1T0NA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0nA01
4ZO6A 2NY0C 3U9UB 4DGIL 4DKFL 3UJTL 3Q6FB 2A38A 4QY8A 3WFDH 2P24B 3K7UA 1QSED 4N8PA 4FNLH 1JGUH 4OF8A 3BPNC 1Q0XH 3KYOA 4NZRH 2AXJA 2DQFB 3HE6B 5HI5C 4QO1A 1EJ6A 1GGTA 1OT1A 2X4PB 3RZCB 3GM8A 4Y4FC 4Y5YA 3HMXL 5M95B 1B2WL 3OZ9H 1QR1B 1UXSB 3TO4A 3O6LH 3U7AA 1OM3H 3HC0B 3BGMB 1CS6A 3D9AL 2ZOLA 4ORGB 3A0OA 5IQ9A 5D2NC 2ESVA 1ZS8B 5FO8A 2IFFH 5I2IA 4CNIA 4V2BA 1U93A 5KW9L 4CL7A 4LSQH 3NGBB 5FGRA 1TITA 5L7XH 3S4SB 4X9IA 3OKYA 2JCCE 2V9QA 1GAFL 4ERSL 5D5ME 1D9KB 3EOAB 5EFIB 4ZUTA 4O2CB 1TFHA 2Z4QA 1HQ4A 3O4LE 5EH1A 1P5VA 4ZUSA 2W91A 3EHBC 1R0AL 2NY6B 4V1DE 3OB0K 3ULVH 5GGVL 3LS5H 4XCNA 4LCUA 3NCJH 4NKMA 3ULVF 4WO4A 3HR5B 4L8DA 3MRDA 4PJHA 5MP6H 4M48L 3BH9A 5F1NB 1T3FA 2KL6A 3L3IB 3BN9D 5ANMA 5DC9B 2IEPA 4BH7A 5KAQF 4XPBL 1TJGH 5CKGA 5KOVC 4WI8A 1V7MH 4Z78B 1LWRA 1NAMH 4PLKC 1CL7I 3QB7C 2V6HA 2B20A 3LH2L 3CH1A 4APQB 4NNYB 4U1GC 2EXYD 1AD0A 3D18B 4XNXL 1GPOL 1IC7H 4ZAKB 3VU2A 1U6AH 2NY7L 2NXYD 4JE4B 4A2LA 3ZE2E 1I7RA 1EGJH 2VLJE 1X5IA 3B43A 3PWPA 4GXUM 3DRQA 2EDOA 3PGCA 4MD4B 1Z3GL 15C8L 1ZHNB 1X4ZA 3D1MC 1MF2H 3DV6B 4TVSa 4JB9H 4BA8A 4ZUVB 3C6LC 5BRZA 4DFIA 4I3RH 4H5SB 4Y4FA 5CGYC 2G5BA 4MNGA 2OR9H 1ZHBB 1U8LA 4X4XB 5FCSH 4S11A 4U1SB 3LKOA 3Q1SL 5D1ZD 4XBPA 1FZJA 4JO3L 3MROB 1J0HA 2BNRE 2P8PA 5IBTH 5D2NA 3UJJL 4OF7A 1C1EL 4MD5A 4RMVA 3VI3E 3HA0A 5CGTA 4XRCA 5HI4D 1XF2A 2Y5TA 4DUVA 4CW1B 3CDGA 3JV4A 3CU7A 5TE6L 3ORJA 1KCGC 1L0YA 3CFEA 5HHQB 2VDNL 3HRZB 4LSUH 4UQ2A 3H3KA 3T77B 4NWTH 5SWZA 3STLB 2QADD 1OW0C 4MA3B 4R26L 4ISVA 4Q6IC 3SY0A 1ACZA 3QNXB 1RMFH 4EDWH 4EDXA 3MYJB 2AV1B 5I1IH 3JWDH 4IIQC 3RP1A 1JUFA 2FX7L 2NZ9C 3UMTA 2YSSB 3VGBA 2PCPA 5EU4B 4NGHH 4MXQA 1A6WL 2A6DA 4ZTPH 5AWNH 4PGEA 1OCWL 1RZJH 2BVEA 5HGGS 3SE8H 3G5VA 3G5XA 2VXTL 4D0CA 1SBSH 1A7BA 5HPOA 2IGFL 2RR3A 3B83A 1DVFD 4M7LH 5H37H 4HJGA 5EC2A 2XPGA 4GXUN 5E8OA 1B0RA 3RGVC 5CEZH 4L3AA 4UV4L 3BX7C 2W0KA 3EDDA 3EYUL 3N06B 1FVEA 1JBJA 4U7MA 3MRIB 2HJKB 4Z9KB 3BMWA 3HI5H 4BFEA 2F53A 5ETUA 3PP4L 1CGUA 1PGRB 2NX5E 1B4RA 2IPTH 2A73B 3UYPA 1P9MC 4PJBB 4D9RE 3BW9B 4TUKL 4MJ4A 2K3TA 5FO9A 5HPMB 1MJUL 1KCUL 2O5YH 5DMJB 1I75A 3C6LA 3Q5OA 5ILTL 1RPQA 1MCSA 4B7LA 5LAXB 3T09A 1IGMH 2WIIA 4OZFA 5MI0C 3FHQA 3EYOB 4M00A 4RDQF 4EOWL 4U6XB 1AXSB 2ICWA 1P1ZB 1OAQH 2P5EA 3T4AA 4DJMA 3I6LE 4YBQC 1C16B 4OGYL 5D9SA 3EFDH 4WEUD 3LMJL 3HE7B 5T5FL 2X89A 3DTXB 1QQDB 3IRZA 3IJSB 1YC7A 4D9QD 1G7JB 2R2EA 3VFTA 2FHBA 4M8QB 3QDAA 2HLAB 4I77L 3H42L 2XZQH 3VWKC 3I9GL 1LO5B 1NL0H 1U3HB 4G7YL 2Q1EA 2JJWA 1PG7X 1QD0A 5ADOH 1RULL 1QRNA 3RDTA 3ULUD 3S96A 8CGTA 5KTEL 1J1PL 4Q6IA 3ARDB 3PXJA 3WL9B 3CVIH 5JQ6H 2ADIA 4YDJA 1S9WB 4WV1C 3HUJB 4G6KH 5T3ZD 3T2PA 2VL5B 3OPZH 3QFDB 4F15B 1BAFL 2GKIA 3MRLB 2A0LC 2P42B 4LSPH 4MNQD 5F9JA 2G75A 1AY1H 4YHPB 5HDLA 3OAZH 1ZLUK 1V3KA 1IEAA 1MVUB 4JN1L 1F8TH 1B0GA 2AGJL 3VXME 1VCAA 2I9LA 4BQCA 2OP4H 5JZ7C 1AGDB 4LEXL 4LLMA 5C0CD 4LSSL 2RCSL 4LLUA 3MRGA 3K80A 1ZLWH 5EOCH 2V2WB 2AXFB 3R06A 3RGVA 2X40A 4EN3A 3HAEA 3SDCD 2BVQA 4N90D 1OGTA 3QO1A 4RFOH 5KS9A 5I1DA 7FABH 5IHLB 1T20A 5GS0L 3P73B 3P3YA 4Y19D 2YEZA 3CJJA 3WD5H 4JRXE 5CP3H 4UDUB 4PJAE 2OX5A 4WU7B 1WBYB 1EXUA 4OZHA 4WVRA 1W8OA 3FFCE 5TQ0H 4HUMB 4BM7A 3FQRA 4I2XB 1B6UA 3EAKA 3FRPA 1Z6JT 4RRPG 3EO0A 4H1LA 2DWDA 2EIZA 2VAAA 3O3AB 2V2TB 1S3KL 2NR6C 5KZCD 3SKMA 2GJZB 2AKRB 1C5BL 4N0UE 5A2KH 3D0VA 2E6PA 3QDJD 4UTBH 3KPRE 4PJFB 2DQTL 1ERNA 5FYKD 3ZKSD 3VGFA 3LDBB 2ENSA 4J8RA 4G9FE 5B38B 3UTSB 1RZ7H 3CX5K 2D9CA 2PXYA 3G9AB 1KCSL 5SV3A 3RU8L 5DFWH 5CZVH 3JUZA 4V3DB 3MLVL 5C09D 4M7ZB 4X98A 3VWKA 3MRNB 5J1SC 2BC4B 3B9VA 3D39B 3N0PB 2MCG1 5KVDL 4ZG1A 3S3SA 3MRMB 5ACMA 3QCTL 5CUSL 4OD1H 2BHZA 5CEYB 1K2DA 2FH6A 4L8BB 3VDAA 4KVNH 4NKDB 5GRUL 3QUZC 1KENL 4PS4L 3OKOA 3DUSB 4HSQA 5E8PB 1N5AA 3HS0A 2ZG2A 1I9RH 1OAUH 5KANI 2QEJA 1XGUB 3HPJB 2F54A 2NXYB 3BP5B 4QGYA 4HK0A 5GZOD 5E2TH 1S9VB 4XMKH 4GG6B 4JRYB 2P48B 4X7DC 5E2UL 2YBRB 5HHOA 4OV5B 3OKDB 3AREC 5ISZE 2IPUG 3CFDB 5HHNB 1UH2A 1TZIB 3WNLA 1L7IL 1H3PL 2AQ2A 1M7DA 2LAAA 4GRWB 2EYTB 4KI5C 4P9HH 4EI5B 4N0RA 3FT3A 2YD5A 5GGUB 3VDCA 5T1DL 4KVCL 5D1ZB 4X6BA 4OLVL 2ICWI 4XXCC 4N5ED 3LB6D 1OVZA 4WGWB 3REVB 5JMRA 5EU6E 3C09B 1B4JL 3VFMB 2ID5A 4GKZA 4MHHG 2DM2A 4JPIA 5I1EL 3MLXL 3TJHC 1DUZA 1GZQA 4PR5B 4E42A 1DDHB 2CGRH 3VXSD 4X5WB 4G8GD 5TF1L 1LQSR 1ADQH 4UBDD 2BDNH 4JO4L 4JANB 4JN2B 3MLSL 2Q76A 4ODSH 5FB8B 1FPTH 3TO2B 1BD2A 2IAND 4XNUL 3IDNA 1P4BL 1K8DA 5KSBA 3CIQA 3P9MA 3UJIL 3ALWA 4FFVD 1IL1B 5GQBA 4NQUA 1IEHA 4HWBA 1JPFB 1DVFB 1U91A 1LE9B 3S97C 1DE4A 1XR9B 1I7UB 1T0PB 4QOKA 3GMOB 3QUZA 2X4OA 1DQLL 4ZFFB 1MAMH 4K3DL 1FBIH 2D4FA 2AJZB 2CMRH 4R0LC 5C92A 2HVJB 4X6EA 1TZGL 1WQVT 2YA2A 4P2OD 5EUOF 4DKDC 2NYYC 3FO9B 4PRPA 4QRPD 4KHXH 3LD8C 2ATKA 2E27L 3OKKB 4IS6B 4NQCA 5JHLH 3AREA 2BSSB 2WWMC 5IOPA 3VFPA 4ZD3L 4DAGH 4HIIA 5F3BA 3S4SG 3OKMA 2CKBB 1MHCB 3TNNA 5KVMC 3GBNH 4J12A 5JPMA 1F02I 3JSSA 3D3VD 4QXTA 5EIIB 5GJSH 2QQNH 4HKZA 3U7YH 1VGKA 2J6EH 5DJ0B 3OXSB 2P7TB 3SDDC 2NLJA 3TCLB 4P4KC 1FIEA 4FN0A 3TIEB 4MJ6A 4GRLC 1R3HB 3KLHD 1A3RH 1EUUA 4XXCA 4JG0L 4XMPH 1KJMA 2BVPA 2GJJA 2VLLA 3CUPB 4YFDB 4AENB 4P3CL 1RY7B 4X4ME 4HV8B 5TGBA 1PD6A 1L8JA 3PP3H 3STZB 5DJ8A 5I8KH 3ULVE 4LHJB 1IVLA 1KJVA 3K8MA 3RFZC 3MYZA 5JUEH 1P7QA 2KH2B 4P5TD 2VLKD 5D1XB 1AE6L 3L1OH 3CDCA 4KV5F 4JY5L 1NMBL 1XF4A 1UM4H 1ACYH 1OOAA 2VZSA 4MNQB 1ES0B 2OTUA 3B2UD 1U36A 5FECB 3RL2B 5KOMC 1VERA 5F9OL 4N0YH 3IAQA 2DBLH 4RNRB 5DVLA 2VH5H 3AY4A 3TBWB 1NGQL 3VXNA 2ZUWA 1YN6A 2HJFA 1KIRB 3FRUB 5C0CB 2PTTA 4JDZB 4RAHA 1J8HA 1F97A 3L3KB 5FM5O 4RAVA 4HUWB 4U1KA 1PAMA 1VA9A 3IFPA 5KJRH 2GCYA 5D5MB 3G04A 3KYMB 2EKJA 5EO9B 3MOBH 4DQOH 2F8XC 2QR0A 3H2WA 4FZ8H 5DMGD 4EKXA 1CGVA 1Q9OB 4Y16D 3RWHB 4FRWA 4R0LA 4M02A 2I27N 1NDMA 4X5LA 2HKHH 1P5UA 1QBLH 5SX4H 3VG9C 5ALCH 1YQVL 5K93A 4CVWA 2VQ1A 4KKLD 3DXAD 2HP4A 3TF7A 2Q6WA 4IHOA 4PGBB 1DCLA 2APXA 5DUBA 1OTSC 3QDGD 4RAUA 3L3HA 1MRCH 2EKSA 5D93B 4OJFL 4N8VA 5T3XE 5HHPA 5DD1H 2R1YB 5KZCB 5CSBA 1RU9H 3ILPB 5E00A 2N4IA 3DARA 1R3JB 4LNRA 2Z35B 1N59A 3RWCB 5ICYA 1RIVL 4MCYA 1NCCL 3SDDA 4P4KA 3T2NH 4GRLA 4B53A 2H1PH 2PR4L 1D5ZA 2DQUL 1QLEL 4XX1E 1CGYA 4ZOEA 2GK2A 2ICWJ 2VLJB 1AGFB 4L3EE 4URTB 2QSCL 4M43H 1KTLA 3HZYB 1FNSH 2ZUXA 4G6FD 3LHPL 1Q9WA 4EJ1C 1QLFA 3O8XD 1BIHA 1OD9A 3GIVB 3TA3B 3ZTNL 3U6RB 5HYSB 2Y1VA 5C9JB 4ZO7A 5KS9F 4YPGB 3LKSB 4Z76A 5E5RB 2CJUH 3DYOA 1YPZA 1VFAA 2QV2A 3SN6N 4PGCA 2XN9A 1BF2A 1QA9A 4FQHA 1QPXA 1JNNL 5CEZE 4PV8A 2BNRB 3AFLA 3MLYL 4QXGL 2NY4C 5C0RH 2CO7B 2EECA 3WLBA 5E1AA 4PJDF 1BIIA 1UM6L 2BVOB 3V7AE 4GUPB 3R1GH 5IB2B 3BIBX 2VDQH 4PJCA 2XG4A 2Z0BA 3K0WA 1F4YH 1A6UH 2CO6B 2FJGA 1L7TL 3CVHH 3QUMH 5CZXD 2DWEA 2XKNB 5FA4A 1F45A 4TRPL 4PJ5E 3VWJD 1IT9H 4PRDB 5T1LB 4PP1C 3EO9L 2VIRA 4XVJL 4NJ9H 1JNHA 1JZ2A 1IRAY 1CG9B 4HWBL 4OCNC 3P0VH 3EDEA 4KRNA 4O2FB 3UTPD 1G7QA 5H8DA 3C2AH 1TQBC 2FEEI 1J11A 3SDXE 1MCNA 1DQML 5B4MC 4KZEL 2X1QA 3MFFB 3SGKC 3PV6A 1JPSL 4Q2ZA 4HBQA 1AKJB 3VXSB 5HDQL 1YEDB 1X5AA 4TULH 4AG4L 5IVZB 4JHZA 4FQXB 3O3EB 4WFFE 3BQUC 3IDJB 3RAJL 1FAIH 4R97B 5LXGH 3MPCA 1QO3B 2R9HD 3QEHA 3VRJA 1WC7B 2E7CA 5D7JC 5CJBA 2NX5B 1KB5H 2FJHA 4FS0A 1EHLL 4O9HL 3N1MC 2WIMA 5I18L 5DQDH 4WEBL 3ZE1E 5CAYB 1S78C 3HZKB 3ZSTA 4P9MH 4S0TD 1B9ZA 4WW2F 4ZFOB 3TPUA 4ZUUB 1YNTA 4JDVA 5I1KL 4X9BA 1R5VB 1CDCA 1RZKC 3ZO0A 5FFLA 1A6TB 2ZSVA 3ESVF 4DGVH 3WFCL 2FEEL 3M1BB 1K5NA 3CPLA 3QBTB 1GC1H 1XCQA 1F3RB 3C8DA 5BZWB 5IHUH 1U0QA 4LCYB 5ENWB 5FHBH 4K3EH 4U6YB 1FHGA 2Q7YB 3PWUB 5MEPB 1UACL 1MUJB 1B3JA 4GQ9H 1XIWB 4NUJA 1ZANL 4GW1A 4PJEA 4KPHH 4XC1L 4MCZB 3MTRA 1CFVL 1IGFL 2P8MA 2FD6H 1BWWA 3C60C 5CS7A 3KNBB 1YEEL 4F2MA 5ICXB 5L2KA 3RJDA 1WJ3A 1T4KB 1CICD 4S2SA 5HJ3A 2D7QA 3C8KA 5FHAL 4UTAH 2GHWB 4XP9L 3D3VB 1FH5L 5K9QI 2PYEE 1HOCB 1HHGA 3CFBB 5EZLA 4HUUA 1PKQE 1XAUA 5B38G 5IKCA 2CR6A 5MEOB 3ARPA 2O26U 2PO6B 3QIUD 5MERB 3QEQD 3I6KB 5A1AA 2CUIA 3VXMB 1ZVSA 1HE7A 4PRNA 4E41A 4KKBD 5IGXL 1CD1B 5E8NA 1IC5L 4OZIB 1PY4A 1R5WA 3DMMA 4YE4H 2CDGB 5ALBH 5EBMB 3SGKA 4M5ZL 4WY7H 1T22A 4ZYKA 4H8WH 4P5TB 2VLKB 5KVEL 3IVKA 4PYGA 5DK2A 5IUSA 1KELH 1MRFL 3GHEH 1F90H 3MACH 4PY7A 3QUYC 2HT2C 5E6IB 3G6DH 4LIQH 2J8UE 1MQ8A 2HKFH 3OJ2C 4LMQI 5BS0E 5D7JA 2X2YA 2CDEB 1FNEB 4F7TB 3VXRE 1JF5A 2DICA 4UT9L 1JL8A 3FFCB 3CFIC 2E7HA 5BVPL 3QYCA 2VXSH 5J9PB 5AAWA 4G43A 4XCEB 2NY5H 4PB9L 1RJYA 1AXIB 3QEGL 3M17B 2P8LB 3H7LA 1UYWH 2X1PA 5IMKB 5FUZL 2LFGA 3H8NA 2AQ1A 4XCYA 4N0UB 1TZHB 4KI5F 1TPXC 3VXUD 1JHLL 2EIDA 5AZ2H 3KPRB 3MV8E 4Y16B 2AV7B 3KYNA 4G9FB 3FN3A 3LPWA 1ZA6A 4JKPH 3U4EA 3TN0C 2R1WA 3U0PB 4R9HA 4DKEH 4M61A 3T4YA 3FO1B 3T1FB 2X4SB 4K7FA 2HFTA 4NO5B 4BJLA 4GBXA 3HMWH 1FE8H 5A40E 5GSRA 5JMOC 1YECH 4PREA 4D8PB 2HTLC 4R4FH 4UINH 1ZHKA 4YIQA 1DQJA 3C60A 1I7TB 1I8MA 4ODWA 3OX8B 4JZOB 4JEGB 1J5OL 4RGMB 1ZGLA 4KK9D 4ENED 2W59A 1G6RH 4JZJC 5ESQA 4P46D 4LRIA 1T03L 3NCYP 1IFHL 5DJYA 3CLFH 4QHLB 3LIZH 5I30H 5FYJL 3RRQA 4N5UA 3LZFL 2HMID 3MRCA 1I1FB 3MLUL 4F7CA 5F9AC 3SDAB 4OUUB 1LO2L 3IAPA 4GAGL 2CDFB 3S34H 2HT4D 1JN6A 5JHDE 1MEXL 4KJYB 1XGQA 2FIKB 2L7UA 3DURB 4J23A 2E3VA 2ED8A 3V52H 4Y4KD 1V8HA 2YZ8A 2BSTB 3MGOA 3GBMH 3PL6C 3QI9C 4G6FB 4LBEB 5ISZB 4KJQD 3O8XB 1JP5A 1VHPA 3UC0L 3NMEA 3U36A 4MYWB 4NO0D 4HJ0C 4LU5H 1NCWH 3H3BC 4X6CF 3FOMB 2X09A 1WWBX 3QUYA 3O11A 3WN5B 2G60L 3OKLB 5BW7C 4G6AC 1G0XA 4GKOA 1HK6A 4Z0XB 1HIMH 3GM0A 3S36H 1INEL 1UT9A 3UO1H 3BDYH 2AEPL 3F6LA 1Y18A 2VKXA 1QNZH 3UTQA 1HYSD 2YPKA 5H2BB 1G7MB 4X9GA 4UV7L 3CSGA 3FQWB 3MV9A 3KLAA 5J6GB 1NUNB 3WDJA 1R3IH 1OP3K 3FFDA 1ZGLP 3SGEI 1P4IH 2X10A 4JM2D 4HT1L 3TH2T 1NMCC 3N1GC 1JWUB 4PJ9C 4DVBA 3VWJB 3TN0A 1YY9D 4Q6YA 1QFHA 2P46B 5DJZB 4YHZH 4LQFH 2D0FA 1X6LA 1ITBB 1YN7A 3M07A 2COQA 4ETYA 2XTJE 2FJFA 3BPCA 4PRIE 4LDEB 3GMPA 2DQIL 3W39B 1AGEA 3GMRA 4WEMB 3V7MA 5IW6B 5C8JA 2OL3L 3W0WE 2Z8SA 2H2SD 2IAMC 4DK3A 5DHVA 3T8XB 4Y4HD 4XVTL 1OHQA 2QSQA 4M1CC 1CGXA 2O5XL 5TDOA 4CVXA 4JZJA 2DKMA 1FL6B 3HB3C 1JPST 2KBGA 3KPSD 4LLYB 3OMZA 1DEEA 1KACB 5C0BE 4RMSA 2Q86B 5IEKB 1V7NL 4ZOCA 2XT1B 1UH3A 4Q9RH 3WIHH 4Z5RB 2NY3D 2A6IA 1KCVH 3TNMB 2XZCH 1JF1B 2AJYL 5I1LA 1UZ8B 1E6OH 5TDNB 1A6AB 4C57C 3SOBH 5HHVL 2E5EA 2JJSC 3QI9A 5C7XH 1JZ4A 1J88A 3TBVB 1U8NA 3ZTJG 3MCKA 4MVBC 5LGHL 1BQLH 4JFDE 3SKNA 4ODUA 4G9DA 4H0HB 4PJIA 2UUDK 4WHTA 5I1HH 5JW3L 3O2WL 1BOYA 1ZMYA 3W11D 1LE5A 4MA1B 5C2BH 3K3QA 1A7OH 1YNKH 4S1RH 1U92B 1Z0NA 4UIKL 3WXWH 2JELH 5A16B 4RBPK 4DCQB 3TT3H 1A7PH 4LP5A 4L29B 4R7NA 4JKLA 1S7RB 2MMXA 3HG1E 3UXFA 3V6ZA 2R0WL 2XFXA 4XBEL 3NAAH 2GTWA 2AABH 1AC6A 4JLRB 4PV9B 1ZVYA 1D5IH 2VISA 4ELKA 5FCUL 4P23A 4GW5A 1JGVL 4UI2A 4X7FC 2XKUA 1BM3L 4U3HA 2VLME 4X4YB 1T0MA 2Y6SC 4OF5A 2DMCA 4FG6C 2X4TB 4OGZA 4PJ9A 4PP2A 3FCTA 3U48A 2YMXH 4UT6L 4JM4H 3D85D 3U79A 3NH7L 1EAPB 2NY2C 1B88A 4YBLC 3WHE1 3DETC 1I9JL 1BBDH 5BS0D 1NAMB 5DFVC 3MO1B 1A7RL 1QBML 4C56A 1UWEH 3TO4D 3QDMA 1RZKL 3O2DA 2IAMA 4F80A 5I1JL 2B2XH 5J13C 5MENA 3BGFC 1UEYA 3NA9L 2YPVH 1KJ3L 1RUKL 2ESVD 1CBVH 1BGXL 3ARFB 4G80B 1S9YB 5HYSG 1PKOA 1EEYA 5E7BA 5CKAA 3WBDA 4PIRF 2FL5B 3FOLB 2PW1A 1BFTA 2RFXB 2Y07H 1IBGH 3QDHA 1KC5L 1JWMB 4GH7B 4ZO9A 1CZ8H 3FMGH 2ZWLT 2ZOKA 1U2CA 4XPFH 3IDMB 4JY6A 3VGGA 4I0CC 4NKIL 5KSAB 1DFBH 4PJXA 1CFQB 1T1XA 1H5BB 4XP1L 4WRLA 1SY6H 4TTDC 1BVKB 2JJSA 4XAWL 5GS0D 2EH8H 3SCMA 1N2RB 3LKPA 4U1JA 4D3CL 1ZT1A 1WV7T 2EE6A 4DEPB 4MVBA 1NGXA 3DYMA 3OTTA 4PJDE 4WI5A 4LDLB 4OCRH 5F9WC 5JIPA 4HCRH 4XHJC 4Z0BL 3E2HB 1Y6KR 3TBYB 2Z92B 3WIFB 3VXUB 1KPUA 5IHZA 4KTEL 2Q8AL 4F7EB 4MSWB 5D71L 2YA1A 1BMGA 4MX7B 3X11A 5CJXA 4WFHE 3VFSB 4V2CB 3BOVA 3HC4L 1MLBA 1E4JA 4KK5C 5AG8A 4QRSB 5JIHA 1FZKA 1HZHL 1E4WL 2NY1B 3EYSH 1R5IB 4L3EB 5C0EB 1X9QA 3HNSL 1KLGB 5FA3A 3C5ZC 4YDVB 3MRHA 4ZODA 4D0BB 4I4WB 2VN4A 4KRPC 5E7FA 1P2CA 3PWPD 1JFQL 4HS6B 2DL2A 2F74A 4K71C 3BH8A 4KMTL 3M45A 2ARJA 2GT9A 3HMXH 5HI5D 1TVHA 5I16A 1CCZA 4LP4A 4WTZG 4NJAL 4Y4FD 2CIKA 5JIIA 4NRYB 1FVDB 4CADA 1A4KA 2XY1A 3D9AH 6FABL 1H9VA 1SEBA 5EBWB 3WNKA 2ZUQC 1MFBH 1KF9B 3V0VB 3HPLB 4MAUH 5LWYL 4RRPA 4UMGA 5JOEA 3C08H 1Z9SA 4LLWA 4DWHA 4POUB 5KW9H 5A2LH 1HI6A 1OARL 4JZNB 3V5HB 1C8PA 25C8L 3MXVH 1B6DA 3MNVB 1G7IB 3KPMB 1TETH 5F1KC 2W0PA 2QLVB 4ERSH 1YDPB 4PB0H 4OQTA 3VFVB 4RZCA 4AH2A 1JVKA 5C07D 4YHYC 5CBAA 5SWZD 1CDGA 2QKIB 3VFRA 4PJ5B 3BAEH 3F58L 3MLZL 1HEZB 1NDGB 3ARGB 4R90L 3AS0A 1S5HB 4Z7NE 5EO0A 1UB6B 2UYLB 1OT2A 3BP6A 3EHBD 3H7BB 2EE9A 3QHZL 1L6ZA 3EJYC 2XWBA 3EZ8A 3OKEB 4NNXB 1HH9A 1NC4D 3CXDL 3OAYK 3HE6C 5TDPB 3DRTB 3MRQA 5DJXA 3KJ4B 4M6AA 4XZUB 3RZCC 3MRPA 1FC2D 3W9DA 4O51A 1ND0A 1UM5L 1WIOA 4PLKD 4TSAL 4NNPH 4LAJH 1Q1JH 3SGDI 3GRWH 1KCLA 4DFHA 3WFZA 3L3DA 3BZFB 4PPTA 3PIQB 1M6OB 1CIUA 1DBBL 4NRXB 4D9LH 5E8DL 1IAMA 5T33H 3TH4T 3MCLL 3C5ZA 4MAYB 3NGBC 3VXOB 1MQKH 1MCQA 1YY8A 2AEIT 3QEUB 1CGSL 4RGNE 4X6DA 15C8H 3L3GA 3EKCA 1DQQA 1D9KC 2OMBA 3PQYE 4XPGL 3UTTE 4PTUB 5CP7B 4YX2L 3B2VH 1IILE 1NGYA 5HYJE 1RUAL 5CHNB 2DQEL 4P5KB 2NY3B 3RWJA 4L8SB 1E4XI 2NY6C 5ESAA 1KPVA 3Q1SH 2WBKA 4F7PA 2P5ED 1FYTA 1GRWA 3A67L 4JO3H 5T1MB 5GISH 4G42A 1I4FB 2UWEA 2LVCA 2NTSP 4CDHA 4OFYA 1XF3B 4WCYH 1C1EH 3DIFA 3QUXB 4MA7L 2G2RA 4WNQA 2GJ6A 1UZ6E 3HNTH 4LIQE 3FB8B 2E8ZA 1S7WA 1BVLB 1Y0LB 5TE6H 3GHBH 3WNNA 2VDNH 4M1GL 1LNUA 4L3CA 3CDYA 1WWCA 2WINA 4EEEA 4WFED 4M7JL 4APQC 1QRND 4POYA 5KBNC 1FGNL 3THML 1F3DH 4MQTB 2PYEB 2PW2B 5J1TC 4ZAKC 3RZWA 1PKQB 1BJ8A 2JIXA 2FX7H 2XWTB 4OCWH 4DN3L 4S1DC 3DSFH 3O2DL 4X0KA 1A6WH 1RJLB 2NZ9D 3U9UA 3Q6FA 2DQJH 2P24A 4NC1C 1NLBL 4ALAH 3AVEA 3G5ZB 1O7VA 2DQFA 2IGFH 4GRMB 2IALB 1W2KT 4X9HA 1PSKH 3HE6A 3FN0L 5DVMA 3HC3H 2X4PA 3JVGC 3RZCA 2PYFB 3HHRB 1D6EB 5IP4A 2VC2L 4WHCA 5ABDE 2AXGB 4UV4H 1KNOB 4HS8H 3KPLB 1QR1A 1UXSA 3OXRB 5F44A 3ZE0F 3HC0A 4MWFB 4ORGA 2J8UB 4MA8L 5GGRY 5K33A 1OAKL 1WZ1L 5BS0B 1XMWA 1ZS8A 3T0BA 3LEYL 3VXRB 2UV3A 2WSKA 4OFDA 4Z8FH 1E4KC 3B9KC 1OP5K 3MLTB 2ZUTA 3RVVC 3VDBA 1AI1H 5FYJU 1CDIA 3I50L 3S4SA 1TIUA 1KCUH 2H32H 3ZKMC 5IG7B 1D9KA 4GLRH 3EOAA 1RUMH 5ILTH 5EFIA 1QOKA 4UB0L 1U9KA 4LK4A 1U3JA 4O2CA 2YN3A 2DTMH 3V2AR 2EDJA 3PNWB 3KGRA 2R8SH 3ULSB 3VI4F 4CU6A 5CEXB 4ODTL 4OGYH 4X6CE 4AEHL 5E0QA 4LRNL 2A1WL 4YBQD 4H20L 1BQSA 3HR5A 2DM3A 2HH0L 1YMMA 1P6FA 4NQDE 1SJHB 4YDKH 5F1NA 3L3IA 4I77H 3GUTB 1MCJA 1NH6A 3P0YH 2MQ3A 3FT2B 3MC0A 4K8RC 1N4XH 4PJGE 4E0RB 4Z78A 3BYYA 4QGTA 43CAB 3VWKD 1JYXA 5ACZB 3G5YB 3O2VL 3V79C 3QWQB 1J1PH 4APQA 4NNYA 3D18A 3SGJC 1SJVA 4MXWL 5FUCC 1TLKA 4NN5C 2H9GB 3EYQC 4P2CG 3U4BL 1NFDE 3N50A 3NCCB 5E5UB 2IPUK 2A0LD 4IMKC 2DRUA 5JHDB 4Y1AE 4MD4A 1ZHNA 2VXVH 5JNYB 2EE3A 3DV6A 5FOJA 4ZUVA 2LU3A 5JZ7D 4O58L 3JVGA 4H5SA 5IESL 4OQTL 4LGPB 3WFBL 5L88L 1ZHBA 5HHOD 5IFAL 4HQQL 4M1DH 4JVWA 4JFHE 1Q72L 4U1SA 5B39B 4JAMB 5IW3A 1JI1A 3HE7C 3MROA 2EE2A 2W1NA 3GSVB 5DEFB 2E7LA 3IFLL 5EORL 1PZ5B 4NFDA 2GSIB 1A47A 1E4KA 4EUPH 4PJXF 2UY7A 1RK1B 5EUOB 5HHQA 1U3HC 2IQ9L 3HRZA 4LCIL 3T77A 3OAUL 4LPTA 3V4UL 2HFGL 3STLA 2BZDA 4MA3A 4NT6B 4OQ1A 5DD3H 1VEOA 3REWB 1E6JL 3ARDC 3QNXA 1C5BH 2BXZA 4ODBD 2P45B 5DJ2A 3KVQA 2AV1A 3MYJA 3NABL 1AXTL 2NR6D 1BZ7B 2YZ1A 4OBSA 5C07B 1LK3H 2RBLA 2YSSA 5EU4A 4J3TA 1F6AB 4YDIH 1LILA 4LARL 1CR9H 2EDRA 32C2B 2XTJB 3RU8H 4NFBA 5HGAB 3MBXH 5DRNB 1EBAA 3CK0L 1ZLUH 3BDXA 4M4PA 1MH5B 4ZXBB 1BD2D 3U7WH 5E03A 4HUXB 2WWKT 4OLUL 2YWZA 1NC4B 3F6IA 2H41A 4XVSH 5CUSH 5AAMA 1JZ7A 1HCFX 4HIHB 4XNYH 4MXVF 3SGJA 5CJOL 4MQSB 4ZNEA 5HYEA 3MRIA 2HJKA 5GRUH 5KAQG 5DLMH 4OSUL 4A6YH 4QOKD 3QUZD 1W0WB 1CN4A 3OBAA 3OF6D 2A73A 3QXWA 4PJBA 3BW9A 4IMKA 5HPMA 5B3NA 2QQKL 1Q8MA 35C8L 4KH2A 3UBXG 1XZ0B 1RAMA 4YUEL 5LAXA 4ELMF 1S7XB 1BZ9B 3QAZB 3EYOA 4P57B 1AFVL 2BNQA 1OPGH 4U6XA 4NQCD 1AXSA 2XNAB 1P1ZA 2MHAB 5HI3C 4JFDB 2HN7B 3ARED 1C16A 4IJ3C 3HNVL 3LDBC 5J12C 3HE7A 4XTRC 2GFBB 3DTXA 1QQDA 1CYGA 4KI5D 3IJSA 1G7JA 1DN0B 3RPKA 1BPVA 2UVEA 4M8QA 5IB3B 2HLAA 5DS8B 5E9DE 4YQXL 1JTPA 1LO5A 2YD4A 5D7KD 1U3HA 1NBVL 2P1YA 3HG1B 1EFQA 3QXTA 1KUMA 3UZEA 1V3MA 1B4JH 4EXPX 5HVWA 4JR9L 1J10A 1TJIH 4RGOL 1C7SA 3ARDA 3WL9A 1LEIB 3MLXH 1S9WA 3HUJA 4B5EA 1XT5A 2VL5A 3QFDA 3MRLA 2BVUA 3TJHD 4OCMC 4P2RD 5TF1H 2B4CH 1CDBA 4LKCB 1P7QD 4G3YH 5CINH 1MVUA 5HGBA 2ADFL 4B0MM 3IDGB 3MUGB 3WIIH 3WUZA 4XX1G 4PY8I 5I15L 5J57B 1AGDA 1OAZH 4XNUH 3QXDB 1Q38A 5IV2B 1AJ7H 3VFNB 1BREA 1HWGB 2AXFA 2V2WA 5C0GB 4M3JA 3ARVA 2BK8A 4OZFH 4HW6A 5IBUB 2XZZA 4OCSL 3WNPA 2APVA 4UU9B 4Z7UF 1PQZB 3PGFH 4NQEE 1IQWL 3P73A 4Z7WF 4EI5C 1J8HD 2YC1B 3BKYH 4UDUA 2N7BA 4K3DH 3DUHA 3H9SE 3K2UL 5T1KD 3D25A 4WU7A 5H37G 1DL7H 3RPIB 1WBYA 3GK8H 4HGKC 4CU7A 2NNAB 5F1SA 2VITB 3N1FC 3P0GB 4I2XA 2AJUH 1JRHH 1J0YA 3C09C 4P4RB 5E2WH 2E27H 2NYYD 3O3AA 5FF6B 3MR9B 4OLEA 2V2TA 3V7AG 2GJZA 2AKRA 1MCPH 1V05A 2BOBB 2VDPH 4HKJB 2XACC 2BFVL 3VMOA 4JFFE 4PJDB 4XP5L 2BCKB 1MLCB 4FFZL 2WWMD 4PJFA 4CU8A 1I3UA 5EC1B 5JXEC 5BXFB 2FHFA 5B38A 5E94B 3UTSA 1EMTL 1NCBL 2DI9A 2QJDA 2OI9B 1EO8L 3KXFE 4HJJL 4POZC 4RDQG 2MPAH 1VADB 4R96B 3SDDD 1N26A 1GGYA 3CVHB 3QUMB 2VDKH 3MRNA 4P4KD 3TP4A 4N1HB 4GRLD 2BC4A 3NIGF 3D39A 5DEZA 4TQEL 3MRMA 1FP5A 2FO1A 4M3KB 4K9EC 5CEYA 3RTQB 4L8BA 1WAAF 4NKDA 4ZTOL 5IJKC 3DUSA 5CWSB 5E8PA 1EERB 1RUPH 4OCXH 4Y89A 1XGUA 3HPJA 5DTFB 5F7KC 4JY5H 4NPYB 1N7ML 2Z93B 3ARBB 3BP5A 4WV1B 4WJ5B 1S9VA 2YWYA 2Y23A 3IGAB 4GG6A 4JRYA 2ZJSH 1NCUA 2YBRA 2XN9D 4YEFA 1EEUA 1F13A 1G9MC 3NCMA 3OKDA 4H1LH 1NGQH 4OV5A 3CFDA 5HHNA 1KTDB 4GMSL 3QIWB 1TZIA 3JTSB 4YC2C 5TE7L 3GI8L 4KZDH 3KS0J 5DZNA 2Y36H 4GO6B 1KB5B 1QBBA 2EYTA 4EI5A 4P3WA 2ZKHL 5IBLC 1RUQL 4WW2B 4UOW0 5GGUA 5CJ5A 4CN6A 1VENA 4YXHH 5D1ZA 4Y8AA 5KN5B 1KIPB 3D48R 4X7CC 1OAXL 3REVA 4UZGA 4QHUB 2ATPB 4OGXL 1U8KB 3VFMA 4U1MB 2XICA 5D7LE 2LE9A 3WFHB 4NQSB 3LS4H 5DHXB 4MQ7B 4S1SH 4PR5A 5AEAA 1WCBB 3GJFH 1J1OL 1DDHA 1BJ1H 4X5WA 1MFAH 4L1DA 3ZL4L 5D1XC 1FNLA 4JANA 3RY6A 3WUWB 4JN2A 5FB8A 4LSRL 1ED3B 1X5LA 3TO2A 5DMKB 2R0ZH 3P77A 2YUXA 5D2LE 4FHBD 3RKPA 2PR4H 2OQJB 4LFHD 5DD5L 1IL1A 3MRRB 5TJWK 3RL1B 4NQVB 5TE4H 1JPFA 1DVFA 2JK5B 3P9WB 1LE9A 3L7FB 5CBEB 3VFWB 1XR9A 5JA8B 4RGNB 3GMOA 3LQAC 2YD8A 3NCYS 3VFGH 5IJKA 3PQYB 3UTTB 4ZFFA 1T21B 2AJZA 4PG9B 3VGEA 5JIKA 1ZAGA 2KDGA 2HVJA 2Z8WC 1Z5LB 2X7LB 1LO0L 1ZWIB 4CDGC 2BRRL 3CZJA 1WLHA 3FO9A 1RJCA 2WK2A 3ZHDA 4F57L 5TFSH 4CVUA 4YFLI 4AK1A 3CFJB 1JNNH 3OKKA 4IS6A 2F58H 4QXGH 5C0IB 2BSSA 3WFEH 4OD2B 1CE1L 2NY4D 1L0QA 3ZDYE 3CAFA 5D93C 2CKBA 1MHCA 5EIIA 3SQBA 1CDUA 5DJ0A 3OXSA 4HGWB 2P7TA 4I5BB 1L7TH 3TCLA 3NZ8B 5L2KD 3TIEA 1R3HA 4FMFA 4NP4L 1A5FL 4XH2B 3S36X 4TRPH 1IAIM 2APBA 2FX9H 1FZMB 1MCBA 3TV3L 3CUPA 4AENA 5B8CC 2OK0L 2XWJA 3QH3B 4HV8A 5E95B 1QSFE 4PP1D 4DKAA 1MFCL 4RIRB 4R2GC 4HWBH 5EN2B 3STZA 2UZXB 1G7HB 2BRQA 4QCIB 4WI6A 1BX2B 3VD5A 3TA3C 3F7VB 4C83B 4E41D 5D1XA 3NIFE 3RVUC 1IM3B 1WWWX 1JPSH 2AW2A 5B4MD 4P2RB 4MNQA 1ES0A 5FKAB 3HRPA 4HXAL 4M6OL 3GMNB 3RL2A 5FECA 1U8HB 5I8OL 3BRGC 2ARJQ 4QNPE 1G0DA 4RNRA 3RAJH 1UG9A 1G6RB 2CK0H 3N85L 3NACH 3TBWA 3BQUD 5FOBB 2FDBP 1KIRA 3FRUA 5C0CA 4JDZA 4PP8C 4O9HH 2LVEA 3L3KA 4W6WB 5D7JD 5I0DA 4WEBH 4G7VH 3WS3B 2B1AH 1VFBB 3PXHA 4HUWA 2XRAL 3RJQB 2VWEE 5D5MA 1N6QL 4FZEL 1S78D 2FBJL 3KYMA 5EO9A 3LEXB 1PG7L 4NSKB 1Q9OA 3RWHA 4LCCB 3CLEL 4X5XA 5B39G 5F97E 3S7GA 2CPCA 3WFCH 2RQ8A 4AIZB 5T1KB 1F4XH 1W72H 1EUTA 4X6CB 1TQCC 3K74B 4PGBA 4NQDB 4YXKL 4S1QL 1MPAH 3L3OB 4FQ1L 3DI3B 1I7ZA 5DURD 5DD0H 3LD8B 2R1YA 4M4RA 2W92A 1CFVH 3ILPA 4PJGB 1R3JA 3G08B 4PJHE 2Z35A 2ZPKH 3RWCA 5F93C 3HUJF 3C60D 3KHOA 4FQXC 3NTCL 4XP9H 1FFNB 4WWKB 4IBLT 1FH5H 1CXKA 2VXUL 1T89C 1FLRL 5IMLB 3SHSA 4JO1H 5ICZB 1RZ8B 3UPRB 4XAKE 1NFDB 1G6VK 3VCLB 5D7IE 1QSVA 2FB4L 2VLJA 1AGFA 1NCDL 3CCHB 2XA8L 4NOBA 5AZEL 2DL9A 4U6VL 3B5HA 4R8WL 5ECJE 3HZYA 4Y1AB 2VXQL 1JZ3A 3PHOB 2AJXL 5IB4B 3GIVA 3QHFH 5IGXH 2W9EL 3TA3A 3S35L 4HXBL 3U6RA 5HYSA 5C9JA 4YPGA 3LKSA 1FZOB 4M5ZH 3W2DL 2DQCH 1N6VA 1JGLH 4YFLF 4K55A 4JFEE 5BRZE 5KVEH 5BMFL 4HC1A 1RJZB 2AJVH 1MRFH 3MJ6A 3L5JA 2BNRA 3VJ6B 5KANG 3QUYD 1XIWC 2HT2D 2EZ0C 3QO0B 5IVXF 4X7SH 2BVOA 2VDRH 3SO5A 4GUPA 3CMOL 4HLZG 1QVOB 4HFUL 4UT9H 5GGSA 5IB2A 3SE4C 5D7LD 1IAIL 4XWGH 4EXKA 3ARWA 1N5YH 3MLPA 5D72L 5J1AB 5HXMA 2NPLX 2EDXA 1KYOK 1U42A 2OXGA 4H25B 5DZLA 4HWNA 5FUZH 2XKNA 4BQ6A 4PRDA 3MCG1 1JHLH 5T1LA 1LK2B 1FJ1B 4ODHL 3BUTA 4JRWA 4TVPL 4N5EA 1MFDL 4QHNB 2PO6C 1CG9A 2R56H 4K9EL 3UTOA 4HIXL 2D03L 4NBZB 4O2FA 5DMYA 3BEWB 2R69L 1UADC 3IFOB 3VG9B 2RJMA 4KGLA 2BNUB 1OB1B 4K3JH 2H45A 1YYLL 5CIPH 5HBBA 2AJSH 3MFFA 4KXZI 2HTLD 1AKJA 3VXSA 1YEDA 2VDLH 5IVZA 3NOIA 3S8WA 4FQXA 3O3EA 2EDFA 3FONB 5DXWA 4WTZA 3SEPA 3IDJA 1T89A 4FXLA 5E6IC 1QO3A 4K94H 1FFPB 3STBA 2B8OT 5FYJH 3B2UC 1WC7A 2NX5A 3LZFH 1BFOB 2DQDL 3HZKA 2K7QA 2F53E 4JKKA 2CKBL 5EZIH 1AGCB 3MJ9A 4ZFOA 2VSDA 4WUKL 4ZUUA 5F6HI 5FGBA 1R5VA 2Y06L 1NBQA 5TQ2H 3KPQB 1A6TA 2VUYA 3SQOH 5KG9B 5IROC 3I3BA 3M1BA 3PL6D 3QI9D 5HYIA 3MRJB 4BQ9A 3H3PL 4Y16C 1ZLVK 3ZZ1A 1BBJB 4Z7UE 2WBWB 3O6FB 5BZWA 4LCYA 5ENWA 3KAAA 1DJSA 4U6YA 5GSVB 2Q7YA 4HJ0D 1Z2KA 1A6VH 1HDMB 3PWUA 2IH1B 4IDJH 1MUJA 5MEPA 3DJ9A 1VKXB 1XIWA 4G6AD 2MCPL 4MCZA 5E9DB 3UPAA 3SE4A 5DWUL 3KNBA 5ICXA 3RUGA 4F9PC 5T3ZL 4UIMB 3RIAF 4RGMC 5A43C 1LVEA 2FRGP 1JGDB 4RMWA 4NC0B 3D3VA 5I1GH 3B3IB 2HYMA 1FO0B 4JFPB 4JPWL 1HOCA 3FRPG 3CFBA 5GHWH 1ZSDB 1BEYH 1KBGL 4U1LB 2DS4A 4C58B 4DW2H 1R3KB 4UUJB 5I6XC 5MEOA 1UC6A 4YJZL 1M7IB 1MCHA 2PO6A 3LEVH 2WZPD 3SDAC 4M62L 4WUUE 2F8VA 1PLGL 5MERA 4CJ0A 3QNZB 4PJ9D 4Z7OF 4YXLH 3I6KA 3X3FH 2FX8L 3MJ8B 3VXMA 2YOCA 4NCC2 1OWRM 3TVMC 4OZGA 4FXKB 1I8KB 1CD1A 4I9WD 3LQAL 4RX4D 5DJAB 5GGSY 1YA5A 3IDUA 3BRFA 4OZIA 2CDGA 2OL3H 5EBMA 4C56D 3NIGE 1I1CA 4QTIL 3MUJA 3QDMD 1TQBB 4P5TA 2O5XH 2VLKA 1DBKL 2IAMD 4NQEB 5JDJA 1PX3A 1SYVB 2OJZL 5MEND 4M1CD 1CLZL 2EICA 4GS7B 4KTDH 3P30L 4L1HA 5GRWA 5E6IA 3WN5C 2HRPL 2XV6B 3HB3D 1LMKA 2CDEA 3H9SB 3DGGA 1FNEA 4F7TA 2IG2H 4GXVH 2KZ1B 2HLFC 3RVTC 3FFCA 3U82B 2C1PA 3BQUB 4J3SA 4GAJL 1GIGL 5J9PA 4L4JA 4XCEA 1CLCA 4QRQA 1T0NB 2ICES 2ZP0T 3M17A 2AEQL 2P8LA 1GGBL 1U2HA 5HHVH 5ERWB 5IMKA 5FYKL 3T3PF 2DAVA 2NW2B 5IROA 4N0UA 1TZHA 2DKUA 3KPOB 1IGIH 3LQMA 4PRBB 3KPRA 1OP3H 4I0PB 4Y16A 5CZXC 4S10A 2AV7A 4MVBD 4G9FA 1VACB 1OSPH 4F8QA 3KR3L 3U0PA 3EIFA 3F62A 3KXFB 4J4PC 3ETBF 5C6TH 1CDYA 3FO1A 4KXZH 1ZXQA 3T1FA 2X4SA 3BISA 4NO5A 4PD4J 3ROLA 4KU1A 4YZFF 4D8PA 5I17B 2NW3B 3JV5A 3IDIB 2OSLB 4BZ2H 1I7TA 4I13B 3OX8A 4JZOA 4Z77B 4WGVB 5DURB 4Y5XA 3ZMRA 1RI8A 4K3GA 3OJDB 3IAGC 4HC1L 4JQXC 4QHLA 1NGZB 4GAYB 2EO9A 1NFIB 5F89B 1I1FA 1EH9A 3GO1L 4K7PY 3SDAA 4OUUA 2J88L 4UT6H 2Y6SD 4FG6D 1HXMB 3NH7H 4KJYA 1OSZB 2FIKA 3DURA 5TH2B 3SKJH 1I3VA 1Q94B 1A7RH 3DETD 1KYOJ 4YHLL 2BSTA 5L8KB 1I8IB 5DFVD 3MNZB 1DSFL 2F54E 4LBEA 5ISZA 3O8XA 1XR8B 5L2JB 3Q5YA 1C5CL 2JCCF 5I1JH 2WBJD 2YKLH 3JXAA 1KJ3H 3WEXB 4JO2L 2ENYA 3FOMA 1NANH 4S0SD 5INDB 4L4VE 1CDHA 3WN5A 4TOYL 2VRAA 3OKLA 1GOGA 2W60B 2ZNXA 4MQXC 4Z0XA 1CLOL 1KC5H 4FXGA 1SVZA 3ARRA 3V8OA 4QT5B 4AL8L 1JYNA 1T1ZB 5H2BA 5JXAL 4P5MB 3BEVB 4RBPH 5C0JB 4LPCA 3FQWA 4XP1H 5D7LB 5J6GA 4NQXB 4KQ4L 4MMZC 1MCEA 1QHOA 3ULVC 4TTDD 3VXTB 5F6HJ 1CXLA 1RSFA 4HPYH 5CJQL 4BFIB 4Z95L 1JWUA 1KGCD 3RWFB 5LCVH 4AMKH 1UKQA 3VWJA 3U9PH 4XHJD 5DJZA 5D70H 4KTEH 2Q8AH 3UDWC 2R1XB 1T2JA 5J89A 2DYPB 4NO3B 2ZUYA 5D2LB 2P5WD 1TENA 1RVFH 3W39A 2FO4B 3MJ9L 4ZFOL 1BHGA 1RV6X 5IW6A 1XCTB 3VW3L 1QFWM 1CT8A 1HZHH 2R0LL 1E4WH 2DMBA 3IETB 3T8XA 4NZUL 4KK5D 5DVOA 2CH8A 3MNWB 1ZLSH 1FL6A 3ARFC 3IS0X 4RMTA 4LLYA 4JQXA 3D0LB 5EOQL 2Q86A 4K7PL 5IEKA 3C5ZD 4KRPD 4J3VA 4Z5RA 4QF1B 1O0VA 5KVGL 5B3JE 3RA7L 3TNMA 3MV7E 4GMTH 1JF1A 4DVRL 5ESVB 3AB0B 1UZ8A 4NJAH 4Y2OA 5F70A 3K4ZA 5KSAC 5TDNA 1A6AA 3VI3F 5IMMB 1HINH 1A6ZB 2QQQA 3TBVA 4GQPH 2FEDC 4C59B 4ZFZB 3FO0H 3WE6B 4PRPE 1F58L 2I60H 2BY2A 3PWJB 1F3JB 1MI5D 4JGJA 1JPTH 2R2BB 3B9AA 1JWSB 1PYWB 3ZYJA 2GJ6D 3S88H 3V0WL 4P59H 3AGVA 3PL6B 2R4SH 1T5WB 4R4NC 5GRZA 4IRSB 1MHEB 3T3ME 3NPSB 2GTZB 1WIPA 1U92A 2H32B 5A16A 1BWMA 3F58H 1MIML 3MLZH 4DCQA 4L29A 4LPYA 1S7RA 3JWOL 3LAFA 2I25N 4L4TE 4R90H 2VLRE 2NY1C 1QSFB 2JIXD 2V7NB 5F3HB 3JWDC 3QG6B 4JLRA 4PV9A 3QHZH 5EU7E 1K6QL 1D6VL 1RZJC 3D6GA 3EJYD 4ENEC 2C7UB 4YHMH 2EEAA 4X4YA 4TTGA 2X4TA 5JW5B 2HTKC 5BCAA 2AP2A 3HE6D 5D6DA 3IFNH 1EAPA 4JY4B 4NM4L 1IC4H 2X5PA 3RZCD 4PTTB 1NAMA 5L6YH 3MO1A 3MUHL 1GOHA 5EB9A 3LN4B 4DN4L 4U31A 1QFWI 2VR5A 1DBBH 1ZEAL 4UAOC 2E9IA 3BRDA 1NUDA 4LAQL 1QFPA 2ZOLB 3ARFA 4G80A 3MCLH 1S9YA 5DR5L 4PUBL 3AS3A 1CGSH 3TFKC 2FL5A 3FOLA 2RFXA 4OB5L 1NKRA 1JWMA 5EZOH 1J0ZA 5CCKL 1RUAH 3IDMA 2DQEH 2DIJA 3ARGC 1I9IL 2IFGA 2GIYA 5KSAA 2XZAH 4OT1H 1CFQA 2P44B 1RIUH 1H5BA 3P11L 4FA8A 1BVKA 2NY6D 3QQ3B 2R39A 2ZCLH 2YD1A 3RI5K 1N2RA 1NPUA 4F9LC 4HZLB 4MA7H 1NCNA 3FO2B 5IVXE 1JMZA 4OLYH 3E2HA 4F8TA 3TBYA 1INDL 2Z92A 3MFGB 3UCRA 3WIFA 4WO4B 3VXUA 1MAJA 4HIJB 3KJ4C 5BJTA 4EUPB 3OAYH 1QFWL 4F7EA 4MSWA 4MX7A 3TJEH 3VFSA 2C3VB 2IC2A 2R15A 3THMH 1UCBH 2FECL 3NCBB 4QRSA 5IF0B 2J7LA 1WBZB 2OMNA 4ZAKD 3PJSA 5D7IB 4JDTL 1R5IA 4L3EA 1RZFL 3FKUS 5C0EA 1KLGA 3A6OA 2X1WL 2EDQA 4S1DD 5I76B 4MAYC 4YDVA 4D0BA 1NSNH 1MHHB 4I4WA 4AIOA 4GAFB 1BJMA 3FQNB 4HS6A 4HPOL 2VKWA 4JFQB 1EFXD 1CXIA 1CDJA 3KWWB 2QL1A 5SWQB 1H3VA 4HK3N 3F8UB 2OM5A 1ULVA 3ZKXC 1RURL 3QCUL 4JFEB 4L8SC 5F8QC 3SE9L 4PJAF 4NRYA 1FVDA 3QULB 1S7UB 1WWAX 4WWID 2VZ3A 1K85A 1CGWA 4BYHA 3IU4H 3V0VA 1WZ1H 3HPLA 5C0NC 2MNUA 3BD4A 3IDXH 3SJVD 2HFFB 2IBBA 3QUXC 1EJOL 3EYVB 4TSBH 1AD9B 2R0KL 5D8JL 5FYJE 4A6YB 4JZNA 3V5HA 3MNVA 3CNKA 3D69B 1G7IA 3B9KD 3KPMA 4UILH 5LBSH 3MXWL 4YHKL 2WBJB 4OKVB 3RVVD 1YDPA 5DD6B 3VFVA 1EA9C 1FN4B 4ELMB 3W11C 2QKIA 4PJ5A 1M71A 2R29L 1HEZA 1NDGA 1OTTD 1Z9MA 1S5HA 1UB6A 2UYLA 4FQIH 2YS4A 1T6VN 4W81A 4LRNH 4XBGB 3H7BA 2ZZUT 2A1WH 4H20H 1SQ2N 4KDVA 4B41A 2O61B 1HN1A 1LEGB 4FTVD 4F9LA 3OKEA 5I8CB 3EOTL 5HTSA 2E9BA 4NNXA 3QFJD 2KUTA 2VZOA 5TDPA 3WFDL 1TMCB 4XZUA 2E6JA 1JGUL 1Q0XL 4NBYB 4K8RD 5IK3B 1LO4H 4BZ1H 3O2VH 1JMXA 5F7LB 4MXWH 3BE1H 2APWA 5IT2H 2M1KA 2VB5A 3OZ9L 3BZFA 2GSGB 3T65B 5AUMB 5DSCA 3PIQA 4J7RA 1M6OA 3L6FB 2P5WB 4NRXA 3GEWB 4UQ3B 2D3VA 3EYQD 3CFCL 1A9EB 4KROB 1FSKC 1NBYB 2F15A 2N1KA 4MAYA 1F11B 3VXOA 2F8OA 2EDLA 3Q5TA 3QEUA 1NUFA 2IFFL 1VESA 4ONFH 2BY3A 4H26B 5I1CL 4PTUA 5CP7A 3VXQB 3O6ML 1G0YR 4LSQL 1G84A 5I0ZA 1V5JA 5IESH 5L7XL 3KYKH 2ZCHL 4P5KA 3TWCL 5IFAH 1Q9LB 4L8SA 4Z7UB 3KDMB 5JOPD 4Z7WB 5T1MA 2X4NA 5D6CB 1I4FA 2WP3T 4FP8L 4ZPTB 5F6IC 4OI8A 1XF3A 5EORH 3HE7D 3QUXA 4P9HC 3ULVL 4KDWA 2A83B 3LS5L 3CSBA 5CP3A 3FB8A 2NZIA 4QYOB 1BVLA 3NCJL 3U46B 3BP4B 1Y0LA 1CU4H 1HILB 1YNLH 4JFZL 3MOQA 4PJEE 1MI5B 1U3HD 3U30C 1TJGL 4AEFA 4QEGA 3EDFA 1V7ML 1E6JH 1NAML 2PYEA 3T3PE 1PKQA 1AXTH 1KG0B 4FQLH 3ARDD 5GGQL 2XWTA 4RISL 3QZWB 5FYKU 1FGVL 1RJLA 2WUBH 2VOTA 1IC7L 4KAQL 4WUUB 5C08E 2ZUUA 1MCOH 2O5ZH 3FL7A 1U6AL 3QCVH 4F58L 2V9TA 2A6JB 3G5ZA 2J3SA 5IQ7H 1EAJA 4GRMA 3QXUA 2IALA 4XVUC 2PYFA 1D6EA 1L9MA 2X44D 3ABZA 2AXGA 2WQRA 4DGYL 1KNOA 5IIEB 3KPLA 4I18C 2LAGB 5FIEA 4I3RL 2WLZA 3D85A 2ZSWB 3BKJH 1U8JB 3A6CL 4MWFA 1ORSB 2J8UA 2ORBL 5BS0A 4OSUH 3VXRA 5D7SL 4MB3A 1KCKA 5IBTL 3MLTA 2CLVB 2YEZB 3CC5B 2XI9A 3K46A 1IKNC 2A2QT 3FTGB 5IG7A 4YUEH 4PRHD 1OD7A 5DO2C 3MRKB 1YUHB 1X5JA 4LSUL 1AFVH 2WWKO 3TT1L 3ZKNC 1LP9E 3PNWA 3AAZB 1H15B 4G8EB 4NN7C 3ULSA 5GJTH 1RZGB 4AIXA 5HI3D 4O4YL 5CEXA 3Q3GB 3KS0H 5B21A 1RMFL 4EDWL 3NZHH 1JGEB 2FCBA 5I1IL 3JWDL 4OAWB 3C5JB 5C71A 1AIFB 1SJHA 2XTJC 4XTRD 3UTSD 3W81A 1IGJB 4J8RB 1UJ3C 4ZTPL 5AWNL 2V9RA 3RBGA 4Y7MA 1RZJL 5IWLC 2CXKA 5DMIL 4ZXBC 2X4RB 3GUTA 1A14L 3FT2A 1SBSL 3T0EE 5F7UA 1NBVH 2DJSA 43CAA 4P2QE 5F21B 4DTGH 5ACZA 3G5YA 2VZUA 3D39D 4M7LL 5DVNA 3O0RH 1NKOA 3UYOD 3PDOB 1VPOH 4MNHB 1MRDH 3WSQL 5F72S 4QRUB 3FB6B 5CEZL 1YEFL 2H9GA 4MJIE 4BSJA 1QACA 4OTXL 1UA6L 2ERJB 4KHTL 3GJFB 1A1MB 1WUNT 2M8XA 4NUGH 5GRJH 3KPNB 4U1NB 3HI5L 1A3LL 1ADQA 2ADFH 5JHDA 3OAZK 2UZIL 1XGPA 1PFCA 3G6AB 2GYSA 5JNYA 2BOCA 3BKCL 4HKBB 4U49A 3QAZC 4JRYD 1ZLWK 1EFXB 4OCSH 1HSBB 5B39A 3F5WB 4JAMA 4HUKB 4L4VB 3FQUB 3WJJC 1I3RB 4Q9QL 1OAQL 3GSVA 2UY6A 1TXKA 5DEFA 3ES6B 4LL9A 4EI5D 1PZ5A 4I3SL 3EFDL 1KIUA 1RK0B 5K59E 5SV4A 1WBXB 1OTUC 1RK1A 5EUOA 3SJVB 3O3UN 2GK0B 3DSNA 3BFOA 3GI9H 3ZSSA 4HGMA 1CL7L 5T3XH 2IWGA 5CSZB 5SWSD 4NT6A 2B7DT 3REWA 3B9KB 3I84A 3WHXB 5ADOL 5TPWL 1A02N 4XP5H 1BZ7A 5AYUH 4JJHA 2GY5A 3PHQB 4FFZH 5C07A 1AR2A 1F6AA 3AS2A 3PWLB 4G6JH 4FOMA 5JQ6L 5JXED 2VZVA 4Z7QE 3E8UL 5LGJB 1EMTH 3OPZL 1NCBH 4LCWD 3IXTB 1EO8H 32C2A 4PYHA 3W5NA 1JHTB 5HGAA 3IDYC 4LSPL 5DRNA 1IKFL 4EI6B 1AY1L 3BESR 1MH5A 4POZD 4ZXBA 1EO7A 1F8TL 4FTVB 4HUXA 4DZBB 1CVRA 1RHHB 2OP4L 5C0AE 1NC4A 3RY5A 3QFJB 5J7CC 4HEPG 3JTTA 4TVPD 4HIHA 4ZDHB 5I9QB 5EOCL 5FYLH 5GS2H 2FYYB 4TUOB 1XF5B 4KJPD 4WU5B 1W0WA 3MV7B 3HI6H 2IMMA 1N7MH 4NN5B 3HLAB 4MD0B 1N0XH 3IRPX 2VZTA 1XZ0A 1IGCH 3AXLB 1QEWB 5TQ0L 2DLGA 3BUYB 1S7XA 1BZ9A 4NIKB 2ZCKL 4P57A 5IFHL 5JOFB 2PKDA 4NYLB 2XNAA 2CUHA 2MHAA 4GMSH 4JFDA 5EDXA 3C2SA 5TE7H 3GI8H 2HN7A 3IS1X 4QXUL 3WJLC 2VDML 3Q0HA 3WJJA 4AQ1B 1VFOA 1T1WB 2BSED 2GFBA 5CSGA 4UTBL 2OI9C 1DN0A 4PJIE 2XOTA 3BZEB 1U3ZA 5IBLD 5IB3A 2R23B 5DS8A 4RSVA 3T2OA 4J2XA 5BO1L 1X5HA 4L4TB 2AI0H 2W9DH 2VLRB 3HG1A 4RA0C 4OGXH 3SDXF 4HULB 2FBOJ 3RTQC 1W72B 3BP7B 1LEIA 3NFSL 1VGEH 5GGTH 5CGMA 1NBZB 5J11B 4EUPG 4OD1L 1PZUB 3H0TB 5GRVK 1CQKA 1H3XA 4QRTB 1OW0A 5DJ8B 3UROR 4KUZL 4LKCA 3ZL4H 2OYPA 4UT7H 1A1NA 3ARBC 4JCLA 3IDGA 3MUGA 5D1XD 1TCRB 4IIQA 5E2VH 3QXDA 2XA3A 4N8CH 5IV2A 3VFNA 3ZE1F 3RY4A 2YUVA 5DD5H 5E2TL 5C0GA 4XMKL 1RIHH 3QIWC 1K8IB 4UU9A 2V5MA 5EA0L 1PQZA 2H6PB 2RB8A 4EBQL 2D4DA 1JHKL 1BOGB 2J12B 2YC1A 1G1YA 4G5ZH 1KEGL 4WW2C 3DGCR 1NFKA 2AS5M 2VDOH 3ARUA 3RPIA 4OCYH 3C87A 1HH6B 3PABB 2J5LB 4XNQB 2NNAA 2VITA 3P9LB 3TZVC 2P4AB 3O4LD 3WXVH 3C9NB 4P4RA 4BSVB 1MCWW 5A2FA 3LV3B 1GC1C 1VDGA 3MBED 4KK8C 5FF6A 4V1DD 3MR9A 1P9MA 2BOBA 3PF2A 4HKJA 1YEKH 3ERYA 4PJDA 1MREH 1CE1H 8FABB 2BCKA 5IVXB 1MLCA 1MIEH 1JZ8A 5HGDB 4PRHB 1MWAH 5EC1A 3ARTA 4AY0A 5BXFA 4RMRA 4P2YA 3BVNB 4BQBA 3GSRB 5E94A 2P49B 5GRVL 3IKCB 3S3PA 1CFTB 1R6VA 3UX9B 2CGRL 1YEJL 2OI9A 4MJID 3L5HA 1M05B 4X4ZA 1VADA 1ADQL 4R96A 2BDNL 4NP4H 3T0VA 5E00B 1A5FH 4IJ3B 4ODSL 3CVHA 3QUMA 1JFMA 1AGBB 5J12B 3TV3H 4NZTH 1P84J 3VGAB 3HI1A 5EOCJ 1UVQB 3RTQA 6CGTA 2YXMA 2VLJD 3V5DB 4R2GD 4RGNC 1J18A 3PP3K 4TSCL 4M7LT 3ZYOA 4C55A 3B4NA 1H0DB 5CWSA 4PJ7F 3TLRA 3TA3D 3N9GH 5DTFA 4NPYA 2Z93A 3ARBA 5KSUB 1A7QH 1DBML 1JPGB 1XEDA 2J8UF 5CIPB 1FBIL 4WV1A 3RVUD 3ZHLA 4F37F 4WJ5A 1J1XL 1LDPH 4HXAH 4M6OH 3IGAA 4WTXA 4H8WC 2J4WL 1CF8H 1PY9A 4JG1L 2BNRD 4KHXL 1KTDA 3AMLA 2I5YH 3QIWA 1BF8A 3JTSA 4B50A 1DBJH 5DVKA 1HKLL 3X13B 5JHLL 1IM9D 1KB5A 5E1AB 1IEBB 2OZ4A 1KCRH 3OKNB 1B0WA 5CD3B 3QIBB 4FZEH 4WW2A 2FBJH 2Q7NA 1OGAE 4M6MH 1ODAA 5KN5A 4H88H 1KIPA 2YUZA 2NY5C 5GJSL 4BZYA 3EZJB 2QQNL 3V4VH 3U7YL 5ID1B 2EC8A 4QHUA 5FUOL 3GSNH 3BPOB 3O45B 2FZ3A 2ZUVA 1A3RL 4IRJC 2ATPA 5T1LD 1U8KA 4U1MA 3WFHA 4IOIB 4NQSA 1TJHH 4XMPL 3EOBB 3LVEA 4MQ7A 4Y5VB 4YXKH 5DYOB 1WCBA 4Y2DB 5SWSB 3U83A 1BFSA 3WUWA 5FV2A 5F7NC 5E8EB 4XPTL 2Q3ZA 5SX4I 1ED3A 5JUEL 5D1QC 5DMKA 5F7WC 4S0UC 1HHJB 5F7HA 1FL3B 4XHQA 4FQJL 1AKJD 5BV7H 2OQJA 4LCWB 3QZWG 4B7IA 4FQXD 1FFQA 1UM4L 1ACYL 1RFDH 2C5DC 5IR1B 3TGXA 4YFEA 3MRRA 3RL1A 2X9XA 3KHQA 2DIAA 4NQVA 1J86A 2JK5A 2DBLL 2E9JA 3L7FA 5CBEA 2XA8H 3VFWA 2D7PA 2NX5D 2VH5L 1N3NB 4D9RD 2VXQH 2AJXH 2C26A 3J8F7 3PQYA 3UTTA 3BDBA 3S35H 4HXBH 1T21A 1JIBA 4PG9A 2OJEB 1CI5A 1T83C 1INQB 4LCCC 3EUUA 3SBWC 5KJRL 3IU3B 3U0WH 5EO1B 1Z5LA 2FWOB 2X7LA 1X5YA 1ZWIA 3ALPA 3MOBL 3W2DH 3NCEB 4K07A 2OL3B 2XIDA 3OF6A 4O5LH 5BMFH 3CFJA 5A2JH 2HKHL 3X3GL 3I6LD 5C0IA 1QBLL 1K5NB 4M93B 5ALCL 4OD2A 3V0AC 3RVXC 3RHWF 1XIWD 1FYTE 2EZ0D 1MCLA 4HUNB 1YYMH 5D72H 4YR6B 1EZVX 4HGWA 4I5BA 3LOWA 4U3CA 3NZ8A 4YC2B 3FJTA 1LO3L 1UXWB 4WWKC 2GI7A 4AQOA 4XH2A 1AO7E 1FZMA 4PJ8C 4QXWA 5HJ3B 4LLQB 1A7NH 4ODHH 3QH3A 2H1PL 3BPLC 3HKFA 5C08B 4RIRA 3DHMA 3BJ91 5EN2A 2D03H 3B9EA 1N64H 1G7HA 2YN5A 2VAJA 2PO6D 2R69H 2H2PC 4QCIA 1BX2A 2XQBL 3VXMD 5K9KB 1V3JA 3F7VA 1P4LB 1QYGL 4M43L 4OD3H 4C83A 1VSCA 1YYLH 1FNSL 5SX5H 1IM3A 2KPNA 3TJHA 5LG1A 4P2RA 5FKAA 3QHTC 1FDLH 1CK0H 1HKFA 3O6KH 3GMNA 1U8HA 3L3JA 3MRBB 2EDHA 3RX5A 1G6RA 1GGCL 1T7WA 1DLFL 1WVZA 5FOBA 5E6ID 4XCFH 4JRXD 5HY9B 4QRRE 5C0RL 3WS3A 2YPLE 1VFBA 2BSRB 5DJCB 2CKBH 3QRGL 3FFCD 2X1OA 2QTEA 4ZS6C 3LEXA 4NSKA 4OZ4B 1MJ7H 3LKNB 2Y06H 2ARWA 3D87B 4LCCA 1A1OB 3SBWA 1LP9B 2DKSA 4KC3B 1A6UL 3CVHL 2JCCB 3PE9A 4AIZA 5T1KA 2WANA 3FT4B 4X6CA 2V17H 2VR4A 3KPRD 1I3GH 1KIQB 4UNVA 4NQDA 1D5MB 3O4LB 4G9FD 3E0GA 1ONQB 3L3OA 4LOUC 3MBEB 2MCPH 4V1DB 1CFNB 3ULUH 3P0VL 4PJGA 3T0EB 1ZOXA 3MA9H 1YMME 3G08A 3ULUF 1Y6MR 3GIZH 1EO5A 4P2QB 3V8CA 1CFSB 5T3ZH 1DTUA 3SE3C 3I85A 3MJGX 1FFNA 3G6JF 1BLNB 4WWKA 1WFNA 2NMSA 1VB9A 4MJIB 4TULL 5IMLA 3QRFM 3VFOB 5ICZA 1RZ8A 4JPVL 3UPRA 1FLTX 4ZMAT 1NFDA 4G8IB 3VA2C 3VCLA 4HX1B 3BWAB 3CCHA 3RWDB 4HG4J 4ZQKB 1JTTA 1YJDH 4NHCH 3BMVA 3ZTJH 2FX8H 1UENA 4Q74A 3DHJA 4Y1AA 3SDAD 1KB5L 3PHOA 2OZ4L 5IB4A 3AMKA 1DBAH 2ADJB 5DQDL 5B8CB 3TVMD 4LHUB 2DDQH 1FL5B 4R2GB 1CVSC 1FZOA 1HHHB 4P9ML 5MHSE 2DQHL 4MB4A 4QTIH 1MAKA 1FAKT 3ALXA 4ZO8A 5ISZD 2Z9TA 3MODL 3O6FC 5GS3A 1RJZA 4OM0H 4HFWB 3VJ6A 1ZLVH 2LU7A 2X9YA 1KN4H 1GC1L 3BIAX 5IVNA 3QO0A 5FYLE 5IHUL 1SM3H 3BT2H 5FHBL 1WEJL 4XPAL 4K3EL 1QVOA 4FQCH 3WIHA 4J1UB 4TNVF 1YMHB 1IQDB 2E7LE 2HLFD 5J1AA 3RVTD 1I85C 2EYSB 5IB1B 5AYQA 4KMQA 5F7DA 5F9DC 4H25A 4ONGL 1IM9B 5BZDB 5EU6D 5FYKH 3L5WB 4X80H 3ZDXE 3UTQB 4Q0XL 3QPXH 1L4IA 1LK2A 4UNUA 5H94B 2X41A 1FJ1A 4UTAL 4HWEH 1W0YT 4QHNA 3KR3H 1ZT7B 1LEKB 5GRYA 3BEWA 1S9XB 4AT6A 2CQVA 3E6HB 3IFOA 3V95A 2BNUA 4J4PD 4JHWH 1C08B 1OB1A 2CUMA 1TQCB 3VFUB 5C0AB 2F5AL 2LABA 4YO0B 4LASH 3AC0A 5E08L 3E3QE 3SPVB 3FONA 4YE4L 4GS7C 4HC1H 4WY7L 1FFPA 1KXQE 1F4HA 2B1HH 3GHEL 4ZNEE 3MACL 3GO1H 1EK3A 2OTWB 2J88H 5DEGB 4ZNCD 2D2OA 1BFOA 3G6DL 1GHFH 1IZKA 3WKMH 1GH7A 4D94A 1AGCA 4ORZC 4W70A 5GS1C 1U8OB 3RIFF 5BVJB 4PJBE 3KPQA 4NWUH 1DSFH 5KG9A 1TDQA 5HYQB 3MGTB 3K8KA 4RQQB 4I48B 2NY5L 3MRJA 1C5CH 1AQKL 4I0PC 5CLTA 1UYWL 1K4CB 3O6FA 4ZOAA 4LSDA 4YHNB 3DVGB 5GSVA 2BNQE 4U6TA 5AZ2L 1HDMA 2IH1A 1TTFA 4H0IA 1VKXA 1BZQK 4U7SA 2VJXA 3LSOB 4Z7NF 4JKPL 2CLZB 4MQXD 5E9DA 5JLZB 5EU5B 2DQGH 4AL8H 1CE6B 1I85A 5JXAH 4UIMA 3GJEB 3HMWL 1FE8L 1YECL 5C70A 4R4FL 2ITDB 4PBVC 4KQ4H 1FO0A 4JFPA 3B6SB 1SY6A 1ZSDA 4U1LA 3LKRB 5CJQH 1F2XK 3ULVD 5FGCE 1R3KA 1G6RL 4UUJA 1H3TA 4JQIL 4Z95H 3RKDC 1M7IA 4P23B 5C9KA 4HCRA 4JHBA 3LIZL 3QNZA 5I30L 3MJ8A 5AD0B 5ELIA 4FXKA 1I8KA 5FO7B 3MQIA 3E1F1 3MJ9H 5DJAA 5DI8B 4LVNB 3S34L 4Q9CA 3VW3H 3VD9A 1QUNA 2HVKB 3GBML 4JCMA 4NQEA 5HHXL 1NC2B 1KLFA 1QSEE 1SYVA 4KY1H 5ACLA 1U8QB 4AM0B 5EOQH 4XI5C 3I6GB 3ARFD 4K7PH 5F96H 3FB7B 1H8OA 3H9SA 4LU5L 2Z31B 4PJ7E 4L8CB 3RA7H 4YNYB 4OM1H 1QKZH 4GG8B 4FQ2H 3BQUA 4DVRH 1SEQH 3K4AA 2MQCA 1HIML 3S36L 4JRXB 2IBZY 2EIEA 2RAMA 3ARSA 3HMXA 4PJAB 3UO1L 2A74B 4JHAL 1T0NA 1ZA3B 1UZ6F 2F19L 1NAKH 5ERWA 5KSAD 1PEWA 2NW2A 5F7EL 3Q6GH 3KPOA 2CRZA 4PRBA 2FEDD 4I0PA 2DD8H 3CD4A 1R3IL 4LEOB 4NHUA 4R7DB 1VACA 5T3XD 5F1IB 1ITCA 4ZS7H 5F7MC 3KXFA 1S7QA 3INUH 5F7YC 1ZT4B 3TYGL 3UEZA 1I8LC 1UWGL 3L95B 2JTDA 2R4RL 4R4ND 1KFAH 2I9TB 4LQFL 5I17A 3IDIA 1MIMH 3TEUA 2OSLA 3JWOH 3DVFA 3TBTB 4XGZB 5A2IH 2BJML 2X6MA 2NY1D 3OJDA 2EDTA 4L3ED 1K6QH 1T80A 1NGZA 3R0NA 4NC2B 4GAYA 1NFIA 5F89A 1QFUL 5DGQA 3NFNB 3EBAA 3MREB 1HXMA 5T5NF 2HTKD 2GUOB 3AB0C 3WIHL 1OSZA 5TH2A 1Q94A 2XZCL 5DK0B 5I6XB 3L5XH 1I8IA 3I3EA 3MNZA 4NKOB 3ECBB 2G9HA 4NRZB 5CEZD 1XR8A 3GRWA 5L2JA 1E6OL 1UB5B 1ZEAH 3S37H 3TVMB 3SOBL 5FM4A 1MCCA 2EEDA 3WEXA 3EJZD 5INDA 3WV0A 4X8JB 4O02L 4KK6C 2W60A 1OGAB 2ICEB 4OLXL 4IRSC 5I1HL 3ZT7A 4MS8C 5JR1H 3NPSC 4WI3A 3TFKD 3EFFB 2IH3B 2DM4A 4QT5A 5C2BL 1FIGH 1IGTB 4WI4A 5F7FA 4BK5A 1A7OL 1I9IH 1T1ZA 1YNKL 4PJ5D 3F65A 1OAYH 4P5MA 4S1RL 4AH2B 5D96B 5C0JA 3ARGD 3A6BH 3WXWL 2JELL 5D7LA 7CGTA 1NGPL 3TT3L 1A7PL 4NQXA 4LDOB 1OLLA 5GGRB 5ID0B 4PJGF 3VXTA 4QWWD 2K1MA 12E8H 3NAAL 4JGMA 5C2UB 2AABL 4BFIA 3BP6B 1TNMA 5JA9A 1UGNA 3NBNA 1IARB 5EU6B 3ZDZE 1D5IL 1INDH 3RWFA 4L5FH 2GY7B 4YAQB 3GSXB 1KB9K 3PWVB 3BKML 4OFPA 2A9NH 1A0QL 2DYPA 2XXMB 3BGAA 1I8LA 4JM4L 5I71B 3QPQC 1NFDF 2FO4A 2ZG3A 2W0LA 1XCTA 4WFFD 1BBDL 2HFEB 3MA7B 5DRXB 3IETA 4ZSOE 4JFXB 1UWEL 1RZFH 2V2XB 3RWEB 2G5RA 3MNWA 1ZK9A 1KJ2H 4YHOL 1X5XA 1T2QL 3D0LA 2VWEC 4LLVB 3PUCA 4OI7A 4MAYD 2YPVL 1CBVL 4QF1A 4OF0A 4LKXB 3BSZH 3RGHA 3L3GB 5ESVA 2Y07L 4OIIL 1IBGL 4ONHB 4YH6A 4ZFGH 2W07A 3FMGL 5IMMA 3MLRL 4XPFL 1A6ZA 3DV4B 4BH8B 3DO3A 3WE6A 1DFBL 1FO0L 3PWJA 1SY6L 2VE6B 5C0ND 1F3JA 3I2CH 4PBXA 3QUXD 1WFUA 2R2BA 1EHNA 1JWSA 4DZ8B 4JJ5B 4MGXA 4WO4C 4NDMB 4IRZH 3PL6A 3UPCA 1GGIL 3K2MC 4HCRL 4ACPA 1T5WA 4JPKH 4IRSA 1MHEA 4V3EB 4Z7VF 1JCKA 4E9LA 4MS8A 2GTZA 3F7PC 2H32A 1AO7B 4OFKA 3V4PL 1XGTA 2PYED 5BW7A 3FAWA 1QSFA 2V7NA 5F3HA 5GIRB 5E6YA 5JORB 4XNMB 3QG6A 4DOHE 3TH3T 5HDOA 4D9QE 4M7KH 3C6SA 4RMUA 3OL2A 3EYSL 1AC0A 2C7UA 1SHMA 4I3GA 5JW5A 1ZTXH 1FFOB 5ITBL 2PTUA 4JY4A 3ULUE 3EO1B 5INCB 4PTTA 1VEMA 1AQDB 4LSTH 3BJLA 1GJIA 5T3ZE 1MSPA 3G6JE 5DJ6B 3SKOB 3LN4A 3MLWH 4MNQE 4RX4A 1HHKB 1ZKAA 4QRRB 3CFCH 4X7TB 1FQ9C 3DX7B 5DDHB 2YPLB 1MFBL 2BMKB 4HLJA 3VXRD 4MAUL 3DECA 3K4DA 4JFYB 4D0DB 3C08L 4LHUG 2WBJC 5C0CE 3RWIA 5I1CH 1FNFA 3O6MH 3MXVL 1TETL 5E1HB 3P4LA 5EPMB 4N90E 2ZCHH 1OF2B 2LQRA 4PB0L 4K2UL 3TWCH 1D5XB 1E28B 3DO7B 3BAEL 4BQ8A 4Y19E 3MV8D 3QQ3A 1X4XA 3CH8A 4FP8H 5DUPH 1CLYH 4HZLA 4MXQC 3FO2A 1N8ZB 3P4OB 4TPRH 1LGVA 1YZZA 4HIJA 3GKZA 1YMMB 4EUPA 1II4E 4JFZH 2QQLL 2CRIA 3ARXA 1F6LL 2C3VA 2YK1H 4PGDB 3QDJE 2A77H 1O7SA 2B0SH 2H26B 4NM8H 3GSWB 5GGQH 5IF0A 5FYKE 4NNPL 4YGVB 1WBZA 4HEME 4QKXB 1Q1JL 1ZHLB 4RISH 5D7IA 3GRWL 1ETZB 3WNOA 4OLZH 1SVCP 1FGVH 2RGSA 4KAQH 1JNLL 4KROC 1CTNA 5I76A 5LGKA 4P3DB 1ZE3C 1MNUL 1MHHA 2B4CC 2WP3O 4F58H 2VABB 2CKNA 4D9LL 4YWGH 3FQNA 5C09E 4YBHA 5T33L 3KJ6L 5CD5C 5JHDD 2CRYA 3QWRA 5J6HB 1TVBA 3LKQA 4JFQA 2EDBA 3KWWA 5SWQA 5M94B 3LN5B 3S98A 1VFMA 1J05B 1MQKL 4DKFH 4DGIH 3UJTH 1U58B 4HKXB 2FGZA 3GMMB 4XVUD 5J8OA 4DGYH 4JFEA 5HVHB 3B2VL 1BECA 3GKWL 3F12B 3QULA 1S7UA 5EULV 3A6CH 4O00A 2ORBH 3O3BB 4WHYH 1B2WH 2HFFA 3EYVA 5D7SH 2FR4B 1AD9A 5GISL 4PRAB 4A6YA 3GSOB 1T1YB 4W4OC 4N9GB 4WCYL 3D69A 4JREC 2WBJA 4OKVA 3HNTL 4PLNC 5DD6A 1KB9J 4UAOB 1FN4A 3GHBL 4ELMA 3DX8B 2XKSA 5DO2D 3TT1H 3GNML 3RDTC 4MLIA 1GAFH 2DJUA 1U95B 3ZKND 4O4YH 2AK4E 4W68A 4XBGA 5DJ2B 4OCWL 2O61A 1LEGA 5I8CA 3DSFL 4GLRI 2QHRL 1R0AH 5DMIH 2XTJD 2DQJL 1A14H 2MWCA 5GGVH 4PRID 4ALAL 1TMCA 5F8RC 2YR3A 4U1IB 4XNZB 4ZXBD 3MMEB 3AUVA 4FQQB 5IK3A 2Z91B 1PSKL 3O41B 3W0WD 4M48H 3SDXB 3HC3L 4QHMB 1WK0A 3WSQH 4XPBH 3HCVB 1MFNA 3WYRA 4EN3C 1YEFH 2GSGA 3VXSE 4HS8L 5AUMA 3T65A 4G8GE 5C0BD 4OTXH 3L6FA 2P5WA 1FORL 1UA6H 4UQ3A 4KHTH 3BIKB 5C0FB 3LH2H 1A9EA 3GGWB 4HD9A 1JV5A 3D5OF 1NBYA 4XNXH 1A3LH 4Z6AT 1F11A 1GPOH 4NN6C 3QG7L 2UZIH 2IANE 4Z8FL 4LLDB 3GSQB 4EVNB 4H26A 2C3WA 2NY7H 3BKCH 3VXQA 3N1PC 5E4EC 1AI1L 3UP1A 3RWGB 3S9DB 1Q9LA 1RUML 1Z3GH 4Z7UA 5DQ9B 1HCVA 3KDMA 2DTML 1CXFA 2F5BL 4JFDD 1NJ9B 4PLJC 2BNQB 4Z7WA 4N0FB 2BVYA 2ZG1A 5IJVB 5D6CA 4Q9QH 2SEBB 1WZKA 3AS1A 4ZPTA 3GSUB 4BKLB 2R8SL 3ZKXB 2CIIB 4I3SH 4XPHL 2A83A 1F2QA 1X7QB 1FNGB 5DHYB 2Q87A 4QYOA 3U46A 1DQDL 3BP4A 4W4OA 2FLRT 3SO3B 1HILA 2PXYC 4QRPE 3ZT6A 4YDKL 1CL7H 2X70B 3OB0H 1TTUA 1OTUD 3DUUB 3UJJH 1MI5A 3JWNC 3T0AA 1FCCA 3HG1D 3DVNB 3P0YL 1N4XL 4JM2F 5TPWH 3RUGE 1A4JB 1T66C 1KG0A 5FGCB 1A9BB 4WI2A 2Y4SA 3QZWA 2ERJC 3L7EB 3D3VE 4R26H 4WUUA 2VLMD 5D2LF 1MWAB 3IYLW 3E8UH 1I1AB 2A6JA 4R3SB 1FV1B 4FABL 5CMAB 1IKFH 4HMDA 3NIDF 5HGBB 2YRZA 1UFUA 3TBSB 1OCWH 3VG0L 2VXVL 3NFPB 1JJUA 2VXTH 4OZGE 1AR1C 4N9OB 5IIEA 1E4XL 4KDTC 1QSEB 4WW1B 5GXBB 5MEQB 2ZSWA 1U8JA 4ETQB 4OZIE 2FATL 1WAAA 1MJ8L 2ITCB 1ORSA 1QG3A 4M1DL 2R2CA 1XGYL 1G7PB 2V5TA 2VLKE 1FRGL 3VXPB 4N68A 4PJ7B 4ODVL 3EYUH 5BQ7B 2CLVA 4GKNB 3BGMA 3CC5A 3GB7B 3VRLE 4L9LB 3FTGA 3D25B 1B90A 3PP4H 3OGCB 2R2HB 3ZDYF 3ET9F 4LVOB 3MRKA 3S35X 1YUHA 3V6FB 2ZCKH 5IFHH 1FSKB 4TUKH 2EXWC 2GAZB 1JI2A 1MJUH 2VERN 3AAZA 3U2SB 1H15A 2ADGB 4G8EA 1F3DJ 1IAKB 5DD3L 4QXUH 1RZGA 2I26N 3Q3GA 2VDMH 1JGEA 4GKSB 2X42A 1WITA 4OAWA 1OTTC 3C5JA 1MHPL 4EOWH 1LK3L 1AIFA 1G1CA 1IGJA 2X4QB 4YDIL 4PGJA 3MV8B 2X4RA 1AP2B 1CR9L 5F71A 4WFHD 5BO1H 3LMJH 5T5FH 3MBXL 3C8HA 4GW4B 1K4DB 1MCFA 5F6IB 3DXAE 2KZWA 1WFTA 3U7WL 4KKCD 3GSNB 3PDOA 5I9QC 3L9RB 3QDGE 4MNHA 3H42H 4QRUA 3NFSH 3I9GH 1F4WL 3FB6A 3NIFF 3RTQD 4G7YH 4XVSL 4HBCL 1RULH 4XNYL 3OWEA 3GJFA 3U30B 3UYRL 3DNKA 4KUZH 5KTEH 1A1MA 5DLML 3KPNA 4U1NA 4XXDB 4QNPF 4LVHB 4ZAKA