8OA 3U79A 4EUPG 5HXMA 2GJZB 3OGCA 4XXCC 5E2VL 4HWBL 1RPQA 4YPGA 3ZKMC 2P5WD 3QYCA 2DQUH 1U8JA 5F7WC 2OL3H 2VH5L 2WLZA 4ZFFA 1Q0XL 2HLAB 1F45A 1PKOA 3NIFE 4L8SA 1EEZB 3QDJE 4Y1AA 3VGFA 4EIZC 2GY7B 5I1AB 2YXMA 2MKLC 1PX3A 1RHHB 4JHWL 4JZJC 4MVBC 5F88B 2NZ9C 2Q6WB 5ID1A 2V9QA 1IKNC 4JVPA 1PDKA 3JV4B 4OFYA 4W81A 3I3DA 2EDJA 2E7LC 3F7VB 3T0AA 1GOGA 3DBXA 4KKLD 3OXSB 2I9LA 5GS0L 5IFJB 1OARH 4KQ4H 3H0TA 3O9WD 1UGNA 4OIAA 1WJ3A 4MJIA 4QOKB 1MJ8L 6CGTA 1QFHA 2ZSVB 2JTDA 5L9DH 3BEWA 4FTVB 1XIWD 1WT5A 3STZB 5B8CC 5I76A 3IFNL 3B6SA 3D18B 1DQDL 4WNQA 3VMOA 1ACYL 2GSGB 1GIGH 4DVBA 3ULVE 3FB7A 5D70H 5D93B 2J6EH 2A1WL 5C0FA 1CZ8L 1LDPH 2Y23A 1U3HB 4HUKB 1MSPA 2QADB 5EZOH 2Z8VC 5DI8B 4PJEA 3ZTNL 4EUPB 5L7XL 4TVPD 3D0VB 5F7HA 4L29B 3KPOB 5FYLH 1UJ3A 2A0LC 3MNZA 5IHUL 1CR9L 4M8QB 4I18B 4NPYA 1ZT7B 5ESAA 1MWAH 3EO0B 4Z77B 1IGMH 3ZKSD 2VERN 1VB9A 5HDOA 3QXDB 1RY7B 2ZCLL 4APQD 2XYCA 4R2GC 2UWEF 3WYRA 1LO2H 2VZSA 4K3HA 4HZAA 2YD8A 1TQBC 2A73A 4ENED 4FHBD 5GRXG 1A9EB 1JNNH 3WXWL 1CTNA 3RPKA 3WHXA 3QH3B 4M93C 2AJUH 1GZQA 3GHBH 3OJDB 1RZGA 3T0BA 3KDMB 1FCCA 3KPQA 1RFDL 1U91A 1Z6JT 1I9JH 3BP5B 1F00I 1KCRH 3BJLA 4KPHL 1ZEAL 1LEGA 4H26A 1T7XA 4KGLA 2G5BB 4J3WA 4AEHL 3QG6B 4JZJA 4U49A 1D3CA 1QBML 4MVBA 4YR6A 1KEGH 1FFPB 4JB9L 1KCKA 2Q7NA 1IKNA 3TBSB 3WSQL 1QRNE 4DGYL 2E7LA 1F4HA 3BWAA 4TOYH 4XRCB 2HFGL 3RY6A 4OFVA 4WHTB 1T89C 3VXMA 5IB4B 3LCYA 4LGSB 1NMCC 1ZVSB 1IGTB 3LS4L 5F7EL 2A6KA 1FAIH 1EVUA 1PYWB 2YHGA 5IW6B 1RU9L 2NY3C 3KR3L 4NZJA 3O4OC 5JA8B 4XCYB 4JFQB 5B8CA 3DETD 3FMGH 3NTCL 4YDIL 2GAZA 1VEOA 5GZND 1T0PB 3S5LG 4WEUD 4Z78B 4Q6IC 3DTXA 4DAGH 2BSED 3T2OA 4Y1AD 4LCYB 4JPKH 4H1LA 3WLBB 1CBVH 4KY1L 3TCLA 1EO7A 5TE6H 4KDTC 3S37X 5DD6B 4FFEX 4TUKL 1AQDB 1RZ7L 4YAQB 3WJLA 4WV1B 1SQ2N 1PKQE 1WBXB 4OFYD 1ZS8A 1VDGA 5CUSL 1Q9LB 4X6FB 5BXFA 4AH2A 3C5JA 5DD3H 1C5DB 5ITFB 4OFKA 4TPRH 3RZWA 4KQ3H 4NZUL 3RU8H 5BZDA 4MJID 4OF3A 4ZUTB 4KK6D 3TBWB 4P5TD 1QFWI 2ED9A 3CU7A 2NY2B 5DD1L 4OCXH 4N9GB 4ISVA 5FF6A 4LSRH 4P59L 5TDPB 2W1NA 3GMRA 3T3ME 2AV1B 1AE6L 2C3HA 1J0JA 2IMNA 3AY4C 3RVWD 4BQ8A 1EAPB 2VUYA 4M1GL 5ICXA 5EUOA 2ZNWA 3QBTB 1X4YA 5C0CB 4FZEH 5F89B 1YEGH 1I1AA 3QXWA 3DRTB 1H3UA 4OI9A 3S5LB 1A4KB 3WUWG 4HJ0C 2BSTB 4X6EB 5D1XD 4RMUA 1I9IL 3D3VB 3ARGC 3H9SD 4ONFL 1QR1A 4ZOAA 4L3ED 4HHAB 1DN0A 3MLYL 1CGTA 4NO3A 2EDHA 3HE7B 5FK9B 3PJSB 5JW5B 4PBWD 4LP5A 4P2QA 3OAYK 3QQ3A 2IBZX 1J8KA 3ZKMD 4G7VL 1IEBA 4GO6B 3G08B 4Q6IA 2H1PH 2VB5A 3P0YH 4GAJL 2J8UB 1PSKL 5ICZB 1JYWA 3MJ8A 2G5RA 1L0QA 4MVBD 5KG9A 1KN2H 4L4VE 5HDLA 5HI3C 5ISZB 2VISA 3SDAC 5E9DE 4C59B 1WICA 1N64L 5C0DB 1W0WA 4PTTA 2A83A 4M5YL 1BWMA 5F7DB 3QFJB 4R26L 5MI0B 2YD4A 3PGCB 4OZ4B 1D6VL 3REWB 2V2WA 2D7PA 3BN3B 3P4OB 4R96A 2VDKH 1UH4A 3WLWC 3OJMB 3WUWB 4GMSH 1MEXH 2G60H 2BSSA 5C08E 2A77L 1HI6A 3QXAB 3S35L 2EKJA 3BUYA 3ME0A 1RZKC 5EO0B 4M1DH 3K1DA 4Z7VF 2IANB 4R0LB 4ORGB 1U8OB 4F33B 3HNSH 4JFFB 3UJIL 4X0KA 3BIAX 3AY4A 3FT3B 2JIXA 5FHBH 4IBLT 2JJSA 3S96B 2I60H 2BDNH 4QRUB 2XNAA 2FO4A 1BGXH 1DVFC 1AQKH 1NFIA 3MCLH 1MCLA 3KNBB 2ARJB 1F5WA 1T7YA 4JM2B 3RUGF 1F4WH 5JHLL 2A0LD 5EN2B 2ADGA 1NKRA 1OTSC 3U7YL 4FABL 5KSVB 4PJ7F 3ARGA 1Q9KA 3GI9H 4KUZL 4I3GA 5GGVL 3DUSA 3BP6B 4GQPH 4XMLL 5F96L 3D0LA 1CQYA 5C07B 4LBEA 2CGRL 4UTBH 4O2EB 4YHIB 4EXKA 1FJ1A 4U1GC 5CBEB 3MLSH 4R2GD 2APFA 2KQNA 3DVIA 3I6KB 4N8PA 1T6WA 2OL3L 4U1NA 2Z92B 4WUKH 3D1MC 3MNVA 4XNUH 1IM9B 2Q76B 2JK5A 1TTGA 3GJFB 3T8XA 2HVKA 4PR5A 3MMEA 3C5ZC 4M6OH 4PJDF 1YEJH 5C0AE 4OD3L 4JY4B 4GAGH 4FQ2L 4Y4HB 1I1AD 4HKBB 3TM6A 3PXJA 2ZUYA 2FWOB 4HBQA 1OARL 3TJEL 2GTWB 3KYKL 4NN5B 5HYSG 3RPIA 3B3IA 4X5WA 5KSAC 1PFCA 4I8DA 5EORH 2F9BT 2XY2A 3D5OF 3QRGH 5E6IC 2I07A 1CICA 4HPOL 4P46C 2A74B 2GJJA 1LGVA 2HP4A 3U2SB 3VGAB 1FFQA 3O6FC 4OLYL 1GH7A 1RZJH 4FFZL 4WFFE 4JEGB 5HHOA 2NY3D 3WHE1 3U83A 1GIGL 2W9DL 3ZKXC 2AEPH 3RKDC 3QEGL 1JJUA 3EJYC 1YEKH 4DEPC 2XQYG 5FYJE 4GW1B 4BFGA 5IHZA 1VADB 1G6VK 4P2QD 2X70B 4HKJA 4KVNH 2SEBA 4ZYKB 1JHTA 5JUEL 3GBNH 3KPLB 2K7PA 2PF6A 3HTLX 4RMWA 3WEXA 5CJQL 3HZMB 2VLRB 3PWLA 3EDEA 2ZUQC 1DVFA 5FYLL 1I85A 5HD8C 3VJ6B 1CGSH 2YOCA 5GS1C 2XTJB 5A2FA 3DURA 4NUJA 1PAMA 3RWFB 5DS8B 1KBGH 3FB6A 4W6XB 4CVXB 4JHAH 2NXYB 2J2ZA 1A4JB 3QULB 5DJZA 3QEQA 5IF0A 4IIQC 3ULSA 4YDJA 3X3FH 4YH6A 4U0RB 1YPZA 1JNNL 3MOAH 1JGDB 3HZYB 1I7ZB 3AFLA 1TPXB 3GHBL 4IJ3C 5HYSB 4UBDD 3DV4A 3OKKB 2YSSA 4ODTL 5D5MA 4D0DB 1I9JL 3QZWA 1KCRL 4UIMB 1N0XL 5KJRH 1Z9OA 2X2YA 4FQXC 1QSFB 2VZUA 3AVEA 5T1KA 2P8MB 1NKOA 4V3EB 3NCYP 1YNKH 4XXDA 2AQ3A 3DARA 5FA3A 3R8QA 4KKBD 3VXPA 3JSSA 2JIXD 3U0WH 4L8CA 5E8NA 1U58A 2XZAH 3DVFA 1OT2A 3D48R 5E8DL 3CC5B 1TMCB 4XC3H 3L5WB 4TOYL 3T4YA 1ITCA 3DIFB 2YC1B 4O2CB 4I0PA 2DL2A 1Y6KR 1AHWC 2XKSA 5GRUL 5KSAA 1SY6A 1AD9A 1OWWA 3I3EA 3ARGD 4NDMA 2CRMA 5E6IA 4NKIL 1RQ5A 3IDGA 3LRHA 3ULUC 1UB5B 4JM4H 1AD0B 1CGWA 1FN4A 2FSEB 3O6FA 4DZBB 4U6TA 4JDZB 5L2JB 2YPVH 3V6OE 4QGYA 4PJGF 3BD5A 2M2DA 4PJBF 4ORZC 1QYGH 3MGAA 5DMKB 5JHDA 4PP2B 2V7HB 3P11L 3S34H 1T83A 3HPJA 3OXRA 3SGJC 2BRRL 1WC7B 2H45A 2VQUA 4ZNCD 1EO8H 1AFVH 4JPKL 2VUOA 5IROA 5TE6L 1FGVL 1FL3A 5ACZB 1WIUA 3OL2A 1EPFA 1P4BH 4JPVL 1EJ6A 4QRQB 5FYJU 5EH1A 4Y88A 3B4NA 3EYUH 4QRTA 5GS1A 3NCJH 3WO4C 4PRPB 4AIOA 3EBAA 3EO9H 1BFOA 4YIQA 5EPMA 1BJ8A 5IP4A 3SDAD 2VXQH 5TJWK 4NYLB 5GRJH 3BPOB 1T22B 3MPCA 1OGTA 1OGAE 4FQCH 4TPRL 2AJZB 2HFEB 4MJ5B 1NAMH 1VSCA 5IW1A 5I1GH 3T3PE 5JPNA 4WJ5A 3K7UA 3TPUA 5LWYH 4YO0B 2CIIB 4NUGH 3ESVF 3WLWD 3L3GA 4Q2ZB 4IRSC 4OCXL 4EKXA 5HHOD 5EUKA 5DEGA 5FV1L 1YJDC 4RDQF 2OSLB 1ZA6A 1DQQA 3O6LH 1H5BC 1S9YB 3RWIB 3BYYA 3WFEH 4NSKB 5GJTL 1MCIA 5DC9B 1CS6A 1CLCA 1YEGL 1EIBA 3ULVC 1JIBA 4XVJH 3HUJE 2AXFB 3RIFK 1DVFD 2APBA 1R5VA 3BPNB 3UTTB 2ZUVA 3FFDA 5K9OB 2BZDA 3OKEA 5C9JB 4NJ9L 1AHWA 1K4DA 2NY7H 2YD7A 1NBZA 1GGCH 1OTSD 1EZVY 4PY8J 4XH2B 1S5IL 4OLZH 4WEBL 1N59B 4YHKH 3LEYH 2CK0H 3UX9B 4XBPB 3N06B 2YRZA 3QEQD 4LVOB 1KJ2H 3QQNA 1ETZB 3U7WH 1LO4H 5IQ9A 1A1MB 1P4LB 3WIHH 1PZUB 1BVKB 3EDDA 2NW3A 4ZUVB 4P4RA 3GKWH 3M45A 1BFSA 1R3LA 1DBML 2GJ6B 2VDOH 3VRLF 3K1KC 3VXUB 4HMEA 5DQ9B 1P53A 2BVYA 3HAEH 3NN8A 2PO6A 5ETUA 5T1KD 3I84A 5C92A 4Y2DC 4AIXA 1H3GA 4U1MB 3P77A 3ARWA 1KN2L 1HSAB 3MBEB 4WI8A 5GJSL 3Q3GB 3UTPE 3IJHB 5E4EC 1E0OB 1ZLVH 2XWBA 3QDJA 3BMWA 4PP1C 5T3XH 2EDXA 2V2TB 2JELL 3QQ4B 3OMZA 4F8QA 5SX4H 1VACA 1XGRB 1CDYA 5EOCH 2VDKL 3I85A 3BKCL 5KSAD 3U4AA 1TQCB 4MCZB 1MEXL 5HY9A 2G60L 5E6ID 2VAAA 1GC1C 4OZGB 2QSCH 3N0PB 2D7TH 5MENE 1FVCA 2HG5B 5MEOA 4YHPA 1E4KC 3TWCH 5EU7C 4P5MA 1CWVA 3O6FD 3BRGC 4M1DL 4PJCB 5K9QI 3SKOB 3L7FA 4WWKC 4JO4L 2B4CH 3LS5L 4LSQL 4AZ8A 3RKDD 4UT9H 2DWEB 3EJYD 5JHDD 5H2BB 2PW2B 5L2KB 4LVHC 4HXBH 1OLZA 4QTHA 1HHHA 1MCJA 4BKLB 3KVQA 1BGXL 1AQKL 4LSUH 3MCLL 4C56E 1XR9B 2BVPB 3TIEB 4PJ9B 4CVZB 4UT7H 1F4WL 3TNMA 3DXAD 3ZYIA 1T2XA 3VGDA 2BVUA 5BJTB 2O5ZH 4OTXL 1WITA 3SDDC 4Z5RA 3K4ZA 4BH8A 5CEXA 4HUXA 5DEFB 5BV7H 4JO2L 5AZEH 3MV7E 3LKRB 4UTBL 5D7IB 2OI9B 1CYGA 4H20H 4RZCA 4BQ6A 4KI5D 3MLSL 4DK6A 4BFIB 2FBJH 4L8DA 3R1GL 3IDUA 4GAYB 1JL8A 1S9XB 5D2NB 4GBXC 1A3QA 1KYOJ 5TFSH 1EEYB 3QHZH 1U2CA 5I8KL 1MY7A 2E7BA 4M61B 5F9AC 1KV3A 4KVCH 1HKLH 4F80A 5SWSB 5ID0B 2GEEA 5IVXB 1P7KB 1BZ9B 4XNUL 5FKPA 1B90A 2B8OT 4R8WL 5HGBB 4ZFZB 3O2VH 2P4AB 2V5MA 1YEJL 4WDIB 5KVDL 3MYZA 5DC4B 4GAGL 2IF7A 3V5DA 2LU4A 4F7CA 4ONHB 3BXNB 5CINH 1D5BB 4RNRB 2VQ1A 3Q6FB 3BI9X 2Y5TA 3L5IA 2A6IB 3MC0A 1VFBA 5EORL 3QRGL 4H88L 2B0SH 4PS4H 4HMCA 5B39B 1G7JB 1QQDA 1FG9C 4HUMB 4N9OB 2BVOB 1D9KB 1QRNA 3N1PC 1T7WA 4E0RB 3C09C 3BGAA 3FONB 3ULUD 5F9OL 4K3EH 1E4KA 3BEVB 2C3GA 1LQVA 5DHXB 3EYOB 2PN5A 3PL6C 4K8RC 3MA9H 2P5EE 3QEUA 1D5MB 4MD0B 1AJ7L 5FDYA 2UUDH 1MCBA 1PVHA 3O2WH 1I7RA 1NCDL 2FIRT 3NAAL 4RA0C 4TQEL 3ZO0A 5TPWL 4PRHE 5EZJA 3SE8H 1KNOB 1TITA 1W72A 1F3JA 1EFXA 3GZKA 1NFDE 1MVUB 3OKDB 3QHFL 2XZQL 1L4IA 2VDPH 3GRWL 2VQTA 3V7MA 3RP1A 4A2LA 3GSUA 1UYWH 3QDJD 4N5EA 4EI6B 3CSPA 5F6IC 3IDIB 1WZLA 3OR6B 3SDDA 1MLCA 5I2IB 5E8PB 5H35B 4BSWB 3FQXB 2V6HA 3X3FL 1QO3A 3KYAA 5IB3A 3T2NH 1F90H 5L0QC 4J7RA 5LXGL 4FQHB 4Z7QF 1PKQA 3WIIH 4GBXA 1U8NA 3ERYA 5DURB 5CBAB 3VRIA 1QEWB 3CSGA 4F7PA 5BVPL 5CEZH 3O3DB 1G7MB 3ECBB 1QPPA 1T21A 5ANMB 2NY1C 3OKLB 3UTZB 3QCVH 1SHMA 1BIIA 3TPKA 1BQLH 3G5ZB 1RZ8B 3VCLA 3PHQA 3LRSB 4ZFOL 2PKDA 4TUOA 3UZVB 1EXUA 4PLJC 5SX5H 5FKAA 3DMMC 3IFLH 3O6MH 3ULVD 3MUGA 2XG4A 5D1QB 3A0OA 3GSWB 3EFFB 2DIJA 3ZDZF 4BM7A 4N0FB 4HIXH 5I9QB 3KLDA 1FO0A 4FFWC 3X12B 4JM4L 4LPWA 1A6ZB 1BLNA 4G6FD 5SV3A 3WDJA 5IESL 3FTGA 4UQ2B 1MREH 2YPVL 3BPCB 3RWGB 3LQZB 1P6AB 1WFOA 1XT5A 2MKWA 5EOTB 3RIFF 3VXOA 1U92B 5B4MD 1QYGL 2DQFA 1XGPB 1NJ9B 4OGZA 5GHWL 1MCEA 1DLFH 3V5HB 4DUWA 1AFVL 3DYOA 4R90H 3GSOA 4YFEA 1NANI 2OJEB 3VFGH 2OTPA 5F3HA 3SE4C 2UWEB 2XWTA 4YHNA 4IHOB 4HIEB 1JWMA 1TJIL 1P4BL 3PDOA 4ODXA 2VLLB 1XGUB 4GW5A 3GSVB 4BZ1H 2DS4A 4U7MA 5CWSB 1Y18A 3NCJL 4HX1B 1DUYA 4L9LB 5BCAA 5CJ8A 3CZFA 3V0WL 5LGHL 2VXQL 2VXVH 5GRJL 7FABH 5FM8A 4FQCL 4PG2A 2Z31C 4PP1D 1RZFH 1BBDH 4L4VA 5I1GL 5C0EB 5I8CB 5INDB 1LWRA 4NUGL 3FT2A 2YEZB 3L3KB 1QRND 5LCVH 4HS6A 1ROWA 1SJVA 5K9QG 3QUML 4G6KL 2BCKB 3O6LL 4B7IA 1NBVL 4HDIB 1JHLH 5I1LA 5K9KB 5HHNA 5DQJA 3BSZL 3VFTA 3PABB 1GZPA 5C08A 2B7DT 5AYUH 3MACH 4Y5VB 4E9LA 2G75B 4KKCD 3LV3B 1KIRA 4ZTPH 3DGCR 2VXTH 3QIBB 3DMMA 4MJ6B 4R4FH 1EFXD 2R2BA 3SCMB 4PGCA 4MWFB 3MODL 4RIRB 3LKNB 1KC5H 1NCAH 1E4XH 1EA9C 1YEHH 4OBRA 3RVUC 1A6TB 2NY7L 4EDXB 1II4E 1GGCL 1QVOA 1SMAA 4N5ED 3BESR 1G9NC 3MRKA 4YHKL 1LHZA 4G3YH 2CK0L 3SDDD 5DJXB 2IJ0C 3VWKA 3CVHL 3MRRB 4PJHE 4QT5B 3LRGA 3ZKNC 1LO4L 2VN4A 1ZWIB 3S35X 3WIHL 5IVNA 4RAUA 4GBXD 1DEEA 2VIRA 4RA3A 1S7WB 2DDQL 3NCMA 1QOKA 1T20B 3R06B 4QRRB 3VI4F 2VDOL 2ZG2A 1YUHA 3WS3B 3JV5A 4R3SB 3F8UB 5CLWA 1BAFH 1GVIA 2LTQB 3VFWA 3SE4A 2PYEB 4WFGE 2FJGB 4YC2B 3PV6B 4JFOB 4NRYB 3BKYH 1DL7H 2OXHA 4HUUB 2GHWB 4AT6A 43C9A 1CFVH 2DQHL 3ESUF 4XPFH 3F7RA 3I3BA 4I3SH 4NJAL 2R1XB 3PNWA 3BP7A 3MBXL 5T3XL 4UIKH 2YBRA 4OAWA 4JQXC 5JNYB 5C0AA 2HTKC 3CH1A 3QI9B 3HMWL 2Z31A 4NO2B 4UUJB 2F8XC 4G8GE 2YD1A 4Q9BA 1C5BH 2R1WA 3KPSB 3RTQB 2NX5B 5IEKA 1TENA 3GI8H 4NOFA 3TWCL 5DTFB 4X9BA 1ZSDB 4NWUH 1ODAA 4KTEH 5ADOH 2B4CL 1BVZA 3BZEB 3VRJA 4K8RD 4UT9L 1FH5H 4KXZI 3HS0B 4NN7B 3C60A 1S8DB 4NZRL 4ZDHA 3QIWB 4LSUL 4MCYA 4UV7L 1GJIA 1MFBH 4NQCB 3V6OC 5KTEL 1VA9A 3MRGB 4MB4A 4TSAH 3JWOH 4R4NC 4ODHL 2EH8H 2V5RA 1LP9E 1BP3B 2CDEA 1ZHBB 2O5ZL 3SO3B 1EUTA 4OLUL 1P5VA 1FVEA 4PJ5B 2J8OA 5AZEL 5ALBH 1AGDB 2H8PB 4WHCA 4KV5E 4NQDB 1QA9A 3MA7A 3RGVB 4QF1B 2FBJL 1DBJH 1YNLL 1RIUH 4L4VD 4NHCL 3MXWH 1FV1B 5AYQA 2HYMA 2F53B 5E9DD 5IG7A 1HKLL 2QJDA 4U3CA 3A6CH 1JNLL 2GI7A 1K8IA 4YNYA 5DJ2A 1JV5B 4OLXH 3O2VL 1HQRA 5HGAB 2F54B 4UOW1 3ROLB 5F7UA 1ED3B 3I6LE 3ZDXE 5BS0E 4HWUA 2NY1D 2WV3A 2JCCF 2R29H 3KAAA 2OP4H 5FUZH 1Z0NA 3FRUB 3IJSB 5CHNB 3CMOH 2X1XR 2ERJC 5D7LE 2OLDA 4PLJD 2CO7B 2BOCA 5IMOB 3DMMD 4Z7VB 3DX9B 1IAOA 2VDQH 5JDSA 2VXUH 4RMRA 3V0AC 2MHAA 3OKOA 4JQXA 1IC7H 4JRYE 2C4FU 3HC0B 2B0SL 1OAZH 1ZA3A 4EN3B 2GCYA 5C0NC 1I3RA 3KLAA 1DQJB 3RA7H 2CK2A 1WBZB 1J10A 3GFUA 3VFNA 2HT4D 3OWEA 3UROR 4YHZH 3MA9L 3TH3T 3RUGB 5DDHA 5DQDL 4JG0H 3ZZ1A 3KPRB 3O2WL 3WXVH 4UU9B 1DBKH 4PJ7B 1MOEA 2NW2A 5L6YH 3GM0A 4ELMF 5FCSH 4JY5L 1MCFA 4Z76A 4PY7B 1AGEB 2YA2A 4PJ8C 1YNTA 5CP7B 4PDCE 3ARDA 4RWYH 2DQGH 3V6OA 3UDWA 1XCTA 2V2XB 2I25N 2D31A 1KLGA 4ERSH 4WCYH 4KJYA 1UYWL 2HFFA 1Q72L 3NACL 5ALCL 4J3VA 1YN7B 3HMXA 4KKAC 4KZDL 3VW3L 3VFVB 2DLGA 4HC1H 3PHOA 4Y5XC 3T2NL 5C0AD 1F90L 2Z31D 2N1KA 1KB9J 2C1OA 4PJDB 4Z7WE 1RJLB 3WIIL 4LNRA 4DKDC 1QNZH 2ZOLB 3PWJB 1KJVA 2K1MA 2DI9A 5FO8A 2VTFA 4IM8A 3IKCA 4Z18A 1OTTC 5CEYB 3WKMH 1CXIA 2DQIH 1OGAA 1OW0C 5C7XH 1RVFL 3SOBH 2EO1A 1KB5B 1JP5A 1V3MA 3HG1E 3QCVL 4HUNB 4JFYB 5CAYB 2G2RB 2YUZA 2W91A 3GJFH 3AAZA 1WEJH 4FQQB 1FP5A 1M6OB 4WFFD 4JE4B 1TCMA 3M1BA 2FATH 3O6ML 2RR3A 2QKIB 1HWGB 5HHPB 1RUAL 3F5WA 4P48A 2ZCKH 5HVGB 5FYJD 3H7BB 4P2RE 2A6JB 3TYGH 2O93L 3EDKA 2OR9L 1UEMA 5EBLA 3FO1B 2ATPB 5IIEA 1BD2B 3HUJA 4J8RA 4XCEB 3MJGX 4UI2A 2ARJQ 3UO1H 5CFHA 2X4PA 3WO3B 1G7HB 2AI0L 4RGOH 3GB7A 4PJFE 4BH7B 1CIDA 2NY5C 3MV8B 4K7FB 2I9TB 1AY1L 2M8XA 4DCQA 3MFFB 4WU5A 3SJVE 1KYOK 1ZTXH 3TP4A 3UTSB 1CL7H 3DRQA 4R90L 3GMLB 2DKSA 5IOPA 3GSQA 1L7IL 1IKFH 5DYOA 1DUZB 2YKLH 4ODUB 4J4PC 4FG6C 1P7QA 3TN0B 2V5YA 4RRPG 1HXMB 5D7SH 3VWJC 5DJDA 1UM6H 3G5XB 3ZE1E 2VXVL 1ZANH 1EMTH 3JTTB 4WFEE 2OM5A 4NQXA 2VAJA 3BH9B 4ZNEE 5FAAA 4LLYA 1NGXB 2APVA 2HTKD 5E2TH 4OUUB 5HVFB 4JRXE 1CGUA 2YA0A 5LCVL 1AGBA 1CDBA 1UM5H 3BKMH 5I66A 1KPVA 2YZ1A 1IAKA 3VMPA 3X14B 5A2JH 1KG0B 2RBLA 4RMSA 3T65B 1JHLL 3UMTA 5BQ7A 2E9BA 1XGTB 1JGEA 1WZKA 2BP3A 4G6AC 5AYUL 3MACL 3BZ4A 4RDQG 4U1KB 5MENA 5GSRA 1MQKL 5GGTH 3B9AA 4L9DA 5C0GB 2WP3O 1TIUA 3OAUL 4R4FL 5FO7A 4WY7H 5IM7B 2CLZB 3A6BL 3A67L 4CW1B 1KC5L 1E4XL 4R4ND 5DHVA 4PJGB 2MPAL 4PJBB 3VMNA 1ADQL 1IC4H 1Z9SA 4C56A 1A1OB 1DDHB 2WIIB 4G3YL 5SWQA 4XB8A 3VFMB 2AXGB 3T08A 3ZT6A 1MIMH 4JZNB 1I1YA 1FRGH 4L4TB 1AKJA 3VFOA 5C0IB 3CSYA 3MV7A 3KPMB 4BZ2H 2HAZA 2XZCH 1NL0H 1TDQA 1I8IB 1JZ2A 4G9FE 1OGAD 3AREC 5J1SC 1BAFL 4S10A 1KACB 5D6DC 3RVTC 2X05A 5ICYA 1L7TH 1KN4H 2C7UB 4ZO8A 1QFWH 2OMNA 2P24B 2X9XA 3LQAH 5LG1A 2GK0A 5TE4H 3W9DB 5LGJB 3BKYL 1DL7L 5HGDA 1FZJB 2X4SB 4JHBA 3TO4A 4PRDA 4Y2OA 5CSZB 4F9PA 2ED8A 5EFIA 2XZZA 3TT3H 1NUNB 5KW9H 1DQLL 4ZSOA 1DFBH 1RUPH 4PREB 4NZTL 4HIJA 2JJTC 3FQNA 1ZT4B 2WUBL 5B3JF 4DOHE 1YQVL 1BJ1J 1C5BL 1DANU 4HBCL 4YBHA 3OBAA 1UWEL 5C0ND 3EJJX 1FZKA 3BVNB 4CDHA 5DJ6B 4G42A 4KTEL 2LV4A 5ADOL 3STLA 1FH5L 4QXUH 2DMKA 2P7TA 3JUYA 2J6EA 3CX5J 3BRDA 4DGIH 5DO2C 1MFBL 3IVKB 3DI3B 3TT1H 5JZ7C 2NY4D 4PJ8D 5EIIB 2P5EA 3BGMA 4OF6A 4U1JB 3UYRL 4OZHF 1P7QD 2DQEL 1MUJA 4U3HA 2YR3A 4PRHA 4U6HA 1YYLL 1MWAA 4DGVH 1UWXK 5KAQF 1A6WL 1ORQA 1NFDA 2HT3C 2AJVL 3HZKB 1IGJB 3AC0A 5H94B 2FX9H 3RWHA 5J11B 1F11B 3UTPD 1CXEA 3MCG1 2W60B 3VG0L 3A6CL 1INQB 4M6AA 5FUOH 4OLXL 2C3VB 3VFRA 4HEME 2W0LA 3AREA 2VDNL 2HKHH 3ZDYF 4Q0XH 2R29L 2OP4L 5IEHA 1F97A 1JVKA 3CCHA 4HV8B 1IAIH 4ZPTB 1G9EA 5MEND 1KCUL 1HINL 3IDMB 4O58H 5HDBF 3CMOL 1UCBL 2OTUB 4CMHB 3ULUF 4OCWL 3QO0A 4Z7OE 1RSFA 5J7CC 5HPMA 2HKFL 2VDQL 5D71H 4S1RL 1YN6A 2JJTA 4G5ZL 4KHXH 2BNQE 4XTRD 2LABA 3VDCA 1XAUA 5DA4A 4LKCA 4YZFF 3BE1L 1CFBA 1U8HB 2OMBA 3RA7L 4C56D 1T3FA 1AO7B 3D2UB 1JNHB 1VGEH 4QY8A 4N0UE 5D6CA 3TIDB 1U8QA 3V0VB 4YHZL 3MLXH 5EWIH 4ZUWB 1LD9B 2VL5B 1W2KT 1E28B 4JG0L 2P5WB 1AKJD 3LDBB 2I26N 2OBGA 1DBKL 5L6YL 5F7KC 3MV7D 2GTZA 3K81A 4JN1H 5L88H 4X7TB 5F71A 3CPLA 3QUYC 1QACA 4RWYL 2DQGL 5JO5A 1BPVA 4IMLB 5FUCE 2W0FA 4ZS6C 3CFEB 4PD4J 4ERSL 3C2SA 3HNVH 2NY0C 1A6VL 4FG6D 1INDH 1KXQE 4HIHB 1TCRA 1CDCA 3TO4D 3VWJD 3QFDA 4DZ8B 3W82A 1CLYH 4IMKA 3QHTC 1XF5B 3K8KA 1U95A 1LEKB 4HC1L 4I5BA 4U6VH 4YHLH 1F3DJ 3FB8B 3QXUA 1MRFH 4PGEA 5FECA 1Q9OA 1JZ6A 3ZTJG 3QUXA 4MXWL 5D8JL 4WW2C 1NBQA 5CEZE 3V8CA 3U9UA 2EC8A 1JI2A 3ZE0E 1ES0A 1QHOA 5D1ZC 3F58H 1XIWB 2Y36H 1JPFB 1KTLB 2DQIL 4M9PA 1FL5B 2IH1B 3FT4A 5DJCA 5C7XL 3ULVF 3EO1A 3SOBL 2DMCA 4C55A 3FN9A 2B2XL 2CIKA 3WJJC 5DRWB 1OWRM 1A6AA 1LNUB 3UP1A 4F15C 1WEJL 4OV5A 4F37K 4P23A 1OAYH 1RHFA 4FQJH 1XGQB 1EUUA 1U8MA 5MERA 1EDQA 2P5ED 2J5LC 4LLDA 2EEDA 5C0JA 4FTVE 3MRFB 3TYGL 1NMAL 2UY7A 1CU4H 3DWTA 4X8JB 4JQVA 3BIKB 4PRHD 3RIAK 3QQ9D 3R0NA 4APQB 2IQAB 3UO1L 4O4YH 5GSVB 1XCQB 3O11B 1AXSA 4Y8DC 3VFPB 3AMKA 4X6BA 4FXGA 4TSBH 1E6OH 4DQOH 1FNSH 5JOPE 5CD3A 3BGFB 2F74A 1JFQH 4NHUB 3MRPB 1NCBH 4NBZB 2VLJE 5DMGC 1KF9B 5KVFL 4PJHA 5E8EA 2DJUA 2YKLL 4OCRH 3ARED 3QUYA 1XZ0A 4LHQB 1J8HE 3RVTD 5LQBH 4YGVA 2MQCA 2L7UA 2KBGA 3KPNB 4GRLB 5F8RC 2LQRA 3EOBA 3KS0H 3T77B 3D85A 2W9EL 1ZANL 2BFVH 1EMTL 2FJFA 1FFOB 4ETQB 3KJ4B 3VE0A 5C2UB 4QRSA 2BJMH 1FNGB 1OL0A 5F1NA 3VXNB 1TJHH 1FSKB 1QG3A 3C9NB 4WI7A 4ZD3L 3N85H 1RZJC 1FGNH 4FOMA 4G8GA 3ABZA 1TTFA 3RDTC 4LSSH 1SBSH 2FL5B 3QJFB 5GGTL 3W39A 5ILTH 4L8SB 1FCGA 4JJ5A 1URLA 1TFHA 2EYRA 4X4YB 3U30C 2ED7A 2DAVA 1E27B 5DO2D 1CLZH 5DR5L 3IDNB 3EFDH 4WY7L 3CK0H 5JZ7D 4LHJB 4LPXA 3GNML 4RGNB 5FO9B 2CJUL 3ZE2E 1FNFA 4WTZA 2FH8A 4AQOA 5E8OA 5DD0H 3FQRB 1I8KA 1J1OH 1SEBB 3MUJA 3QXVA 2I9LB 1O5DT 3BT2H 1MIML 1CLOH 4WIQA 1RJYA 1LP9A 2AW2A 3VXRB 4DFHA 3V7AE 1FRGL 2HT3D 2V7NA 1VHPA 4PYHA 2CKBH 4M48H 4P5TB 2AABH 5D7JB 1KB9K 2EXYC 2IH3B 2XZCL 3RHWK 5I76B 3GMOB 3T3MF 5CLTA 1UH2A 4BSVA 1F8TL 2BNUB 2WZPD 3I6GA 4PGDB 4DVBB 4AEIH 3LEXB 2AEQH 2Q87A 3FB7B 1L7TL 1QFWL 4UINH 4DKAA 1V7NH 3DX6A 5TH2A 5IMKB 4PBXA 1LE5A 4M7ZB 4B5EA 4PLKC 4I3RH 4P23D 3TT3L 2ID5A 5IV2A 1T0NA 2DBLL 1RUPL 1Q94B 4YDLB 5BS0A 5D1XB 4LPCA 3UZEA 2X5PA 2E27H 3LN4B 3GGWA 1FE8H 4NQSA 3H9SB 5DT1L 3PQYB 2V9RA 5ESAB 4TULL 6FABH 1N3NA 5KVGH 5KN5B 3ARYA 2FHCA 3MRNA 5D7LA 3FO9A 1AIFA 4E41B 4L3EB 3CH8A 3DX8A 4Y16C 2A2QT 3RWJB 5I73B 2ADJA 2MTPA 4R7NA 1JPST 4PBVC 5JTWA 5E2UH 4ZOCA 4JRYA 1NGWB 2A73B 4JR9H 1F6AB 5DMJB 2AEIT 1R3HA 3PWVA 2EKSB 2J88L 2VLME 1PLGH 1NCCH 4DGIL 1B0GB 1UVQA 1WSST 5C2BH 1HCVA 2YPKA 4GG6E 5E1AA 3O0RH 1LILA 3BAEH 2OZ4L 4LK4A 5FCUL 4MX7B 4FXKA 3QUYD 1BMGA 1GGBL 1LEGB 3D3VE 3DROA 4H26B 4CJ1A 2UVEA 3CFKB 4JZJB 3GUTA 3GBMH 2D0GA 4YR6B 4PJIF 4GXVL 4MA7L 1K9TA 1UM4L 2WNGA 2AV7A 3EOTH 1P5UA 2NY0D 2HRPH 3D85D 4DGVL 2WINA 4AM0A 3RNKA 3CLEH 4JY6A 1KPUB 3GSRA 4WFGD 3D39E 2FX9L 3IFPA 4Q7DA 5H37G 2A6KB 3WN5C 2X4QA 4NBXB 5I1KL 5FUOL 1Z5LA 4MJ2A 4MQ7A 3BN9C 5HPOA 2J8UE 4OGXH 1RUKH 3GSNL 2HKHL 5AG9A 4Z7WA 4G8GD 4Q0XL 1N7MH 2ITCB 4RBPH 4QWWC 5IB5A 2O61B 1WZ1L 3SKJL 3VXTA 3O4LE 3RNQA 15C8L 2B5IB 1XMWA 3HG1A 4ZFOA 1A3LL 2AGJL 2Q20A 1E6JH 5FB8B 1IC5H 4KRMB 5JOFA 2DWDA 5ESVB 4FZ8L 2B1AH 2EIZB 1ZS8B 2NNAA 1S7SA 4X9HA 5BO1H 3C5JB 5CJBA 4F37F 1G6RL 5EWIL 2W92A 3MRIA 4MNGE 4JFFE 4P2RA 4R2GB 2HMIC 4NCC1 1X5AA 5CZXD 1TQBB 5DRZA 3LB6D 3WNLA 1X5YA 5MEPA 2DLEA 1X6NA 4LCCC 4JN1L 5L88L 4M93B 4U1SB 4QHNA 3SBWC 5KSBE 4Y8AA 5FF6B 3GMRB 4PJFA 1OSZA 5DMGD 3RIAF 4XBGA 1J5OH 2R8SL 1H8SA 2KKQA 3SJVA 1MCRA 4R6UA 4UV4L 4LHUA 1INDL 1UXWB 3FO2A 4ESKA 4OF5A 4PY8I 4AJ0A 4GLRH 1IQWH 4U6VL 1FLTX 2WBKA 3I6LD 3MRCA 4PRAA 5BS0D 1QRKA 3DVNA 1MFCL 1MRFL 1B4JL 3MRHB 5EU5A 1SEQL 3TBVA 2JCCB 2IALA 3INUH 2BC4A 1NMCB 3F58L 2Y36L 1NAMA 5D7LD 4ZO6A 3WN5A 2C1PA 2NY3B 5T5NF 1XR8A 3O4OB 3QO1A 4ZNEA 2AKRA 4OGYL 3MO1A 2WP3T 3RY4A 4JRYD 2DM2A 2X41A 1HHJB 3MXVL 4JRXA 2FX8H 3WIFA 1R5IA 2KQMA 2VR5A 3QA3A 3WS6C 3QQ3B 2HVJA 5A2LH 3RDTD 2DQDH 2WBJA 3MLPA 4YDKL 4FQJL 4Q6IB 3O3AB 3RL1A 4WTWA 3CX5K 3NA9H 2XFXB 3GIZH 4NQEE 2VJXA 4ZTOL 3MJ8B 3MV9B 3DV6A 2BRQA 1KFAL 1RK1B 1B3JA 3SY0A 5KG9B 3SQOH 2UVFA 2ICEA 3EYFA 4D8PA 2EYSB 4ELMB 2ICCA 3OKMA 1FORH 2A83B 4NFDA 4JQIL 1OF2A 4O4YL 5BV7C 3QPQC 4OQTH 3CFBB 2V2WB 4PTUB 1JWUA 4WI5A 3GIVB 1T66C 4HH9B 2EEBA 3DECA 2ICWA 3UPCA 2IFGA 1KJ2A 4GUPA 2Z91A 4N0RA 1HI6B 3GK8L 5T3ZH 5IB1A 5J4MA 5IMMB 2EXYD 3BUYB 4XNQA 4GRMA 4LEOA 1XH3B 4H8WL 3V4VH 5DZLA 2I5YL 4FQLL 3SBWA 3O45A 1JNJA 4F9LC 5J06A 1AGCB 4XPTL 5BOPA 1T6VN 5LQBL 4X0KB 5EZIL 2H3NB 2WK2A 4LSDA 3HAEA 4HUWB 2YRLA 4XPAH 3SKMA 1U8LA 1G0YR 4G9FA 4EI5A 2XNAB 3FCTA 4PLKD 3WNKA 4CJ0A 5GRVL 3NBNA 2BFVL 4G9DB 1L0XA 3RHWF 2DYPB 3HG1D 2BJML 4LL9A 4FQIL 3SGDH 3WNPA 3QCUH 2X4TA 3ARGB 1Q9KB 2IC2A 1KCGC 1PG7X 1RULL 1OD7A 4YE4H 5FOBB 3Q6GL 3HRZA 4LSPH 1H15A 1R5WA 4BQ9A 4Y4KC 4Y16D 5FYKH 1U8KB 3I2CL 4H0HB 4P2RD 4UT6L 1RJZA 3FRPG 4XHJC 1KT2A 4LSSL 1SBSL 2K3TA 1KB5H 3QJHA 1OHQA 4U1NB 5BOZG 2EECA 4G6MH 3MNVB 2AK1L 1CLZL 4HK0B 1IBGL 3UTQB 1IL1B 2JK5B 3NGBC 5DMIL 3CK0L 2HVKB 3MMEB 2EDFA 4H25A 1MRCH 4JLRA 3SJVD 4LHUD 3CUPA 5DD0L 1NANH 1J11A 1NCNA 1J1OL 3SDAB 3MR9A 3NABH 4JRWA 2WWKT 2IAMC 3KHOA 2MQ3A 1VFMA 5AD0A 5EOCJ 1NUDA 3B3IB 5EZLA 4HLZG 2BOBA 3K46A 3QZWG 2FO1A 4M48L 2AABL 2CH8A 2MJWA 1OB1B 2P8LB 1K5NB 2FX7L 4WFED 3MOQA 4X80H 2ENYA 3SKNB 1L9NA 3NIDE 2XACC 4HCRH 5F7YC 4UINL 1CDIA 4PP8C 1GCFA 4WRLA 4IOFC 4XP1L 4JRXD 4JDVB 5IHZB 1X9QA 2IPTL 3P0VH 2VXSL 4OCSH 5IQ7L 2WBJD 1EFQA 1FZMB 3WEXB 2H6PA 2CDGA 5SV4A 3LIZL 4P2OC 12E8L 1DVFB 4G7YL 3L9RB 2X44D 2ADIA 4Z7UF 3OQ3B 2FECI 1FYTE 6FABL 3DURB 3I75B 5KVGL 1DCLA 2ESVE 1LO5A 5E2WL 5EU3A 3MGTA 3LQMA 5M95B 5DJZB 3QEQB 3P30H 5E2UL 5HGHB 5IF0B 2J12B 4F2MA 4JR9L 1GGUA 2CD0A 5FA4A 4PG9B 4GQ9H 5KS9E 4U1GB 2Q8AL 1EGJL 2IGFL 2VZVA 3O6KL 4OB5L 2CR3A 4TRPL 1CT8B 1NCCL 1U93A 1N8ZB 1EJOL 3B9KA 3P4NB 4N0UA 2FB4H 2YSSB 3T4AA 2D03H 3O0RL 5FV2A 3BAEL 4X7EC 4G43A 3TVMC 1C12A 1B2WH 4LCIH 4A6YA 4N5UA 4EOWH 1GGTA 5T1KB 5A16A 3C2AH 1DSFH 5FA3B 1ZAGA 3VXPB 4L8CB 3C5ZB 1N26A 5E8NB 5AZ2H 1U58B 5HVWA 4G9FD 2HRPL 1D7FA 4LLWA 4EI5D 2XOTA 5CILL 4LEXL 3T4YB 1VCAA 1G7LA 1X5KA 4P57B 2XQYK 3RL2B 2IAMA 2ZUXA 3AM8A 4JPWL 3MGOB 1HHIA 1CXFA 3UCRA 2GW5A 4NM4L 5KSAB 4NKMA 1AD9B 4G8EB 4LRNH 1I7TA 5KAQG 3B9VA 3P3YA 4OD1H 5E6IB 1IAIM 3IDGB 4P46B 3CDGA 1BOGA 5T1LA 1J1PL 3Q2CA 4BSJA 1CG9B 4OGXL 1RUKL 3O6FB 1AXIB 4E42A 4GSDH 3OAYH 1N7ML 3ZKXB 4I77L 5JXEA 2D9QB 5JHDB 1EEZA 4KJQC 5EU4A 4DEPB 4YXHH 3OXRB 1MPAL 5DWUL 1RHHA 5GGSB 5F88A 5E1HB 1IRAY 5I19L 2Q6WA 5LVEA 1FL3B 3FAWA 4M6NH 4P2OA 2ZUQB 4LOUC 4KXZH 4LLUB 1E6JL 1IC5L 3DXAB 4CDGC 2NMSA 5GS1B 2B1AL 4OZGE 1A47A 3OXSA 3KYNA 5HHMD 5IFJA 1UWGH 1BFOB 4YIQB 5EPMB 2A9ML 2UZIH 3RWCB 5BO1L 4PJCE 1MI5E 1OGTB 1KELH 2ZSVA 2NXZC 4FTVA 2AS5M 4IIQB 2R9HD 4KROD 4OZHB 5JPNB 1PD6A 4WJ5B 3TPUB 1T66D 4DN3H 1F02I 3NFSH 4IDJH 3ZYOA 3PGFL 1SM3H 5DF0A 3OJ2C 3VD3A 4IJ3B 3QIUC 1PX4A 1ZA6B 1DQQB 5I71C 5HHVL 3TVMA 1JTTA 3GM8A 4FQXB 5I8OL 1IEHA 5DI8A 3C6SB 5I30L 1TJGL 1WCBB 3FO0H 3D0VA 4L29A 3KPOA 2VLJA 5D7IE 5GRWA 3S6CA 2HT2C 3GJEB 1NCTA 1IQWL 5DZNA 3TJHC 1R5VB 1CD1B 2ZOKA 3EO0A 2DM3A 4Z77A 3RZCC 4KK5C 1AHWB 1K4DB 5SWSE 3QXDA 2EE3A 5IVXE 2DQJH 2C26A 4A2MA 3K2UH 2H2SC 1TZHA 4YWGH 3QEHB 2VSDA 1BEYL 3IS1X 1A9EA 4HXAL 3VG9C 5TF0A 2BNQD 2C3WA 3QH3A 2GQHA 4Y4KD 5KVEH 3OJDA 1NAKL 2JB5H 3KDMA 4X6DB 1G9MH 1I75A 2NW3B 5IBUG 4XHJD 3B83A 4P5KB 3BP5A 1P9MA 3C8KA 3NA9L 3AROA 2G5BA 4KTYA 2P48B 1D6EB 3Q0HA 1YECH 4JN2A 4GMTL 3RVXC 1FFPA 3JWOC 1HKFA 3P77B 2KH2B 4LP4A 3TBSA 5T1DH 3SQOL 2PR4L 3F65A 4FRWA 2XWBB 3QDJB 1JN6A 4XRCA 5DFTA 1WQVT 4MZ2A 5AUMB 4WHTA 2X7LB 1OM3L 3LN5A 4U2YA 3IDJB 3ARFC 2IAMD 1ZVSA 1KCVH 3MLRH 5K9JH 1PYWA 5E5UB 5IW6A 5HHXL 1QD0A 5D96C 5SWZD 5HY9B 2WMPA 4XCYA 5T3ZL 1EZVX 4JFQA 1CFQA 4MD5B 1HEZB 3WFHA 1NDGA 4IRSB 2YPLD 2MOVA 2WWMC 4PRIE 3QWOA 3FFCE 4XI5D 1YEFH 4X4ZA 1H5BB 4Z78A 2DKMA 5JXED 5CEZD 3TBTA 4MMZC 1LK3H 3LD8C 4IOFD 2FBOJ 4JG1L 4QTHB 2HRLA 3JTSB 3WLBA 3SDYH 1MFAL 4YPJA 2RAMA 2M26A 5CJ5A 2VZ1A 5DD6A 5TDOA 1F4YH 1JGUH 1UKTA 2DQCL 4MNQB 5IBUB 4YAQA 1HOCB 1F4XL 3OZ9H 4WV1A 3L95A 4P2OD 3TNMB 3TJHA 5GGUA 3QCUL 2NZIA 4KDWA 4FQ1L 5GRYA 1Q9LA 2QSTA 3RZCA 3KG5A 3FQWA 4YE4L 4LAQH 1C5DA 5CEXB 4LSPL 1NGQH 4G6FB 2EDLA 4M7KH 3OX8B 4XP9H 4RZCB 1QFUL 5FYKL 5ACMA 4KJPC 5F70A 2DLFH 1T5WB 4FTVD 2C4FT 4MYWB 5JDJA 4X5XB 3H9HA 4NIKB 1KB5L 3HI5L 4PJXE 5EO9B 3EOYG 2AV1A 5J6GB 5E2VH 4HWBH 3Q48A 1MJJA 5FKPB 32C2A 2CPCA 3TVMD 2AVGA 4ZS7H 1Q0XH 1KJ3L 5C86A 1WCQA 4CAGA 4Y2DB 3V5DB 2I24N 1A4KA 3MLVL 3MJ9L 2VLJD 4QRPD 2BSTA 4X6EA 5E4EB 4LKXB 5IT2L 4JVUA 1HH9A 3D3VA 2H2PD 1V7MH 1J8HD 1FNAA 4NKQB 1T5XB 4RMQA 3P4LA 1R0AL 4CVUA 1MCKA 1QSZA 5D2LE 4AL8L 5GS0H 5I1HL 4WI3A 4HHAA 1P1ZB 3UYOD 2YUVA 3SKUD 5FK9A 3BKJH 1MJ8H 3PJSA 5JW5A 3D39A 4M9OA 5J3HC 1C7SA 1UZ8B 1N2RA 4JFEE 4WWKB 2X89A 1R24B 3IFNH 3P0VL 4S1DC 2CDFB 4D0CB 4KUCD 1DQDH 4TNVK 1ACYH 4OCSL 4KHTH 3B5HA 1WISA 5ABDE 2QQNL 4LVHB 2J8UA 2A1WH 2CUMA 4M8VA 1W72B 3SGEH 4YJZL 1A1NA 4RGMC 5DLML 4K9EC 1Z3GH 2XKNB 1H3VA 5ISZA 1AH1A 1M7IA 5L7XH 5C0DA 5DMYA 5I1DB 3O3UN 3O4LA 3LPFA 5GRVK 3PGCA 1WLHA 3SDDB 2R23A 1MLCB 2GFBB 3P4OA 2APTA 3P30L 2R2HB 1UKQA 3IXAA 5DJYB 3WUWA 1RMFL 3DI2B 3IGAA 1PKQB 3QXAA 1JPGB 2ZCLH 2NXZD 3BO8B 1K8DA 4GBXB 2G9HB 5EO0A 9CGTA 4WFHE 3VRIB 2IBBA 4F7PB 3IF1B 3C87A 1U8OA 2QHRL 1U8IB 4MNGA 3QIUD 4LCIL 4JFFA 4BK5A 1T21B 4EOWL 5BRZB 5EU6E 3QUMB 3FT3A 3C2AL 3RWEA 1DSFL 4O02H 5JIIA 1AC6A 4QRUA 1A5FH 1RFDH 3JWDC 2VABB 3VCLB 4KPHH 4WW2F 5KSBA 4X6CB 1EXUB 2X4UA 3M17A 5FKAB 2DM4A 1VPOL 3MUGB 1QBMH 5EN2A 2BSRB 3BD4A 3TESA 3QDAA 4JB9H 5KSVA 3TJHD 1HK6A 4HC1A 3A6OA 3BP6A 3PDGA 4DGYH 4OD1L 3RZCD 4KK5D 4QRRE 3K4AA 1FO0B 4YHIA 4HWNA 1EHLL 5A43C 4QO1A 5HI5D 1BLNB 4N0CC 2H2SD 1JCKA 2H32B 3C09B 5F7EH 5EB9A 5JQ6L 4GSDL 3VH8A 2PYEE 1RU9H 3CVHB 3KR3H 3VXOB 3PL6B 1L0YA 2NY2D 4PLNC 3X13B 1OOAA 5DC0A 3FN0L 3ZYZA 4WW1A 3GJFA 3L3IB 5F3HB 2XWTB 4FA8A 4M6NL 2N7BA 2JJUA 4YHNB 3MROA 4JY4A 1YDPB 2EICA 4Y5YC 3RY5A 4ODXB 1C08A 4J12A 4W6YB 2CR6A 3RVXD 3KPSE 4HKBA 2FIKB 2NX5E 1DUYB 4XWGH 2FWOA 4QHLB 1UWGL 3SDXE 1JFMA 4BELD 2GTWA 4CN1A 1NEUA 2BX5A 4NQEA 2WANA 4TUKH 5F6IB 3U46B 1RZ7H 3D3VD 2A74A 1ZVYA 3ARFD 5CUSH 3U2SA 1NQBA 4OCLC 3NFSL 5L0QB 3FT2B 1HIML 4K55A 5E9DB 3EZ8A 4PJIB 2OCFD 4YXLL 4ENEC 4NQCE 1AR2A 4DKFH 1GOHA 2VE6A 3ZDXF 1PY4A 3D39D 1N4XL 1VADA 5I1LB 2WWMD 5HHNB 2A6DB 5DD1H 4ZYKA 3BD3A 3KPLA 3B9EA 5I17A 4PJ5E 3FO0L 3LQAC 5EBMB 3HZMA 4LSTL 3DUUA 3BH8A 3VJ6A 2OX5A 2H26B 2V5TA 4HWEH 4M1GH 1WIPA 3DMMB 3JTCA 2B20A 2CLRA 4ZODA 5L8JB 2R2BB 3RWFA 5DS8A 4OCYL 1RZIA 3RAJH 4ODWA 1X5ZA 3IDXH 3EHBC 35C8L 3OKYA 3O4LD 1QVOB 2WQRA 2DQJL 1A4JA 4ELKB 4LFHD 3QULA 3K2UL 1I9IH 2QQQA 4NGHL 4YWGL 4H0IA 3HR6A 3BW9B 2F54E 1PBYA 4ONFH 4N0CA 1JGDA 3F7YA 1CVRA 3HPLB 2R0WL 2VDLH 5KVEL 4QYOA 1SYVB 1I7ZA 2DL9A 3V95A 3HE6C 4KJPD 3DETC 3QISA 4FNLH 5HYSA 3MNWB 5T5NG 3OKKA 1DANT 2VIRB 4D0DA 2B1HL 3MLYH 3OG4B 1XF3A 4YDVA 1YUHB 5C0BD 1KLUA 4Z7VE 3D25B 3LAFA 1E4JA 3QNZB 3VFWB 4G7VH 5EC2A 4Y5YA 5T1DL 3CC5A 2UYLB 3AGVA 4GAJH 3L5WA 2VR9A 3DIFA 1J9CT 4LNVA 1PSKH 5JMRA 4O2CA 4O9HH 2Q8BL 1MAKA 3MLWL 1WAAE 4LRIC 3VI3F 4OAWB 2X4OB 3RUGE 4GT7A 2FEEI 4CNIB 5T3ZE 1KCVL 4JREC 4NC1E 5IHBA 3LPWA 4KFZC 2BMKB 2Z31B 1BQUA 3LKPA 4M5YH 4PJ7E 1D5IL 5EOQL 3PXHA 2R1WB 4R26H 1AD0A 1D6VH 2FSEA 4DZBA 2EIDA 5CD5C 3HR5B 4LLQA 2KL6A 2PYFB 1WT5C 1T1WB 5DMKA 4GJTB 3VRJB 3JWDL 4KJWC 1I1CA 4FMKA 4S1DD 1V3LA 4PV8A 1S7VB 4ZDHB 1S9VB 2VZTA 4R4BB 4ZXBC 1F4YL 1N5AB 4UILL 3OZ9L 3JWNC 2CDEB 3DYMA 1HXYB 1UJ3C 4XPBL 3RJQB 1Q9WB 4M7LT 1FVEB 2MNUA 5FYKE 1PEWA 5IW3A 4OCMC 5IBLC 1IVLA 4TNVF 1FFRA 5JHLH 1NGQL 2AJZA 4NQED 2WAHA 1H8OA 4PJFF 2HJFB 3TH4T 3MA7B 5ESQB 1FYTA 2DLFL 2Y6SC 3E8UH 2QLVB 4HG4J 4M03A 4Q2ZA 4XMLH 2ESVA 4J3SA 1J1XH 2CGRH 4C54A 1KGCE 1LE9A 1EH9A 5DJ2B 1S9YA 3RWIA 1HQRB 4NSKA 4Z8FL 4ZS7L 5KS9A 4TVPL 2NYYC 3VDBA 4N0YH 3U7AA 4JCLA 2EDNA 1MHCB 5GIRA 4BK4A 1AP2A 1BD2E 3MLTB 4X9GA 2AXFA 3IU3A 3ZYJA 5SX5K 5E6YA 4WGWB 4OD3H 2R69H 1V7ML 4RFNC 5JDSB 3MV8E 4FQ2H 4LRIA 2MHAB 3HN3A 1I8MB 3ALWA 4XH2A 3RY6C 2QTEA 3TJEH 2GCYB 2NXYD 3KYKH 4XZUB 3HCVA 2ZPKL 5JIPA 2R2EB 4LCWB 3BKJL 2FGWH 2XTLA 5J1TC 1P4LA 4HPOH 4GOSA 4JANB 4N0CD 1VEPA 1BVKA 3J8F7 4XCCH 1CFTB 4OLYH 1ZLUK 4FFZH 2NW2B 4KHTL 2W9DH 1YQ2A 4JFDB 1DLHB 2DRUA 3QEGH 1E4WL 4EBQL 4JKWA 3MRBB 3O8XC 4ZXBA 1HSAA 3MBEA 3IU4H 1Z3GL 5JUEH 5F1KC 3IJHA 1KLGB 4MD4A 5CJQH 4KJYB 2NLJA 2HFFB 3BPLC 4YFDB 1RI8A 5FM5M 3QQ4A 3WJLC 2XPGB 2LFGA 3FQUB 1XGRA 4AMKL 4EZMA 3L5XH 5TF1L 2AJSH 3OB0H 2C1OB 4OZGA 3TV3L 1S3KH 4FFYH 4ODSL 2HG5A 5FYKU 3T0WA 5GZOC 3CVIH 4HLJA 4W70A 5FO8B 2ZSWB 3CDFA 1IT9L 4PJCA 4UDTB 3TC9A 3SKOA 1MI5A 2W65A 4IS6A 4YXKH 4QHUB 1TLKA 4GXUM 2DWEA 2PW2A 5L2KA 4O02L 1BX2A 4LDOB 4PJBE 1A5FL 4ODTH 4BKLA 1VFOA 3QNXB 1N0XH 4P3CH 1XR9A 3T09A 5LGKA 1S7RA 1A9BA 3TIEA 4CVZA 4NKDA 4U1HA 3T0EE 2ERJB 3F5WB 1I1AC 4U1IB 3L3OA 5E8DH 3V5KA 1FIEA 3ARUA 4WO4C 5EBLB 5D7IA 5BW7C 3EHBD 3NCEB 4MA3A 1ZLWK 4DWHA 5IB2B 4HKXB 5IIEB 4J8RB 2OI9A 1YC7A 4WVRA 1OP3K 4CADA 2AQ2A 4GAYA 2X4PB 1S9XA 3HI1A 4U05A 5GRUH 3MRLB 4F3FB 3GB7B 5KVMC 1FYTD 4NKIH 1ZHKA 4M61A 4Z7UB 4HPYH 3VXQB 5SWSA 5ID0A 2KDGA 1JTOA 3LKOA 2ESVD 1RZKH 5IVXA 5J1AA 2RB8A 4WU5B 3HE6D 1P7KA 4ZFZA 5HGBA 3EDFA 4L1DA 3GSQB 2ARWA 5DYOB 2FZ3A 4PJ8B 4WDIA 4N1EA 4Z7NE 3P11H 1YMME 4U6XA 3O8XA 2AK4E 2BRRH 3LEVH 4ONHA 4XWGL 2DKUA 1FGVH 1R3IL 2ZP0T 4Z0BH 4LLAA 4RNRA 3Q6FA 4JPVH 4MAYC 3V4PH 4WUUE 3ROOB 2RQ8A 4NQXB 5B39A 1G7JA 2FDBP 3FJTA 2BVOA 1QUNA 4Y5XB 1JPTL 2EIEA 3FONA 1K3ZA 5C6TL 2XA8H 4DKFL 3NCFB 1V05A 3HZVB 3MX0A 5I66B 3TH2T 4UBDC 5CD5D 1D5MA 1ND0A 4MD0A 1ZGLB 1BIHA 2Y4SA 1JGEB 3V6ZA 3PWNB 2BY3A 5E7BA 3BZ4B 5MENB 1YY8A 1B0WA 4KJWD 5L8KB 4Z7OF 4KKBC 4P3DA 3VRLE 4HWEL 1ZXQA 5CSBA 3WDIA 1MVUA 2JJSC 3GDBA 5GJTH 1DN2A 4PRIA 3FFCA 4MGXA 3K8LA 5FO7B 3B8SA 4ZXBD 2DTML 3KWWA 3RAJL 5DHVB 2CRYA 3IDXL 4EI6A 3IDIA 3OR6A 4XP4H 1UJTA 5I2IA 1OAUH 4H5SB 4LCUA 5I16B 4C56B 4WO4A 5SWQB 1M71B 5BW7A 4XP6H 4TUJA 1FZOB 2Z8SA 4OF0A 5IBLD 5DUBB 4NJ9H 2VDLL 1ZVHA 2PUQT 3TO2B 1S5IH 4WEBH 4FNLL 1NGPL 2Y6SD 5CBAA 3VFOB 3W2DH 1QEWA 4L8BB 4HWZB 1G7MA 1S9WA 1MI5D 3NH7H 1AGFA 3UTZA 3QG7H 2K9UA 3TBYB 2HWZH 4IEFB 5ICYB 1F3RB 4PJXA 5DRXB 1DBMH 3LRSA 4ONOA 2NYYD 3DSNA 1X44A 1JWSA 2AJ3B 4JPIB 2ZUSA 1AO7E 3VWJB 4PRDB 5D1QA 3GSWA 5I18L 4O9HL 1FFNB 1J87A 4YQXH 5A2KH 1NUGA 4MAYA 5GJSH 1UG9A 4KDVA 3TYFA 3OAZK 2P5WE 2O5XH 4XMPL 3P73A 1A6ZA 2JELH 2VMFA 3VFSB 3U9PL 4X7DC 4UQ2A 4UQ3B 1CICC 3IETB 3RWGA 2X9WA 1TNNA 3VXMD 2CKBA 4K07A 5CMAA 5DUPH 5IFHL 5C70A 3BKCH 5EOTA 5JW3H 2X6MA 1T1YB 1U92A 2FGZA 1XGPA 1NJ9A 5D2LA 1HCFX 5SWSD