1T0NA

Conformational switch in polymorphic h-2k molecules containing an hsv peptide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
278
structure length
278
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The structure of H-2K(b) and K(bm8) complexed to a herpes simplex virus determinant: evidence for a conformational switch that governs T cell repertoire selection and viral resistance
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 278
sequence length 278
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t0nA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1t0nA01
4TULH 1HHKB 1FNGB 1XFPA 4MCYA 5LAXB 5FYJE 1NAMA 25C8H 3TT3H 4XXDB 4P4RA 4UAOC 5EWIL 2EDHA 1AD0B 2JF1A 1EBAA 1ED3B 5C07E 1F8TL 3IGAB 2IQAA 1CFNB 3JWDL 3W9EB 4KRNA 6FABH 4JGJA 4JKPH 1MUJA 4LCUA 1J1OH 4XCEB 3RKDC 1EMTL 4CVUA 4KGLA 1FBIL 4UNVA 1S9YB 4YGAB 1AXSB 1IC7H 1EEUA 3OKDA 4QHKJ 4JHAH 3OKOB 1NMBH 3D0LA 1REIA 3CSYA 1AD9B 1G9NC 1IAKA 3PNWB 5DD1L 1UB5A 4EOWL 3ARDC 1OAZL 2VAAB 4UNUA 1IGFL 3DSNA 1CU4H 2AJSH 3QIWD 5HI5D 5DA0B 4DW2L 2JCCE 3FO9A 2YS4A 1R5WB 2HVJA 3ULUL 4XMLH 4N8VB 4O9HH 3RNQA 3KYMA 1FHGA 4MQ7B 3VDAA 3FN0L 4CVXA 4YR6A 3NH7L 4NQEA 3VGBA 4PREB 3IVKA 2H9GB 4OD2A 5DC0A 1FYTA 5K9KB 4L29A 2FLRT 3FRPA 4ODXB 4ZFOL 2OL3A 4D8PB 4LFHD 1XCQA 1DVFC 3MJ7A 3M1BB 3C5JA 5E00B 3AREA 1QFWM 3RWEB 1DFBH 1YJDC 3BKCH 1NMCB 3ZLQC 4JPWH 1TVBA 1VFUA 3MRQA 4S11A 1A7NH 3VFUB 1GH7A 1C5CL 2D03L 2QHLA 2AXHA 4WHDA 4JREB 3HC4H 4ODTL 2Y1VA 4QRQA 1JWUB 5KSBE 1T89C 5DLMH 3QUXB 3CDGA 4Y4KA 3T2QA 1A1NB 3BPNB 4LL9A 3VGHA 5DEFA 3GGWA 3HPLA 1S7UA 3C5SA 2AK4A 1U8HA 3DVGB 5DRWA 1CXKA 4HIJB 4JFQB 2LTQB 3EYUL 2R0LH 3RVUD 5DD5H 5IVZB 4ELMA 1KIRB 4CDGC 3UYRH 3VXSB 43C9A 2OK0L 5BW7C 3HC3L 1NL0L 4XCCH 4UU9A 1JNNH 4JFEA 4IJ3C 4JM4L 4UV7H 3MREB 4JZJA 1MCPH 4G6KH 5DQ9B 1SYSB 1ETZA 3HA0A 3RIAK 3DYMA 4PJFA 4FQ2H 4ZAKD 3U0WH 4KI5C 5D6CA 3TPKA 5DJ0B 1CQKA 4AEEA 5D5MB 3BZ4B 5EOQL 1GZPB 2WBWB 3VW3H 4F33B 3S7GA 4F2MB 4NPYB 1QSFB 3MROA 5J57B 3UYPA 4PP8C 1N6VA 2RR3A 4I5BB 4QRRA 4X4ZA 4JY5H 1BD2B 2P42B 4CMMA 2HKFH 1FG2A 1AR1D 4DGIL 3S34H 1MOEA 1MHPL 1N3NB 3SDDD 3EHBD 4MAYA 5IUSA 3ZHKA 2P4AB 1UYWH 4HIIA 3EJJX 3DV4B 3MGTA 3M8OL 1TENA 1G6RA 1GGCH 1HXMB 3L1OH 4XVUC 5INCA 4FTVD 4WWID 2VISA 4RFEA 3U1SH 3MBXL 3I3EA 1W72L 3WV0A 4X6DB 3L3DB 3MGOB 1TQBB 1OF2B 3O3EA 3KPOB 2Z91A 3U0PA 1I7UA 2E9BA 3IDMA 2FECI 3ERYA 3CFEB 4X4YA 3QHFH 4YAQA 3OKLB 4ZTPH 4DAGH 3WNPA 5T3ZH 4JRYB 4X7SL 3QXDB 5D1XB 4R26L 3A6CH 4RWYH 3ESUF 4MQXD 4YZFF 4WU5B 4E42B 4PJEA 1JCKA 4C56B 4OF7A 1JHLH 4K3EL 2OP4L 2VXSH 4PJBA 1UQSA 1A6WL 3BPCB 1F11B 3R06B 3KPMA 5JW3L 2H32H 3I02B 3SGKA 5HI3D 3BVNA 3DTXA 3P4MA 4WUUE 5C2BL 4PUBL 5AG8A 4WHTB 2AGJH 1HE7A 1EEYA 2OMBA 4M62L 4HDIA 3MSPA 5HGDA 3BYYA 3L5WB 2EZ0C 3EO9L 4GRWB 1KJVA 5FO8B 4HK3N 1T66C 4M48L 4Q2ZB 4IDJH 1ND0B 3CX5J 1TNNA 1NGQL 2NXYD 3MXVH 4KJPC 3VXUE 4J6RL 1I7RB 1SJEA 3H9ZA 1GGBH 3HNVH 4X6BA 2IBZX 1TZIB 5ADPL 2DQCL 4S0TD 1L7TL 3DHMA 4U1IB 4WV1A 1YEFH 4WW1A 3O6FD 5IHZB 3OKNA 3QJFB 4OIIL 4OUUA 4LASH 5ID0A 5DR5L 1MLBB 1Z0NA 1QEWB 4FABL 1PFCA 1DBKL 3T3PF 1K8IB 4LSVL 3BT2H 5TQ0L 3F12B 4G3YL 3BPLB 4NCDA 4QTIL 2EKSA 4F80A 1BJ8A 1U0QA 4HUKB 4XBGA 3MLXH 3TN0C 3IDXL 5I18L 5DHXB 5DT1L 1KENL 3OKMA 3ARBD 5E94A 3CLFH 3E6HA 5ESQB 5C0RH 1U8LA 4KXZI 1KN2L 4FZEH 1J5OL 5BOPA 1DN0A 3QO0B 1KLUB 2F8VA 5J1SC 4CRPA 1LDPL 4HF5L 4YQXH 4N5UA 4JM2F 3PGDB 1M7DA 3LKRB 3UJTL 2ZSVB 4L4VD 4AG4L 1NMCC 2MQ3A 5D4QA 1FNGA 5DFVC 1F4WH 5HHPB 5LAXA 3SE4C 3QIUD 2YK1L 2AI0H 4FN0A 4CU7A 4XXDA 5LQBL 5CJ8A 4QRSB 4WNQB 1CTNA 1WWCA 5ESAB 1FFNB 4OBRA 1QNZL 2C9AA 1SBSH 3HI6H 3EFFA 3IGAA 2SEBB 4PGCA 4JQIL 1CFNA 4GRLD 3W9EA 2Z92B 1KCUH 4Y5VA 5TGBA 5MEOB 4RAVB 1UM6H 3VGDA 1P69B 1OAUH 4H26A 5DD3L 5DURB 1S9YA 3UROR 1AXSA 4R97C 3VWJD 4PLKD 3TO2B 3DX7B 1GOHA 1JPSL 4MYWB 4PB0H 5T33H 1AD9A 4YDLC 3PNWA 1BFTA 1UJ3B 3ARFB 5DWUH 3LQMA 1SEBA 3PHQA 1A6VL 3OAYH 2VAAA 1EEZB 4LHUB 1U41A 1EAPB 2X09A 1S5IH 2X41A 4DFIA 4Y89A 4LLYB 3B6SB 4M6OL 3ZKMD 1UADC 2ICWJ 2FYYB 1JZ3A 4KRLB 2CIKB 4J4PC 1EO8H 1T0MB 3ORJA 3KPQA 4H0HB 4PREA 1ZEAH 4KKCD 4U1GC 4ZD3L 2H9GA 1P7QB 4Z18A 5TE4H 2CGRH 3OJDB 4CMHB 5K9KA 3B9KD 1MAML 4IOIB 2ORBH 4ODXA 3I2CH 4G7VH 4N8CH 3HR6A 3VG0L 5GGUB 2OQJB 1QLEH 3M1BA 3JTCA 5E00A 5B8CB 4M1CD 3LB6C 1T7VA 3RWEA 4A6YL 2R2EA 4P59L 2BY0A 4AH2B 1G9MH 4HFUH 1OQXA 4RX4D 5GSVB 4NQEE 1CVRA 2WZPD 1LK2A 2VAJA 2IAND 1FYTE 3DSFH 1Q72L 2KH2B 3K4AA 4I2XB 1LO0H 3O2WH 4XPBH 5D1ZB 3QUXA 1PZ5B 1FORH 2E7HA 3N9GL 1A1NA 4PY8J 3GBNH 3MV11 2FD6H 2X9YA 4XP5L 12E8H 4HIJA 4M7KH 4DUVA 4K9EL 4JFQA 3TBSB 2NY4B 3E6FA 1HHJB 3ARGC 1TQCB 3UZEA 1MNUL 2R29L 4MXQC 5IVZA 1OWRM 5I1EL 4XNUL 4JPVH 2EEAA 4PRDB 1RIUL 4RFOH 4S1QH 2UV3A 3MREA 1P9MC 4E41D 4GAFB 1WEJH 2AK4E 4KQ3H 3JZ7A 4NN7C 4OIBA 2V9QA 2WINB 1S7WB 2DTML 5F1NA 5DJ0A 1IQWH 5D5MA 3BZ4A 4YHMH 1GZPA 3IKKA 4ELME 2BNRB 3UBXG 4F33A 4F2MA 4NPYA 1QSFA 3V8OA 3HNTL 4JHZA 1OAKH 2I27N 5GGVH 4CL7A 2QSVA 2VXQH 4JFEE 1WV7T 1SEQL 1CD8A 2FL5A 3TO4A 1ZT7B 3KWWA 2BY3A 2VDNH 1GHFH 2C3XA 3NPSC 4PJFE 3GM0A 1ITBB 2X44D 4EN3C 4KDTA 3VFOA 5ACZB 3UTSE 4LSPH 4U6XB 4CGTA 4G6MH 4QRRE 1HXMA 2NY6C 3W2DH 5FOBB 4EXPX 1U8MA 3WHXB 4R2GD 2WM0A 1DQQB 4PJ5B 5JZ7D 3AB0B 3WUZA 3L3DA 1XR8B 5IB2B 1OF2A 1NC2D 3KPOA 3HCVB 3QP3A 5IEKB 2VXVL 3GZKA 1HSAB 3QNYA 2VKWA 4JRYA 5D1XA 4PGZA 4PTTB 4KVCH 5GJTL 4FFYL 4I18C 4ZTOL 4DZBB 4HSQA 1RUMH 4C56A 5C0IB 2P8MB 4PV9B 1D5IL 1C16A 1B90A 4KKLC 2VERN 4BFGA 3P9MB 1F11A 2CO6B 3R06A 4WO4B 1HZHH 3I02A 4JB9H 1Z9MA 5C09B 1A4JB 5C9KA 4JFFB 1H3TA 1KCSH 2IG2H 2IGFL 2Q7NA 4WHTA 4FFVD 4KTDL 2R8SH 5GS0H 1T5WA 4O5LH 2BNQD 4PJEE 3B2VL 2EH7L 3LDBC 3N85L 3C87A 3L5WA 5IFAH 3PE9A 4PJBE 3UYOD 2X6MA 2HWZH 5HI4C 3H7BB 4HIXL 2LQRA 3IFLL 4P2QB 5ICYB 3MRIB 4Q2ZA 1ZVSB 4OQ1A 3WXWL 1HYSD 1XGRB 1OT1A 1FVCB 4OLXL 1I7RA 4NO3B 4ETQB 4JFOB 3K8KA 1IT9H 4TRPL 5A16B 2VZUA 4JRXB 4U1IA 2VLKA 4KK9D 1OPGL 4Y8AA 5IHZA 3BAEL 1A02N 1QFOA 5I8CA 5EWIH 4M03A 2VR5A 3QJFA 1FG9C 4F3FA 4FOMA 1F8TH 4J12A 1T21B 4PBVC 4P2OC 1QRNB 4X0KA 1BFOB 2F8XC 4DJMA 1RI8A 1QEWA 3GO1L 3JWDH 1IBGL 5HGAA 4OIAA 2V2TB 2NY2C 4OFDA 6CGTA 4U6YA 1WBZA 3Q48A 1VFAB 1EMTH 3LN4B 5KSUB 1FBIH 2NZIA 5IMOA 2GQHA 2EDEA 1NPUA 5E7BA 1J8HA 2P46B 1AKJD 5ESQA 4KZEL 5BV7C 5DD1H 4EOWH 1OAZH 2J8OA 2W91A 1JFMA 5J1AA 1IGFH 4N8PA 1KLUA 2VDKL 4DW2H 4ZFGL 5IW1B 1QHPA 3MODL 3QDGB 3ULUH 3PGDA 1G7QA 3LKRA 4CJ0A 4AY0A 4DKDC 5IF0B 3RDTC 1DDHB 1VFOA 2WBJC 2JJSC 1EAJA 3FN0H 1JJUA 3NH7H 4YBLB 5FFLA 4EI5B 2F9BT 1WTGT 5JTWA 4QRSA 1IAII 4DCQB 4CU8A 5L9DL 5ESAA 3KGRA 3X14B 3FQRB 3HAEB 2SEBA 1V3JA 1T04B 4HEME 3MLPA 4KJQC 2GAZA 4HKJB 5MEOA 5CEZE 1C5CH 2D03H 3L5HA 5CJ5A 4ODTH 3AUVA 4NBXB 3DI2B 3ZDYF 4LRIA 5B38B 1HI6B 3CIQA 3G5YB 5FUCC 3VXMD 1UJ3A 3KDMB 2DM7A 5E6YA 2HTLD 1EEZA 4H8WC 4DOHB 1EAPA 2YPLD 3EYUH 1KJ2B 4WEMB 1JRHI 2YHGA 3B6SA 2FHBA 1VKXA 2OX5A 1K85A 4DTGL 4NC1E 5DI8B 4MAUL 5I9QC 2OK0H 3VG9C 3HC3H 1NL0H 2CIKA 2IEPA 4JM4H 1KELL 1GOFA 4QHMA 1T0MA 4YFDB 3D9AL 2W07A 1NUFA 4UTBL 5B22A 5ELIA 1BQSA 3NZHL 5HHOD 4X8XA 1MVUB 4IOIA 5EOQH 1L9MA 1G7MB 5GGUA 3V7AG 5IFJB 4DKAA 2OQJA 3SE3A 1CFQB 5ABDE 1WZLA 1DBMH 3GNML 1W0WB 4TTDD 1LO3L 4AH2A 5GSVA 2OTWB 4L8BB 1U3HC 1CDIA 3DVNB 1Y18B 3LD8B 1X5HA 5GZOC 4DGIH 5CZXC 4FQXD 1MHPH 1S3KL 4HZLA 4I2XA 5D1ZA 1PZ5A 4Y5XB 3M8OH 4OAWB 5DGQA 3IDJB 4GW5B 1ZHLA 1EZVY 4NN6B 3MBXH 5TDPB 4PDCE 1W0YT 4JM2A 1W72H 1WZ1L 2WBKA 1HHJA 4LPXA 2V6HA 2O26U 4JRWA 5F1SA 3WCYA 3NIGE 1CICD 3C5ZC 1MFNA 4AT6B 4PRDA 4LSRL 3CC5A 3RY5A 1LO4L 4I3SL 4X7SH 4EBQL 1ZLWH 4R26H 1ZA6B 3E2HC 2WINA 1S7WA 5I1LB 1JTPA 1CL7L 3PP3K 4PJDB 1F90L 4JN2B 3HE7B 2BNRA 4K3EH 2OP4H 2YA2A 1WT5A 3VXSE 1A6WH 3FAXA 3QZWB 4H0IA 4L4TB 5JW3H 1DP0A 3BWAB 1DTUA 1BWWA 1ZT7A 2ZWLT 1C5DA 3HG1A 2RB8A 4LMQE 1KCRL 5C2BH 4PUBH 1QP1A 4MSWB 4APQC 5IGXL 5D5ME 4M62H 3BKJL 4ODSL 3ZHLA 1N8ZB 5CJBA 3SGDI 2H3NB 3SCMD 1TETL 3EO9H 3V6OA 1QSFE 1RZFL 2YZ1A 3QIBD 4M48H 5D2LF 3K7UA 3WHXA 2CDFB 5E5UB 1DQQA 4PJ5A 5DTFB 1NGQH 4D2NA 1XR8A 5HGBB 5HYSB 4J6RH 1WTLA 3SDAB 3HCVA 4EVNB 2E7MA 4CJ1A 1RPQA 5ADPH 2DQCH 5B4MC 1CCZA 1L7TH 3RVWC 3IB4A 1YPZF 2GSIB 3DX6A 1MFDL 1VA9A 4P5TC 2Z8WC 5E8PA 1G9EA 4WW2C 5CFHA 4HGWA 4NNYB 4DZBA 4RFNC 4OIIH 2O61B 1RZIB 5DR5H 2J88L 4KU1A 4XPAL 4FABH 2P8MA 1DBKH 4PV9A 1A3RL 3S3JA 4LSVH 4JY4B 3P3YA 5TQ0H 3P9MA 5JA9A 5T1KA 4G3YH 4PLJC 4GMTL 4WO4A 1KUMA 4QTIH 1MI5B 1NBZA 2DQHL 4JRYE 5C09A 4NZJA 3C6LD 2DYPD 3IDXH 3NGBB 5I18H 1ZTXL 5DT1H 1KENH 4RGNB 5F93C 1NAKL 4C56E 3SKUD 1J5OH 1LDPH 3OAUL 4I8DA 5CSBA 4Y4HC 4QWWC 3H7BA 4HF5H 3MV8A 5GSRB 5ICYA 1RZJC 3O2VL 1ZVSA 5EFIB 2NLJA 1XGRA 3HMXL 1FVCA 3UJTH 4ETQA 4AG4H 2O5XL 1NFDB 4JFOA 2FEEL 4JRXA 2G9HB 3STLB 3NIFF 4G6AC 3HRZB 4C4KO 2YK1H 1KJMA 4G5ZL 3KJ4B 5LQBH 2DOCA 2BFVL 5LGHL 2D31B 5I1IL 3GSVB 2IH1B 1ZMYA 1QNZH 4NQED 1T21A 5FK9B 1QRNA 1KTRL 1R3IL 4OGAC 1JK8B 4JQIH 3O41B 3KYKL 4MS8C 3QXVA 1O0VA 2VLKE 2BVUA 3GEWB 3DO7B 3OF6A 1VFAA 5KSUA 1IAIM 3TGXA 3V0WL 5DD3H 2DTSA 5F9DC 1A1OB 1JPSH 2MNUA 5T1LB 3FFDA 4OGZA 4M61A 2NCMA 5CMAB 2WY3A 1B0WA 3WUWG 1JNLL 3TYGL 1A6VH 1VDGA 3FB8A 3NFPB 1BVKB 4OLEA 4M6OH 5IW1A 3BP5A 3QDGA 3QUYB 3LV3B 4ONFL 1J8HE 5IF0A 3HZKB 4G8IA 4K7FB 3DJ9A 4KJYB 5FDWB 1TVHA 4LOUD 3C2SA 4RAHA 2EYRB 2ZUQC 4HPYL 4OB5L 1S7TB 2GJ6B 4ZD3H 4WI7A 3X11A 3HR5B 2DIJA 2WP3O 4JFED 1MAMH 3TA3B 2HMID 1PEWA 1KB5B 1MCQA 1MFCL 3FT3B 1G7PB 3VG0H 3UCRA 4PRBB 5E9DA 2VL4A 3QBTB 1CLOL 3FQRA 4AL8L 3HAEA 4CBPA 4A6YH 1B2WL 4P59H 1WWWX 1X5AA 3UTSD 4NN5B 4YZFE 4MNQD 1JE6A 4HKJA 5I2IB 3HPJB 1Q72H 2GJZB 1QUNA 4U6HB 4AYFA 4KROC 3NCFB 2GCYB 5CCKL 3N9GH 4R90L 5B38A 1HI6A 3WKNA 3FRUB 5DJCA 4XP5H 1GJIA 4MAYD 4K9EH 4NYLA 1UFUA 4TN9A 3S97C 5FA4B 3S35X 5IVXF 2X1XR 3ULVC 1KJ2A 1MNUH 4V3DB 2R29H 4BFIB 4FQPA 4RISL 5I1EH 4XNUH 1PX3A 2XN9D 3T4YA 1RIUH 3SDYL 1HDMB 4WDIB 3QI9B 2CKBL 3B5GA 4I0KA 2FNBA 5KSVA 5KZCD 2DTMH 2QSQA 5ERWB 4EQ2A 1MVUA 2AKRB 4PJIF 4XHQA 1G7MA 5IFJA 3HNTH 3GSXB 4UDUA 1SEQH 2R1XB 3AU1B 5JNYB 3QWOB 4L8BA 1MCWW 3DVNA 2EXWD 4NHCL 3U2SB 3WIHA 1PEZA 3SDAC 1J86A 4GFTB 3ETBF 4X9GA 1B0RB 1D6VL 5DMJB 2IC2A 1HINL 1WCBB 3GB7B 3RWCB 1A6PA 3M17A 4OAWA 4Z7NF 1LNUB 4TSBL 5MEPB 2FSEA 1X3DA 4KI5D 4E0RB 3L7EA 4W6WB 4JE4B 4HWZA 4U6TA 5J12B 3CFDB 3TV3L 2ID5A 5JDJA 4MVBD 4J3WA 2VXVH 4BQ9A 3A67L 1RZKL 4I2XE 3PWUB 4AT6A 2DQJL 3VJ6B 4JQXC 5HD8C 1BREA 4Q6IB 5F1OB 3F7PC 5FM5O 1ZA6A 5GJTH 4FFYH 4UDTB 2YD5A 4XNMB 4ZTOH 1AIFB 2DKSA 3DETC 1AFVL 4JN2A 4XH2B 4F7MA 1RIHL 3HE7A 1D5IH 4UI2A 5I8KL 5I74C 5F70A 3UBXI 2O5YL 2QHRL 4I13B 1B0GB 4L4TA 4X8JB 1EUTA 2XY2A 3MJGX 3BWAA 3R8BB 1H5BC 4GBXB 3T4AB 4MSWA 2IGFH 4KTDH 4YXKL 1YEJL 3PUCA 4YHPB 3RX7A 3B2VH 1N8ZA 2EH7H 3N85H 1TPXC 2BNRE 2H3NA 4WUKL 4GS7C 4HIXH 3IFLH 3PWPB 2VRAA 1U3JA 4Z78B 3QUZA 3HG1E 3RVXD 4Y4FA 2BVOA 3WXWH 4OLXH 5KSAB 4EVNA 4TRPH 3B83A 4IIQB 2H8PB 1OPGH 3V6OE 3BAEH 2GSIA 5IBLC 5C0BD 1NH6A 4X7TB 4F7EB 1J05B 4PJ5E 3O3AA 2Z31C 1BEYL 4QYOA 5I73B 5L2KB 1ZWIB 3X3FL 2O61A 1MRFL 1RZIA 2EZ0D 1HNGA 1IE5A 3L3IA 3GO1H 3RGVA 1FZMA 1IBGH 5CGTA 1PG7W 2CJUL 1DUYB 3RZCB 1G7IB 1S9VB 3LEXB 3KLHC 2A6IB 2NY7L 3MRGB 3HLAB 5C0EB 3WYRA 3T0WA 3VFNB 3O45B 5DVLA 3HI1A 4KZEH 4NJ9L 2NNAB 4NQDD 4OI7A 2Q87A 4NHUB 2YBRA 2XI9A 1L4IA 3D85D 4X4XB 1QLFB 1ULVA 4E9LA 2VDKH 2PYED 4K3HA 5GSRA 4ZFGH 4JFHE 5JXEC 3BUYA 3MODH 5C09E 5EFIA 4JANA 1CE1L 1A22B 4YHNB 4ODHL 4PFEA 3DMMA 3V4UL 3MRKA 2EE6A 2G9HA 4JCLA 1KLFA 3TN0D 4DK3A 3WNNA 2NZ9C 3MJ9A 5L9DH 2IH1A 5DJXB 1EFQA 3FQTA 2IPUK 1NANH 5GRUL 3SGJA 1JK8A 5C3LD 3CPLB 3O41A 2X4SA 3MR9B 2AQ1A 1DANU 4JRXE 4PJCB 2AEWA 3KG5A 3DO7A 3AY4A 4OZGB 3FFCA 2ZUVA 3GMQB 4ZSOA 1RHFA 5EU6A 5GPRA 3SBWC 3N1QC 2A2QT 3CVHL 3RI5F 4F58L 2BX5A 2OI9C 1E4KA 5T1LA 3JWNC 1QRNE 1T3FB 4FFWC 5TDNA 5DFVD 4TNWF 4L3CB 2N7AA 3MFFB 1BQHB 2EE3A 1D5BB 3NFPA 1QR1A 3BD3A 2GY5A 1BVKA 2BP3A 4BM7A 1H3XA 1QFUL 4DTGH 1LE9B 1U92A 4MAUH 3SN6N 1XF1A 3QUYA 4CKVX 3W5NA 1YPZA 1KELH 4JDZB 4RWHA 3BSZL 3BP4A 4RNRB 1PZUB 4L8SB 1CK0L 2EYRA 4K3JL 3D9AH 4UTBH 1S7TA 2UUDK 3VXSD 1A6AB 3NZHH 3TA3A 4N1EA 1INEL 3FT3A 5F72S 1G7PA 4PRPD 4PRBA 3ARYA 1P5UA 1JIBA 3QDGE 4F9PA 3AS2A 3GNMH 2AJ3B 2FIKB 3BFOA 2VLRA 1LO3H 3TIEB 3RZWA 1P4LB 1CFTA 1QSFD 5I2IA 1YY9C 4YXHL 3HPJA 3CFIC 4KV5F 1S3KH 2GJZA 1BD2D 4U6HA 5HHXL 2GCYA 4J4PD 3UTPE 5E9DE 4P23C 3U4AA 4RMRA 1DVFA 1PJ9A 2XA3A 2PXYB 2PYFA 1WZ1H 4LPCA 3Q2CA 1LWRA 5DJZB 4PG9B 4P2CG 1IEAB 3D2UD 4WGWB 3MOBL 5C0CB 4X6CB 4LSRH 5HYJD 5J1TC 1HDMA 1LO4H 1BJ1J 1CZ8L 2YEZB 3EO0B 4I3SH 4EBQH 4NZDA 1M71A 3OGCA 1CL7H 1LHZA 4QCIB 4DOHE 4TYUA 5BMFL 1F90H 2OBGA 2BSTB 1G9NL 4JRYD 2OR8A 5D1XD 4OLYL 1EJ6A 1DJSA 3S35L 2IF7A 3GSXA 3DGGA 1EEQA 2R1XA 3ARGD 4FMKA 2MQ0A 3N1MC 5CZVL 5JNYA 1OSZA 4C56D 4XWGL 4MXQD 3QWOA 5E03A 3U2SA 1KCRH 1ADQA 3ZE1F 4ZO6A 5ESVB 5IGXH 4UBDC 4ODSH 1XIWC 3BKJH 4NQCD 5KVDL 5HYIA 4ODWA 1TETH 1RZFH 3JTSA 1BGXL 1T20A 3GB7A 2HJKB 3SE9L 3IDYC 2J8UF 1LNUA 5MEPA 3CH1A 3MRRB 4E0RA 4NCC2 3OX8B 1NBYB 1GSMA 4JN1L 1R0AL 2UWEB 5F3BA 4JEGB 1YJDL 4KRMB 4LCYB 4M9PA 1S5HB 4LLUA 3RL1B 3VJ6A 2JKXA 4FXKA 2AXGB 4KC3B 4Q6IA 1MFDH 3CCHA 3GJEB 1MJJB 4UDTA 3I3DA 1I8KB 4XNMA 1AIFA 3FCTB 1CFSA 1Q94B 1WAAA 5F7HA 2FJGB 3ZTNL 1G0XA 2J88H 4XH2A 1XH3B 4XPAH 4D9QE 1A3RH 2BSRA 4JJHA 4NFBA 5D7IF 3QR2A 2MCPL 1A8JH 4IM8A 1B0GA 3T09A 3PDGA 4GMTH 3GMPA 4BKLB 4WENB 4QHKI 1SY6A 2MKWA 2DQHH 5CIPH 4Z7OF 5JOPE 4U7KA 3O6KL 1G9MC 1PW3A 1ZTXH 1KYOK 4YC2C 5MERB 5J11B 4JJ5B 3T4AA 4DWHA 5BVJB 1R3HB 1A0QL 4RRPA 4Z7QF 1NAKH 1CT8B 3CNKA 5HVFB 4X7DC 4EDXA 2HRPL 4OQTA 5IVXA 3OAUH 1QYGL 4L4TE 4Z78A 3UPCA 3O2VH 2DS4A 3ZDYE 3HMXH 3MUZ1 2NPLX 3BMVA 3WHE1 2O5XH 4L4JA 1ZA3B 5KSAA 2BXYA 1A21A 5DJ8A 4IIQA 2EH8L 1QFHA 2H8PA 3H9SB 2QJDA 3EJZC 3H42L 4G5ZH 5EU4A 2BFVH 3SO3C 5LGHH 2MOVA 2W9LA 5FUOL 4BSJA 3MV9B 4U2YA 1A2YA 5I1IH 5KG9A 3TCLA 4IBLT 1OP5K 1R3IH 1ZWIA 5SX4H 3EJYC 3KYKH 1T1WB 1B9ZA 5B39A 5BVPL 5GRXG 3HB3C 1WF5A 2N1KA 1AO7B 1G7IA 4NO0D 3V0WH 3MRGA 3HLAA 5C0EA 3JV4B 3S4SG 4YO0B 3OXRB 1S78C 3IJYB 1KB9K 3GIZL 3L95B 4HHAA 3VFNA 2JIXB 4LPYA 2HH0L 1XGUB 2NNAA 3OPZL 5C6PB 1JNLH 1BIIB 3TYGH 5DURD 4Z8FL 4NHUA 3FONB 4X4XA 4YFLI 2BHYA 4J3UA 5D7LB 4YXLL 1KIQB 3UZVB 1MI5E 3ARFD 4C57C 5FO7B 1IM3A 2J5LC 4LHUD 5M95B 2R1YB 4ONFH 4YHNA 4R9HA 2N56A 2CUHA 1UWXK 3P30L 1RVFL 4HPYH 4OB5H 5E4IA 5DHYB 4D94A 1HKLL 1T22A 3H3BC 2AS5M 4NC2B 3H0TB 1MFCH 3BW9B 2EDWA 4MHHG 1XR9A 1CLOH 1P7QD 4AL8H 3TJHA 2PTUA 2VUYA 1B2WH 3CPLA 5ENWB 1NFDE 2CRYA 3MR9A 4KAQL 3GMQA 3SE4A 2YD3A 3MRCB 4ZO9A 1Z5LB 4DVRL 2IALB 3MLUL 2F58L 1VGKB 4KRPB 5CCKH 5C7XL 4R90H 5DJAA 3SE8L 3T3ME 3NCJL 1T3FA 1XT5A 3V79C 1NGXB 3R4DA 1QOKA 4L3CA 3BZFA 4L3AA 1BQHA 2A6DB 3EOBB 1D5BA 3FJTA 5CSZB 2CLRB 4Q97A 4JKLA 2NY1B 5F9WC 3FFCE 4ZSOE 5D1QB 5EU6E 4RISH 5EA0L 5LCVL 1NQBA 2NY4D 3SDYH 1MAJA 4JDZA 2NY0C 4J3SA 2X10A 4L8SA 2CKBH 2R9HD 1T1XB 1VENA 5HHMB 1R5IB 1A6AA 4GUPB 2X1WL 5EZOL 3QXTA 4K71C 3MJ8B 2X89D 4XX1G 5I1HL 3RI5K 2AAVA 1R3LB 5E8NA 2AJ3A 1YPZE 4TNWK 5EDXA 4D9RE 5DO2D 2BMKA 3CDFA 4HJ0C 4NHCH 4P4KC 5DZOA 1LO2L 2ZG2A 3Q5OA 2Q6WA 2ZKHL 3T1FB 1D6VH 5DDHB 1HINH 4G42B 3GJFH 4UQ2B 4O51B 5BZWB 4TSBH 2GEEA 5DHVH 1R3JA 4XP1L 3LN9A 3T2OA 2CRZA 2PXYA 2YUVA 3BI9X 4NKQB 1WBYB 3EOAB 3TV3H 3VXTB 5I6XC 5DJZA 4LSDA 4PG9A 1IEAA 3Q6FA 3A67H 3FZUD 1RZKH 3EZJB 3EDEA 5C0CA 4X6CA 2DQJH 1Y6KR 4PJ5D 3QSKB 3F8UB 4QRUB 1I1YB 2YEZA 5GZOD 3TP4A 3T08A 5BXFA 3D1MC 3QG7L 1J9CT 1AFVH 2BSTA 1RIHH 2CH8A 4XP9L 5I8KH 1CXEA 1Q9WA 2EDJA 2O5YH 4U7SA 5J7CC 2QHRH 3EDKA 5IMKB 5C0JB 4QO1A 1FNEB 1AGFA 4YXKH 1YEJH 5SWZD 2ZUSA 3EDDA 4JFHD 4WUKH 5C09D 4JFFD 3WS6C 1V3KA 3HZVB 3MRRA 4B5EA 3OX8A 4LARL 5DC9B 1MCBA 4H1LH 1YQVL 4L8DA 2UWEA 4IRSC 2F5AL 3DROB 3VRLF 3TH3T 4YHYB 4P2QD 2WIIB 2DMBA 4LCYA 3VGGA 5LVEA 1S5HA 1UEMA 2YC1B 3RL1A 4Y5YB 5ID1A 3S8WA 4RIRB 3SGEH 4WFGD 5J13B 2AXGA 3LKPB 4C4KT 3GJEA 1CTOA 1MJJA 4PYGA 2W0FA 1I8KA 1BEYH 1Q94A 3X3FH 4LLMA 1E27B 1MRFH 2FJGA 3PL6B 4XB8A 5MENB 1XH3A 3O0RL 4Z0XA 3VDBA 2CJUH 4S1DC 1QRND 2NY7H 1BZQK 1FVDB 1ES0B 4PP2B 3O6ML 5K59F 4HUUB 3FQXA 4JJ5A 5BVJA 1R3HA 3ABZA 1WAAE 4NJ9H 1ZVHA 1PG7X 3FL7A 5JPMB 4NM8L 4XVJL 1VERA 3GMNB 1MWAL 4PJXF 4P5TD 1X5LA 4H5SA 5FV2A 4O00A 2YZ8A 3KLSA 4M5YL 5F6IB 2AXJA 2ENSA 1F13A 1KBGL 4LKXA 1ONQB 5D9SB 1CE1H 4ODHH 2PCPB 1WWBX 1UVQA 3QCUL 1ZA3A 3V4UH 4PLJD 4NRZB 1CFBA 4MX7A 5E4EB 3H9SA 1DLFL 3QDGD 5IVXE 2EDQA 1II4E 2IPKA 4ODBD 3K8MA 2WP3T 2Y5TB 3MV9A 1IGML 3MLVL 1FV1B 4EI5D 3IDIA 2ZOKB 2XQBL 4RGMB 5K9OB 5GRUH 1T1WA 4QWWD 4WJ5B 5AAMA 3WIFB 1OOAA 1F45A 1MY5A 3UTPD 1WISA 3L5IA 3L7FB 1N4XL 5I1DB 3UTTB 1LD9B 3CVHH 4HLZH 3JV4A 4HWUA 4F58H 4YO0A 3MRPA 1EHNA 3IJYA 3U82B 1JGDA 2J8UA 5ETUA 2HT3C 3OG4B 3TZVC 1H8NA 4P2OA 5SWSA 3QB7C 1XGUA 4LNVA 2HFFB 4PRNB 4GW1B 1BIIA 4WFHE 3T0BA 2DBJA 3VXPB 3PV7A 5D7KE 4YNYB 1I8LA 4GXVL 3U79A 5HSFA 1JZ6A 3FONA 1VADB 3QFJB 2I24N 3WMSA 2YUWA 2BCKB 3C60C 5ISZA 1HH9B 5EUKB 4POZC 3ZKSD 1QFUH 3PWVB 5FO7A 2VSCA 4M6ML 5IESL 4TVPL 2VE6B 3BSZH 2NW2B 1OTTC 5TFSL 4F7TA 1CK0H 1JGUL 3ECBB 4IRJB 4K3JH 4S1SL 1EHLL 3CZFB 4NHUE 4K8RC 4ZOEA 5DHYA 4UNTA 1PX4A 2VDPL 2DB8A 3UBXB 4WI9A 3WFDL 3H0TA 1INEH 1DR9A 5BZDB 2RJMA 5GS1C 5D7IA 1U58B 4OT1L 1JI2A 3INUL 5ENWA 1SYVB 3RDTA 1ZHKA 2JJSA 1IC5L 4P46C 4YXHH 3TEUA 3NN8A 3MRCA 5HHXH 1FE8L 1JNHB 1MRDL 4I3RL 4HCRA 4ZPVB 4TUOB 4ZYKA 2C5DC 2FJFB 3NIDF 1NGXA 5DUML 2JB5L 1NGZA 1H3GA 3ILPB 3T0EC 2QSCL 2A6JA 2A6DA 3EOBA 1F3RB 4MLSA 2CLRA 5IHBA 4QF1A 5DEGB 3MOBH 1BFSA 3OKEB 4PP1C 1IAMA 4BUGA 1LQSR 3MRFA 2DD8L 1CZ8H 3ZT7A 1N0LA 1B6UA 5L0QB 5CHNA 1T1XA 4GKOA 3DVFA 4KROD 5BMFH 1R5IA 4GUPA 3TWCL 3FO2A 2F54B 4JKKA 3MJ8A 1EJOL 1G9NH 5BV7L 2V5MA 5JOPD 4OLYH 2R2BA 2MTPA 4G59A 4N5EA 5JW4M 3S35H 3IFPB 5BS0B 5CP3A 4DZ8B 3ULVD 3O9WB 5CZVH 5KVGL 4ZS6C 4XWGH 5K9JL 4M7JL 3HE7D 4ZFFB 1TMCB 4LF3A 5DRXA 4JFDB 1WFUA 4O02L 1E6JL 3BQUB 4L4TD 5C3TA 5FKAB 5C86A 3ZKNC 1FGNL 3QEGL 5KVDH 2PO6A 4GO6B 4G42A 2I9LA 5DDHA 1I9EA 3SE9H 1BGXH 4O51A 5LKNA 1I1AB 1TDQA 5BZWA 5C08B 1KYOJ 1ORSB 5HHNB 5F9JB 3QCTL 4I48B 1SJVA 2QBWA 5E5MB 1WBYA 3EOAA 1S9WB 4JN1H 1R0AH 3VXTA 5IB4B 1VPOL 1NSNL 4MA7L 1UENA 3HZMA 4M1GL 1YJDH 3C6SB 2Y6SD 1NKRA 4QRUA 3O8XB 2HLAA 4OD1L 3LKQB 4HX1B 1H8OA 3SDAD 3GHEL 4OD3L 5CD5D 1LMKA 4PV8B 5GRYA 4JFXB 4Z95L 5HBBA 3ZTNH 1EBPA 2FO4B 4G8GD 2MCPH 4H8WL 4X6CE 4I1NB 5IMKA 2C3GA 4WGVB 5C0CE 3AAZB 3TBVB 2P48B 5BRZB 4HLJA 2E9IA 2IMNA 3O6KH 3O11B 1O7VA 1YC8A 1FNEA 4WY7L 3ZKXC 3FB5B 1A0QH 3GSOB 3HZYA 1MI5D 3P2TA 2APFA 2HRPH 1UZ6E 4ODUA 2ZNXA 2WW8A 1JZ8A 4M7ZC 1QYGH 1KB9J 4RGND 3HZVA 3P77A 3DETD 4ORZC 4RGMC 1ZHNB 1IJ9A 3QIWC 5HI5C 5DYOB 4NKDB 1H9VA 1CIUA 3DROA 1Q9KA 2UY6A 4APQA 2WIIA 1I9JL 2CMRL 1XZ0B 2EH8H 3JWOC 1C12B 1BLNB 3HNSL 1CFVL 2YC1A 4Y5YA 2HFGL 4F57L 3H42H 4AIOA 5IK3B 2HFEB 5FUOH 1D5MB 4HZAA 1DBJL 1X5KA 1X5IA 5H8DA 2IAMC 2F19L 2WAHA 1F4HA 3V9FA 1E27A 3PL6A 3BGFC 5D2NB 2UWEE 4XCNB 4NDMB 5BVPH 4PJ8C 5DA4A 4NP4L 4RMWA 4DN3L 5HHQB 1XF5A 3B8SA 2CK2A 1RJZB 1FVDA 2CLZB 1IC4L 1ES0A 2OS7A 3IDNB 4HUUA 3GIZH 1F6AB 5CAYB 2HH0H 3OPZH 2DQGL 1ZLVK 4Z8FH 2CPCA 4CADB 3LRSB 1CXHA 1IILE 5T1LD 2VKXA 1JYWA 4YXLH 1QFPA 1R6VA 3PWLA 1OSPL 4Z7UB 5F88A 1ONQA 5D9SA 4BZ2L 4MQSB 1SVCP 3GRWA 2PCPA 1L8JA 2P8LA 3P30H 1RVFH 2X2YA 3QUYD 1HKLH 4U33A 1PG7L 1VEOA 2EO1A 4Y4HA 5GGSB 3SQOL 2Y5TA 5IMLA 4CN6A 3QEUB 2JJVA 5I19L 1FV1A 2KKQA 4ZAKC 5D72L 2GJ6D 1DUZB 1N6QL 3WIFA 3TA3D 3NOIA 4KAQH 2JK5A 4N9GB 3H9SE 2R0KL 4OCXL 5I1DA 1DZBA 3UTTA 1LD9A 4DVRH 2R2CA 3ARVA 15C8L 3KS0H 3MLUH 2F58H 1OAYL 3MV9E 1MJUL 1AR1C 5C7XH 3BJLA 3SE8H 3NCJH 2AP2A 3SDCC 4A2LA 4QXUL 3SDDC 3EHBC 2HFFA 5EUOB 4PRNA 3TFKC 2NZ9D 3VXPA 5IQ7L 4YNYA 3LOWA 3OKKB 5F1KC 3VGAC 4MS8A 3MNVB 1AO7E 5EO9B 1VADA 3QFJA 3ZE1E 2BCKA 2Y23A 3RWJA 1T2JA 1CDCA 1HH9A 2FRGP 5E95B 5EUKA 2H32B 1WFTA 1NBVL 2VLME 5EA0H 5LCVH 3VXRB 2VE6A 2J8UE 3REVB 2NW2A 1GGYA 1FL6B 2I07B 4Y2DB 4IRJA 5LG1A 1I8MA 3P40A 3V5KB 3CZFA 3CD4A 4L8CA 4BSWA 5EZOH 3UBXA 3QI9D 1RZ7L 1YEIL 5I1HH 1U58A 3S96B 5I71B 2XZAL 4MHHI 4MJ5B 2LU7A 1UH4A 1AR2A 2GW5A 4PRID 1SYVA 1D6EB 2NY5L 3G6JB 5EIVA 1RZJL 1WFNA 4MZ3A 3RVVD 2QR0B 1LO2H 4YEEA 2X4QB 5FYLE 2ZKHH 1JNHA 5HI3C 1IVLA 4R96A 4QY8B 3EUUA 3OQ3B 5D7IE 3W11D 3P4OB 3PIQA 3NA4A 4ZUWB 3BRDA 4Z7OE 4XP1H 5IJKA 3LVEA 3ZE0F 2ZSWA 3K74B 3ILPA 3CX2A 3AS1A 5AD0B 1S7RA 2Y06L 1A47A 5IROC 2XTJB 2DJSA 2H26B 2Y36L 2D7QA 4D9LL 2K7PA 1OT2A 4Z7QE 4PJHF 1KLGA 4LP5A 2NXYC 3WSQL 4XZUA 4Z7WF 1YY9D 3OL2A 2GK2A 4HAGA 1JWSA 3QG7H 4PJGF 1ACZA 1D9KB 1MRCL 2P7TB 3B3IB 1G6VK 1WZMA 2F54A 5DJ6B 1YEDB 3K1KC 1N6UA 4XP9H 5JW4R 1YECL 2P5EA 3L9RB 4NO5B 2RIKA 3FB7B 3ISWA 3BPOC 3IFPA 5BS0A 1KNOB 4LP4A 1UWXH 2BRRL 4P3WA 5FUCE 3HTLX 4H1LG 2B1AL 2X9WA 2AERT 1RZGB 3QDJD 5C07B 1TMCA 3QXAB 4JFDA 1EA9C 3IU4L 1F00I 1YDPB 2GFBB 3MRHB 5FKAA 1VFBB 2VITB 5SV4A 4GBXD 3CJJA 4M93B 3QQ9D 3ARBC 1WITA 2D2OA 5HHNA 1ORSA 5F9JA 3ZT5A 3I6KB 1UCBL 4I48A 1QACA 1Y6NR 4LARH 4ZO7A 1YQVH 4JDVB 1CBVL 4XPTL 1S9WA 3MLTA 1WICA 3ARXA 3MZGB 2X1QA 2VLJB 3MCKB 2F5AH 2R23A 1BOYA 1T6VN 1JV5B 3DX8B 3PWPD 3SKMB 3C6SA 1MQ8A 2VZ3A 2ESVA 3IYLW 2X4NB 3O8XA 3WE6A 3LKQA 4HX1A 3ROOB 2JCCB 3GHBL 4PV8A 4R3SB 4UBDD 4JFXA 4DEPB 4NUJA 3HE6B 1GVIA 3QHTC 3LKOB 1BX2B 3O0RH 4EUPH 2FO4A 1DL7L 5L2KD 3ULVL 4JQXA 4GRLC 4YJZL 3JV0A 4WFHD 5BRZA 5LGJB 2Z35B 3MOAL 3O11A 3O6MH 3QQ4B 5D7KD 4ZS7L 3WUWB 3K0WA 3DX9B 3FB5A 1SJHA 3ILQD 3RZCD 2E7LC 4NM8H 1FFRA 4XVJH 3GSOA 1MWAH 2AV7A 2BSED 3WO4C 4PLKC 2VQTA 2OR9L 5FDYA 4M5YH 2W0LA 3KPNB 2ZG1A 4GRWH 1KBGH 4Z7WB 5EBLA 1ZHNA 3DIFB 5DYOA 4NKDA 5F7KC 3BH8B 3V0AC 1EO7A 3QCUH 3ZKMC 1QPPA 4XAKE 3D39B 1XZ0A 4F9LA 1C12A 1BLNA 1CD1B 1DLFH 2BOCA 3N1GC 4NUGL 2HAZA 4ZOAA 2DKUA 3Q3GB 4HLZG 5IK3A 4LAQL 1GXEA 2HFEA 2BRQA 3ZHDA 1D5MA 1IGMH 5GRVK 1MHEB 4KKCC 3H3KA 3MLVH 2XQBH 2AW2A 2YPVL 5T3XD 5C0GB 2DN7A 4KMTL 1HH6B 1YYLL 4XNQA 5IKCB 5E7FA 3C2AL 1T83C 1A14L 3QNZB 4M1CC 4OF8A 1N4XH 4HKXB 5HHQA 3TJHD 1HHHB 4LGPB 3RX5A 4JGMA 1RJZA 4KTYA 4AENB 3KXFB 3IDNA 3GMLB 4DKFL 4HULB 3FO0L 2Z31A 4N0RA 3BJ91 5AYUL 3NAAL 1K4CB 3IFOB 3S5LG 2J2ZA 4CADA 5K93A 4YH6A 1FFPA 4HXBL 5CGMA 4GLRH 3PWNA 4F7PB 4M6MH 3D3VD 1IKNA 5IESH 4HS8L 1NANI 3HB3D 3R1GL 4TVPH 4BZYA 5IT2L 2ZCLL 43CAB 5TFSH 1JGUH 5TJWK 1XF2B 4S1SH 1EHLH 2P5WD 1UWEL 5JIPA 2D4DA 1JF5A 2VDPH 1S78D 2VQUA 3WFDH 2V2XB 4ALAL 5GGSA 2IADB 4OV5B 3QG6A 5JXEA 1OL0A 4OT1H 5TF1L 4I0PB 3INUH 3BO8B 4UILL 1DUZA 2GITB 3VA2C 1IC5H 4KUCD 5DK3A 4N9GA 4AM0B 3IJHA 2AVGA 5FOJA 2BOBB 1FE8H 4OFYA 2X7LB 2VMFA 5JO5B 1MRDH 1RAMA 4I3RH 2C3VB 4GQ9L 1FNFA 4Z77B 3QULB 5DUMH 2JB5H 5EUOA 2PTTA 2OYPA 1U8NB 2QSCH 3OKKA 3S36X 5FM4A 1MSPA 1J8KA 1I4FA 4R2GC 3UTTE 3SBWA 5SV3A 5JZ7C 2H32A 2PXYD 5F97E 2OI9A 1CE6A 3REVA 2DD8H 1P53A 2P49B 1FL6A 3LQZB 4Y2DA 2Y72A 3V5KA 3EYSL 3MV7B 5C0CD 2JJTA 3TWCH 5GS2H 5CGYD 1RU9L 3QFJE 3VXUB 1EJOH 5BV7H 1I1CA 3VXOB 3VRLE 5E2VL 4UQ3B 3WDHA 4Z6AT 2DLIA 1UACL 3S96A 1RK1B 4U1JB 1J0JA 3MNWB 5A1AA 1FLRL 2ATPB 5ICXA 3TNNB 1KB5L 3X12B 1D6EA 1WIOA 5KVGH 3MYZA 5K9JH 3G6JA 4M7JH 2BVPB 1XF4B 1PVHA 4U3XA 3LSOB 5F9AC 1HHGB 2E6QA 2QR0A 2FWOA 4O02H 1E6JH 3GKWL 3T0AA 4S1RL 2X4QA 3JBG7 1FGNH 5GRVL 3QEGH 2ICWB 1L0QA 4QY8A 1R3KB 4CAGA 2NY0D 5KS9B 3P73A 4ZUWA 4L1HA 2R15A 3QCTH 4YHIA 3RWFB 5FA3B 5TF0A 1GZQB 5AD0A 4FG6D 3CXHK 1CL7I 1V3MA 1C7SA 2H26A 5CP7B 3P4NB 1VPOH 1NSNH 4MA7H 4OV6F 4M1GH 1X6LA 4IMLA 1EFXB 1HYSC 2I60L 3MBEB 4OD1H 4P23A 3OAYK 5B3JF 1FL3B 4N68A 3GHEH 4OD3H 4XGZA 3WJJC 3VXNB 4KK9C 4Z95H 4U0QB 1U8OB 1D9KA 3B3IA 4KHXL 1YEDA 3WFHB 2L7JA 4GRMB 5IJVA 3L9RA 4NO5A 3RJQB 5A40E 4H8WH 1KULA 4CVZB 4GXUM 1A3QA 4HQQL 1RZGA 3QXAA 4WY7H 1YDPA 2GFBA 3MRHA 3VFRB 2ZNWA 1ZGLP 2F54E 4HJGA 1VFBA 5MI0C 3G6AB 4LCWB 2P5EE 4ZFOB 3Q6GL 3BEVB 2KL6A 5BS0E 5A2IH 3WNLA 3I6KA 4L5FL 3HHRB 3K80A 4JFDE 2VLJA 3MCKA 1LE5B 3NCYP 4P3CL 5JXAL 4U0RC 4C58B 1I9JH 2CMRH 3HNSH 1CFVH 2HFGH 2X4NA 5HVWA 4F57H 3FMGL 1MUJB 5B21A 1DBJH 3ZTJH 2DDQL 2F19H 4TNVF 3HE6A 1B4RA 3LKOA 1BX2A 5DD6B 1OW0A 3S3SA 5I1GL 3CX5K 1Z3GL 3LHPL 4NP4H 1PYWA 4DN3H 2ESVE 2B5IC 5J56B 5JIIA 4YBHA 2Q3AA 2DF3A 5LGJA 1MCDA 2Z35A 1IC4H 3ZYIA 2O5ZL 3QQ4A 1IGIL 2QKIB 3WUWA 2HVJB 1AO7D 1F4XL 1KPVA 3RNQB 2ARJB 2DQGH 5F21B 2FEEI 2BZDA 3G5VA 3CU7A 5F7FA 3KYMB 4F15C 4K23L 2VLMD 2W38A 2YN5A 4LDEB 3TBTA 1KGCE 3EYQD 4N1HB 3KPSB 1FYTB 2JIXD 1I3GL 4PJHA 4LEXL 4L29B 3SO5A 2EDOA 2HTLC 5BRZE 1OSPH 4LVOC 1X44A 1UXWA 4Z7WA 1GYAA 3DIFA 4BZ2H 3E1F1 2XKNB 5SX4I 3C5JB 3NIDE 5D7LD 3AREB 2UZXB 4RMVA 3D39A 2OSLA 4MA3B 1RJYB 1UB6B 1CD1A 2QADB 1TVBB 1ROWA 1PG7H 3Q3GA 1IQDB 1FL5B 1TLKA 1DQLL 3SQOH 1S7VB 5I19H 4H20L 4WEBL 5D72H 4Y4KB 3MV01 5C0GA 1N6QH 3GGWB 1HH6A 1S7UB 3C5SB 5HYQA 5IKCA 1U8HB 2YD2A 4W4OA 4NO2B 2R0KH 4OCXH 4TTDC 4HKXA 2FH8A 2LVCA 1HHHA 1VEPA 1MLCA 4BQCA 15C8H 1EZVX 1OAYH 5CLTA 4AENA 1MJUH 3W0WD 3KXFA 2ADFL 3EW3B 3BD4A 5SWQA 4OTXL 4FQXC 4QXUH 4QOKB 1K4CA 4UMGA 5IQ7H 4N8VG 4BH8B 4KRPD 4QXWA 1WUNT 3BKYL 4OCMC 2CSPA 5D6CB 2FEDD 1U8KB 3P4LA 4Z0BL 3V0VB 5KOVC 2D4FA 1NBVH 2C26A 3QAZC 4F7PA 4IOFD 1OQOA 5DMGD 5F7NC 1P7HL 1QG3A 4QT5A 43CAA 3E3QC 2NY1D 1XF2A 5D1QD 1VFMA 4TUJB 2AXFA 4J3TA 5GISL 3EO1A 2V2XA 1RZ7H 1YEIH 2HT3D 2IADA 5JR1L 4K7PY 2XZAH 4LSUL 5HHMD 5T3XL 3GSUB 3BO8A 4V1DB 3SY0B 2GITA 2NY5H 4P5MB 1I85A 3VD4A 1DQJA 1RZJH 2VISB 2X4OA 4RFEB 4N5ED 5FM5M 4AM0A 4YIQB 1CXFA 5EBWB 3QUMA 2BOBA 4LQ1A 5CINL 2WV3A 3QRFM 3V7AE 2X7LA 2Z91B 5JO5A 1F2QA 2H2SD 3U0PB 2C3VA 3MRJB 1I7UB 3IDMB 4X4YB 4Y19A 4Z77A 3QULA 2JE8A 4QKXB 2W1NA 3K2UL 1U8NA 2Y06H 3IF1A 1FJ1B 2Y36H 4D9LH 4OCWL 1QBAA 5DUBA 3FOMA 3WSQH 5T3ZE 3K81A 1ZK9A 2IFGA 4PJBB 1L6XA 3LKNA 4YK4C 3LQZA 5EUOE 4WFED 3QUKB 5GGTL 4FS0A 3MV7A 4N0UB 4BELD 3DVIA 2DLFL 1MRCH 2OXHA 4LQFL 3VXOA 1YECH 4UQ3A 1EEYB 3S36L 4RAUB 2D7MA 3MNWA 3T0ED 5I0ZA 3VXRE 1WCQA 1ZV5A 3X12A 2BRRH 1KV3A 2BVPA 4DN4L 1XF4A 2B1AH 5E70A 3LSOA 5B3NA 3IU4H 1KFAL 4MNHB 4MA1B 1R3KA 3LPFA 4UT6L 2NY3B 3RTQB 5KS9A 3QUML 5K9QG 1K3IA 2Q76B 1RIVL 1UCBH 3OKNB 4XAKD 2CR6A 3G6JE 3ZMRA 5ANMA 1CBVH 4XPTH 5CP7A 4P4KA 3MLWL 5EOCL 1C7TA 4EUPG 4OCSL 4OUUB 2E7CA 4CDHA 1EFXA 2XPGA 5IM7B 5DZLA 4I9WD 2H2PC 1FL3A 1M05B 3GHBH 3QFDB 2EKSB 3KJ6L 35C8L 1AH1A 4XBGB 1U8OA 2YN3A 3IAPA 2D7NA 4LVHB 5E94B 5EO0B 2R0ZL 3RPIA 3WFHA 3PF2A 4GRMA 1PKQB 2ITDA 1DL7H 1U8LB 1PBYA 4OZIF 1ZXQA 4QNPF 3GFUA 3VFWB 1D7FA 3ULVH 3S4SB 4CVZA 5JQ6L 5MEND 4CW1B 4NNXB 3MOAH 1UKSA 4ZS7H 1M4KA 1OGAD 3MLRL 2P44B 1J88A 1GGUA 1TJIL 3VFRA 2A0LD 4AQOA 2F53B 4XNZC 4LCWA 4ZFOA 4LCCB 3BEVA 3RVTD 4L9LB 4KQ4L 4RMSA 3SGEI 2OR9H 2LE9A 5CJQL 1ZAGA 4HK0A 4A6YB 2NYYD 3LCYA 3EFFB 1LE5A 2XT1B 5IB5B 5D7JB 4PGCB 3CDYA 4NUGH 1A7PL 2DLEA 3JUYA 4JZNB 4Y5VB 5HDBF 5TGBB 3IRZA 3OMZA 4LAQH 4LOUC 4H26B 3DBXB 1MH5A 3RRQA 4MZ2A 2YPVH 5CJXC 2HMIC 2R1WB 5DD6A 2VLJE 4JZJC 4KMTH 1YYLH 4IRSA 5JOEA 3C2AH 4DGYL 4YPGB 4J7RA 1A14H 1SEBB 3PHQB 1ZLWK 4M3KB 1HQRB 1XGYL 2W59A 5ITFB 3MRLB 1NKOA 2Q20A 2QKIA 4DKFH 4QGYA 3FO0H 1MCNA 3GMRB 4ONHA 2ARJA 5AYUH 3NAAH 2QTEA 1YEEL 3UTTD 1CWVA 4HC1L 5D93B 3KPQB 2EDBA 3MX0A 2IAMD 3KPSA 3B2UD 4HXBH 4MAYC 3VDCA 4TNVK 4PJ8D 1QA9A 2E5EA 2OTUB 1FIEA 4HS8H 2XKNA 2DLHA 3R1GH 3RBGA 5IT2H 3QFJD 2ZCLH 5C71A 4NSKB 2R2EB 3ZE0E 1LP9F 1RJYA 4MA3A 1UB6A 1UWEH 5DXWA 3BXNB 1LK2B 1IQDA 2DBLL 1FL5A 4ALAH 1OLLA 4PJHE 2E6PA 1CGVA 1S7VA 2RBLA 5TF1H 3MRDB 4Z7WE 5DFTA 3W9DB 4UILH 3OJMB 1W72A 4MXWL 1F4YL 1YMMD 3D39E 3E8UL 4NO2A 1K2DB 3VWKB 3VI3F 5FYKU 3E6FB 3LRGA 4UUJA 2NTSP 5BOZG 4OBSA 2J4WL 3KHOA 4GSDL 2EXWC 4GQ9H 4N90E 5CLWA 4K94L 4QOKA 2KZWA 1IM9B 1LILA 5EC2B 3REWB 3SGKC 4U4BA 4HWNA 4BH8A 1UH3A 4P9ML 1CLZL 5F1NB 3MFGB 4ZO8A 1U8KA 3V0VA 2VC2L 1C1EL 2UZYB 2W65B 2Y07L 5E1AB 3CXHJ 3KXFE 2IBBA 4YHZL 2GUOB 3IXAA 4MVBC 3TZVA 4GW4B 4WEUD 3EYSH 4JLRB 2FL5B 4TUJA 3TO4B 3KWWB 1KG0B 1FSKC 1I1RA 3H9HB 1LEKA 1WIPA 1RU9H 1V05A 3BIKB 4WI6A 2ZPKL 5CD3B 1IFHH 3C60A 4FTVB 2NY3C 5E2VH 3SDCD 1B6DA 1UACH 1N0XL 2D9QB 4HWBL 1NDGB 3TFKD 3VFOB 4WV1C 3GSUA 1FLRH 3BHBB 4V1DA 4IDLA 3K1DA 4LSSL 1KB5H 3SY0A 2F54D 4P5MA 3FQWB 3EBAA 1U8MB 1U42A 2XNAA 1IGJB 4YIQA 1LGVA 1T5XB 5EBWA 3GKWH 3CFKB 4S1RH 3O9WD 4P57B 3CXDL 1RUKL 4S0SD 3WHE0 3MRJA 4NQXA 4W4NA 1HCFX 3UTQA 4JFDD 3QNYB 4WFFE 4POYA 3BQUD 5GRZA 5DMYA 4NRYB 5HPOA 2NMSA 4N0CD 1FJ1A 1ZT4A 2ZG3A 5DVNA 2X5PA 1I1AD 1KTLB 5C08D 4P3DB 1JHKL 1FH5L 3RVXC 2I60H 1C16B 5KAQG 4WHYH 1MCKA 1CG9B 4HUMB 5FGBA 1AGCB 4Y19E 3QUKA 2G5BA 2FCBA 4N0UA 3EOTH 5J3HC 4PGJA 1LO5A 3MRBB 4XT1C 3O8XD 4KHXH 3WL9B 1T5WB 1E0OB 1F6FB 4RAUA 5C0NC 4ENEC 5AZEL 1Z0MA 4LDOB 1BQLL 1H3UA 4HQQH 1OLZA 1JYNA 4ZOCA 3MV7E 3ZE2F 4ONOA 3O6FB 2JB6B 4MNHA 2NR6C 1A7RL 3NACL 1UGNA 2K3TA 1OP9A 3RTQA 5J6HB 4MD4B 3Q6GH 1F3DJ 1CN4A 4K8RL 2VLKB 5F8RC 3QQ3B 5EZJB 4Z76A 2Q76A 3KYNB 4TTGA 2DQIL 4Y8DC 3ZTJG 4FQJL 4L5FH 4NC1C 4Q6YA 5I8CB 2QV2A 4F3FB 2CRMA 2W92A 3U4BL 3NCEB 4U1MA 3RX8A 5HGGS 4P3CH 4X0KB 3SDXF 5JXAH 2X4UB 1JYVA 3L3JA 2ED8A 4R0LB 5IM7A 4PTUA 5HGAB 4G43B 2PN5A 2YA0A 3VI4E 5KS9E 2XG5A 3FMGH 1M05A 4U6YB 1WBZB 3QFDA 4M02A 5FAAA 1K8DB 5IMOB 2DDQH 2E9WA 1MCLA 5ANME 5M7QA 1J8HB 3I50L 5EO0A 5I1GH 5E5RB 1PKQA 4Z5RB 4KWUA 1MEXL 1Z3GH 3WFEL 3ZL4L 5F7DB 3LHPH 4NJAL 5J1AB 5T1MA 3VFWA 2XRAL 5I30L 3TC9A 3S4SA 3TYFA 2V7NA 2Z0BA 4CW1A 4NNXA 3STZB 2O5ZH 1IGIH 5J4MA 2EDKA 1F4XH 3QIUB 3ALPA 1G7QB 2F15A 1T7ZA 2QQQA 3TNMA 2F53A 4O2EB 4K23H 5EOCJ 1FO0L 3NZ8B 2X4TA 4LCCA 3F58L 1FVEA 1S7QB 4L9LA 1BPVA 2P8PA 1IMHC 3BIBX 1HILB 1I3GH 2YD9A 4LEXH 4G7YL 4JREC 3ULUE 3QWRD 1FLTX 5ITBL 4A6YA 2YPKA 3QUXC 2WK2A 3BPNC 4LIQL 1E28B 5IB5A 5D7JA 2XOTA 3VWJB 1AP2A 4LCWE 5CEYB 3UJIL 2VNCA 2LTQC 4JZNA 2PF6A 2GAZB 1G84A 2V2WB 1DQLH 4ODVL 4Q74A 1M6OB 2K9UA 1UJTA 1T7YA 2I5YL 3DBXA 4UV4L 4H20H 4WEBH 1FNHA 2N4IA 2R1WA 3ZO0A 5KVEL 4LHJB 4DGVL 4YPGA 3QA3A 5EIIB 3UX9B 1HQRA 2Y4SA 2WNGA 5FYKD 5ITFA 2KZ1B 1VKXB 2WMPA 3MRLA 2E27L 2ADFH 4TSCL 4OTXH 2VLLA 3GMRA 5JPNB 3V5DB 2CUIA 2YXFA 3MO1A 4WIQA 1CVSC 4QHMB 1LEIB 2APTA 1MCRA 1A6ZB 4NKIL 3BKYH 3DRTA 4Z0BH 4KDTC 1CDUA 4YHKL 4PG2C 5FKPB 3SOBL 2OTUA 4M4PA 4R4NC 3TIDA 4NSKA 1AJ7L 4ZODA 2LV4A 3BXNA 5GISH 3X13A 4OFIA 1TQBC 5JW4Q 4NIKB 2ICEA 3VXRD 5HVHB 1JZ7A 3KPSE 3O81A 3PQYB 5JR1H 2EDNA 4HZLB 4Y2DD 4RCAA 4KI1A 1ZLUH 3IU3A 4OZIA 4LSUH 3TVMB 5T3XH 3MRDA 3W9DA 4J2XA 1YN6A 5B3JE 3IS0X 4PRHD 5D1XC 1ZHLB 5DJYA 5E2TL 1V5JA 1K2DA 1OD9A 3VWKA 4JM2B 5CINH 1XGTB 4KPHL 3JWOL 3PHSA 3RP1A 3CC5B 1GPOL 3ARQA 5C0DB 4LLQA 3K2UH 2R39A 4EDWL 5EC2A 1IM9A 3REWA 5CZKA 1H0DA 2XQYG 3GSRB 4MWFB 1F58L 3FO1B 1BVLA 2AEIT 4OCWH 3MA7B 1F3DH 2V5YA 1CYGA 4UB0L 3BRGC 5KSBF 3IDGB 1MHCB 2HTKD 2NXZB 2W65A 5E1AA 2XTJD 5E6IB 4B7IA 2GUOA 4HWEL 3DARA 4GW4A 4QOKE 1S8DB 5GGTH 3VFMB 4JLRA 1C5DB 1KG0A 3HG1B 2DLFH 1BQUA 3H9HA 3BIKA 1MCSA 5F7YC 4LQFH 5CD3A 5HPMA 4FTVA 3JTTB 5CUSL 3S36H 1NDGA 3RHWF 2P24B 4TOYL 4OM1L 5GZND 5I8EB 3BHBA 4XP4L 1R24B 4R8WL 1D9KD 3GI8L 2Q1EA 4JKWA 1FP5A 2RQ8A 3FQWA 4DN4H 1IGJA 3VRIB 4D0CA 1T5XA 4O4YL 1KFAH 2H6PB 1TXKA 5FYJD 3CFKA 1XAUA 1O7SA 4EKXA 3GK8L 2R4SL 3ES6A 4P57A 2WWKO 4YX2L 4UT6H 1WFOA 5C07D 3QUMH 3WD5L 4K3GA 3BPLC 4V1DE 5T1DL 1RIVH 4NRYA 1RD6A 3DX6B 1GGIL 1RJLA 5E8PB 1ZANL 3E0GA 4HGWB 2Q7YA 2ERJB 3MLWH 5EOCH 1KTLA 3DURB 4OCSH 4P3DA 2E6JA 5FGCB 2LABA 3AM8A 1LP9A 2EDLA 4GAGL 2BVEA 1BHGA 5JIHA 1IGYA 1J87A 1I3UA 1X4ZA 1CG9A 2RFXB 2FJHA 1AGCA 5T1KB 5I76B 2BNQB 1NBZB 3QZWG 3KJ6H 35C8H 1J12A 5EULV 5J06A 5IROA 3MRBA 4LVNB 3RIFF 3W81A 1NCNA 3DV6B 3T65B 2XWTB 2R0ZH 3OR6A 4I4WB 3WL9A 1MVFA 2WIMA 3EIFA 4G8FB 5D96B 1YN7A 1LK3L 3C08L 4XCYA 2FHFA 2ZUXA 5CBEB 3HE6D 4XXCA 5JQ6H 1H3PL 3L3GA 3MV8B 3MRNB 3MLRH 2DWDB 2NLJB 4N0UE 1FFOA 2MCG1 5I16B 3O6FA 2JB6A 1TJIH 1J0IA 2HYMA 5IV2B 3D0VA 5J6HA 4MD4A 1M7XA 2HN7A 1U8QA 4LRNL 4KQ4H 3B4NA 3QQ3A 5EZJA 3KYNA 1UM4L 1MY7A 1KJMB 5CJQH 4LRIC 5FCUL 2G75B 3V6FB 3ARFC 1UJ3C 2X4UA 3IAGC 1RV6X 3MJ6A 4LLVB 4R0LA 4KUZL 5E2JA 1A7PH 4G43A 2BJML 3SEPA 3TCXA 4WWKB 3GSNL 1K6QL 5FB8A 1K8DA 3D39D 4NFCA 2Q8AL 1GL4B 3FFDB 4M61B 2DICA 3V6ZB 4YBQC 3EGSB 4Z5RA 2DRUA 4NQUA 3FOLB 4DGYH 4G9DB 5F7DA 1XGYH 4N90D 2XWJB 4B50A 4CMHC 3FB8B 4KVNL 2I26N 4L4VA 4PS4L 3STZA 2BVQA 3BP5B 1MQKL 3CFJB 3SE3C 4XMKL 4HS6B 2E9JA 3QIUA 1TZGL 5B8CC 1Q1JL 2PNDA 4HIEB 1YEEH 4G8IB 5GHWL 4O2EA 3Q0HA 4HC1H 1PKQE 1TVHB 2FX8L 3NZ8A 1S7QA 3X11B 1HILA 5IW3A 3VA6A 4EIGB 2VIRB 5D1ZC 4Y0GA 2ARJQ 5E9DB 4OZ4A 1OTUD 1G7JB 1E28A 4IEFB 5IVOA 1NEUA 5F8QC 3U0TA 3LEYL 4PBWD 2F53E 3VWJA 5CEYA 2NY4C 1AE6L 1TQCC 2NW3B 3NCMA 5IQ9B 1KTKE 2DBLH 2V2WA 2VDRL 3U4EA 4XVSL 2R9HC 3VXMB 1M6OA 1I7ZB 2A77L 1GGTA 3R8QA 4MXWH 1F4YH 1PY9A 2OZ4L 1P7KB 5DJCB 4AEHL 3E8UH 5F89A 4NYLB 5EIIA 4H25B 3OZ9L 4I0PD 1DE4A 5JLZA 2J4WH 5DO2C 4GSDH 3QPXL 4OI9A 1WT5C 1HQ4B 2HA1A 4F37F 4KK6D 3T4YB 5EB9A 4K94H 5HHOB 5JPNA 3V5DA 3B9KA 3BUTA 3WDJA 5I1KL 1LEIA 4P9MH 5KSVB 1A6ZA 1CLZH 2VXUL 3SDXA 1OAQL 4CNIB 3EYFB 1CXIA 5I75B 3WLBB 5E8DL 1UT9A 2VC2H 1C1EH 4RX4A 2Y07H 3V6OC 1EUUA 5FKPA 3MYJB 5I1JL 4WUUD 4YHZH 4UDUB 1FZKB 2IANA 3F6LA 3M45A 3FZUC 3D69B 1AQDA 3QCVL 3AB0C 1OP3H 3VFSA 2XWBB 3G5XA 2X4PA 3O4OB 2ZPKH 3PQYA 4Q9BA 4ZUSB 1N0XH 4HWBH 3GMMA 3TVMA 1IEBA 5GS0D 5GQBA 1UZ8B 3MV7D 5GIRB 3H9YA 4XRCB 4LSSH 3M17B 3VXUD 2FSEB 2EYTA 3L7EB 1R5VB 4ERSL 3S6CA 4BFBD 2DQDL 1JZ4A 5FYKL 4HWZB 4XX1E 1XGTA 4O2CA 4ZXBB 3B8YA 3LPWA 1IC1A 4GKSB 3OJVC 3CXDH 1RUKH 4DQOL 4OZIE 4WHYG 3SGDH 5GGRB 5C0DA 4WO4C 2Q86B 5GGQL 3I9GL 4F7CB 1WQVT 3QRGL 2AJUL 5DVMA 4HBQA 3GSRA 4MWFA 1EXUB 4ZQKB 3FO1A 3MA7A 1CF8L 2WUCL 3RFZC 3AC0A 1JHKH 1FH5H 3IDGA 4F7MB 1MHCA 2JJWA 5CIPA 3J7HA 5E6IA 1AHWB 3NTCL 1E6OL 3MRMB 2EC9T 1S8DA 3VFMA 5I66A 3C09B 4P49A 3LRHA 3HC0A 5F71A 1EFXD 3SCMB 3TPUA 1JUFB 3MBED 3BMWA 2WANA 1EV2E 3QIBB 5IWLA 3JTTA 3WO3B 3N06B 1VGEL 2P24A 5I8EA 2CIIB 5AZEH 5HDBE 1R24A 1D5XB 1FZJB 3HMXA 2I25N 1BQLH 3LKSA 3Q5YA 2ZCHL 1YYML 4Q9RL 3F7YA 3QUZB 3VRIA 3UPRA 4P2RB 4UOW1 4Y4FB 2BVOB 3GSWB 5FCSH 2H6PA 1A7RH 4Y16B 4PJ9B 3ULUD 3NACH 3U7YL 5E2UL 4FTVE 4ELMF 4K8RH 2OCFD 5GS3A 4JFYB 2R56L 2DQIH 4FQJH 1DQML 3U9UA 4RGOL 4J8RB 4LCWD 3U4BH 3O3AB 4QYOB 2YD7A 1WBXB 3DURA 3K2MC 3CVIL 4PJFF 4HGMA 2XKSA 3T2NL 4LGSB 3NCBB 3L3IB 3RGVB 2DMKA 2V5RA 3C6LB 2GSGA 2X1PA 3RHWK 1FZMB 4U6VL 4PLNC 3FTGA 4UOJA 2RFXA 2VQ1A 5I76A 2BNQA 5F6HJ 3VGEA 5E2WL 1BOGB 4UINL 3Q1SL 1DQDL 1A1MB 1GC1C 3DV6A 3T65A 2XWTA 3I50H 5E6ZA 3HI1B 2EEDA 4I4WA 1MEXH 4YBLC 1JBJA 1LP9E 4G8FA 3WFEH 4EI5C 3ZL4H 4NJAH 1KN2H 3P0GB 4N0YL 3BZEB 2BVYA 2XRAH 5CBEA 2YBRB 5I30H 4NWUL 3G08B 5LBSL 3WJJA 2NY5C 4AQ1B 3MRNA 3BUYB 3WN5B 2DWDA 5FYJL 4JANB 5I16A 3OXSB 3S5LB 3DMMB 2H2PD 5IV2A 3PV6B 1FO0H 3MRKB 3F58H 3VI3E 2GTWA 2M1KA 4G7YH 4LPUA 5ITBH 2WUBL 1T4KB 5IMMA 5MP6L 4M43L 3ULSB 4FQQB 3FQTB 4EZMA 3RIFK 2G75A 4LIQH 3GJFK 2OLDA 3V6FA 1Q0XL 1FYTD 3KPSD 3RL2B 4PJEF 3L3OB 3LQAC 4LLVA 2X4SB 4G9FB 4O2FA 4QGTA 1N26A 3K8LA 2B39A 3OB0K 5DGRA 3UJIH 3MC0A 2R69L 4ODVH 4WWKA 1JGEB 5SX5K 4OZFH 3FFCB 5HGHA 4ZSOB 1KCGC 5EU6B 2I5YH 3ARED 4UV4H 1HN1A 4UAOB 1T7XA 2QADD 5TDNB 3V6ZA 2DKMA 2P1YA 3I6LE 3EGSA 4IMKA 5KVEH 1JYXA 5D2LB 4DGVH 3FOLA 4KI5F 4G9DA 3IETA 3HFML 1GOGA 3KLDA 2GYSA 2XWJA 3C8KB 4KTEL 4Y4KD 1OY3B 1NEZG 4KJWD 1QR1B 5D6DA 2CDGB 3NMEA 4TUKL 1VESA 2AK4D 3CFJA 2E27H 4TSCH 5IBTL 1U92B 2CKBA 1YA5A 4FQ1L 4HS6A 1YPZB 4HIEA 4OZHF 1X5FA 1RMFL 3BP4B 1U6AL 2IBGA 3MCLL 5L8KB 1A64A 3ARDB 3LD8C 3WJLA 4NKIH 4U3HA 2VIRA 1VCAA 1U93B 4Y5XC 4YHKH 3SOBH 3ZYJA 2AEQL 3DRQA 1G7JA 4WTXA 3T77B 3RUGF 2VLRB 4NN6C 3QDMB 1AJ7H 1KSRA 3K46A 1CFTB 3IXTB 1QO3B 5IQ9A 2NW3A 3GJFA 1FCGA 4W68A 4QRRD 3VXMA 2FR4B 1I7ZA 3NABL 5DHVA 1I9RL 2YPLA 1IAOB 1DVFB 2AJXL 4N0FB 1P7KA 5E2TH 1C08B 2ADGA 1PQZB 4H25A 2PYFB 3BP7B 3WNOA 3BDYL 4NRXA 4V1DD 5D70L 5HHVL 4KPHH 1N7ML 2W0PA 3HE7C 3WLWD 3LIZL 1HQ4A 3JWOH 3BEWB 2N7BA 1W2KT 1B88A 1GPOH 5HHOA 4EDWH 3FQNB 1M71B 1F58H 3OGCB 2KDGA 2RCSL 4CNIA 3EYFA 4ZNCD 3WLBA 1KPUB 4UB0H 1MCEA 3MYJA 4ZFZB 1A7OL 4RDQF 3DGGB 1FZKA 3UDWA 4HWEH 4FQXA 3D69A 5CEXA 2R0WL 4IJ3B 3ARWA 4FQLL 1OSZB 2Y6SC 5IHUL 5EG6C 4P0DA 3VD9A 2Z8SA 1P4IL 2XWBA 5C9JB 3SDXE 3DI3B 5CD5C 5MHSE 1MFBL 4ZUSA 5CUSH 3T3PE 4JPIA 4ODWB 4OM1H 4TOYH 1UZ8A 4F37K 5GIRA 3JTSB 4XP4H 1T20B 4H1LA 4R8WH 4XRCA 3GI8H 1BF8A 3KYOB 2IANE 3E3QA 3CH1B 1UEYA 1PSKL 1CICA 3PP4L 1R5VA 2W9DL 2EYSB 4O4YH 4KDWA 4OZHB 4ZXBA 3GBLA 5F3BB 3GK8H 2R4SH 3PQYE 4GKSA 4YX2H 3BH9A 5GGRA 3WD5H 2Z4QB 4LLUB 1FGVL 2Q86A 4FXKB 5T1DH 1CDHA 4F7CA 1GGIH 3CCHB 32C2B 1EXUA 1F2XK 1ZANH 2NY3D 3I6GA 3NGBC 4ZQKA 3H3PL 4RGNC 2NX5B 1CFSB 1MCFA 1G0DA 5EBGA 2C7UA 4GAGH 3QDAA 1H3VA 1FCCA 2BSRB 1AHWA 5A3ID 1JGVL 3MLZL 3MRMA 1J0ZA 1EGJL 3GMPB 3L6FB 1MCWM 1ODAA 1JF1B 3SCMA 1JUFA 1S7XA 1U95A 3QIBA 1JMXA 4HUVA 3NIGF 1PY4A 2CIIA 1LK3H 1TJHL 3C08H 4EDXB 5IVXB 1D5XA 3PXJA 1FZJA 1WVZA 2VZ1A 4ORGA 1H3PH 3KJ4C 2A1WL 4MDJB 4NFDA 3ARSA 3G04A 2VB5A 1KT2A 4P2RA 3GSWA 3QH3B 3TPUE 2EE2A 4Y16A 5DRZB 4PJ9A 4PLOB 3GDBA 1UKTA 4JO1L 5EN2B 3BX7C 5DJ8B 4LRNH 4GAJL 2WLZA 2CDEB 3AY4C 4JFYA 1UM4H 5J3HD 2YRLA 1Z9LA 5EU4B 4PJIB 2F53D 1FNLA 4FXGA 4J8RA 5KG9B 1A2YB 1CLYL 1Q38A 3TCLB 1E4KC 5FCUH 1JHTB 5C0ND 1WBXA 4ENED 5CEZD 3CLEL 3UTOA 5L8LB 5D5MF 5D7SL 3C6LA 5B39B 3CVHA 2DYPA 4KUZH 1MREL 2MQCA 2BJMH 2VWEE 1TVDA 2J6EL 2V9RA 5I1CL 1KCVL 3GSNH 1K6QH 2NR6D 3O3DA 4NQDB 5D7JD 1BOGA 1EO5A 3QUYC 2Q8AH 4C59B 4PGBB 3D85B 4HHAB 1A1MA 1HKFA 2PYEB 2XTLA 2F74A 5FGCE 2LFGA 3IS1X 3BZEA 4OJFL 4JHBA 2ZUWA 3G08A 4KVNH 3TA3C 4PS4H 1BZ7B 2BNQE 4JFZL 1MQKH 3WN5A 5JW5B 2XYCA 4F9PC 5HDQL 1IM3B 1T1ZA 4XMKH 3OAZH 1TZGH 2UYLA 3OXSA 3QEHB 1Q1JH 4NQVB 3TN0B 4X6DF 1KTDB 3S5LA 4HAFA 1AGBA 1IZJA 1D5ZB 4K55A 5GHWH 1AGEA 4P2YA 3PV6A 2FX8H 4NN5C 1L9NA 2HRLA 4JCMA 4EXKA 4Z9KB 3L5JA 1T22B 3PGFL 3O2DL 3MV8E 3VFGL 1T4KA 3L3HA 3O4LB 4FQQA 3ULSA 5DSCB 3VE0A 1XR9B 1NAML 3VFPB 1UCTA 3QNXB 3RL2A 3LEYH 3L3OA 3ARZA 4G9FA 3WFCL 1AE6H 4MGXA 2FATL 1HIML 3WNKA 4OLZL 2VDRH 4G6FB 1RHHB 1JGEA 1P4BL 4XVSH 4MJIB 3OR7B 2XXMB 5GJSL 2YSSB 3GMOA 2A77H 1QD0A 4XMPL 2ITCA 3U48A 3RWIB 2PW1B 3QI9C 5DJAB 2OZ4H 4AEHH 5D2LA 1P1ZA 1UXSB 1NLBL 4JO3L 3BZFB 1XMWA 3OHXB 3QUXD 3OZ9H 3MUGB 3C8KA 3D25A 1FNSL 4GRWF 1J0KA 3V4VL 2CDGA 1CGXA 2P47B 3QPXH 3RVVC 3DYOA 4RSVA 2DAVA 4R97B 5TQ2L 3VWKD 2V5SA 5CJXA 3MOQA 5I1KH 4PRPB 3W11C 4YDLB 1QRKA 3ARDA 4B0MM 1WZKA 2YD4A 1RK0B 2VXUH 1OAQH 3TESA 5IBUB 1CXLA 5E8DH 2EDYA 3H6JA 1U93A 4S2SB 1IM9D 4NQTA 3UTSA 2QLVB 4MNQA 2CRIA 5I1JH 5E8NB 3ZDZF 1XF3A 1DBML 3T77A 4DKEL 1DANT 3QDMA 3QCVH 2OL3L 2BMKB 5DK0B 5J12C 3IXTA 1QO3A 4U1GB 1OARL 2Q6WB 2FR4A 5E8OA 1ZVYA 1JPFB 4J1UA 2K1MA 3TO4D 4Y1AB 1IAOA 3RQ3A 2HJFB 3PABB 4Q6IC 4N0FA 1R3JB 3C8DA 3D2UB 1C08A 1CGSL 1PQZA 4ERSH 2DQDH 2XN9A 5FYKH 3BP7A 5HYJB 2YMXL 3VCLA 4R4ND 2VYRE 3VXME 3Q6FB 1GCFA 4DQOH 3BEWA 3U9PL 1T89A 2WWKT 1H15B 1HNFA 2YPLE 4M9OA 4POUB 5GGQH 5K33A 2X4RB 4UIKL 5GGSY 3I9GH 4RZCA 5CILL 3FQNA 4LNRB 5DK2B 3QRGH 4EI6B 4GBXC 2AJUH 3ALWA 3QQ9C 4EUPB 5BXFB 1N5YL 5DJDB 1CF8H 2WUCH 4JR9L 2BY2A 3ARGB 3UMTA 1KPUA 3ELAT 1NCWL 1Q9WB 1U8IB 4ZFZA 3NTCH 5F44A 1E6OH 3KPPB 5BW7A 1HWGB 5HHOE 4NQCB 1I7TA 3QO1A 1MWAB 3PJSB 1KOAA 4NN7B 1AGFB 1BFVL 2DMCA 5C9JA 4HBCL 5KSAC 5ECJE 4PB9L 3KVQA 3KAAA 5FIEA 1VGEH 4IIQC 5FGSA 1KN4L 4R7DB 4ZNEA 3AXLB 4LVEA 3KYOA 2J7LA 4MVBA 5I17A 2ZCHH 1SMOA 1YYMH 3T8XA 2EIEA 4Q9RH 2VDML 2EYSA 5I73C 5L88L 1G6RL 1J11A 4L8DB 4OZHA 3DYPA 3U7YH 3NPSB 5E2UH 4EN3B 5EO1A 3BKML 4LCIL 3ILQC 3RZCC 2Z4QA 5ID1B 2R56H 2EIZB 2HLFD 2DQEL 4XPGL 1DQMH 3E3QE 3LZFL 2NY6B 4RGOH 4DUXA 32C2A 2VDOL 4XNYL 2W0FB 2VLKD 1KIPA 3W39A 2NX5A 3DUSA 3RUGA 4LLMB 3CVIH 3T2NH 4KY1L 4NBZB 4Z0XB 1K5NB 4U6VH 1JNJA 2Y5EA 3I6LD 3L6FA 5DEZA 2CUMA 5E2WH 1HOCB 1JF1A 4UINH 1I75A 3Q1SH 4I18B 1DQDH 4YDVA 3FQXB 4ZPTB 4O58L 4QRTB 2KPNA 3MZTA 4N0YH 4H5SB 2A83A 4NWUH 2GHWB 3ZKQD 1J8HD 5EU7E 4MDJA 5LBSH 4NGHL 4XC3L 2B20A 5FYJH 3QH3A 2AABL 4LKXB 3DHJA 3TJHC 5DRZA 4BH7B 1FQ9C 5C0BA 1UVQB 5EN2A 2G5RA 4HMEA 4MX7B 1HHKA 3BYTA 2LAAA 2R2HB 2CDEA 3LDBB 1TNMA 3TH4T 4OZFG 2IPKB 1J1XL 1A6TB 2WUBH 4PJIA 2X9XA 5MP6H 4M43H 1AD0A 1ED3A 1B4JL 4P2RE 5EBMB 3IDIB 1JHTA 4B41A 4NO0B 1ITCA 1Q0XH 2L4OA 5KAQF 4GQPH 3CZJA 2R69H 4JFPB 4XCEA 2FB4L 5GRJL 4NQDA 2BY1A 2FH6A 4PGBA 3D85A 3MRPB 2FDBP 1JGDB 2BHUA 2J8UB 5ETUB 3UO1L 3OKOA 2PYEA 4P2OB 5SWSB 4L8SC 4UT7L 3TJEL 3HFMH 4KTEH 2JTDA 3RNKB 2VUOA 2V17L 2NY2B 2PW2B 1RJCA 5CKGA 3WXVL 1UC6A 5ISZB 1BZ7A 4TUKH 2BHZA 4K3DL 5IBTH 5JW5A 5IVNA 2BNUB 1R5WA 4JVUA 4FQ1H 2MPAL 3SQBA 3QEHA 2XFXB 4NQVA 3TN0A 4N8VA 1KTDA 2RHEA 1RMFH 1D5ZA 1NMAL 5JOFB 5ICZB 1U6AH 4LKCB 1U3YA 4MQ7A 4F7TB 5BV7B 2X70B 3MCLH 5DC4B 3LS4L 3IT8D 1GAFL 4HIHB 3QDHA 4YBQD 2AEQH 4D8PA 5D7IB 3O4LA 3KPLB 2APWA 5DSCA 5CEZL 4KZDL 3VFPA 1RZ8B 3QNXA 5MHSD 4MNGB 3RDTB 2PXYC 1ZHKB 2WBJB 3BE1L 1HXYB 3VFUA 1RHHA 1G7HB 1F02I 3NN8B 4MJIA 3OR7A 1TITA 2YSSA 3NABH 1I9RH 1JWUA 1V7ML 3QWQB 5CGYC 3RWIA 4K07A 2PW1A 4JO2L 4ZYKB 2AJXH 3PQYD 1QBML 4NOBA 1UXSA 2W60B 4X4MA 3DVGA 3BN9D 1NGZB 3D6GA 4G9FE 4HW6A 3OHXA 5D1ZD 3TVMD 3MUGA 2A6JB 3BDYH 1KC5L 5D70H 5HHVH 1N7MH 3QEQB 2XZQL 4LFHG 3LIZH 4QF1B 1KIRA 1YEKL 4XBPB 3RWGB 1U2CA 4L1DA 3VXSA 2ICES 4JM2D 4FRWA 1JPGB 3MRFB 4X99B 5DQ9A 4PRPA 5D2LE 1SYSA 5CHNB 1C5BL 2Z93B 2RCSH 1RK0A 1F5WA 2OMNA 3T0VA 3FO2B 1EVTC 2IH3B 4FG6C 4S2SA 1DBAL 2R2BB 3ME0A 4P9HC 5ACLA 2D0GA 3P9LB 3DPBA 1A7OH 4I5BA 4XTRD 5I9QB 3VG9B 2R0WH 1BD2A 3KYAA 4FQLH 2R4RL 2QSTA 2IQ9L 4J4PA 4ETYA 4KK8D 5IHUH 2NXZD 2BNRD 5DK0A