1T0NA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
278
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
total genus 74
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0nA01
4PJ9A 5GGTH 1E6OH 3FO9B 4RFOH 5I8KL 4ORGB 5LKNA 2XOTA 1JK8B 1G7QA 4HZAA 4J3WA 3BPLC 2VDMH 4G80B 5JMOC 3WNKA 1G7LB 1LO5A 3ZT6A 2R2HB 3LS5L 2ENYA 1QD0A 4L8DA 1R3JA 4PUBL 2CKNA 1F58H 4R97B 4I3SH 2NY2B 1NLBL 5L2KD 2DMCA 3OZ9H 4XC3L 2J4WL 3D25A 1EJOL 2P8PB 4M1CD 4QEGA 4N5UA 2CGRL 4UDUA 2FJHB 4NQSB 3DX7A 2P49B 2FYYB 1K8DB 2LAAA 1JGLL 1OSZB 1JWSA 4HPOH 3KR3L 3NCCB 1M7IB 2VQTA 2HT2C 1S7TB 1E4KC 3B3IB 4ONHA 3V95A 5F9DC 3O4OB 4MA7H 3G6JB 4M7LH 3FZUC 1TZHB 1OAYL 1RUPH 2FWOB 4UQ3A 3SQOL 4AIZB 4DGVL 3NZHL 5F88A 3U4BH 1HHKB 4G5ZH 5IFHH 2ICES 4OZHB 5D1XB 1A6WL 3HS0B 3GMOA 3TH2T 3CCHA 3TJEH 1AO7A 2HKFL 4KPHH 3FB5B 5HPMB 1MJUL 3ZO0A 4RFEB 4WUUA 2ADGA 4JLRB 3TIEA 4Q9RL 3B9DA 2DDQH 4TTDC 4NQED 1L9MA 2D7PA 4J8RA 4MD0A 3K4ZA 3U4EA 5B8CA 4LFHD 1FNLA 1SYVB 3BKJL 2MCPH 4NZJA 4ZS7H 4WI8A 5GJSH 3QUXC 3IS0X 2EYTB 3EBAA 4OLUH 1XGQA 1JHLH 2IALA 4GW1B 5F1NB 5I75B 1FJ1A 1GJIA 5F9JB 1RIUH 4R4FH 2Q8BH 3STLA 1MLCB 2F8VA 3KDMA 3QUXB 3QIBA 3CC5B 5T1KA 1FZKA 4HG4J 1FFNA 3CX5J 4Y2DD 3TZVD 1ACZA 4ZUUB 3RX5A 3K4DA 1Q9KA 4XWGH 2HTKC 4JDZB 1NCCH 4JE4B 3WUZA 4KQ3H 5CMAB 5DRXA 4UILH 1DUZB 5HYSG 3TH4T 4X0KB 1TJHL 4JM2A 5A16A 4E41A 1YQ2A 4POYA 3MJGX 4ZFFB 3T0EB 2CKBH 1DBBH 2V6HA 3MGAA 1H5BC 1TZIB 3FMGH 5KW9L 2ZUQC 2VR9A 1MRFL 1F97A 3MRIB 4W4OA 2Z9TA 3KWWB 1LD9A 4M6AA 1AR1C 4YHKL 5L7XH 5CJ8A 5DRNA 2PTTB 1QFOA 2YD4A 1KYOK 2YPLD 3RWDB 1WGOA 5K9OA 1ZEAL 3I9GL 5KANG 3KDMB 4R4ND 4MJIB 4OM1L 5GZNC 3QUYD 4EBQH 5JW3L 3HI5L 5JTWA 4XP5H 1SY6A 3FQUB 2P48B 5KJRL 1K8DA 2L4OA 4XPTL 1MJJB 1D5XA 3QZWB 3Q3GB 1ZOXA 3OR7B 1I3GL 2R69H 3QDJB 1XGTA 2IAMB 3QNYA 2VLJD 3C5SB 5HYJA 3MJ8B 1TJIL 4LSDA 1AGDB 1A6PA 5JNYB 3RWJA 5FUOH 5D7KD 4QXUL 4Z76B 4UNVA 4LU5L 5DD0H 2WWMC 3GSUB 1YEIH 4I9WE 2IFFH 1KCRL 3UJTH 5JOPE 3AU1B 4EUPH 3IDXL 1CGUA 2D3VA 1FHGA 3GMQA 3VU2A 4TUJA 3DUHA 1I3RA 4QRQB 2JJTC 4FQJH 3L5WB 5L8JB 5A3ID 1MCSA 1QEWA 2NYYC 4ETQB 4H88L 2ED8A 3HE6A 1HHGB 3S88L 2F19L 1NL0H 3QQ4B 2F53B 15C8L 5KZCB 4NHCH 2P4AB 2J8UE 2BC4B 5D1ZC 3O8XA 3SE3C 3SKMB 4JDVB 3VFRB 4YDVA 1ERNA 2XA8H 1DUYA 3V6OA 3ILPA 5IHLB 1KG0A 3UBXA 2FD6L 4Z6AT 4CN1A 3LRHA 2J8OA 2WUBL 4ELKA 5KAQF 4PP1D 1FO0B 4CKVX 4FQ2L 5H37G 4XNQA 1EUTA 4N1CA 1LMKA 5GPRA 4J7RA 1PEZA 5C0CD 4ODXB 3VRLF 1CN4A 4RGND 3V6ZA 5KANI 1OP5K 4MQXD 3KR3H 1FGNH 3T8XA 4MXWL 4QTIH 1BX2B 5DA0B 1FIGL 2NY3B 4O2EB 1IBGH 3UP1A 4NN6B 4K71B 3ARYA 4JRYE 1T7VA 3SQOH 3F5WB 3UDWA 4WU7A 4DGVH 1FCCA 5LAXB 5E4EB 3VJ6B 2FBJH 2XN9D 1T2JA 4G5ZL 4NM8H 1G6VK 1K2DB 5E03A 3QHZH 4GKZB 3QDME 1AQKH 1OPGL 1BGXH 3FT4A 1DN0A 2DQJL 4Q9RH 1UZ6E 3ESVF 1CGSL 3VG9B 4BSWB 1A6VH 5EPMB 5ALBL 4OKVA 2ARJQ 1HHHA 4XVJH 2HT4C 4PY8J 4WEUD 2BSTB 2GYSA 2FHCA 3NIGF 1YY8B 4S0SD 5GISL 3VXPA 5CD5D 5DMKA 1A5FL 3G6DL 4NBYB 3L3HA 4MJ5A 3BHBA 1T04A 5LWYL 2VZOA 5IESL 4KMTH 4F9PC 3UTZB 2PO6C 5E5RB 1GGYA 5IGXH 2AXHA 4PJBA 4PRHB 2YBRB 3TBYB 5I73B 4WHDA 1AIFB 2B8OT 5CINL 3GMNA 1T22B 4E41D 4HUWB 25C8L 3EOTH 1XIWC 1HQ4A 4PYGA 5DMKB 5FKAB 4GRWE 5B22A 1NGQH 3QUZD 3PG2A 2PXYD 3U2SB 3LAFA 1A3RL 4LCCC 3VI4F 5I1IL 4W4NA 4CADA 3CNKA 3FT4B 1R5VA 3SDAD 2Z93B 3HE6C 1MI5A 3PHOB 3UO1H 2DLIA 2UYLA 1BFOA 3QRFM 3HUJA 5B21A 1B90A 1MWAA 2Y23A 2YD8A 2KKQA 3VE0A 4ZOCA 2QSTA 2EIDA 1XMWA 2B0SL 1HDMA 1YMME 5MEQB 3VXUE 3C8HA 3X3FH 4OCYH 5E2TH 3VMPA 5IQ7L 2QSQA 2V2WB 2P5WA 3MLVL 3MROB 2FIKA 3PL6C 3MV9E 2V2TB 5EN2A 5CJXA 3DHMA 2D31B 2BOCA 4ZUTB 4OAWA 1CD1B 3BXNA 3L3GA 4JFFD 5C0RL 2DQHH 4KZDH 3VFSB 5I15L 4OCWL 5IJVB 4PY8I 1GC1H 2CKBB 3LKQA 3HFMH 5FA3A 4DJMA 5HGDA 4MA3A 5KTEL 3U2SA 5KVGH 4YIQA 5E2UL 2DLEA 5MEPA 1KJMB 3BYTA 3MJ7B 4HK3N 4WHYH 5SX4I 5TDOB 3ARDC 5J11B 1KLFA 2C26A 4KQ4L 5DJYA 2QADD 3MRCA 3GIZL 4NGHH 1HH9B 3DNKA 3FO2B 4XPBH 3LQZB 3EOBA 3FCTB 2P8MB 1AFVH 4UIMB 3EJYD 4EI6B 1MY5A 4KI5E 1U2HA 3EYSL 1MEXL 1JGDA 3SE4C 1N6QL 2UWEA 2Y5TB 5FYJE 4PR5B 4XPHH 3V4PH 4Y2OA 5FM4A 3VDAA 3WLWD 1A2YA 3EJZD 4JO1L 4OKVB 1MCWM 3GI9H 2RGSA 4M8VA 2G75B 4ORZC 4QXWA 1E4WH 3AU1A 2HLAA 3D2UA 15C8H 3RRQA 1KCVH 4HIEA 4NUJA 3C8KB 3B8YA 1PY4A 2H2SC 2JELL 3G6JF 4F37K 1KF9B 3UBXG 4NQDD 1XEDA 4LHUA 5EOTA 12E8H 4KTEH 4PJBB 3MREB 4RZCB 3MOAH 3G04B 1AXTL 1XF3B 5T5NG 3SDXB 3EYOB 5L6YL 2WQ8A 2CIKB 4APQD 4WFED 1WK0A 3JVGC 1U8JA 4XB7A 3VWJA 2CJUL 3NMEA 4LVOC 4P4KD 3HNVH 4DVBB 3VFPA 4U1LA 2X6MA 1KPVB 2VXTH 4P2YA 3FL7A 4UQ2B 4Y2DA 2E9WA 1AE6L 1DCLA 1P9MC 3EOAA 2R2BA 3O6LL 4NQDE 1BM3L 4WJ5B 4AEEA 4Z5RB 3WHE1 5JQHC 2OJEB 5IWLA 1KN4L 3CSYA 3RWIB 4I0CC 3NA9H 3CX2A 4JVUA 1HSBB 4RX4A 4ELMB 2DQJH 5E4IA 3WFCH 2MNUA 3F6IA 5C0AD 2WBJB 3OKNA 4HH9B 2VDOH 1GZQA 5FO9A 3UPRA 1YNLL 4GAGL 3BZFA 3EFFA 1WIOA 3BDXA 1CZ8H 4PJDB 4YDJA 4G6JL 4JDZA 3OF6D 3OBAA 2PTUA 6FABL 4MNHA 3SDYH 1Y18B 4QHKI 1TCMA 3IFLH 3ARXA 4UQ3B 1AP2B 4O5LH 3FQWB 4X6EA 5I1CL 2YPVH 5D7IA 1T1XB 2H41A 1CLYL 4OCXL 3PIQB 4E9LA 4U7KA 1P7KB 3FQTA 3T3PF 1RIHL 4XNZB 5JOEA 4RWYL 5J1AA 3PGDB 5DRNB 5D72H 2C1OB 5CZVH 5HTSA 3ORJA 1NDMB 3X13A 1A3RH 2DF3A 5AYUL 4Y4HA 3CFJA 1B0GA 1ZANL 5SWZB 2CLRB 3NA4A 2M1KA 5TFSH 3LIZH 3R8BB 5E95B 3CLEL 2OP4L 3ARFA 4WHTB 1J87A 1T2QH 1IARB 3QI9C 4N0CA 3O6MH 1A7QL 1HNGA 1U3HB 2DWDA 5GHWL 4BZ2L 3U7YL 3KXFE 4JZOB 4NPYA 2EYRA 3U1SH 1EGJH 4UUJA 3ZT5A 2V9RA 1I8LA 4TVSa 4YQXH 3NFPB 3B43A 5F71A 1QLRB 3TIDB 2AK1H 1DJSA 5C09A 3VWKC 2DQGL 4U1JA 1K2DA 1FG9C 3MLYL 4TNVK 2PTVA 5D1XC 5ADOH 1T4KB 4M6OL 4RNRA 2A1WL 2HFFA 3TFKD 1RHFA 2IBZX 3DV4B 4NKOA 4WFFE 3U6RA 1KJ2L 1WBXB 2WUCH 5KTEH 5DJ6A 5HHNA 2NNAA 2D0HA 5JMRA 3B6SA 3U9PH 4NHUE 1DL7H 4FQIL 4MAYA 1F3JA 3BSZH 3NCYP 5DUPL 3C5ZC 5F96L 4GBXA 4FZ8L 2NW2B 3G5XB 4HS3B 4IBLT 1RJLB 5A40E 1I1YB 5JORA 1DVFD 1LD9B 3MRIA 2FSEB 5DI8B 5T5FL 1MI5E 2AJZA 3QCVL 5DEZA 3LV3A 1CLCA 3RKDC 3CFBB 1D5MA 2P42B 2J12B 4HK0A 4LU5H 3ET9F 5AAMA 4GS7C 3ZMRA 3NFSH 5KS9E 4HC1H 5JUEH 3MJ6A 1MQ8A 1YY9D 4G8FB 3HMWH 4LK4A 2BRRH 5T1MA 1KTDA 5CIPA 2P5WE 1DANU 3HZVA 4GG6A 4UV7L 3WFHB 1BQHG 2WW8A 4YEFA 2JCCF 3O3DA 5J12C 1Z3GL 3N9GL 1G9MH 4YO0B 5DD5L 3W0WD 3GEWB 4YPGA 4KTDL 5ICYA 3NTCH 1EEZA 1E4XH 5I8CB 3UZQA 1U8MB 1FNSL 1X4ZA 4J2XA 3QHFH 5GRUL 3T0DA 1T7ZA 2I60L 2QSCL 1RY7B 2HJLB 4YGVB 2VLMD 3ULSB 1C5DA 5IVZA 2W0LA 4JFPB 2GUOB 3ROOB 2NXZD 2IPUG 2VXTL 1IM9B 3P9MB 2R56L 4KV5E 1JP5A 4OZFA 4PD4K 5FOBB 1OGAE 4U1JB 5I1EH 5J3HC 4CMHC 3IU3B 1CLOH 4X4ME 1NBYA 2BC4A 3ZZ1A 1UYWH 1XCTA 4HV8A 1FE8L 4XC1L 2GEEA 4NZRL 4RGNB 3QCUH 2V2XB 5AEAA 2ZG1A 4NPYB 4XP9L 5HHPB 3MLXL 1LO2L 1I4FA 1KEGL 2IG2L 2IAMC 4L3EA 3NFPA 5E9DB 3BKML 1LHZA 4P5TC 4FG6D 1CFBA 5TDPB 1JFQL 4QO1A 1AGFA 1EBAA 3U0TB 3VFMB 4DTGH 1MJ8L 3ZE0F 1GGBH 1HSBA 2ZUSA 4U6YA 4XPFL 1FFRA 4O4YH 3ULUL 5CSZB 4ZO8A 3IKCA 1U92B 3MA7B 3CZFB 2MPAH 3SOBL 1FNAA 1MPAL 2D03L 2OMBA 3Q6FA 5IESH 3VGFA 2VAAB 1EK3A 1M7DB 4LDLB 4L8BA 3ZDXF 3DVGA 4YFLF 4WTZA 1Y18A 4X5XB 3DBXB 3IU4L 3CU7A 4HKJA 2X4QA 1C16A 1MIEH 1DR9A 1YDPB 4GKNB 1T21B 1BF8A 2BY0A 1VADB 3AFLA 1PEWA 2AEPH 2DQFB 3TNMA 3OXRA 1UB5A 3KYKL 4HS8H 5IMOA 3VFUB 5BO1H 5D70H 4LARL 2V17H 4K8RL 2FEEI 4CMMA 4JG1H 2QEJA 3H0TA 1S9XA 4XP1L 4XI5D 5DVOA 3SGKA 1BQHA 1ZT7A 2VUOA 1HHGA 3R0MA 3VXTB 3IETA 1FC2D 5KAQG 4K23H 3VXRA 2AAVA 4JFXA 3JZ7A 2IC2A 3MRBA 4U3HA 4IIQB 4ENEC 4FFWC 2PUQT 2J88H 4KUCD 3OJMB 5GS0H 4PDCE 3JXAA 3BKYH 1ULVA 1VESA 4LLDB 3E2HB 5F89B 3MLVH 3OKEB 3AVEA 5DJ2A 4P2RA 4IM8A 4GUPA 4WW2B 2RHEA 3QHTC 4N0RA 1KPUA 4PJIE 5D71L 4UTBL 4ODHL 4XNQB 5EU4A 3N06B 1PBYA 2F54A 3FFCB 1JGDB 3G6JA 1HCFX 3LMJL 1Q0YH 5ESAA 4H5SA 5HHMB 1HK6A 4HGMA 5IVXF 3QQ3A 3PP3K 1NANH 3MR9B 1JTOA 2BSSB 4LBEB 3MLUL 1QFWH 1UT9A 2I25N 3FFCD 3BSZL 2YSSB 1G9NC 1U3JA 1ZMYA 3KPSB 3RWCA 3RZCB 1V7NL 2VDNL 4NN7C 4X8XA 4U1HA 1NJ9A 1R5IA 3RKPA 1UKTA 4NUJB 3RTQA 4R8WH 1EMTL 5EBMB 4LKCA 5IFHL 3R1GL 3CDYA 4PJBF 3PP4L 5I8EB 1AGCB 3EYUH 2V7HB 3PWJA 5C86A 3FB8A 4Y2DC 2VL5A 4KUZH 1U58B 1T80A 2BVTA 4NZUH 1QQDB 1S7QA 2VN4A 4JM2B 1DE4B 1I1FA 4KI5F 4Z7UA 5BS0E 4WFGE 4BFGA 4Y4FC 3G5ZB 3TO4C 3LEVH 5MENB 2E7MA 5IVNA 2XI9A 2MCPL 2VDKL 2J8UF 5TDOA 5EB9A 3FB5A 1DEEA 3RGVC 5HPMA 4BFIA 4LCWA 1SJHA 1HH6B 4U3CA 3BQUD 3QISA 1PLGH 1Q9KB 4M1GH 4X9HA 1JWSB 1FH5H 1NAMH 4P3CL 3PWNB 2ZZUT 3VWKD 1ZHNA 3LD8C 5IMLA 1R5IB 4YXHH 5IFJA 1N0XL 3VI4E 2I60H 2QSCH 1INEH 4NQVB 5CP7B 1SJVA 3ZTJH 1MFCH 2X05A 4MHHG 2EDOA 3B4NA 2VISB 1B2WL 4E0RA 4LCWB 3WO4B 3AMLA 3OKEA 2NZIA 3HZMB 3T65A 1IC4H 2R2HA 1Z5LB 2V9QA 1JFMA 3BN9D 4LRNL 3C8KA 2ZKHH 1H3VA 4OB5H 4OF7A 4Y88A 1OD9A 4HXAH 4LHUB 3CVIH 5AWNL 3S4SB 5EOCL 5DRZB 3MGTB 3ARDB 2IPTL 5DMGD 1SBSH 2YA1A 3T2QA 5JHDA 3RAJH 3L7FA 2X4TA 3DETC 5C0CB 4OZGA 5L2JB 3Q3GA 3VI3E 4JJHA 5DXWA 1RMFH 3A67L 1RULH 1TLKA 1A4KA 3REWA 1F4WH 2HRPH 2HVKB 4HWEH 3E3QC 4EDXA 1NCNA 2DOCA 2GCYA 4Y16B 1FFPB 4UDUB 1BJ1H 3W2DH 1N5YH 2DN7A 4M5ZH 3G6AA 3LQZA 4L4TA 1K9TA 4I77L 2OK0H 4QRRA 3ALWA 4MX7A 4QLRA 4Y19E 2HWZL 1MFNA 4JPIA 2JK5B 3SDDA 1QLEH 1V5JA 1RIHH 4XP4H 5L8LB 4BELD 3BIKA 2ZJSH 4RAVB 3IGAB 1I7ZB 3G5VA 3DMMB 4JRYA 2WIIA 3FN0L 2WANA 3VGAC 3CK0H 1CWVA 3PQYA 5I1JL 1DQLL 3PWUB 2H9GB 5BVPH 1RZ7L 2BK8A 5HHQA 3P4LA 4QTHB 2V7NA 4S2SB 5MEQA 2AJ3B 3H0TB 4JO3H 5GS0L 2EXWD 1IC5L 2R0LH 1J1OL 2A74A 1TTFA 5J1TC 3O0RL 4OV5A 5F9AC 4JCMA 1IAIM 4FXGA 4UTBH 3QAZB 3GHBH 1H9VA 1T1WA 1JCKA 1X5IA 2EIEA 4IHOB 1CGWA 3DSNA 1C1EL 1V3JA 2AJXL 1VB9A 1T1ZA 3I84A 1FNHA 1QKZL 2VLLB 4K2UL 3WIIH 1HSAB 3IJSA 1X7QB 3TCLA 1MCPH 4DZBB 3A0OA 1INDL 3IKCB 4U6HA 4FZ8H 3H42L 4MXQD 5IB1B 4OGXL 4Q9BA 4PRBB 1BZQK 4ZO7A 4I2XA 4F8QA 1VPOL 3D0VB 1NC2D 2FBJL 5C7XH 4KWUA 5IR1A 3AS3A 3R1GH 4NO0B 1UM5L 3HC0A 4CVZA 4F9LC 1K8IB 3QHZL 3AM8A 3AMKA 2ORBH 5AUMB 3HUJE 1ZA3B 5I73C 4MAYD 1I85C 1KENL 5ENWA 4ZPTA 1A7RH 2NZ9D 3QUMB 2ZUQB 4XVJL 3CFCH 3BDYH 4UB0H 2D0GA 4PTUB 1S7UB 4U1IB 5EIQA 5FYJU 4KAQH 1NGWA 3V6BR 2NW3A 2EICA 2I07A 1YYML 1CICD 2EEBA 5BZWB 1BOYA 5EFIA 2NW2A 5C0AB 3ARWA 3I3EA 1GZPB 3GSVB 3Q5TA 1UWEL 3MGOB 3FQTB 4PJ8C 1D5XB 3QZWA 4LPTA 3BPOC 5INDB 5DRXB 4NQEA 1I75A 2ID5A 3GK8L 1I9RL 4G9FB 2J7LA 4L4TB 5EZOL 1OB1A 1HEZB 3SJVE 4OFIA 4O2EA 5JPNA 2O26U 4G80A 1W0YT 1J8HD 5CGTA 5EO9B 2Q1EA 3EAKA 3GGWA 1RZIB 5IT2H 4POUB 1Z0NA 2EDBA 3C6LA 4QWWD 4K3EL 5ACZA 4NC1C 3QIBB 1P4BL 1F6AA 5IMLB 3GSNB 1N3NB 4PS4H 4D9QE 5I18L 5TE4L 1WITA 4PLOB 1WAAA 5I0ZA 1UH2A 3MX0A 3I02B 2ZUXA 1IC4L 5FM5M 1JGLH 3MZTA 4OQ1A 3GSQA 1KLGA 5D2NC 3O3DB 4U6VH 3SN6N 4B50A 3FO0H 2VIRA 1XF5B 1AKJA 3HI1B 5CJQL 3Q6FB 4APQC 5F1KC 4TNVF 4P0DA 4LMQE 3KLHC 1BQLH 4IMKA 3MMEB 4PLKD 3JTTA 4FMFA 4EN3C 1BEYL 4N0UB 1NBVH 5FB8A 1LO4H 1IAOB 4A6YL 5IROA 1SJEA 1X5XA 5M95B 3CVHH 2VIRB 4X6BB 3UTSE 1QBML 4DKDC 4FNLH 3IETB 2A6DA 4XZUB 4JY4B 1JPFA 3FHAA 5F7HA 1F6AB 3B2UD 3UC0L 1XCTB 4ZOAA 4XPAL 3KPPB 4GXUN 3GKWL 3WLBB 1C5CH 1LNUB 5CBAB 1NUDA 2VH5L 4JHWH 1CIDA 1JN6A 2JCCA 1BJ8A 1P2CA 5JLZA 1WFNA 1AC6A 5IB4B 2OX5A 3MCKA 4J6RH 3MBEB 4QHUB 1L0YA 2F74A 2QADC 4DKEH 3C6SB 5DVMA 3FKUS 3SBWC 2NXYC 5EU4B 3HI6L 1N59B 2YA2A 1T0NA 2VLRB 1ZWIA 2WNGA 5MI0B 1DQLH 1TPXC 4J1UA 2C3VB 4TUKH 4PGZA 5HHMA 5IVXB 4ZFOA 3QUKA 5A2IH 3RIAF 4UILL 1JRHL 1KCUH 1MJ7L 4FS0A 2EZ0D 3U46B 1XH3B 3WHXB 2V5SA 4J3OC 4G8GD 2ADJB 4KC3B 2QQKH 5E1HB 3JBG7 4U1HB 5D96C 4F33B 1HKLH 4P5TD 4J3VA 4NSKA 5HY9A 2ESVB 2X4PB 2BMKB 3AXLA 4GRLD 2X7LA 1S7SA 2NY1C 4WFFD 1E28B 2R2BB 3X3GH 1F6LL 5I6XB 3MCKB 3VXTA 3W11D 5ISZD 4EVNB 5JXEA 2W9EH 2C4XA 4LCIL 3D39B 1XR8A 5D5MA 3S96B 4HJGA 1RHHB 1I1FB 3U79A 4PJ7F 5E8EB 1I1YA 3DARA 4JFDD 1MCLA 4P48A 3DWTA 4ALAH 3X12B 3QH3A 1NDGB 3DGCR 5T33H 4OLVL 5FECA 5HD8C 5LVEA 2FO1A 3TPUA 4CU7A 1UWGL 3BZFB 3FRPG 1TETL 1X4YA 3VRIA 5DR5L 3QUYC 1AGBB 2N7AA 1KN4H 3MXVL 4OF0A 1LO3H 1QSFB 5FGRA 2MOVA 3BEVB 4H0GA 1KJ3H 1FNEA 3FFCE 4MQTB 3ARZA 4WFGD 3EOAB 4HJ0C 4NRYA 3MLPA 1NC4B 3Q5YA 3ULVL 4MLIA 4MB5A 3SDAC 1JPSL 1YEEL 4AH2A 3EUUA 2PR4H 32C2A 1EHLL 4KHXL 1OAQH 2EDJA 1TIUA 1ZT4B 4O58H 2CIKA 2PKDA 3B3IA 5C0NC 1CBVL 4K7PL 1S9VA 1UZ8B 3HLAA 4UNUA 4YIQB 1NCAH 3M8OH 3TT3L 3PXHA 4U7MA 1AIFA 1IVLA 4KJWD 1J0ZA 4NKIL 3QUZC 1BD2E 1AD0B 4HSQA 1INEL 5L9DL 3CXDH 1T5XB 1WBZB 2RIKA 3E2HC 5FKPB 1R3LA 2FDBP 3GSXA 4NO5A 2JTDA 1BIIB 2OL3A 1FO0H 3QIUC 4MD0B 5TF1H 4X4YB 2HVKA 3OF6A 1J10A 2CH8A 3EZ8A 4O9HH 2OTPA 5CD3A 1CT8A 4XCYA 4H1LB 3BP5B 2LTQC 5EO1B 1GOFA 1HILA 1KIQA 3B9AA 3HUJB 4WVRA 2HKHH 4Y8AA 1XGPB 4YXKL 3QIUD 4HDIB 3ARBC 5DFVC 1HDMB 5F7YC 4GG8B 5T1LA 2D7NA 3O45A 4HULB 1SBSL 1K4CA 5B3JE 1LEKA 4GLRH 2P7TA 1WIUA 5ADOL 2NYYD 5T1MB 3T3ME 3R06B 5D9SA 5D2LF 4EUPB 4GBXC 2A1WH 4QYOA 3OTTA 3VXNB 3I50L 1ZA6B 2FSEA 2HRPL 3RWIA 3AREB 3NN8B 4ERSH 2W9DL 5IJVA 3VW3L 3G6DH 1W72B 3BEVA 1P7HL 3CFBA 1DL7L 2C1OA 3B5GA 3EW3B 4L4VB 4XAKE 3SCMD 5BQ7A 5LXGH 3IFPA 4HKBB 4XXDA 2VXSH 2XNAB 4Z7WA 1LEKB 3W9EA 1I1AB 1U93B 4I3RL 4MJ5B 1AR2A 3TF7C 4OJFH 4TNWK 1VHPA 4L4VD 5T5FH 4IRJA 5JIHA 4ENED 2IJ0C 4PP2B 4MA1B 3WNLA 3TV3L 2NNAB 1BD2B 4GG8A 1TITA 4OCRL 1BJ1J 4JPKL 1I9EA 1TTGA 2IH3A 1A6ZA 2GJ6D 1EAPA 3F7VA 3SEPA 3KLDA 3BZDA 2AEQH 1GZQB 5FO9B 1ZVSA 3BT2L 1BD2D 3L3JB 4JN2B 1WBZA 5B38G 3TN0C 4I18A 3ARRA 1J86A 3QWRA 4IRSC 1IC5H 4W4OC 4CMHB 4PRPD 3GI8L 4MX7B 4NN5B 1HYSC 4P99A 1AGDA 4ZNEA 3MJ8A 5E1AA 1YMMB 4AEIL 1UCTA 3DX9A 1QP1A 5HI4D 5IV2B 1XFPA 3EFDL 1WQVT 1IKNA 2GAZA 3EYOA 4DZ8A 2W65B 4OCWH 2CGRH 3VXUD 4K55A 4JZJB 5CCKL 1G9NL 3IFOA 4UDTA 5IVOA 1ZK9A 2FH8A 4PRPE 4GKSA 3IAPA 4MJ2A 4UT9L 5T3XL 4ZXBA 3O9WD 1F8TH 3V4VH 1DLHA 2A77H 1OTUC 2Z4QB 4R7NA 1EERB 1U3HA 4KI5D 5CJXC 3GIZH 4EDWH 5HHME 3K8LA 2E27H 3I6LD 3NH7L 4PJEE 2GHWB 3MA9H 4TVPD 4OZGB 5L2JA 1AQDB 1VFBA 1QVOA 4XAWH 5D7JA 3NCJL 1IGYA 2OI9C 2VXUH 3S6CA 4LCUB 1MJUH 1MEXH 5IBTL 5MENA 4OZFH 5DD6B 5GGUA 4C56D 2F53D 4PJ5E 4NO0D 2C7UB 2BNQE 2LFGA 4IIQA 3DXAA 3ECBB 4HCRH 3CFKB 3V7MA 3CFEB 3BPLB 3MNWB 4CNIA 2Z31A 3CDFA 3RDTB 3MNZA 4LLWB 3HNTH 4JZNB 3MRDA 1XGYL 3QDJA 5D7JB 1NBZA 4V3EB 1UJ3C 1NEZG 5HHXH 1MFBL 4F9LA 4NZTL 3MXWL 4P23A 3EGSA 4DN3H 4NQCD 4GKSB 3LEXB 3STLB 4KK9D 5KS9B 2DYPB 3KPNA 1CL7I 4DEPB 3IDUA 3S34L 1SJXA 4KTEL 2UY7A 1M7XA 1E4JA 5BV7L 5CEXA 1J5OH 1PKQA 4POZC 2YPLB 4B5EA 1FLTX 1U6AL 3MRDB 3IJYA 5IW3A 1YZZA 3GMMB 4K94L 4K7FA 1OQOA 2BSSA 4LBEA 3QIUA 4L3CA 1NCBL 3H9SE 4KK9C 3UYRH 4RQQB 1J8KA 2UVFA 3WYRA 5F44A 5EULV 1AXIB 3DSFL 3MNWA 1S5HA 1SY6L 2GJZB 3MGOA 4GH7B 3F6LA 4K9EL 4BZ1L 4IMLB 4G7VH 5DK0B 1B4RA 3QFDA 3WBDA 4LLUA 4X99B 4WFHD 1NGZA 3U30B 4QXTA 4EI6A 4HPYH 4NM4L 5CLTA 2EXYD 4M43H 1JTPA 3QO1A 3TWCH 3U83A 2Z93A 5JR1H 3KJ4B 4RIRA 1T1YB 4ONFH 1LEIB 3QWOA 2BNQB 2XTLA 3BKJH 4D0BB 5F1IA 5FCSH 4GW5A 1Z2KA 3MLUH 1OP3K 5L0QB 5LGKA 1NLDH 3O4LE 5F3BB 4U1NA 3LQAL 5D6CB 3PV6B 2O5XH 1R24A 1UWXK 1I1CA 3OMZA 1UENA 4JFED 2X70A 4XHJD 1X6NA 2K3TA 2BNQD 1SYSB 4R26L 1IAOA 1ZAGA 3AY4A 4KKCD 4PJHF 4N0YL 1O5DT 4UTAH 1IAKA 5I1AA 4PG2C 1I7RA 4RMVA 4F7TB 4Z7WB 1TJIH 1L6ZA 4IRZL 4PV8B 8FABB 4JFQB 4XB8A 1FVDA 3CZFA 2BOCB 5D1ZA 4FQQB 1JK8A 5F7KC 2XG5A 4E41B 4NUGL 1KBGL 4LSRH 1ZANH 1TDQA 2XY1A 3OHXB 1CGTA 1G9EA 3U0WH 1U8OB 1AD9A 5MI0C 4G9DB 3V8CA 1KTLB 4G8GE 1KPVA 3NIDE 3O2DH 1JRHH 3PDGA 4PJ7B 1EDQA 2VWEC 4P46A 3L3DA 1UQSA 3P4MA 4ZDHB 3NPZB 1FYTB 1Q0XH 4OZGE 3RY6A 4Q6IC 3VGHA 3GMOB 5HYSA 1CDBA 5JLZB 3D3VB 2FB4L 4JFEA 2DD8H 5H8DA 1A6UH 4LLYB 3MRCB 2VC2H 4TSCL 4XPGL 4GO6B 5MERA 1HN1A 2G5RA 3C5JA 3T1FB 1GHFH 5KVEL 1CFQA 1N8ZA 4YXHL 1S7TA 2QKIB 5HYQB 3RY6C 2FATH 4AL8L 2WWKO 3BEWB 1N64L 4OD1H 3EO9H 5JO5B 4QNPE 3ZHLA 4Z78A 4DGIH 4QYOB 2QADB 4XP5L 2YD9A 1NMAL 3DI2B 3U9PL 3LSOA 2B7DT 2Z35A 2Q3ZA 2HVJB 4LAQL 2VZSA 1U8QB 3TIEB 1RUAL 3OXSA 2CIIB 1PZUB 1RZJL 5HDLA 2V2WA 2BMKA 3AXLB 5FYKH 3CVIL 5AWNH 3Q2CA 1EFXB 2W0FA 1XIWD 3N0PB 3VWJD 3CXHK 2X4UA 3MLZH 4NFDA 5ID0A 1VGEL 3O9WA 5AG8A 1AQKL 3DETD 4BKLB 4KKAC 3P9LB 2VXVH 1T0PB 1WTGT 2YRZA 2Y7QA 5LGHH 1KCSL 1YY8A 3VXPB 4F9PA 1FVCB 1EFXD 1YJDH 1A9BA 3LPWA 3CH8A 5GSVA 1G7JA 1HKFA 3NPSC 4MA3B 2OL3B 4B41A 4NDMB 4S11A 1S7WB 1ED3B 2W60B 5CD3B 2Q76A 1MRCL 1NDGA 1SEQH 2ADFH 1IGIL 1NC2B 4ZPVA 3VG9C 4JQIL 5EC1A 3VRIB 3HUJF 3A6CH 1SM3L 1AXSB 5EZJA 3DUSA 5HYEA 3V7AG 1F00I 2XPGA 3QWRD 4WTXA 3ELAT 4PJAE 3TGXA 4WUKH 4LEOB 4JO2H 4WO4A 1NFIB 5HI4C 4MDJB 5E8DH 1A7NL 5LJYH 2R29H 4WWKA 4XH2B 5I8CA 2FX8L 5D6DC 2XQBH 5DF0A 4HIXL 5I2IB 5K9KA 4URTB 4KRNA 3ROLB 3RVTC 5EZIH 5GSRB 5DFVD 1DBML 5EOCJ 1JWUA 1H3WM 2XZCH 4LDEB 4OCSH 3F65A 2FEDD 4GMSH 4HX1B 1MHCA 3N85H 1JVKA 5HY9B 4PJ5A 1U8HB 3LRSA 3NZHH 3U4BL 4W68A 1SYVA 1VA9A 4G7VL 2OJZL 1LO2H 2ZUWA 1AY1L 5JORB 5A1AA 3MRHB 5J12B 5ITFA 1S9YB 5DC0A 2WP3O 2XWTB 3BKMH 1MRDH 3WMSA 5DJXA 1URLA 4HW6A 4LLMA 4ZFZB 1FZOB 3JV0A 1OY3B 2CMRH 2F58H 3H7BB 3UTTE 3SPVB 5E8NA 4XVSL 4EIZC 4UQ2A 5EBLB 4O02H 1P6AB 4DUWA 5I8EA 5DRWA 5TJWK 5C9JB 2VLJE 2Q8AH 3PHQA 4W6WB 5TQ2H 5FV2A 2NY5H 2DL2A 1A1NA 4XCEB 5FO7B 1YEFH 4JREB 4U1KA 1SBBA 1LEIA 1K4DB 4F3FA 5IF0A 5D5ME 2WV3A 1EH9A 2WZPD 3S36X 4P59L 1LE9B 2YK1L 5M94B 5F1SA 1CTOA 3TIDA 5SX5H 3D18A 4UT6H 1QNZL 4EJ1C 4NFCA 5JW4R 4RISL 1WUNT 4OIIH 3CDGB 1H5BA 4P9HL 5J1SC 3SCMA 1LP9B 1XGRA 3SDCD 1FP5A 3LKNB 4JHAH 4LCWD 4NQCA 4WEBL 1DBAH 1QFWI 4WI5A 4XP1H 3SGDH 4RFEA 1CVRA 2Q7YB 4PJ9D 3PWLA 1R0AL 1AR1D 3DLQR 5LCVH 4KQ3L 4PJXA 4HJ0D 1FZOA 1G7HB 3PABA 1MCIA 1TJHH 3CAFA 3DECA 4ISVB 1D6EB 1YYMH 5KZCD 4HK3J 5T1KD 5C0GB 3FO9A 4KKLC 3MBED 1J9CT 5BJTB 4FG6C 2HAZA 1OD7A 3LKNA 4NQCB 3CFDB 4XNYH 4GAYB 5E08H 2CO6B 1Q9OA 4PV9A 1KIPA 4JRXB 3RWGA 3PGDA 3N1QC 5KVEH 2IBZY 4U1KB 4M9PA 4H25B 2DM3A 3GJFB 3BP7B 1G6RL 1EHXA 5IFJB 4QWWC 2FNBA 5IMKA 3TN0A 1UWXH 3ZKQD 5BS0D 5C07E 1VACB 3N1GC 5GS2D 1B3JA 3FB6A 4UT9H 5T3XH 3TBWB 3V7AE 4OUOA 1KB9J 3H9ZA 1NFDA 3NCMA 5DJCA 4P5KA 4OZHE 3KPSE 1KGCD 1NEUA 3WFBL 1BQLL 1EJ6A 4R4NC 2F74B 1X5GA 4L8BB 5CZXC 3RBSA 3T4AB 2OR8A 3LRSB 3NA9L 4QXUH 1FAIH 1IGML 1RUQH 4HUXB 4X9IA 3EYUL 3TBWA 1N6QH 2OL3L 4LGSB 2XZAH 2OI9B 3QFJB 4QOKA 1ZHKB 2XWJB 4QRRD 4YHLL 4P2QD 4UDTB 4ZSOA 2CRMA 3NIGE 3FO1B 4P57A 4X8JA 3I6GB 3TLRA 1NH6A 2Y4SA 1DLHB 2X4RB 5I1KL 5AUMA 1UCBL 3F58H 4FQXB 3BIAX 2QLVB 3P4NB 1J11A 2JELH 2DI7A 4NZTH 3MC0A 3TJHC 5F7EH 2V2XA 1U3HC 2XWBA 4GKOA 3WE6B 1EEQA 4K3GA 3HPLA 1NAML 3H3PH 5DEFA 1JI1A 4RGMB 5GJTL 5BRZA 3RVVD 3BGFB 4XCNA 5C08B 4DQOH 3MOAL 5EC1B 3GMRB 1D6EA 2JF1A 3GJEA 1YEGH 3QEUB 5DQDH 5EFIB 4Q9QH 3HRPA 2OR7A 3IRZA 4EI5B 2DQIH 4U49A 3RNKA 1F2XK 1K5NB 1ZGLP 3HR6A 4H8WL 2AK4E 5DO2D 5BCAA 4OV5B 4PJHA 1DBMH 5FAAA 2DJUA 3GBMH 1M6OB 5DJDA 1JE6A 3GKZA 4LPUA 2YXFA 3KAAA 4BK4A 5DEGB 1CXIA 2B2XH 4PJXB 1ZVHA 2XRAH 4YDLC 3KG5A 3C6LB 1NC4D 3C2SA 4YPGB 5ECJE 4UIMA 2ATKB 5FGCE 4HMCA 5C09D 4HKJB 4K3JH 4PJHB 4HQQL 1X5KA 4EOWH 2BNUA 1OPGH 4NNPH 4P2QE 1BBDL 3G08B 5E7FA 4JB9L 1UB5B 4MAYC 1KJMA 4JFPA 3RWGB 5H35A 4I0PC 1G7PA 2IANB 5FA4B 4FMKA 2LV4A 4I2XB 1Z6JT 5D6DA 3QULB 4FQPA 2HLFD 4DAGL 2AXFB 1JNNH 5GISH 4ZNEE 1ORQA 2BSRB 1CICB 5MEOB 3GMLA 2E5EA 5GSVB 4U6TA 3VRLE 4WIQA 1S9VB 2HTLD 5CILL 4UT7L 3P9WB 4R3SB 3W2DL 1N5YL 2Z8RA 1L9NA 4GRWF 4I0PD 4UU9B 4CU8A 1E6JL 4OFDA 1CGVA 1UADC 4PRDB 1W0WB 3FT3B 4WFHE 4XCCH 1OAKH 3D69B 3ZE2F 2CDGB 1B4JH 4LLYA 2BSTA 4NC1E 3MLWL 4NBXB 2HFTA 4AH2B 5D2LE 2GSGA 4ZG1A 5T5NF 1TPXB 3FN9A 4X9FA 2ARJB 1OF2A 3BHBB 2FX9H 3LZFH 4C83A 4ZFOL 1BZ7A 3I6LE 1KJ2B 4NQXB 5EBWA 4HBQA 3QDMB 4KTYA 4H8WC 5A43C 2D9CA 3O4LD 4WEBH 4OFYD 1KN2H 4KXZH 4Q74A 3FTGA 4P4KA 4KK6C 4LPYA 1OLLA 4MCYA 4AM0B 1ETZB 2BRRL 2FYYA 5I30L 2WIIB 4KGLA 2IMNA 3V0VB 4YHNB 1OAQL 3O4LB 4I3GA 5CHNB 3IXAB 2AGJL 2XTJD 4HWBA 4XP6H 5BVJB 3U0PA 3VDBA 3ARBA 3UTTA 5I19L 4JFHE 5E2TL 2D9QB 1FZMB 3C60D 1FVDB 4PUBH 2XTJB 1F58L 4OF6A 2DQEH 4U31A 1OM3L 4OZIB 1TQBC 1GSMA 4X5LA 3JV4A 1QUNA 2CRIA 4NKIH 5E9DE 2Y07L 5FGSA 1A7PL 4X7TB 4KZDL 5E5MB 4AL8H 5DA4A 2VSDA 1R3IL 4WI4A 4QRTA 3UJJL 4GFTB 1O7SA 1IC1A 1B9ZA 1P4IH 4JN1L 5JW5A 1LILA 2VAJA 2MSPA 2NLJA 1GC1C 3NIDF 3SBWA 1JNHB 5FO8B 1PYWB 4XC1H 2P47B 1CGYA 3IS1X 4P2RB 3FOMB 3O6KH 4H0IA 4IJ3C 4PIRF 2H1PH 3C60A 1N2RA 1A1MA 2UZIH 1TMCA 1NGZB 5BXFA 4ZUWA 3MODL 5EU5A 1Z9MA 5HGAB 4Y4HB 3BE1H 4JVPA 4PY7A 3TYGL 3BWUC 4L29B 3O2WH 2XZAL 4TUOA 4F57L 5F9WB 1HQRA 4QRPB 3S37H 4HLZG 2E7LA 4DOHE 1XF2B 3V6FA 1OHQA 4Y4HD 4E0RB 2E8YA 2X4OB 3BWAA 5E6YA 5ACLA 2F5BH 4WV1C 3MLRH 5FM5O 3ULUH 3L3OA 2HVJA 3HR5A 4PG9A 4MA8H 2NPLX 2DS4A 3VFVA 1IGIH 5LXGL 3KPMB 4F7EA 1MCQA 3OX8B 5CEXB 5DD5H 3BFOA 4JKPH 2A0LD 3QCTH 4R6UA 3U7AA 4LPVA 1UVQA 1JHLL 1JN6B 3PDOB 3ARDA 4Z18A 3PP3H 1WCBA 1GAFL 3W39A 3P9LA 5F7UA 4ZUSA 2GTWA 3K8MA 3LN4B 4P2QB 2Y9RT 3TJHA 5INCB 2ITDA 4LLMB 4ZFZA 2R29L 3RU8L 1NFDE 4LARH 4G9DA 3RDTD 3TYFA 1QBLL 4F7MA 3GO1L 1J7VR 5B8CB 5I1EL 1IEAB 2C3VA 2YN5A 1G1CA 1G7MB 3A6OA 5FV1L 3O9WC 3ULUF 4YUEH 3VXME 4HG4K 2WIMA 4ZO9A 2VZUA 5CEYB 4KZEH 4J4PD 1DFBH 4WDIB 1DANT 5FXCH 1F13A 4MMXC 3FQRB 5DDHA 3T3PE 1Y6KR 3FJTA 5GRYA 3WXVL 3DXAE 1CU4H 1A6WH 3H6JA 4GQPH 5DJCB 4OTXH 4AMKH 5IW6B 4YR6A 5D7JD 5E0QA 1F90L 2NXYB 4QHNA 1ADQA 1XZ0B 1JHTB 1PQZB 1H8SA 3B2VH 3PIQA 3GBNH 1QBBA 1LK3L 4YBQD 5GSRA 1Q0YL 1LE5A 3BX7C 4ZYKB 3NGBC 3WIFB 1I1AC 4M02A 1CDCA 4M3JA 5IBLD 3UC0H 5T3XD 2AV7B 3ZYZA 4YR6B 2QBWA 5TQ2L 4NN6C 1TCRB 3IRPX 4XZUA 2EDYA 5K9JL 1PW3A 3NFNB 5DURB 3W9DA 1FPTL 3PJSA 4BQ8A 2XG4A 4NNXA 5BJTA 1AO7D 2GAZB 2ZG2A 2J5LB 2GITA 2YD3A 4GXUM 2NY0C 1P7QA 1IZJA 4H26B 1UXWA 4ZO6A 2XZZA 3BJLA 5I1DA 5D72L 5IEKA 4ODVH 2V17L 3PL6D 5EU5B 3RWEB 5AYUH 3GNML 2NY0B 1NANI 4ODBD 5C6WH 4XXCA 5BRZD 1OT2A 5ESQA 5FGCB 1N59A 2P7TB 1R5WB 3QEQB 1ZVYA 2FJFB 3O6FC 2YD5A 3RA7L 3LEVL 4HKZB 2APTA 3BJ91 3LKRB 4P2QA 3L3KB 4ONOA 2F19H 2LAGB 2AJSH 3S5LG 4JPVH 4AT6A 5D7SH 2J6EH 4Z95H 5HJ3A 3UTQB 3D0LA 3BQUA 2B4CH 3WSQH 1U3HD 1QACA 1M71A 2BVQB 1FLRH 3CSBA 1OTTD 2R2CA 1FFNB 5T1KB 3BP5A 5ISZE 1YNTB 1WZKA 5HYFA 4R0LB 3VMOA 4KMLB 1DSFH 2DKUA 4ZNCD 3I9GH 3OGCB 3GSRB 1NCBH 5HGBA 3BRFA 3P0GB 3L3GB 1IJ9A 1KEMH 4HJJL 2WBJA 2Y06H 1MOEA 4DKFH 4JRWA 5BZWA 4IRJC 3SHSA 3JTSB 4S1QH 3ZSTA 3SKUD 1MHPH 2BCKB 2KH2B 1NSNH 4KJQC 3ECBA 3FB7B 3TO2A 4A2MA 4MS8C 5EOQL 3VH8G 1SY6H 3TNMB 1GGCH 3BD5A 2UZIL 4P4RB 3IDMB 5E94B 3VXRE 5IFAL 2ITCA 5EU3A 3IAQA 5J6HB 4XI5C 5I1GL 1DQJB 1RUQL 2NY6D 5F21B 3SDXE 2CXKA 3MJ9H 4L4VE 5D1ZD 5K59F 1YUHB 1NCUA 4Z0BL 4P46C 4Y1AD 1NMCC 1S7XB 4PRIE 2A38A 1N3NA 5T3ZH 3ARGC 3O3BB 2YOCA 1OWRM 2YD1A 1JNLL 1X7QA 5F7NC 4DZBA 1L7IH 2F54E 4PJXF 2X4OA 5EUOA 2XV6B 3B2UC 3X14A 3VFTB 4YDKH 1PLGL 4M1GL 3OKOB 1YMMD 2E6PA 3ARBB 3UTTB 1WIPA 5HYQA 2VLJA 4Q6IB 3C2AL 1EA9C 3ILQD 2Z92B 5FOJA 1CTNA 5D7IE 3GM0A 1MCOH 2NMSA 2DTMH 3QXTA 3GO1H 3VD3A 2VKWA 3U9UB 1RURH 2EE9A 4P5MA 4NOBA 5D7IF 4A6YA 4NKQB 4PRNB 4M5YL 4FQLL 2FJFA 1JYVA 1Q0XL 4YK4B 4BM7A 2BHYA 4S1SL 2C1PB 5DVLA 3D69A 5C08A 4JY6A 5DMIH 1T22A 3GMNB 1RK0A 3P0YL 2XKNB 2X1QA 2BNRA 2EYSA 4OLWL 4OFPA 4CW1A 2VZ3A 3SO5A 1GHFL 4GBXB 3QEUA 2X40A 4KK5D 4J3TA 3RGVA 4D3CH 4M00A 5BOZG 1OARL 2O5ZH 1OTTC 1FFPA 3MV8B 3RZWA 4ZFGL 5HHOB 1S3KL 1NMBL 4J1UB 3RJQB 2VKXA 2F54D 4UMGA 2PW2A 2NY2D 5C0ND 3HFML 3SE8H 3R06A 4K7FB 3LCYA 1S9WA 3D2UD 4BFIB 1NFKA 5CILH 3B6SB 3C5JB 2GK2A 3MNVB 5GS0C 1G0YR 5EIIB 3S3JA 5E24E 4MA1C 1IE5A 3ARFD 4FQCL 1EJOH 3G08A 5DI8A 4CVWA 2DLFL 4JAMB 3VXMA 4OZIF 5JZ7C 4DWHA 4MMZC 3MBXL 3FN0H 1QEWB 1H0DB 4LMQI 1MVFA 1PZ5A 5D1XD 3RVTD 4XPHL 3V4PL 4MJIE 4FOMA 1U2CA 4WWKD 3GSXB 2CRZA 4LVHC 1RJYA 5F9OL 3Q0HA 1ZT1B 1G0DA 4M93C 4JAMA 5EA0H 5I8KH 2J6EL 3ARGD 4Z95L 3RNQB 3RPIB 2ADFL 4RAUB 5CJ5A 3BUYA 4LHQB 3CLFL 3LKSA 1QOKA 5I19H 5GZND 1BF2A 2ED7A 4Z5RA 2BVYA 2GT9A 4AEFA 4TPRL 4Y5XC 1XIWA 1R24B 3UTQA 3P30L 4JM4H 2YWYA 1AHWA 1IQDB 3MOQA 3O45B 3F8UB 1BBJB 3UJIH 2Y07H 5HYJD 4EDXB 5B8CC 1WJ3A 1EX0A 3DX9B 3V0WL 4QRRE 1H3PH 1GC1L 4JQVA 3ZDYE 3BO8B 4LSTL 2FO4B 5F89A 3E2HA 5DJ8A 1CIUA 2ADJA 3RGVB 3HR5B 2E7HA 4NWUH 5DJXB 4QXGH 2IALB 4OCSL 1J8HE 1PGRB 1FFQA 2Y36L 4JFDB 3WFEH 4Y89A 1IMHC 3MROA 2GJZA 1EMTH 5D7LB 1BEYH 3SGJA 3PJSB 3AY4C 1AFVL 3IDYC 1XT5A 1RU9H 3B9KC 2NY5C 5M7QA 3LN4A 5IBTH 1OSPL 3KXFB 5EU6B 4PP2A 2CLVB 1TFHA 3HNSH 1B0RB 3TYFB 2BDNL 4JY4A 4GKNA 4CDGC 2BVPB 2P8LB 1T0MB 3GI9L 5D4QA 1BFVH 2XTJC 2X9XA 5GGVH 5IVXE 4X4ZA 3QH3B 4M62H 4G8EA 3HNTL 5ESAB 5KG9B 1CXHA 1UZ6F 2MKWA 3MPCA 1FZKB 3FMGL 2Q8AL 5KW9H 4HKZA 4TULL 4OFVA 4JDTL 4MNQA 3RWFB 4XPAH 3C60C 5JW4N 4OQTH 3MTRA 3QIWA 4KRPB 4E5XB 4JHWL 5FGBA 4N9OB 4GRLB 1KELL 5FHBH 4EQ3A 5E8NB 3QP3A 4PJFA 4JGJA 4Z7QF 4TOYL 4TUOB 2NY7L 4V1DB 5C0BE 2Q76B 4GS7B 4WI2A 5D7LA 3LKSB 3OR6A 3UAJC 3VXNA 1DBAL 1MREH 3SJVD 1INQA 1J12A 1JF5A 4HIEB 2YEZB 4Z7OF 4Z8FL 4OZIE 1JGUH 2R2EA 4MDIA 4MNQD 5I17A 1U8KB 1LK2B 2IH1B 3RWJB 1IGFL 4P5MB 4TN9A 3CD4A 4PJ8B 4YBQC 2HLFC 5HSFA 1UVQB 2IBGA 5FUOL 4AIOA 4I5BB 3R8QA 1G7QB 1KCLA 2VLKB 4LF3A 3VFNA 1X9QA 2OSLB 4AMKL 5AZEL 4HFUH 3EJZC 1CFNB 1MCKA 2HFGL 2IGFH 3DMMC 1HXYA 3SO3B 3VD5A 1WBYA 43C9B 2JJTA 5E8OB 5IB5A 5JXED 1QSEE 3L6FA 3PGFL 5EUOE 3MCLL 1JRHI 4NQEE 1RZJC 5BRZE 3FHQA 4OM1H 4HKXB 1ZGLM 2RCSL 1NMCB 3RY5A 3W81A 1YEKL 4L3AA 1F11A 1NLDL 2IADB 1OAZH 1I1RA 3OL2A 1OGTA 1IKNC 2JJUA 2QHRH 3SPVA 1QLFB 5T1LB 5K9QI 4ONGH 5GRXG 1ZLWK 5ICZB 1IZKA 1QLEL 3QCVH 4MNGE 5SWQA 1A9EB 1N5AA 4U1MA 1SMOA 5CZVL 1AGEA 1IGTB 4XMPL 3I6KA 1XR9A 4LASH 1F4XH 3S3SA 4KDTA 3LS4L 4PJDE 2H26A 1PG7H 3LIZL 3R0NA 4PRHE 4R2GB 3D39E 1ZV5A 2OP4H 1QRKA 4C59B 4CMMB 5SX5K 3AAZA 4LQ1A 5GS0D 5JQ6L 1X5JA 3QDGD 4WU5A 3GGWB 2FR4A 3TEUA 4IS6B 4UBDD 5KSUB 2H32H 4RGOH 3AS0A 2D31A 1HHJB 2DM4A 4JO4H 4KRLB 3GSNA 4ZUTA 4D8PA 1NGXB 3DVIA 1LDSA 1IM3A 4R7DB 4FN0A 3OAZK 4LRIA 3O0RH 3PHSA 1KUMA 4X7FC 1LO5B 3VXUB 4D0DB 1MF2L 3VFGH 3D3VA 3TF7A 5E00B 1BX2A 5GRUH 4KK5C 3ULVD 4I8DA 2DWEA 3GMPB 2VITA 1BVKB 3JWNC 1RAMA 3BGAA 4Y5VC 1R5WA 2QHLA 3LD8B 3SE9L 4H8WH 1DBKL 1RFDL 1JHKH 4O2FB 5D2LA 5FUZH 2I27N 1QSZA 4NBZB 4G6MH 4MB3A 5E6ID 3T2PA 4RDQF 5IGXL 4NT6A 3GRWL 3RQ3A 1A1MB 2E9JA 1MCNA 1W8OA 5CGYD 1JYWA 3QUMA 1FE8H 3ABZA 4WGVB 1RUPL 4NZRH 4ZSOB 3WFEL 4XP9H 4I18C 5DR5H 5D8JH 2I9TA 4QRPE 5C0GA 3ES6B 4RRPG 4QY8B 5I1GH 3O4OC 4BH8A 2YXMA 3JUZA 4ZAKA 2VLJB 4Q6IA 5DJDB 4X5WB 4YHOH 3Q48A 1KCSH 2BOBA 4OI9A 5IB3A 5HI3D 4I13B 1BOGB 1QLFA 3T08A 4RDQG 3L1OL 1E4KA 5HHNB 4WU7B 1AO7E 2OXGA 2VL5B 1FRGL 2BSED 4WCYL 5CEZL 1VENA 5D7IB 4GQ9L 2RAMA 1XGUB 1VGKA 4F15B 2D03H 1WICA 2FGWL 5DQJA 1QO3B 3QXDB 5GJSL 1UM4H 3FQUA 2NTFB 2X2YA 3PL6A 4WHCA 4XRCB 4OLUL 4YDKL 1OAKL 3ZSSA 5IKCA 1T03H 3X11B 1KFAL 1K4DA 4LFHG 1JGVH 4WU5B 4WUKL 3C5ZA 5DWUL 5MERB 1TVBB 4X6DF 5EIVA 1IT9L 1YPZB 4PJGF 4G8FA 5I18H 1RZ8B 2KZ1B 3MFGB 1FO0L 4PJ9C 1AGEB 1W0WA 1NGPH 3DI3B 4NJ9L 4ODTH 5DFTA 1T7YA 1ZHLB 3IDNA 4L8CA 5IB3B 3VG0H 2X4NA 2DBLH 1CLOL 3HMXA 4F7CB 4QTHA 1BAFH 2B1HL 3TCXA 3PABB 2PCPB 2CD0A 4ELMA 4LVNB 1AGBA 3VWKB 5T3ZD 1U41A 1Y0LA 5BXFB 4S1SH 4XP6L 4R4BB 4P9MH 5I9QB 3TBVB 3RNKB 2ZPKL 4TTGA 2QJDA 3TT1L 2IG2H 3RTQB 2VE6A 2HKFH 3QUYA 1DQDH 1FL6A 5ELIA 4YDVB 3X12A 3ETBF 1LNUA 1H3TA 1MVUB 2X1OA 3QNZB 5DHYB 1RZGB 3MRNA 1OARH 5DJ6B 1T6WA 2NR6C 5HYJB 3NACH 5IW1B 1S3KH 1NMBH 5GGQH 1BQHB 5J13B 2RCSH 4HIJA 1QFPA 1DE4A 1PX3A 4X7EC 4Z7UB 5I1LA 3S37X 3PUCA 4P46B 5LBSH 4M7KH 3GKWH 1FG2B 4L29A 5HDQL 5D7LE 4Y4KD 2DRUA 4ZOBA 2A77L 4M3KB 2IPKB 4BQBA 1QVOB 1TXKA 3DO7A 4PTUA 4P59H 3KNBA 4J12A 2H32A 4G8IB 1XH3A 5DD6A 3WHXA 3ARPA 1KPUB 3RZCC 4NCC2 5BO1L 2H45A 4RISH 4WHTA 2VXUL 5F6HI 4OLZH 4XAKD 4JPIB 3EDJA 4PTTA 1IM9D 5I76B 4AJ0A 3PNWA 5B38B 4HUVB 3M07A 3CVHA 2GTZB 2PO6D 2P43B 4MYWB 5IHZA 3CDGA 5A2KH 1NFDF 3KPLB 3GJEB 3DVFA 1W72L 2AJYL 4ODSL 1Y6MR 5DJ8B 2OBGA 2NXYD 1GCFA 3PGCB 1LQSR 2CLZB 4NOFA 1Q9WB 2Y6SC 2UUDK 3CLFH 2RFXA 4U1LB 3QXDA 2HFEB 5L88L 4NKMA 4XX1G 2VABB 1I3VA 5C0JA 1X5AA 4DCQB 2F5AH 4H0HB 1P9MA 2J8UA 3EFDH 5CS7A 1J5OL 4GAGH 4GRMA 3QNXB 2HT4D 3CGTA 1T3FA 2CLVA 2FJGB 2QQLL 3MRBB 1S7QB 3H7BA 5GGRB 2NCMA 4JJ5B 5FUZL 1ZT1A 1U8IB 3DHJA 1OP9A 1YEJH 5IBLC 2FX7L 4MXWH 1ITBB 5DYOA 3S35L 3GUTB 1R3HB 3NBNA 1IBGL 4OB5L 3WFDH 1YQVH 4KY1L 3ARUA 3UTPD 3HKFA 4HEPG 4YZFF 5IF0B 4F3FB 4JPWH 1GL4B 1V7ML 2LU3A 1R3KB 4EN3A 3P4OB 2D7MA 4QHLA 4XXDB 1A7OH 3HC0B 4CVZB 5E2WH 3MRGA 4YZFE 3L1OH 4MS8D 2AXJA 1JNHA 5FO8A 4H1LG 2V5YA 5J9PB 3PQYB 5J8OA 3TWCL 5D2NA 2PR4L 5J6GB 1EHLH 4OGYL 2Z8SA 4HUMB 3H3KA 2H8PB 1PSKH 5F8RC 2HG5B 2FGWH 4J4PA 4FXKA 4LHJB 2O5XL 3WDIA 3CVHB 3VXOA 4OQTL 4LSQL 3AROA 4S1DD 1KACB 3V5HB 2GUOA 4Q0XH 2YBRA 3TBYA 5J9PA 4A2LA 2AERT 2HWZH 1KGCE 2HH0H 2NZ9C 3QPQD 3VA6A 2HLAB 4HXBH 3D2UB 5ITFB 3INUH 3ZTNH 1CFNA 3EO1B 1MFEH 1KXTB 3CXDL 1RZFH 4G6KH 3VGEA 4IOFD 5FHAH 5FIEA 3ZYIA 3NCBB 5BW7C 5HYJE 2BVPA 1IFHL 1WZLA 4LDOB 4PJEA 1YPZA 3CXHJ 4CADB 4ORGA 1UEYA 4E42B 1P84J 1KB5H 5TH2A 1JMZA 2X10A 4MSWA 1CF8L 1NPUA 3S36H 3GSNH 4OT1H 1XCQA 3QI9D 3S35X 1YN7A 4M61B 3PE9A 5GS3A 5C0FA 5EOCH 3TC9A 4OCYL 5IB1A 2IEPA 3MV8A 1FBIL 1DLFH 4FP8L 1VEOA 4MDJA 4V1DA 5ICZA 2EECA 1MFDH 3Q6GH 3SE3A 2ICWJ 1CGSH 3RBGA 1J1PL 1YYLH 3MA7A 4BH8B 4Z78B 2ATPB 3H9HB 4XCFL 5KVDH 4CJ1A 1D9KA 2YUWA 3KLAA 1BHGA 3UZVB 2WUCL 2X70B 1EEYB 5CP3H 1ES0A 4TRPL 2W92A 4WENB 5K93A 4Z9KB 1JYNA 1JF6A 3P77B 4M5ZL 1MFAL 4QT5B 2WP3T 4LP5A 3QDJD 3D9AL 4PJEB 4PLNC 4OZHF 4X80H 2A74B 5CINH 1U8PB 3KVQA 2C4FU 1I8KA 2APBA 25C8H 5IOPA 4ODWB 4YDLB 1JGEB 3MUY1 5FDYA 3EYSH 4C4KO 5ABDE 1J8HA 2VXQL 2ZCKH 4G8IA 1V3LA 3LS4H 4Y5YC 3WKML 3ZDXE 3FB6B 3IJHA 1RJLA 2LVEA 4LCYB 1ZWIB 4UV7H 2AEQL 1CICC 2EC9T 2G2RB 4KAQL 1N26A 3HHRB 4MQ7B 4RA3A 3HG1E 3ZDZF 4YE4H 4AIXA 1BVZA 2E9IA 4Y5YB 3VGBA 1VFBB 4HD9A 3NN8A 4MWFB 3GSRA 4TSAL 3IDGB 4KXZI 2E3VA 2DICA 1B0GB 4RMUA 3LEYH 5F7MC 1OTSD 3C5SA 2P5EA 3WUWG 1BWMA 4IOIB 1UZ8A 1RUML 4XNMB 3VFMA 4BYHA 5HVWA 3MRPB 2DMKA 4L9LB 3BQUC 5C0DA 1FV1B 4JEGB 5E8DL 1EO7A 1NQBA 1A7NH 4UUJB 4XPFH 1AJ7H 2X7LB 4NCC1 1EO5A 1E4XI 2UV3A 3BQUB 1N64H 5C0BD 2R56H 1R6VA 3UJJH 3GZKA 5MP6H 1U42A 1U8KA 3SO3C 4XGZB 2HT2D 1NMAH 4S1RH 5C3TA 5SWZA 2F53A 3QQ4A 3GRWH 1V8HA 1L7TH 3SKOA 5DS8A 2NX5B 1QPXA 4JJ5A 2LABA 1YQVL 1A6AA 3KWWA 4P3DA 1I7UB 5FYKL 2ZUUA 3OKYA 1U58A 3QFJE 2IPKA 1UM5H 2WMPA 5FECB 2E7CA 4YHPA 5ISZB 1JPST 3BE1L 3GMRA 1B6DA 1TVBA 5DD3H 4L8SA 4XWGL 4X6DB 1D9KC 4JFXB 5KG9A 3BUTA 2J1KA 4PJ8D 1X5HA 1X6LA 4MCZB 3I02A 2A73A 4XVSH 1I9IH 3RWFA 3V5KB 1DQQB 2WWKT 2HFFB 4YDJB 1E4WL 3OR7A 5SWSE 3RP1A 5LQBL 2AABL 1KCVL 4QGYA 1YEHH 4B0MM 1OW0C 5EC2A 2SEBA 5I1CH 3L3OB 1WT5C 1SEBA 4Y5XA 4EI5D 4JRXD 4Y4FD 3CFEA 4L4JA 4WNQB 4LHUD 1FDLL 3L3KA 1KTRL 2CQVA 4RBPH 1FL6B 1WZ1H 2IQ9L 3K7UA 5H37H 1QRNB 3REVB 4X5WA 3LMJH 2BRQA 4LKXA 3QJHB 4XMLL 1QLRA 4OFKA 3SDDD 1IKFH 5F7FA 5JW3H 4JY6B 1U8NA 2ZUYA 3C09B 4XPTH 4C58B 5CFHA 3CFJB 3HTLX 5IMMB 1K6QH 5CUSH 1T2QL 4PREA 3U0TA 3VG0L 4POZD 2YPLA 1DVFB 4LKCB 4BFBD 3E1F1 4RIRB 4YQXL 3X11A 2MWCA 1UH3A 5I16B 4MQXC 3TT1H 5HGGS 4HUKB 5AD0A 5DHVB 5D1QC 4U1NB 3QXAA 1DQDL 3KXFA 3RWCB 1IEHA 3P30H 3WIHA 3G5YB 1U8QA 3MRPA 3ARFC 2X1PA 5BZDA 1QFWM 2VRAA 3GSWA 4Y19B 5JR1L 1UG9A 4C54A 5ITBL 4KU1A 1BJMA 1QSEB 3ROOA 2BX5A 4JGUA 1RUKL 4PJFE 4X99A 4GUPB 2VDPL 5GXBB 4EKXA 3EZJB 4C55A 5HDQH 4R4BA 3CFKA 4FFWD 3K3QA 4N5EA 1NEZB 5CD5C 3QDMD 2P5WD 4L3ED 1FN4B 5HHOE 3HLAB 4HWBL 1U0QA 3I6KB 2OQJB 3BPCA 3OJVC 5EU7E 5JA9A 2I5YH 1LGVA 1AQDA 5CBEA 5DD0L 4ZD3L 3U36A 3F12A 4WO4D 4HUUA 4L3EB 4OLZL 3L9RA 4HK0B 2EEAA 2ZCKL 2WSKA 2V9TA 2LVCA 2DYPA 3QIWB 4ZTPH 3K2UL 3F7PC 1ORSA 3GJFH 5EIIA 2EEDA 1K3ZA 3HB3C 2VDRL 1NEZA 2VNCA 4DVBA 5HGDB 2ICEB 3L3IB 1TZHA 2ZKHL 1PKQB 5GRVL 3RWEA 1IQDA 3O8XD 4NC0B 5GGVL 4UINL 4UU9A 5JW5B 5IVZB 1NFIA 3RVWD 1DQQA 3TO4D 4JPVL 4GW4A 4JZNA 4PGBB 4MD5A 1OB1B 3P73B 1QSEA 4JFDE 5K9KB 4HUWA 5F7EL 2VITB 3NTCL 1RZIA 1FLRL 4CU6A 4BSVA 5E8OA 1N0XH 5HGAA 4D9LL 4LGRB 1DQML 2FCBA 4Q9QL 2JB5L 1KT2A 1RD6A 2C5DC 4V2BA 4TNWF 1BFOB 3P0VL 5MP6L 3VWJC 5J7CC 4HUUB 1AGFB 1MIMH 5HVHB 3VE0B 4MNGA 2K1MA 5ILTH 2FX7H 5CIPH 5KSBB 2LQRA 1CR9H 2OK0L 4N8VA 4WI3A 4KHTH 4PREB 3H9SA 2AKRA 4P5TA 2GJ6B 2ZCLH 2ESVE 4YFEA 4BSWA 3VRJA 3VXSE 4X7CC 2GIYA 4X4MA 1UB6B 1CD8A 4HQQH 1VGEH 5I1IH 4ETQA 3OSKA 4CW1B 5J1AB 4HBCH 3KS0H 2XPGB 2W0PA 1AH1A 1N4XH 1WCQA 4HWUA 4L3EE 4OQTA 3SDCA 1DDHA 1ADQL 2YUVA 5C09E 5MEPB 5CZKA 4OGYH 5GRJH 2CK0H 2ZOKB 2AABH 4HT1L 5C07D 4F2MB 3BP4B 4FQHB 1ACYH 3MV9D 4PGDB 4JRYD 3T0EE 5JIPA 3O3BA 3PQYD 1RZKC 1ZGLB 4OM0H 5J4MA 4PGCA 5GJTH 1REIA 4UAOB 5DHVH 3VXQB 3TNNA 3JV5A 4XBEL 1Q72L 4P23B 4UOJA 1KPRA 1K4CB 5BV7C 1FYTE 2HJKB 1QFUL 5DJ0A 5F7WC 3BPCB 1U9KA 5D70L 2W0FB 4QRUA 4JFEB 1UJ3A 5E2VH 3S7GA 2Q7NA 4X98A 2IFGA 2A0LC 5DFWH 5I1JH 3F12B 4KJYA 2AV1B 1OCWL 2Z92A 3LKOB 3JWOC 2D2OA 1HE7A 4FXKB 3HCVB 1KTLA 1U8LB 1A14H 2D0FA 3RKDD 4JANA 3HMXH 1I8IB 4NNXB 4HLJA 1EGJA 3TJEL 1F5WA 1U91A 4LP4A 1UC6A 1F11B 1QG3A 1SVZA 4XBPA 1P7QB 2OS7A 1SJHB 1CD9B 1NJ9B 1BQSA 1DBJL 1FYTD 5EU6D 1ZLUK 5C0EA 2ZNXA 5JHLL 5AD0B 3K4AA 4P5TB 2B39A 2R23A 4HGWA 4P2RE 1SQ2N 3G5YA 2EDDA 3C6LD 3GSOA 1CDHA 1JHKL 3KPOB 5ALCH 3SOBH 3LKRA 3KYNA 1NGYA 2VDPH 4BZYA 3IB4A 1RJCA 2NY5L 1OVZA 4ZAKC 1ZHBB 3L5XH 2HTKD 4X7SL 1A4KB 5GGVY 5CJOL 1I3RB 5K9OB 1JYXA 1ROWA 2IBBA 4ELMF 1VPOH 4HWBH 5I76A 5HD8D 5C7XL 1CS6A 1MCJA 4EI5A 4HH9A 2WBJC 4F2MA 3OKNB 4C56E 5JOFB 2G5BB 1TNMA 2R4SL 4XNUH 4R0LA 1MCRA 1NGYB 5J3HD 4JG1L 3V0VA 4ELME 5LG1A 3QA3B 4ZTPL 3O2VH 1CG9B 4QRRB 1JNJA 1LE9A 3WNMA 4FFYH 3RIFK 4HC1A 2C4FT 3L5JA 1KULA 3BT2H 2FECI 3WDHA 2AJVH 4NYLB 43CAB 4PBVC 4PLKC 4WI9A 1XF3A 4Z7VE 1UGNA 3W0WB 4ZUUA 3GI8H 4MJ6B 5L7XL 2VLKD 5D2NE 1CG9A 2GTWB 4U3XA 1UACH 1RK1A 4K8RC 5DHYA 5D71H 4ZQKA 4D0CB 2EZ0C 1ZHNB 9CGTA 1ZKAA 4EUPG 3H9SD 5L6YH 2A6DB 2IQAB 5GQBA 4CJ0A 4HHAB 2KQMA 3ZKMC 1CICA 2DKSA 3AB0B 1LQVA 2EDEA 2EE2A 2CR6A 3P0VH 3FQXA 4LSTH 4JFHD 4U6YB 5KJRH 5L2KB 4WDIA 2OYPA 3SCMB 2MJWA 3WLWC 1V7NH 2VDNH 5C8JB 4I18B 3V52L 2Q3AA 3N1PC 4P2CG 4AG4L 1BAFL 4KZEL 3C5ZB 1O0VA 4RMQA 3QDGA 4IMKC 4F58H 4JFOB 1SEBB 3O6FB 4U0RB 2QV2A 3MA9L 1CU4L 2VDQL 2IANE 4LSSL 5AZ2L 4QHNB 3C5ZD 4O2CA 3DMMD 5T1DL 3J8F7 1OSPH 1KIPB 4HPYL 4NM4H 4OLYH 3QNYB 3TH3T 1FJ1B 1QBMH 5E2JA 2HJFA 1CDUA 1HEZA 2ZOLB 3B2VL 4Y19D 4BH7A 3L9RB 5F7LB 4BZ2H 4JR9H 5IHUL 3U4EB 3W9EB 4PJIA 4MA8L 3OG6B 4LCCA 4RWHA 3GB7A 5DS8B 1Q8MA 3T3MF 4O5LL 3G9VA 1SJEB 4JDTH 3V4UH 1T89C 5EN2B 5B38A 4P23C 5FK9A 2Z91B 3KLHD 3A6BH 4G6FB 3VFWB 4UTAL 5I1DB 2R0WH 4M6OH 4Z0XA 2QSVA 1DZBA 4LCUA 2A2QT 5AYQA 3H2WA 3THML 4XP4L 1MWAB 5IB2B 1R3JB 2W9EL 4LCIH 3RUGE 4XMLH 2GI7A 3U0PB 3HZVB 4GG6B 2YR3A 1IL1A 4FQIH 1YN6B 3RVVC 1FGNL 2JCCB 3EJJX 3U0WL 1KT2B 4CN4A 3JSSA 5FYLH 3SGKC 3S9DB 2OI9A 5B39B 4NC2B 1FIGH 2DIJA 3QQNA 1FSKB 1JPGA 2IPUK 3W82A 3MACH 2FZ3B 3O81A 1QSFA 3MRLB 4X5XA 5KBNC 2J8HA 5HHOD 2ATPA 4EOWL 1HSAA 3TCLB 1H8NA 4RAHA 1HYRC 3NFSL 3ULSA 2GW5A 1EEYA 1F90H 1W72A 1U91B 2JJVA 2DB8A 4BJLA 4XCNB 5FYKD 3UBXB 2DM7A 5DVKA 4N90E 2IWGA 5FCUH 3MRLA 3QO0B 1ORSB 1MI5D 2RQ8A 4V3DB 4LVHB 3ZKMD 4ZAKB 4RX4D 4NQXA 1QKZH 2OTUB 1FYTA 4FTVD 1OL0A 4ZDHA 1INDH 5SWSD 5C07A 2Q6WB 2C1PA 3BKCH 1GPOL 3RI5K 2EH7L 4OGXH 5IHZB 4XMKL 2WY3A 4JCLA 1JPTH 4NHUA 3DX8A 4N8CH 5FYJH 3E3QE 5E5MA 1VSCA 1NGQL 3VJ6A 2F53E 4OI7A 4JM2C 4Z77B 4OV6F 3VXQA 1K8IA 1CK0L 4XMPH 2PYFA 1A7OL 5KVFH 1A7RL 4Y8DC 5JO5A 4L5FH 1RZ7H 1X5FA 2VLME 3J7HA 4HIIB 3JV4B 4M7LL 5JHDE 1OAYH 5C0FB 4JO3L 1VCAA 4P49A 5GGTL 1LO0L 3ULVF 1H3XA 3LRGA 3WUWB 3D48R 5KSBF 4PJIB 4F37F 3FONA 3OB0H 2FJGA 5FYLE 1R3LB 3DO3A 4ZSOE 1GVIA 3RGHA 2PYFB 1GZPA 4NIKB 4GAFB 3ULVE 2HJLA 4YGVA 1UACL 2YKLL 4DVRH 3QYCA 5JXAL 1NAKH 4M48L 4JG0H 1T5WB 4K94C 3WNPA 1NLBH 1J0JA 1HCVA 2DDQL 2HH0L 5CBEB 2J4WH 2DL9A 3VMNA 5IT2L 3L7FB 5I15H 3DX8B 5C0RH 3B8SA 2HN7A 1OAUH 3EDEA 1Q9WA 5ETUA 4BSJA 5J11C 3FB7A 4BUHA 4KK8C 5B4MC 4PTTB 3KJ6L 4HPOL 2K7QA 1KEML 1J05A 3P4MB 4HJJH 2VXSL 3VA2C 3WNOA 1MIML 4Z7OE 1EVUA 1T5WA 5GRWA 3D39D 2CDEB 4GSDL 1S7RA 2FL5A 1RUAH 1NBQA 2EKSA 3IU4H 4KV5F 3WXWH 3PQYE 4YHZL 4N0FB 5CKGA 3NVQA 4PJHE 3MRQA 3TVMD 4WW2F 4GRLA 3RGVD 4U2ZA 2WM0A 4FFVD 1LO4L 3MRRB 1IC7L 3MODH 3VH8A 2B1AL 3E6HB 3FRPA 3HRZB 3SY0B 4Z0BH 4HBCL 2PO6B 5IB4A 4RSVA 3PDOA 4K3HA 1N4XL 3ROLA 4NZDA 2AK4B 1JZ8A 4KJQD 4QOKB 3VW3H 4TRPH 2ADIB 2R2EB 1T7XA 5IW6A 5E70A 3LN5A 2ZWLT 5DK2B 1U8IA 3DV6A 2PO6A 5C07B 1XF2A 1UKSA 3BIBX 1KFAH 2EDFA 3D85A 5F7DA 1C08A 5JHDD 5GS1C 1KYOJ 5L2KE 3KYKH 2JIXD 1PD6A 4JKLA 4I0PB 2Z91A 4JM2F 2CJUH 2CRYA 4P9HH 5CP3A 3SGEI 2CPCA 2CO7B 4QNPF 4I2XE 1SVCP 5D93B 2NY3C 1VERA 1ZLWH 1S5HB 4TQEL 4K7PX 1RURL 1OCWH 1KXVC 1AE6H 5I74C 5T3ZE 1Q9LA 4Y7MA 2J8UB 1BM3H 4LNVA 1MSPA 1DN2A 3KYNB 3RVUC 4NO2B 1DBBL 1JZ2A 3GHEL 1MQKH 4JFYB 4KJWC 5D2NB 3IVKB 3RTQC 5GGTA 5IP4A 3PWNA 4QRTB 3IYLW 2OJZH 4GW1A 1OW0A 1QRND 5F1NA 2DIAA 3NCJH 1QYGH 5I0DA 3O3AB 3P0YH 4K8RD 4TPRH 4PBWD 3CC5A 3QWOB 3I3BA 5DGQA 4TVPH 4HCRL 3MR9A 2KL6A 2VE6B 4MQ7A 3G04A 2L0DA 1OSZA 4G6JH 1KV3A 3O3UN 1CZ8L 4CVXA 3VXSD 4CL7A 2BVUA 1I7UA 2A9NH 4MWFA 5CCKH 1F3RB 4X6BA 1N7MH 3BYYA 3HE7A 3U4AA 2NTSP 1KCKA 2FR4B 4YHIB 3AREC 2BFVL 2B4CC 1J05B 4HUNB 2UVEA 5K9JH 3ZLQC 4LQFL 4P3CH 3ULUD 4YDIH 1JJUA 3CCHB 1WAAE 1F02I 4PYHA 3WN5A 4HIHB 4F15C 2EKSB 3WCYA 1YC7A 1HHIA 3WFZA 3BOVA 4EDWL 3FB8B 2XWTA 1HH9A 3GMMA 1FFOA 5KN5A 1YEDB 4RWYH 2WWMD 5DURD 4YX2H 3BP7A 2N56A 3GJFA 5HVGB 4DW2L 3E8UL 4ZXBB 3NIFE 1JZ5A 5KVFL 4IOIA 2FEDC 2AVGA 3O6ML 3PHQB 4LEXH 1YC8A 1KLGB 3ARSA 1OGTB 3IJSB 3BPOB 2D7TH 4KJPD 5I1KH 1UCBH 4WW1B 1XGQB 4TULH 4Z7UE 4DN4L 2BNRB 1IM9A 3QDGB 4EI5C 4X6DA 1JZ7A 4NO3B 4G9FD 1TENA 3R4DA 5JIIA 1YA5A 2DQCL 4DQOL 1UJ3B 2FD6H 2G2RA 2F5AL 4CNIB 2BNRD 1C08B 1DSFL 2EDRA 3FRUB 2V2TA 2PYEA 1GRWA 3PWLB 4D0BA 2NXZB 1FIEA 1UA6L 2AJ3A 2V7NB 4S2SA 4JQVC 3SGEH 4TSBL 3B83A 1BD2A 2I07B 4ALAL 2NW3B 3VDCA 5D1QA 5C0IB 4DKFL 3ARVA 3MSPA 5C70A 1VGKB 1VADA 3QIBC 1A6TB 1QBAA 3C9NB 3MZGB 4LOUC 2Y7QB 4IRZH 2Q6WA 1MCBA 5FK9B 3AS1A 2MKLC 4I4WA 2ZSWA 4H25A 2DWEB 3GMPA 4Q97A 4LSSH 5I75C 5E6IC 4U0RC 4JB9H 5EDXA 3EOBB 3FCTA 1Z0MA 4XXCC 3RWHB 5H2BB 1YMMA 1ED3A 5ALBH 5JUEL 5ID1A 1T66C 3OKOA 4OLYL 1U8MA 4XVTH 3V6ZB 4GG6F 2A6JB 5T3ZL 1MHHA 3K74B 3MV9A 3G6AB 3SDDC 4MD5B 4M62L 2O93L 1M05A 4MZ3A 1ZS8B 2R0LL 1GIGL 3LH2L 1G9ML 4P2RD 1JZ4A 2XKNA 5IM7A 1RZKL 5BMFL 2FB4H 3LQAC 2GFBB 5HHMD 5TPWH 5J6GA 5ADPL 4LLQB 2VC2L 4TSCH 4XPGH 1A6ZB 4OLXL 3ZKND 1OTSC 3TA3C 3RVUD 5KOVC 1NKRA 1D9KD 3MUHL 3L3JA 3TO2B 1Z9SA 4O2CB 4MAUH 4JM2D 2XZQH 3CH1B 3L3DB 3ULVC 4Z7WE 3FZUD 2DQHL 3C2AH 1FVEB 4NRZA 2CDFB 3EO9L 5HHQB 1I4FB 1J88A 2ZNWA 4QHKJ 3W5MA 4HMEA 4LSVH 5D96B 2EO9A 5TF1L 1PG7L 3B5TA 1F45A 1MAJA 3M45A 1T3FB 3OB8A 4WV1B 5FF6B 1IILE 2DI9A 3NCYS 4KRPD 1CF8H 5CKAA 4OT1L 3KPQA 1MHHB 1V05A 2AGJH 5J89A 1RK1B 5DEFB 3BEWA 3DTXB 4OD2B 3L95A 5HHVL 2DKMA 2VXVL 4NNPL 1FVCA 3PV6A 2G9HB 4M7ZC 1FO0A 5DQ9B 4WV1A 4JFZL 4WFEE 2HFGH 4Z77A 2DQEL 1OM3H 4Y4FA 3QFJD 4ZUVA 4NQDB 1RVFL 3WS6C 4RMWA 4JO1H 3C9NA 4DFHA 3IDMA 1WF5A 1MLBA 2ZP0T 3Q1SL 4TVPE 2W9DH 1KIUA 4Z7VB 1MPAH 2MPAL 4U1SA 2E7BA 3KPSD 2VDML 3WJLA 1OAZL 1SM3H 5GGSA 4YFDB 3GIVB 4PJIF 5IMMA 3H7LA 4IDJH 4KQ4H 5C9KA 2L7JA 4M03A 1ZLSL 3WHE0 2H1PL 3WNNA 2E27L 3L5HA 1JUFB 2AEPL 1ZS8A 3NFNA 4NJAH 3W9DB 3QI9A 3FFDB 3CPLA 4PGEA 3VXSB 3STZB 2I24N 4Y16D 5DUBB 2CR3A 3QXAB 4JPKH 1F4XL 4AQOA 3S37L 3T2NH 4E5XA 4HJGB 2R1XB 5H2BA 1EO8L 1KNOA 1NDMA 2N7BA 4LEXL 1YECH 5CBAA 4K3DH 4NQVA 4D9RD 3VFUA 1A64A 4G7YH 5IMOB 1MRCH 3T1WA 1WWBX 2BNQA 1A8JH 1IEBB 5ICXB 1Q94B 1G7IA 1UWEH 2B5IC 2FEEL 3TN0B 5IMKB 2JKXA 3LHPH 5E56A 2XIDA 4CAGA 2XQYK 1Q72H 3MOBH 3HA0A 3E6HA 3HRZA 5FFLA 2X44D 1U8LA 1QR4A 2XKSA 3S98A 2O5YL 3QPQC 4V2CB 2ZUVA 5DK0A 2NY4D 4NRYB 4CDHA 2VR5A 4KFZC 4UZGA 5E2VL 1DEEB 5E6ZA 2M2DA 4LLDA 2LTQB 4N9GA 3T0VA 3SE9H 1S9KC 4YC2B 4XHJC 4L3CB 3U7WH 3U46A 1ZHBA 2N1KA 4FHBD 2H6PB 3FO0L 4PRHD 1BVLA 2WINB 1FORH 1QZ1A 1KPRB 4QGTA 4GMSL 4KGJA 2P5WB 1LVEA 4KKNA 3MFFB 4J6RL 3TPKA 4YHIA 3H9YA 3DV6B 2EDHA 4IOSD 5DK2A 4QRUB 2C9AA 4N8VG 3PP4H 4ODUB 1CQKA 2O61B 3MV01 5D6CA 3MRNB 3SDXF 1YEIL 2B1AH 4ZUSB 2LU7A 3OAUL 4U1GB 4KVCL 5DD3L 3IDXH 5CJBA 1NCCL 1XIWB 4NP4L 4PGCB 4WWID 4KI5C 3VFPB 2X4QB 4M43L 3MRJB 2DQUL 3MFFA 3SKMA 4FNLL 1MY7A 4X6DE 1QO3A 3WLBA 1I8IA 3GDBA 2CKBL 3MLRL 1A3LL 4TYUA 3MJ7A 4WCYH 3GJFK 2C7UA 2VQUA 5D7KE 2PN5A 3SDYL 2DIBA 3OKMB 4GQ9H 4G6AD 2FL5B 3ZE0E 5ALCL 5HHXL 2DWDB 1S9YA 2Z31B 5CWSA 4P2OB 4H20H 4R90H 3S4SG 3OHXA 4JFYA 3IVKA 3UBXI 1TMCB 2VMFA 3BD4A 1OAXH 3CSYB 3BPNB 2ZG3A 4YHYC 1EXUA 2EO1A 5H94A 3U48A 3HCVA 4PY7B 5TE7H 4RGMC 1MFCL 4AIZA 4DKEL 1ZEAH 5F6IC 5C6TH 1HI6A 2JCCE 4K94H 4WNQA 3BW9B 1PFCA 4PJCE 5ID0B 3QDGE 3HS0A 4P2OA 32C2B 4JHAL 1KB5B 4PJDF 5GIRA 2H2SD 1FL5B 3VCLA 5IK3B 3WL9B 2AQ1A 3FONB 5C0EB 1WV7T 2YUXA 4NFBA 1Q38A 3U1SL 1I8MB 2VLRD 1TETH 5KSAD 1VFOA 3DRQA 3CZJA 1FZMA 3ULUE 3UAJD 5C92A 4YPJA 3L7EA 4YNYB 4ZTOH 3MUJA 4OTXL 3QA3A 3QSKB 2F8XC 2BJML 1QYGL 3MUZ1 1RJZA 1HZHL 1A6VL 4HS6B 4F7PA 4KROB 3MO1B 2JIXA 4JRXE 3WD5H 5C8JA 2X09A 1RULL 2Z8WC 1CFQB 1D5BB 4X4XA 1P53A 5FDWA 1T66D 5DD1H 3UYOD 3S88H 3ARBD 3UTTD 1TZIA 4N0UE 3MV7E 1TNNA 1NUNB 1S7RB 4W81A 4WTZG 5CEYA 2R15A 3WEXA 4QY8A 4GXVL 4IEFB 3KJ4C 3MRQB 4KJYB 3HC4H 1N2RB 2ARJA 1FL5A 3VCLB 4IDJL 1FPTH 4HDIA 4UIKL 3HE6D 4I3SL 3ZKXC 4X6CF 2EIZA 5C2BL