3TBTA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
275
structure length
263
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSEVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 64
structure length 263
sequence length 275
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbtA01
3HMXL 3SDCA 1R5IA 3FQRB 1INEH 1YQVH 3FO0L 4TUKH 2I9TB 1UA6H 5ACZA 4DKEH 1HQRB 2Q7YB 1UXSB 2HFEB 3P77A 4N0RA 2UWEA 1CDUA 2L7JA 3DRQB 5FYLE 4AENA 4ZOAA 5H37G 4OF0A 5C9JA 1Q9OB 3EUUA 4L8SB 2QHLA 2IBZY 3ZE0F 1FZJB 4PJIE 3C8DA 2NNAA 3GSOA 4DEPC 2YRPA 4F7TA 2H3NB 2F54E 5F3BB 3REWB 2EKSB 2I60H 3BKCL 4HH9B 4KJYA 3RWEB 2OXHA 5FYKE 4UOW1 5CEXA 1UACL 2KPNA 2R0LH 3H9ZA 4LKXB 2Z91A 3MGTB 1Z0NA 3VXOA 3GKWH 4OTXL 4LARH 1FL6A 1FYTE 4K23H 3RWJB 3P11L 4YHPA 1AQKH 5KANG 3QUXA 3KJ4B 3TJHC 5C3LD 2OSLB 2W9DH 3HNTL 4NO3A 5EB9A 4KK9C 1JGVH 1Q72H 4JZOA 4L4VB 1WBZB 3MOAH 1JGUH 4K2UH 3RGVA 1FVCB 4K94L 3LEVL 1EEYA 3ARDA 3EW3B 4QRSB 4Z7VB 4KV5F 4QRRA 4TVPH 4NHCH 4QHNB 2R15A 3F6LA 2YR3A 5CZXC 4PREB 1FIGL 2BHYA 2F15A 4OAWA 3SDAD 4G59A 2G5RA 3OR7A 2ZPKL 4ODHH 2HT4C 3ARFB 4K8RD 3RKPA 4RNRB 4NQUA 2HH0H 4YGAB 3NZHL 3KR3H 2BRQA 1ZA6B 2EDWA 2H9GB 3S8WA 4WU7B 5IBTH 1PQZB 1KN4L 1WC7B 4FXKB 1GAFH 1HXYA 3U9UA 3W39A 1OWRM 2WM0A 4FFVD 3FT2B 2XT1B 4F33A 3DVGB 3LEXA 3PWPB 2NY7H 3PABB 4JFOA 2MNUA 4CNIB 1KJMA 3NCCB 4CMMB 1TQBB 3RVXC 5GRVL 1EAPA 4D0DB 4F7MA 4NQDB 1VB9A 4DKAA 2XA3A 3HZYB 1FH5L 1OP5K 5ESVA 1MOEA 5IVNA 1ETZB 3CFEA 4NQCA 4NNYA 4K94C 3TBWA 4DQOL 3SY0A 2P5EE 4E42A 4GRLA 4U1LB 1SJVA 1YPZA 4WY7H 5TDPA 4TNVF 1B4RA 5LQBH 4XNUH 3HAEG 4G6JH 4WHYH 1QFWI 1MLCB 5DRWB 4LF3B 4TSCH 1K4DA 1HOCA 2VE6A 3EZJB 5I1AA 2HVKA 5E8EB 1E28B 1MVUB 1Y18B 5JW5B 4DGVL 3ARBA 4JE4B 4XPBH 2GUOB 2GT9B 1QLEL 2WY3A 2WBJA 2R9HC 2B1AL 1UM6L 4XH2A 3HG1B 4R0LA 3WFZA 5T3ZH 4XVSL 4QF1B 3MUGB 4LCWA 4WHTB 5EOCH 3U0TB 2WP3T 2R4SL 3LRSA 1T2QH 5AZ2H 4PP1C 4X6EA 43CAB 5FHAL 3SKOB 3RKDC 2BMKB 4MAYC 4XBGB 4LHUD 3KLAA 5IMLB 4HWBH 1SVZA 4XP9H 5MI0B 4WFGD 4X99B 5F7FA 5GGTL 5BVPL 2M2DA 3FFCE 1G7QA 2VITA 3FAWA 1NMAH 3MV7A 5GJTL 3QULA 2D2OA 1I85A 2G9HB 4D9QD 4PJCE 4XP4L 1Z2KA 1YEJL 1AGDB 4Q2ZB 3V6FA 2V5MA 4OCLC 4X9GA 1LK3H 1RAMA 4KROC 1QYGH 5F1NB 1KLUA 1ZANH 5E8NA 3VMOA 1DVFB 1UB6A 1GGTA 1OGAD 4HS3A 2BVTA 4HUVA 3QQ3B 4PLOB 1I3VA 1L0QA 4NSKB 4TPRL 5FYJL 4XCCH 1Z3GH 4HGWA 4HZAA 5JHLL 4NKDB 3O6KH 1MJ8H 1T1ZA 5I19L 1QKZL 5GRZA 1DANT 3D85D 1YECH 4X0KA 4N0CA 3QDMB 1RIVL 4PR5A 5KSBA 3BT2H 3C60A 3QDJA 4LLWB 3BAEL 4PS4H 5L88H 4K9EH 5ID1A 4CVXA 1VFOA 3VMPA 2Y4SA 3VXSE 5IESH 4Y1AE 4HXBH 3HZMA 3HE6D 1JGEB 4DCQA 3T2OA 2J5LB 3VRJA 1YMMD 5B8CB 5BV7B 1E4WL 5BJTB 1EBAA 4OZGB 5MEQA 3V8OA 2FWOB 1KB9J 4J6RH 1NCCL 3W9DA 1VKXB 1H15B 2J4WH 5HHOB 1EJ6A 3RDTB 1J1OH 2UUDK 5D7LA 1I1CA 4HT1H 3U30B 3WHE1 1V5JA 2OM5A 1TETL 3QHZH 3OHXB 1WITA 3O8XD 3PV6A 3CCHA 5C08B 1PKOA 2OTWB 3QUYC 5K9KB 2ITDA 2IALB 4MD0B 2VL4A 4U6YA 4OF5A 4DZ8A 4TULL 4PJ5A 4PP1D 5FKPA 1MFAL 5D9SB 3WUWG 4MSWB 1N6VA 1YEKH 3L5JA 4HS6A 4IS6B 5F7DA 3RKDD 1AXIB 3T04D 4EI5B 4FNLH 5DEFB 5CEZD 4FQXB 3B8YA 3CIQA 4LSDA 4X4YB 4P46B 3T2NH 3C2AH 4L3EA 5CJOH 1JJUA 1T20B 3R0NA 4HIHA 5CKGA 3DX7A 3W11D 3OAZK 3BD3A 5E08L 1F4AA 1FNAA 1HEZA 4UDUA 3WIFA 3EOYG 1JWSB 1T04A 4JB9H 3RWCA 1L7TH 1C12A 3NACH 3HNVH 4JREB 2NY6C 4RGOH 4KROD 2JJSC 3QXWA 1S3KL 5DT1L 2IPTL 3MMEA 4Q6YA 1Z6JT 3L5XH 2WUCH 4NM4L 1J11A 5FCUL 4G8GD 4IBLT 2F53B 5J11B 4GXUM 4YPJA 3LZFL 1HKLH 2YD8A 5EN2A 1FL5A 1I9IL 3GO1L 4KVCL 3DMMD 3UZVB 3MRJB 5KSVB 1BPVA 2DQFB 3CXHK 3VFMB 4PPTA 3PQYD 2CK0H 4Z7VF 4AMKH 1MJUH 4QGTA 5KVFL 4Z7UE 5FA3A 1CXHA 4O4YL 4R4BA 1FFNA 3SE4C 5JHDB 3LQAC 3OMZA 3QSKB 4G8FA 1HQ4A 4XMPL 3L7EB 4YHLH 3TPUE 4FQ2H 4JJ5B 3GI9L 3MOBH 3K8MA 4X6DA 3B2UD 2DWDB 1KCVH 4Y19B 1DQML 1PZ5B 2VDQH 3V0VA 5JLZA 2O61B 1U8PA 3IFOB 3N1MC 3KLDA 3PL6B 4KRPC 3S7GA 1BQLL 2BVPA 4MJIB 3UZEA 5CP7B 3K7UA 3WFEL 5IW6A 5I1HL 1NBZA 2APTA 4M93C 3QUYD 5DI8A 1IAOA 5DDHB 1MCPL 1RK1A 1FSKC 6FABH 3O6LH 1M1SA 3QEGL 1MIEL 3DYOA 3GMMB 1I7ZA 4WI2A 1MCNA 2BVEA 1T0NB 2FX8L 1U93A 3BPNC 4P2OB 3O0RL 2FJFA 3HZKA 4PBXA 2DI8A 1YMHA 5EBLA 4XCFL 3OB8A 5DJ8A 1KEMH 3FO9A 3WFBH 3QRFM 3T3ME 3RTQC 3LD8B 3TCLA 3IT8D 4QY8B 3RVTD 5DUPH 4LKCA 1ERNA 2EIDA 4G9FA 1J0YA 4OLVL 4WW1A 4KI5F 4C56E 4RMTA 2BK8A 1E4KC 4C57C 4R3SB 3T0EA 5KSAB 3QG6A 2OL3L 5F97E 2LFGA 1XIWA 4XAKD 1I7RA 4AG4L 3QI9C 5BZWA 4KHTH 3MFFB 2FX7L 1B0GB 5CUSH 4KJPC 4HK0B 4XAWL 4CGTA 1T2XA 4H5SA 4PV8B 3WEXA 1WAAA 3NCYP 1VEMA 2Y07H 5GPRA 5DMIL 4FQCH 1YEHL 3H9SD 5SX5H 5J13C 3I6LD 3LRHA 1U8JB 3GB7B 5J6HB 4YO0B 2AEWA 1RQ5A 4YNYA 1LO4L 3LPGA 1BFTA 1H5BA 5HGBA 5TF1L 3B9KD 3WLWD 4D9RD 2GJ6E 5CJ5A 2ZKHH 2B4CH 4X5LA 3MV8E 1Q9KB 3SGDI 1A0QH 3G5XA 4NO2A 1M7IA 2FZ3B 4NFCA 1U41A 1ZHKA 3D1MC 4FN0A 2AQ2A 4H26B 2R1WA 3TF7C 2R69H 4KXZI 5DD0H 4FQIL 5BMFH 1J8HD 5DQ9A 4M61B 2BNRE 1Z9MA 4XMKH 3SQBA 4LRIC 1KPVA 2R2HA 3WKML 2Y5TB 1OD9A 3SO3B 1FO0L 2CGRL 4S1QH 5JNYA 4JQXC 3GSWB 3H42L 4Z5RB 3LKOA 1RIUH 3FQNA 4EDXA 4ZFFB 4PJ7A 5I8KH 3BUYB 5I8EA 4RFOH 5DYOA 3KLSA 4YH6A 4HWBA 4PJ8C 3S5LB 5C0CB 3U0WH 3O2VL 3MROB 4YHYC 5D5ME 1VA9A 1QHPA 1TCMA 4M6OL 4BZ1H 1KC5L 2NW2B 3K2UH 3SDXE 4F8QA 3L3KB 1MFNA 1T6WA 5I9QC 2WLYA 3FKUS 3D9AL 5TE4L 4U1HB 5I8CA 1RUMH 4OKVB 4NCC2 1CXEA 3AREA 1G0XA 4UNUA 3BPCA 1NKOA 3BZDA 1ZHNA 3CK0L 5T1DL 5FO9B 2Q8AH 4OZGF 1I8IA 3R0MA 3QUMH 5SWSA 4NKMA 1CF8H 3ULUD 4RX4A 5FM4A 4YDLC 2HRPH 3VGAB 1LMKA 1OTUD 1G7LB 4ZDHA 3G08B 4LQFL 4O58L 4FQJH 5I6XC 2X4RB 1JBJA 1YEGL 4LDLB 4OUUA 1H3GA 2FIRT 1OCWH 1TENA 4NZUH 1G6RB 3AAZB 1GPOH 1HZHL 4JO1L 1VDGA 1Q0XH 4CDGC 3ILPB 4U6HB 5IP4A 2AJUL 3HNSL 5IM7A 3D0LB 1U8KA 5CMAB 4WGVB 1KFAH 3AROA 1GGBL 4GG8B 4H1LH 2E9IA 1BVLB 4P5TD 2Z31C 3PGDB 2N1KA 1OAXH 4Q9QL 3QISA 4GG6E 5MERA 5D1QB 3G5ZA 4YDIL 4Z7WA 5DC9B 4QOKE 1DQJB 3E6HB 4Y5XA 3MREB 4JFXA 5J56B 5F7HA 2EXYD 3CXDH 4Z7OE 4N5EA 1A6AB 1NCDL 4P59L 3BP5A 3GIZH 4X6BB 1JHTA 1T1YA 2XN9D 5DQJA 2Z35A 1A4JA 3U2SB 2NW3B 3IDNB 3ALWA 4Q74A 4Z76A 3JV6B 2YUXA 3UMTA 3FB8B 1XCTA 2VDRH 3CLEL 4NO0A 4JKMA 3WO3B 5GGQH 5EZOH 4POZC 5ALBL 3MRGB 4JO3H 3H0TB 4YQXL 2RAMA 5JORB 2JK5A 1I7TB 4XVTL 1S9WB 5IB2A 3IJHB 1OTTC 2GAZA 4MNGE 1FE8H 3JTCA 4YHZH 1MELA 1HSBB 5DJAB 3MZTA 3QWQB 1YEDA 3FB7B 4NBYB 3U9PH 1IE5A 1VFAB 5E7BA 1BD2B 3ZSTA 5JA8B 4JFEA 3UTZA 2HFFA 1QSFD 1NGPH 3NGBB 3UTSE 3BIBX 3P0GB 3JWNC 5HPMA 1A8JH 4FQHA 3MV9A 4P9MH 5GZNC 5DRNA 1EXUB 4UINH 1P7HL 3V2AR 5GGUA 3NBNA 5IK3A 4MMZC 3E1F1 2IANB 2QSCH 1C1EH 2PYED 5I1IL 1BLNA 2LAAA 2XWJB 5C0FB 3VWKC 4C4KT 2VISA 2Z31D 5JMRA 1AJ7H 3VI4F 4I18A 4HKZB 4CN4A 4LCIL 1PLGH 2YSSB 1BZ7B 1TVHB 4TUOB 4ELMB 2BFVL 1S7RB 4G3YL 4PRPD 3EO9H 2PCPA 3DIFB 4L9LC 3MLVH 3GSRA 4O2FA 5D6DC 5H2BA 3GSVB 4NRZA 2AJYL 5IHUH 3VXMB 4OV5B 1HH9B 1R24A 1FORH 4EN3C 5C07B 4OCRH 4UT6L 3QEHA 2BSSB 7FABL 4KQ3L 4MYWB 1RUKL 2VXVL 3WDHA 2VSDA 1CIUA 3LPWA 3UO1L 5E70A 1ZAGA 2DQDH 3QO0B 3MRFA 12E8H 4M7KL 1AKJA 1GOHA 4OLXH 4XC3H 5I76B 2FYYB 4CUCA 2IQAB 1HK6A 1YEFL 4F9PC 3O3BB 4CAGA 4IOIA 1F4HA 2X9WA 2ESVB 5L2JA 2M26A 4HBCH 5HHMA 1IKFL 3JV4A 5F1OB 2UYLB 2DM7A 2EYSA 3MLWH 4I2XA 4W81A 3RY5A 5IIEA 3RL1A 5IT2L 2G5BA 3GSQA 1ORSB 5LGKA 1UENA 1TTUA 1IAMA 5KZCB 2BVUA 1LP9B 1RUQL 4X5WB 3D39B 5I30H 3VFSA 3MRNA 4DZBA 2QJDA 3WIHL 3EOAA 4FFZL 1NAKH 4XCNB 3NFPA 3KHQA 1UJ3A 4GAJH 4LP4A 4NN7C 1EFQA 1IM9B 5GGSB 4D94A 3DV6B 5GRYA 2DLFL 4WTZG 4Y4HA 4NZRH 1HSAB 2OR9L 1KBGL 3VH8G 1A3QA 1CE1H 3IF1A 3QFJD 4ZUVB 3QEQA 1MQKL 3CSYB 4LLMB 1ZT1A 1QFUL 2IG2L 5IEHB 3BWAA 3TN0C 1YDPA 2ZJSL 5A2IH 4AL8L 2X4UA 1CFVH 1AI1L 4KMTL 3KVQA 5E24E 4JZNA 1AR2A 1P84K 4LHUG 4S1RL 4RMUA 3GJFK 1NC4A 1R3IH 5HVWA 5E1AA 5HYIA 3I3DA 4PD4K 4PJEB 4X8JB 2W9EH 3DUSB 4OFYA 4UV4H 1ZGLP 4GFTB 3MRHB 3HUJA 2SEBB 1R5WB 2JIXB 2AXFB 5FOBB 1U8LB 5FDYA 3RP1A 4G6AD 4M5ZL 4UOJA 2YD3A 1MH5A 4PJFF 5ID0B 5D72L 1JF1A 4B50A 3PWNB 3GJFB 2NY2D 4M9OA 1RZFH 1CR9H 3LN5B 2VH5L 2W0FB 1ZE3C 3VXNA 5EBWB 4NGHH 4U31A 3ZT5A 3SDAA 4YXLL 2J2ZA 4Y4FB 1ZLWK 4ISVA 2AABL 2BC4B 4E0RB 5SX4H 1FN4B 3OKYA 3QFDA 4FP8H 3IDYB 4KJWD 1UEYA 3VXPA 2EDLA 3IDJA 4MX7A 1CDIA 5GZOC 4R96B 2X4TB 1IGJB 5E4IA 2XTJB 4NCDA 3VGGA 4RWYH 3VXUD 4E41A 3TA3C 1CE6A 4Z7NF 5F1SA 2XA8L 3QUMA 3MRPB 3OKNA 3J8F7 3LN4B 4LNRA 1A7NL 2NPLX 4FMFA 2E6QA 1JTOA 3MBEA 1EIBA 3WL9B 4F9LC 3T0WA 1MWAB 5I1JH 1Q94A 3MPCA 1D5MB 4G7VH 5FHBL 2W0LA 1I1AA 5A3ID 2VDLH 2KDGA 2OJZH 2I26N 5F3HA 2V6HA 5MP6L 5IMOA 1WFNA 1GIGH 5CINH 3LMJL 4PRDA 3S3JA 1KUMA 3FQXA 4YHIB 5IMMA 2ZUQC 2AKRA 4LBEB 2QQLL 4ZXBB 3QZWG 3FT4B 3WNPA 4MVBA 3S96B 1YYLL 4X7CC 5CSBA 1IMHC 4LAQH 3BSZL 3BYTA 3QIBB 2FO4A 5DGQA 2AEQH 3TWCH 1XF2A 1CT8A 2CJUL 5I73B 3SDCB 4NN6C 1R5IB 5E9DE 4LVNC 1AC6A 3Q2CA 3ZE2E 5ACZB 4QTIH 3P77B 1G1YA 1YYMH 1FAIL 2UWEB 2ADGB 5DJCA 3PXHA 4AENB 3WV0A 1HHKA 5C9JB 4S1DD 4YWGL 4XC1L 5HGGS 4Q9RH 3O4LD 3MRMA 2A6DA 4U0RB 4K7PY 4NIKB 3RL2A 4NWTH 2IFGA 3G5VA 3GSOB 5F96H 2HJKA 2ORBH 3QDAA 4L4JA 4L5FL 4GRMA 5DVNA 3UC0L 4KJYB 3SDDA 1L0XA 4QXUL 1KENL 3BO8A 2Q20A 5CEXB 4JFDE 1AD0A 2Z91B 2CIKA 3VXOB 3LOWA 1H3UA 1FL6B 1JFQL 4WO4C 2K7PA 2UV3A 4YPGA 4YHPB 1LWRA 4JKKA 3QUXB 5GZOD 2VQUA 2NXYB 4NO3B 1T3FA 3U1SL 5ISZD 4G6ML 4JZOB 1TJIL 4OGXL 3TA3D 3RGVB 3CXHJ 1EEYB 1MSPA 3ARDB 5C09D 4M9PA 4QRRB 5B3JF 3IVKA 2O5XH 4H88L 1CGSL 3EJYC 1QRND 3KS0H 2Q6WA 4UDTA 3OR7B 3ULUH 4ELMF 4DK3A 2O5ZH 3BE1H 4AQ1B 1ZA3A 3GHBL 3D18A 3EDFA 3S36H 3GMRB 4NHUE 1IEAA 2R2BA 4MJ4A 4WI9A 4ZAKA 3WXVH 4K7PH 3LKSA 3EYUL 3NAAL 5F7MC 4L4TA 3TYGL 1HXYB 2DQIH 1MAKA 3U9UB 3W39B 5E2WL 3NN8A 4OZHE 3ZTJG 3LKNA 1FZKA 3C9NB 3Q1SH 1F8TH 3D3VE 4F33B 1YMME 3QDGD 1OAKH 4JFOB 5ANMB 1KJMB 4QRPE 2C1PA 4RMSA 4S0SD 4HF5L 1HIMH 1EAPB 3FRUA 5JW3H 4F7MB 1A6WL 1PBYA 1T1WA 4WDIA 3UBXG 1LE5A 1CK0L 1FNEA 2A6KA 1WBXA 3KJ6L 3IDXH 5ESVB 4WNQA 3CFEB 1MRCH 4NNYB 4NQCB 3TBWB 1HXMA 3K4DA 1IJ9A 3SY0B 3TO4D 4E42B 2FD6L 3ZTNL 1YPZB 2VDOH 4G5ZH 4OD1H 5TDPB 1J0KA 1MNUL 1SEQH 1K3IA 4RMQA 4M62H 2Q3ZA 3HE7D 1K4DB 1K4CA 3P4LA 2VE6B 4MGXA 1LP9F 3G6JA 1NC2D 1T80A 2I5YL 5CEZE 2C3XA 3ETBF 4HLJA 1ZT7B 4FG6C 3ARBB 1J1XH 4ZTPH 5FECA 3ZDXF 2WBJB 4LAJH 2E5EA 4JPWL 4XH2B 4U1KA 3QQNA 4R0LB 3V8CA 2VMFA 3S88H 1EJOH 1CFBA 3LRGA 5GHWL 1XGUA 1QSED 2C4XA 4LCWB 2B8OT 1N3NA 2HJFA 3PWLA 3LRSB 4OB5L 4KKLD 3IAPA 1YEEH 3LV3A 3VXRD 4X6EB 3ZT6A 3SOBL 3CMGA 3NZ8A 3LQZA 3TZVA 1IGFL 1AFVH 3P73A 3KLAB 1XH3A 5EPMA 2DTSA 3IU3A 2DQHH 3BQUA 3KYAA 1G7QB 1GGCL 2VITB 4FTVD 3MV7B 3QULB 2YC1A 1YNTA 2OYPA 3DBXB 4N9OB 1RIHH 1T89C 1A1MA 4XI5D 4KZEL 5FUOH 3V6FB 4ERSH 5IHBA 1NGWA 2EH7H 3VA2C 3PQYE 4BH7A 1KLUB 5E8NB 1UB6B 2IGFH 2KQMA 3D69A 5EIQA 4O9HH 4HS3B 2RFXA 2WUBL 4HUVB 4ODSH 3RPIA 3CX5J 1ZLUK 5FDWA 3GI8H 4G6FB 2CUMA 4X7DC 3C6LA 4HGWB 1X6NA 5HYJD 5KW9H 1T1ZB 4OCXL 1NGXA 3HMWL 1KELL 4X0KB 4PR5B 5KSBB 3C60B 1KN2H 2EC9U 1CXLA 2ERJB 3KPSE 4CVXB 3MXWL 4AZ8A 5ID1B 1FFOA 2NY5L 3P30L 4A6YA 1K2DA 4YZFF 5FYJE 3HZMB 5L2KD 1AHWC 1B0WA 2IPUG 4DCQB 3ZDYE 3VRJB 4ETQA 4C58B 4JRXE 2OMBA 2YXMA 4KDWA 4PJIA 5MEQB 3F7QA 4H20L 1HILA 3W9DB 2FDBP 4OLWL 2F54A 2ZG2A 4YC2B 4I4WA 5DK2A 1MCEA 1V3LA 4U2ZA 5D7LB 5IKCA 4HKJA 1IL1A 1N5AA 1G9NL 2J8UE 5H94A 3NCMA 1QR1A 1FGVL 3UROR 4J3UA 1FC2D 1Q1JL 5KS9E 3PV6B 1FLRH 3DI3B 2V17L 4M8VA 5CD5D 3CCHB 1U8QA 3SGEH 3OGOE 2ITDB 3BVNA 4U6YB 5HI3D 4DZ8B 4PJ5B 2E7LC 5FKPB 4OFKA 1PEZA 1U8NA 1C16A 4HS6B 3JBG7 4QNPE 4KTDL 1DL7H 1CLOH 3LHPH 4MNQD 3PJSB 1OP3H 3RU8H 3ZSSA 5M94B 1TQCB 2UWEF 4L3EB 5L0QB 2EDOA 2WIIA 2I25N 3DX7B 4XXCA 5CCKL 2NY5C 4P2YA 1HEZB 4C59B 4P2RE 1V8HA 1N0XH 4UDUB 1Y6NR 2M1KA 4HIXL 2CXGA 3WIFB 1U9KA 1T04B 1XGYH 3RWCB 2OK0L 1C12B 4Y0GA 2VXQH 5DXWA 4HJGA 1DZBA 5F7LB 1K9TA 2OTUA 3QB7C 2DLTA 4H0IA 3MMEB 3U6RA 4OQTH 3IDIA 2IFFH 5KOMC 3T08A 1HI6A 4KRNA 1NFKA 4M6NH 1V7NL 1MF2H 3UYRH 5JUEH 5CIPH 1IGCL 3RI5F 1HHJA 2ZUSA 5C0EA 4FQ1L 3OPZH 4KI5C 2QQNH 5EN2B 4Q7DA 3EYSH 1FL5B 1QO3A 5I16A 3EOTH 2P7TA 4BZ2L 1J8HA 3ARWA 1M71A 1CLZH 3BD5A 4Y88A 1KTLA 2DJ4A 4UTBH 2ZCKH 5ALCH 5JOPE 3TLRA 2P5EA 3L5WA 5FA3B 4R4BB 4F7PA 1FFNB 5IJVA 4L4VD 5ICXB 3DXAE 5FEBA 4G8FB 1ZHLA 4IJ3B 4WTXA 4OCMC 3C5ZA 4R4FL 4U1MA 1WTLA 3GNMH 1DBAH 2P45B 3G6AB 4X6DB 3AU1A 1Q9LA 3ARFD 3V0VB 5BV7L 4JKWA 5MI0C 1D6VH 2EXWC 3Q5YA 2BVPB 3V6OC 1W0WA 4Y16C 1R0AH 3JWOL 5IW6B 3P0YL 5BOPA 5DI8B 1IAOB 4XPHL 1RK1B 1W72H 4IRZH 3I9GL 2OLDA 5D71H 4JG0L 4J4PC 2BHZA 3TPKA 1I7ZB 4LQ1A 5C9KA 1DVFC 1U93B 5IW3A 3PWPD 3FFDA 2FJFB 3HC3H 3HZKB 3RHWK 1YMHB 5EBLB 3L6FA 3FO9B 4HWUA 4Y4KC 3R06B 3IU4L 4NQDD 1N4XH 3DGCR 3E2HC 2DQEL 4JGMA 1YPZF 3TVMC 3PWVA 4LKCB 2ZUUA 4HWZA 5CS7A 1QBMH 4G9FB 4DGYL 2DWEA 4G43A 4Z95H 4WW1B 1WGOA 3CVHH 3BX7C 2LVEA 3T0EB 2FEDD 4M00A 4OCSL 3QG6B 4S1SH 5F7NC 1F02I 1XIWB 1ZWIA 1I7RB 2GI7A 3CMOL 2DKSA 1GSMA 4WI3A 1N7ML 5BZWB 5BV7C 4EDWL 4KI5D 3K4ZA 4ZD3H 5GS3A 1FNSH 1WUNT 1NMCB 1GYAA 2BRRH 1A3LL 4H5SB 3WEXB 4Z7QF 1N5YH 4YXKL 1VFBA 2YA0A 2K3TA 3KAAA 3HG1D 1LO5A 1PGRB 5I1CH 2DQJH 3E3QC 3VWJA 4DN3H 2XRAL 4YNYB 1OAUL 4YBLC 3DX9A 3FZUC 1H5BB 5HGBB 2YMXH 4UMGA 3WNMA 1IC4L 3G5XB 4NO2B 5TFSL 4HJJH 4EI5C 2DIBA 1ZHKB 4KKAC 2R1WB 4ZSOA 4FQXC 2Z92A 5DJDA 4XPTH 4P46C 1X5KA 2EXWD 4XX1E 5DQ9B 5T3XD 2XFXB 4KFZC 5EC2A 5I8OL 1KPVB 2R2HB 1KJ3H 4KVNH 3QCTH 3LKOB 4JREC 4KQ4L 2ARJQ 3IJSA 1JNLH 3FQNB 4EDXB 4PJ7B 4QXGL 4UV7L 1DVFD 5I8EB 1CICC 5DYOB 5D7SL 1DFBH 1JPFA 3STLA 1KJVA 4WFHE 3PDOA 5DK0B 5IFAL 5EUOE 1QSFE 5J11C 1CDYA 1P84J 2EDHA 1S78C 2XQBL 2J12B 1IAIM 4LFHD 4KDVA 1Z5LA 4PD4J 3QDMD 5I8CB 4NZTH 2EE3A 5LXGL 3AREB 3VRLE 1NGQL 4ONFL 5D1XC 1V3KA 1WFOA 3BPCB 4MJ6B 5L9DL 1ZHNB 1F4XL 5DURB 3I2CL 5C0BB 2G75A 1NAMH 5SWSB 4NKMB 2DS4A 4APQA 4OSUH 4XNMA 5C7XL 4RGMB 2QHRL 4M1GL 5AZEH 4ZDHB 4AJ0A 4WWKC 5TJWK 5F1KC 3VXQA 1IGYA 3SCMA 5KVMC 4D9LL 3MLUL 1KCSL 4OUUB 1NFDF 5HHOD 4PRPE 5B38G 3RDTD 3WFDH 1E4XI 4ZNEE 2ZG1A 2A38A 4YAQA 1U58A 3WXWL 4FQQA 3MSPA 3GUTA 1U8KB 3S4SA 4GW5A 4LHJB 5C08D 5KVEH 1UCBH 4M7LT 4KKBD 1BVZA 4PGBA 2NR6D 2DRUA 4AH2A 5I71B 3G5ZB 3C08L 4EI5D 4Z7WB 4HMEA 1CDJA 3SE9H 4XBEH 4FQXD 3GRWL 1F90H 4P46D 5GJSL 5JOFA 1RHHA 4JFXB 2BVYA 3BGFB 1YNKL 4MA8H 3OXSA 2F8VA 4HAFA 5HHVL 1SMAA 2HKHL 4NUGL 1NBYB 4WW2A 1JHKH 3BP5B 1FVEA 4F15B 2H26A 3NPSC 1KV3A 1T83C 4JFYB 5E2TH 3ZKXB 3TJEL 2F5AL 2YBRA 1MAMH 4LCCC 1JHTB 1T1YB 5DQJB 2Z35B 1A4JB 3QJHA 1F58H 2F53D 2AEPH 2UZXB 3K80A 4Z76B 5KSAC 2YZ8A 1S78D 1XCTB 4NO0B 1MRFL 1NBVL 1I3GL 1F4YL 1MCHA 3JWDH 3TV3L 3OXRA 2JK5B 4NN5B 1CGVA 5IB2B 4XWOC 3KGRA 2GAZB 5HI4D 3JV0A 2AXGA 4R26L 4OQTA 3MC0A 3V4UL 1LO0H 1N8ZA 5GS0L 1MHEA 5CIPA 4KDTA 1YEDB 5JW4Q 4C56A 4LLUB 4MAUL 5JHDD 4BFBD 3WUWA 3OTTA 4XP6L 3UTZB 3CPLB 1IGIH 2FX9H 1KCKA 25C8H 3O3AA 1I1YB 2PF6A 4P9HH 2C5DC 5GRXG 5HPMB 4IRJA 4FQHB 3MV9B 4MXQC 3ULVL 5DRNB 1RSFA 4NM8L 4YDKH 2XWBA 4OGAC 5GGUB 4Y19D 1IQWH 1CGUA 3PL6D 4MJID 1T0MA 1T6VN 1BLNB 2AV1A 4M48L 3X3FL 2VISB 2EDFA 1TMCA 1CD1A 5GSVA 5IHZA 4IHOA 4I18B 3B9VA 4P3CL 2X42A 5IBLC 3DPBA 3BZFA 3MV8A 4P2OD 4U6VL 2PCPB 1JIBA 5H2BB 3CVIH 3EO1A 4NRZB 5D8JL 1TZGL 4NBXB 1EGJH 1R24B 1UC6A 5I17A 5IR1A 4P4KC 4EVNB 3VXUE 5GS0C 5I1EL 2I07A 1W72A 1OGTA 1SBSL 3RHWF 3H2WA 4ZO9A 1QNZL 5CFHA 5L7XL 2YKLL 1Z9SA 3S35L 3HB3C 5AG8A 4GMTL 1Q0YL 5KSAD 3RIFF 3MRFB 2NY0B 1YY8A 1AKJB 5D7IA 2MKWA 4XZUA 2AJVL 5EU7E 3VGAC 4EBQL 1AXTH 1NLBH 1WAAF 4NKIH 5HYSG 1W0VA 4WI4A 5FK9B 5D5MA 2YXFA 4IOIB 4Y5YB 2XQYG 4NZDA 2VDKH 1GGIH 3QIWA 1CD9B 3L1OH 3PWUA 5HHMB 4YHML 1A6UH 3JV4B 1WFTA 2FNBA 3SDXA 1JZ8A 4PLKC 2EYSB 3CVHA 3TO2A 4I2XB 4LSTL 2ZG3A 5IIEB 4N90D 3RL1B 2G5BB 1CVRA 1FGNH 2KZWA 3GSQB 4QRUA 5HHQA 2CKBA 2CMRH 3ARVA 4ZTOL 4Y8AA 3VFSB 3MRNB 5DC0A 4XP1L 4Q9BA 4DZBB 1MCBA 2RHEA 2A9NH 5DUML 3EOAB 1ZXQA 4BZYA 3NFPB 4HK3J 1UJ3B 2GW5A 1E6JL 4MXQD 4KC3B 4K3JH 4MA3A 4Y4HB 1VERA 4Q9CA 3O4LE 2Z4QA 4LRNH 3IF1B 2B7DT 3QEQB 1OT1A 1ZT1B 4K7FA 4PJ7F 4C55A 1C5CH 2R2EA 3BWAB 3TT1L 1YDPB 2AAVA 4HPOL 2X4UB 3ABZA 3U4EA 4AIZA 4EUPG 2DQTL 3B43A 2AJSH 3ZE0E 1RZJH 2X4PA 3B83A 5IFHL 5JXAH 4LVOB 1NC4B 2ICWA 5E1AB 5F6IC 1WWBX 3I75A 3IFPA 5D7KD 3EDEA 3KYNA 4GG6A 5HI5D 3HUJB 1GC1C 5C0CD 5IROC 4JG1L 1E27A 1H3VA 1MH5B 2C26A 3VG0H 4QOKA 2DQGL 1CQYA 2YEZA 4PJXF 3FO2A 5E56A 3H7LA 5C09A 2FO1A 1BBJA 3VXNB 2FEEI 1RMFH 5L6YH 4XPGH 1A7BA 3KPRB 3HMXH 5HBBA 4JFFE 1TCRA 3FO0H 4OFDA 5J1SC 1A3RL 3IDMA 3BZEA 4ISVB 3UJTL 4GBXB 4NFBA 3VDAA 4R7DA 2A74A 3QFDB 1T4KA 1INQA 1DDHA 1OT2A 3IDJB 4MX7B 4DAGL 3WJJC 3NGBC 4CKVX 4UB0L 3JVGC 4RCAA 2OZ4L 4E41B 4FMKA 1CE6B 3SJVE 1WQVT 3QUMB 1NAMA 1YUHA 4U6TA 3OKNB 2DBLH 3QCUH 4LNRB 1YY9C 4PRHE 3MBEB 4MNGA 3IKCA 1VGKA 4Z7WF 1UACH 1EMTL 2JCCA 1Q94B 4OTXH 1I1AB 4LVEA 5F3HB 5D1QD 3EHBD 3P11H 4GMSH 5IMOB 4PRDB 5B39G 5MENE 3FQXB 2APBA 5HGAA 5IMMB 3UTSA 3V0WL 2AKRB 5C0NC 1OQOA 2A73A 4BM7A 1YJDH 3LEVH 4MCZA 5DJ2A 5DJXA 5EZIL 1IZJA 2DJSA 2MCG1 2FO4B 2XKNA 3HE7A 3CAFA 1CT8B 4YEEA 3U7YL 3W2DL 2ZPKH 4LOUD 1S7QA 4BELD 3VFTA 1HYSC 5DZNA 5FF6B 3NZHH 5DJCB 4OCYL 2ZCLL 1KN4H 5EU6B 4PJBB 1IAKA 3MRMB 2A6DB 3GBML 1QSEE 5I15L 3RL2B 3VGFA 3VD9A 1OY3B 3F12A 2EKJA 4LSUL 4UIKL 4GRMB 4DN4L 1JHLL 3VXRE 3GHEL 3BPOC 5C1MB 3SDDB 3BO8B 1I8MA 4X7SL 5JZ7C 1AD0B 1HHIA 2OMNA 4K7PX 3K46A 2CIKB 5BRZB 5KN5A 2ENYA 2D3VA 2DLGA 5KANI 1VADA 2PW1A 2PETA 4FTVA 1BD2D 2GJJA 4FFEX 4YPGB 4DQOH 5GIRA 5ERWA 1F97A 4UQ2A 2N7BA 4PRNA 1T3FB 4O02L 5E1HB 1JZ2A 3WO4B 5D1ZA 1BMGA 4JPVL 2F19L 3T4AB 4N8VB 1TJHL 4YIQA 1MQ8A 5IVOA 3VMNA 3IVKB 2IAND 3AMKA 1DQDL 5I1LA 4LLVB 4M03A 4WU5A 1LNUA 4GW1A 4DGVH 1ZA3B 1XF5A 2WIMA 4V1DE 1IEAB 1UM6H 2R2BB 4WEUD 4ZAKB 4ORGA 2YN5A 3LKSB 4GAGL 4M7JH 4L4TB 1X5IA 4XVSH 4X98A 4ZFGH 2HMID 4MA1B 3NN8B 4M7ZC 4EQ3A 4OLYH 1FZKB 1G1CA 4XHQA 3RGHA 2R4SH 3VXMD 2V5RA 4FZ8L 4OLEA 4WEMB 3QDHA 3N06B 3HC4H 5C07D 3BKJH 5FHAH 4PFEA 3HI1A 2BXZA 3PWJA 3VGBA 2C1PB 3ARTA 4WUUE 4R97B 1UKQA 3FRUB 4XHJD 4S0UC 3ZZ1A 5GGTH 5BVPH 4ZO8A 3DVNB 3MCG1 1T1WB 3N50A 4WDIB 1LE5B 1FNEB 2A6KB 1WBXB 1F4WL 3DROA 5K93A 4WNQB 5B4MC 1OM3L 1HXMB 1YEJH 3FCTA 4X9IA 4YBHA 2XV6B 5A1AA 1EGJA 1NCBL 3D87B 4JQVC 4YE4L 1PW3A 3W81A 3VD4A 3MA7A 2IC2A 2R29L 3M1BA 4NJ9L 3V5HA 1A7OL 1B90A 3UDWA 4LVHC 4NO5A 2ESVD 1MCRA 4DKDC 1KCLA 1I1FA 3U83A 2DDQH 4H25A 5FYJH 5FYLL 1K4CB 4TPRH 3GSNB 2E7CA 3G6JB 5JHLH 1XGRA 1QBAA 4FXLA 3E6FB 1QKZH 5KZCD 5FECB 2Q87A 3ZYIA 8FABA 3SKMA 3Q6GL 1QZ1A 3FQRA 3D39D 3BAEH 4JM2C 4U1KB 4KK8C 2Q7YA 4LSVL 3V0AC 1HNGA 1A6TA 4PG2A 5FYKL 4R8WL 1IM9D 1N3NB 4GRWH 2HJFB 3PWLB 3RJDA 5ADOL 1UM5L 3MRKA 1E4WH 3LV3B 4O51B 3OAYH 4O5LL 4YBQD 3NZ8B 3LQZB 1NCCH 3TZVB 1VPOL 5ILTL 2A77L 3P73B 1RUPH 1XH3B 2VZOA 1KIUA 3BQUB 1NCAL 2LTQB 3TNNA 5EOCJ 3HUJF 1CL7L 4E9LA 5I73C 2YHGA 1MIML 2YC1B 1YNTB 2BSTA 1A22B 3VFGL 1RULL 1EO7A 3AFLA 5B3NA 3E8UL 1ZVSA 8CGTA 2IAMC 2EEBA 1UH4A 4PRAA 1NGWB 2JIXD 4BH7B 3K1KC 4XVJL 2EYTA 1FLTX 3SO5A 1MFAH 3D69B 2RFXB 3IETA 1JZ3A 3RPIB 1MI5A 3VFPA 3QAZB 2Y6SC 3L3JB 5FDWB 4RISH 4OLUH 4BUHA 3K8LA 3C6LB 4LPUA 1NGXB 2H45A 3I50L 1QFPA 3MOQA 5E08H 5E9DA 4LFHG 5DA4A 2P5WE 5EO9A 4Y4FD 5A2JH 3O6ML 1FFOB 3VFWA 1WIOA 4A6YB 1K2DB 3TJHA 4YK4B 3QUXC 3W5NA 5DT1H 2IPTH 2NXYC 2E7LE 2ADIA 5GGRA 1A6VL 4ETQB 4FABL 2XTJD 3AS2A 4Q97A 1DANU 3HMXA 4PJIB 5ITBH 3RGVC 1EX0A 1KB5L 1J0ZA 1HILB 3DVGA 3PXJA 3LZFH 3BMWA 3RA7L 2F54B 3PWPA 4K3GA 4I4WB 2AW2A 2YPVL 3OX8B 5DK2B 5A2LH 5IKCB 4HKJB 1IL1B 1N5AB 3ET9F 3GO1H 1BGXL 3QWRA 4KVCH 5H94B 2PXYA 4JFDA 3NMEA 4NQDE 5IFJA 1FYTB 3RFZC 1U8QB 4NNPL 5AYQA 1ETZA 3BVNB 4POYA 4O4YH 5T1LB 3CDGA 4ZXBD 1NUNB 4RGNC 1U8NB 1C16B 5BO1L 3OGCA 3QIBD 4JDVB 5J06A 3SDCD 2WIIB 3RY6A 4OBSA 4YXHL 1K8IA 1DQMH 3G04A 1T7ZA 1WBYB 3OQ3B 4ZUSA 2H8PA 5JW5A 1BQLH 4M3JA 3WFEH 5I1HH 5DRZA 4NHUA 4OT1L 1MCPH 4HJGB 2OTUB 1U8HA 2HT3D 4GRLC 3U6RB 3IDIB 1Z9LA 2H2SC 4QF1A 1HI6B 3NIGF 2FX8H 1S9KC 1KIPA 5C0EB 1HHJB 3O0RH 5A2FA 1WFUA 4PY7A 3TGXA 4QRPA 4XCFH 1QO3B 5I16B 2VQ1A 1FG2A 5B22A 3DNKA 1N64L 2P7TB 1AGFA 5LWYL 5FOJA 1JRHI 3DVFA 3V6OE 5L8KB 1M71B 1KTLB 3SBWA 2OP4L 1FNFA 2LVCA 4C54A 3QUXD 3DJ9A 4R0LC 2NXYD 4OLVH 2P5EB 3L5WB 1OF2A 3B3IB 4F7PB 5IJVB 3QZWA 2OL3H 5EO1A 3RGVD 4CN1A 5F1NA 1ZHLB 3ARDD 4NQVA 3GKZA 5IB4A 2B1HL 4QRRD 3C5ZB 1JN6A 2YPKA 3CSPA 1IAIL 4DVRH 2CDGA 2W0PA 3QQ3A 4MAYA 2APXA 3AU1B 4CJ0A 3BZ4A 5E2VL 3ARUA 3ROLA 5D6CA 3BKYL 1DBML 1RY7B 1J05A 5KTEL 1W0WB 4HLZH 3QA3A 5MHSD 1SJEB 3T0AA 4U7SA 3VI3E 2VDPL 5J0BA 5DMIH 1YEHH 5IUSA 5GRUL 4ZO6A 4R2GB 3T65A 1LO4H 4MXWL 2R1XA 2NY3C 4MCYA 1XMWA 3FRPG 4XWGL 1NANH 5TF1H 1S9VA 5E4EC 2ZOLA 1ADQH 5IG7A 1FRGL 3C5JA 1QSVA 3FFDB 4KAQL 5B8CA 5BJTA 3QPXH 4OZGE 5ADPH 3V6BR 1OTSC 3L6FB 1H15A 4FQIH 2WW8A 1JCKA 3N9GL 4N0CC 3IKKA 1RHFA 3PWVB 4J12A 1FO0H 2CGRH 3R8BB 3E3QE 4NQCD 4H8WL 1K8DA 1I9RH 4HWZB 3H42H 2DWEB 5K9JL 4G43B 4Z78A 2ERJC 3KPOA 5HDLA 3I02A 5C08E 1RUAL 3R8QA 2VLJE 3G6JF 1YEIL 5C2BL 2GYSA 2IALA 5CD3A 1XT5A 5JR1H 1ZWIB 5TQ0L 5D9SA 3WJLC 2DTML 5GGTA 5C0RL 4U3HA 3ELAT 1ZTXL 2HT2D 3NOIA 4OM1L 4YDVA 2YD6A 4KJQC 1KC5H 3UJIL 3W0WA 4YC2C 3ARBD 4R4ND 1G9EA 1DTUA 2WBJD 3G9AB 3WMSA 1VFBB 1R3JA 1YQVL 4TUKL 3L3IA 5CEYA 1LO5B 3DETD 2YS4A 4F7CA 2Y06L 3CK0H 3KPSA 3VWJB 3EDJA 1UKTA 2D03L 4X80H 1MFDL 4LCWD 1XCQB 3DX9B 4Y1AB 5IJKC 2MOVA 4X7TA 4JRXA 5CBAA 2AXJA 3VRIA 1MVFA 2VAJA 4LQFH 4O58H 2F53A 1F11A 4W6WB 1II4E 3WHE0 1CFNB 3O4OB 2Z92B 5DJDB 2QSVA 4H8WC 4S10A 1HZHH 2J8UA 4JO1H 5EC2B 4HWNA 2CKNA 3MV7D 3UBXA 4HFWA 3RWGA 4JVPA 2AK4E 2R0LL 3BDBA 3HNSH 4FZEL 4LARL 3BHBA 2EDJA 5KS9A 1RZ8A 2XZAL 1GGBH 2BY3A 1FNGA 4I48A 5F7UA 2JJSA 4Y8DC 3IJSB 5GQBA 2XNAA 1AQKL 3DV4A 2EE9A 2W9DL 4N0UE 4Q9QH 5JHDE 2WANA 1SJXA 1JPFB 3STLB 1Q72L 4RAUA 1KJVB 4YDIH 3PDOB 2WWKO 4FFWD 4K2UL 1X5FA 3U7WL 4G6FD 4M5YH 3WFHA 3S5LG 5SV4A 4TVPL 3MRQA 2W92A 1Z5LB 2DYPA 3C60D 1JYNA 3CDCA 4I3SL 5GXBB 2H32H 4JGJA 3TESA 2HH0L 1VFUA 1NCDH 4G80A 4P59H 1ZVHA 4G7YH 2G75B 3C6SA 5GGSY 2PR4L 4QRQA 3UAJC 2FCBA 4APQB 4XPGL 3O6FA 4XNMB 4W4OA 4PP2A 2VN4A 3VXQB 1IGYB 3P0VL 3OG4B 3SCMB 3VI4E 4IJ3C 4KJQD 4OZFH 3CLEH 2NY7L 4RZCA 5D7LD 4DUXA 3P40A 3RJQB 3KPNA 4ZYKA 2VLKE 4YQXH 9CGTA 4XVTH 4ENEC 1QFHA 1U58B 4N5UA 3PDGA 4I9WD 4FQQB 3GUTB 3S4SB 4GW5B 4M1DL 4GQPH 5T5FL 4JFQA 3V6ZA 2EE2A 2W60A 2G60L 4YDJA 5K9QG 4EXKA 4PJ5D 4PGBB 1AC0A 3EYVA 5HDQH 4AH2B 4WY7L 4R3SA 4M4PA 4F3FA 3DXAA 1M7XA 2EO1A 5ETUA 1IGTA 4G6JL 3P3YA 4L3ED 3AC0A 5JOFB 1RHHB 4TTDC 4UI2A 4AK1A 4XNZC 3OXSB 3RTQA 5I2IA 4GW4A 1A9EA 4J7RA 5I1IH 5ICYA 2EZ0C 3K2MC 4WW2B 3GJEA 1FVEB 4JM4L 2H26B 3BEVA 2YBRB 5T3ZL 4LCIH 1MFBL 1QR4A 5T1KA 3QJHB 5CJBA 2Y5EA 4LLQA 2BFVH 1XIWC 1JRHL 4G3YH 3GMPA 3MO1A 5DTFA 3QH3A 1J7VR 5IMKA 2B39A 3UTTE 3OXRB 1NMCC 3L3GB 4JZJC 4HWBL 4XP9L 2VR5A 1MEXL 2AXGB 2R4RL 4NC1C 4UT6H 5GGVY 7FABH 3LKPA 2J88L 1N8ZB 3UAJD 2YPLA 2VXVH 3MX0A 4QXWA 4JKLA 4PRIE 1MHEB 5CIPB 3UO1H 5J9PB 4C56B 3ZKMC 4Q6IC 3WUWB 4DW2H 4IRSA 1QYGL 2EEAA 1FFQA 3O3AB 3MYZA 5ECJE 2O93L 4MDJA 3NPZB 1KCRL 1KCGC 2NY4B 5C0CA 4IRJB 1NUFA 1YEFH 1A7QL 3MROA 3L5HA 4H0GA 4XCCL 1L9MA 1Z3GL 3TF7A 1UH2A 2XWBB 5EFIA 4P4RA 1WWAX 1CGTA 3RVWC 1YECL 2FHCA 4CBPA 4LRIA 3TM6A 4CMHB 4JHAH 5IT2H 4Y2DA 4PJFE 2COQA 4PS4L 2OL3A 4HMDA 1TMCB 3SGDH 5L88L 3ULUF 3GSXA 1CD1B 5GSVB 5IHZB 4IHOB 5MEPA 3QQ9C 1FBIL 5FO9A 3HHRB 1RUQH 3GMOA 3HLAA 5D7JB 5IESL 2D0HA 2RQ8A 4EEEA 4KXZH 5IBUG 5EBGA 3FN0L 4FFZH 3QIUC 2GJ6B 1I7UA 1O0VA 3C09B 3BZFB 3MV8B 1MWAH 2DLFH 3EO1B 2F74A 2J4WL 5I17B 5IR1B 2I07B 1W72B 1OGTB 2BNRB 4HT1L 1ZGLA 1MQKH 4HS8H 4GSDL 1FPTL 1NEZA 1QFUH 2IG2H 3QHZL 3QXUA 3ILPA 2ZJSH 4AL8H 4KMTH 3BRDA 4G9FD 2W07A 1K5NA 4S1RH 3T0ED 4NRYA 2EYRA 1XIWD 2DI9A 3CGTA 1SY6L 1YY8B 1B2WH 5D7IB 2A1WL 1EO8L 4XZUB 4RGMC 1CI5A 5EUOA 4M5ZH 3KYKL 5CJXC 5D5MB 3F7VA 4K3EH 4HBQA 5D72H 2VZSA 1KT2A 1FO0A 3QIWB 3PWUB 5IW1B 3CZFA 3SDXB 3WIIL 4MLIA 3B5TA 3CVHB 3TO2B 4TOYH 2V9QA 2VH5H 3DYMA 4DTGH 4QRUB 5HHQB 2CKBB 1GVIA 1WZKA 2EIEA 2VN7A 3KXFE 2X1XR 1A6AA 1L7TL 3NACL 5SWZE 5F7WC 2DM3A 3RVVC 5HYQA 4JY6A 2AABH 1BM3H 5I71C 3DI2B 3IDNA 4WV1A 4CN6A 1ZEAL 2BNUB 4MA3B 1LD9A 5BQ7A 1HKLL 2Z4QB 3RVWD 5T3ZD 3WE6A 4Y5XC 5FUCC 3ZHKA 4ZNEA 2XA8H 3OKLA 4K7FB 2R2EB 2EDYA 2EDKA 3DARA 2IQ9H 3QQ9D 3U4EB 4AIZB 4GO6B 2X4PB 5F89A 1F3JA 2ICWB 2VNCA 1REIA 4IMKA 3I75B 3IFPB 4CU8A 2P1YA 1Z9OA 3KYNB 4GG6B 3P9MA 1BD2E 1PKQE 3ARGA 3KDMA 1U8MA 3LMJH 5E8PA 1E27B 2AK1H 2AGJL 4HIEA 4QOKB 4FQ2L 5ENWA 3HI5H 2C7UA 2Z8VC 3D48R 4JR9H 1YYLH 3ARED 5E7FA 3BSZH 1BBJB 4NN5C 1QBLH 1OPGH 1A6ZA 4PJHA 2VDNL 5DURD 1TCRB 4HQQH 5C0BD 5SWSD 1MY7A 3IDMB 3Q6FA 4MB4A 4YR6A 3BZEB 3ERYA 3LIZH 5C0JA 1M6OA 2MTPA 4EUPH 1KTRL 3O6LL 4R7DB 2A74B 1DBBH 5TH2A 1T4KB 4ELME 3FO1A 1INQB 4XNYH 1DDHB 4XC1H 2NXZC 4N68A 5J1AA 2CXKA 1NCTA 2HWZH 1LE9A 2H32A 2NY1B 2A9MH 4I3RH 4L5FH 5LCVL 2BNQE 4CVZA 1NAMB 1PG7L 1YUHB 5C07A 2D7TH 2CR6A 4QXUH 1KENH 3QQ4A 2JJUA 3V5DA 1D5XA 4MNGB 3IKCB 1VGKB 2JCCB 1JFQH 4OZFA 4AT6A 4LLYA 1R3KA 3SKNA 1P4BH 5HGAB 3UTSB 4L9LA 2A73B 4KHTL 4IOFC 4OGXH 2QQKL 4WW2F 4P2CG 2VWEE 4MCZB 4CRPA 3MYJA 5DJ2B 5DJXB 5IB3A 2VIRA 2ESVE 4WCYL 4EN3A 2Q3AA 2DAVA 4H88H 2XKNB 5KSUA 2DB8A 5TPWL 4N5ED 1PDKA 1S7QB 2Y07L 5JIPA 1ORSA 4TSAL 4UBDC 3VFTB 5TDOA 5E6IB 3NAAH 4NJAH 2I24N 2NY0C 1IAKB 2B4CL 4NO0D 3UP1A 4D8PA 5BS0A 5GGSA 3C2SA 3VGEA 1QD0A 1UYWL 3F12B 4WFEE 5CJQL 3ZLQC 2ZP0T 2W0KA 5ICZA 1H9VA 5D2LF 2VXTL 1IILE 3T8XA 2DD8L 3ZKND 1I8MB 1AY1L 5ESAA 1T7YA 1HHIB 4MD4A 1X4XA 5KN5B 1A6WH 3RUGE 2X4OA 1FV1A 4S1QL 1VADB 3WSQL 43C9A 3OKOA 1CK0H 1BIHA 1RIUL 2X9XA 1RZKL 4N8CL 5I8KL 5GIRB 1U0QA 5ERWB 4UQ2B 1QG3A 4PRNB 1PAMA 1PYWA 5D1ZB 1AGEB 3MV9D 5FOBA 1MNUH 1H3WM 2E9WA 4MZ2A 4RWHA 3U0WL 4K8RL 4YIQB 4LCUA 3D2UA 3K2UL 4Y7MA 2YD5A 1J10A 4WU5B 1E6OH 3NFNA 4PGEA 1LNUB 1RUML 4PYGA 2I5YH 4GW1B 3TN0A 15C8H 5EBWA 3RZCA 1LEGA 1XF5B 2YD4A 3ROOB 2B4CC 4JY5L 2VSCA 4LVOC 4JPWH 1MCDA 4ORGB 1CF8L 1CVSC 1AO7E 1KXTB 3KS0J 4NQSA 4QT5A 4X98B 4DKFL 5BOZG 4PB0H 4JY4A 1HHHA 4FQJL 1IGJA 3HI1B 3PWJB 3SOBH 2RJMA 1GPOL 2AJZB 2IH1A 2CRIA 3UBXI 4A2LA 3S34L 4UBDD 5D7IF 4UQ3A 1C7SA 2AJXH 4B7LA 1GGCH 2X09A 2D7NA 4WVRA 3SDAC 2PW2A 2Z93A 5D5MF 1MWAA 1JP5A 1KTKE 1CU4H 2FHFA 3DROB 5DD6A 2NY0D 3LB6C 1AKJD 3FCTB 4K8RC 3CNKA 5E99H 3QPQD 2V2XA 2X2YA 4MWFA 3MA7B 4XRCA 3M1BB 5D96B 3V5HB 4NO5B 2R23B 5HHMD 1I1FB 2WUBH 1TITA 4FFVC 4H25B 1MREL 3S96A 4MLSA 3GEWB 5J6GA 4AYFA 3LPFA 3QIBA 4OCXH 1B88A 1KELH 8FABB 4JFFA 3SKMB 4QHKJ 3RIAK 4QXTA 1AGBA 1CN4A 1TZHA 1RK0A 1PX4A 4JCLA 4LEOA 3MXWH 4JFHD 3T4YA 1JF6A 1A6TB 4D0CA 1I1AC 3T0DA 1KYOJ 2ADGA 2NY5H 3P30H 1RURL 3K3QA 5EUKA 1F2XK 3TT3H 4Y4HD 3VA6A 5E6ZA 2B0SH 3MRKB 4Z8FH 2VDRL 3EJZD 1I8KA 3L7FA 2VLMD 4J8RA 3SJVA 4MVBC 5GGQL 3QEQD 5EZOL 2P44B 4GAYA 1X5YA 4JO3L 1FCGA 3TNNB 1DQLL 1G9NH 3HPLA 1HWGB 4PRHA 4GG6F 1FGVH 1NC4D 2IPKA 2OJEB 2BSTB 1IBGL 3LKRA 1B6UA 3QG7H 4OFYD 1ZVSB 2NX5E 1O5DT 4PRAB 4CW1A 3VD7A 3QUZA 1JUFA 2EYTB 3UTPD 3GMQA 5MENA 4OZIE 1DLHA 2FLBT 4NP4H 3IETB 3VFPB 1MI5B 4P9ML 4KTDH 1X4ZA 4U05A 4UINL 1L7IL 3A6OA 4QRRE 1L0YA 2XACC 2YA2A 4JRYE 2AVGA 3KPRD 4LDOB 3SDDC 4AEIL 4PY8J 5BVJA 5E9DB 5EO9B 3C87A 4WO4A 4L8CA 3LB6D 2GIYA 5IQ7L 4HIXH 4M8QA 4GBXD 2OK0H 3GMRA 4P3DA 3VFWB 3O2WL 5DA0B 4HPYL 4YUEL 5DD3L 4X7EC 7CGTA 2YZ1A 2ADIB 5GGRB 2D31A 4RGNE 1KJ2H 2OCFD 2A6JA 3MLVL 4E41D 3C9NA 3IFNH 2OI9C 3AMLA 5IF0A 5IHUL 1IGCH 2JCCF 4FQ1H 1FORL 2R0ZH 1JE6A 5ANMA 4EUPA 3MBED 3VFVA 4OCRL 2PXYB 4JFDB 3S9DB 4OGZA 4BZ2H 1P4IL 5IFJB 2PN5A 5ITFA 1I1AD 4CVWA 1SYSA 2XYCA 1AE6H 2YRLA 5CEZL 1X6LA 2FH8A 12E8L 3MLPA 1RJCA 3CDGB 4OLXL 4MA1C 4OI8A 3OGCB 1TDQA 4MVBD 2R39A 3HE6C 5LG1A 3MNVA 5DMJB 4R4FH 1TFHA 3O2DL 1SYVA 4HUXA 1JV5A 5EU5A 3T0VA 4PGJA 1M7DA 2R8SH 5DFTA 1K8IB 5TE6L 1RZGA 3G04B 4ZUSB 2H8PB 3VG9C 4W70A 1ZT7A 5DMKA 3JWOH 4V1DA 5DRZB 4K3DL 4NHUB 5I30L 5EU6D 5CZKA 5C8JA 1U8HB 3O8XC 4JG0H 5IGXH 4LCWE 4KUZL 1G9MH 3IXTA 3D3VB 1IQDA 4NZRL 1KIPB 3SE3A 1IT9L 2Z9TA 1ACYL 1CTNA 4PY7B 1JVKA 3SDDD 4QRPB 3IDGB 4WUUA 2VQ1B 1FG2B 3HZVA 1AGFB 1NANI 3OJMB 1Z0MA 5BRZD 3ZL4L 2AEIT 4QLRA 3W11C 6CGTA 3DBXA 3WNLA 2QQQA 4DGYH 4R90H 4UV4L 1S7TA 5F8RC 4JEGB 1OF2B 1QSZA 1J5OH 1OAQL 4OCSH 3QZWB 5EO1B 1P7KA 3MCLH 4NQVB 5IB4B 1BVKA 1N7MH 1JN6B 1CWVA 1UXWA 2MPAL 2YPKB 3FAXA 2CDGB 5CSZA 1XEDA 4MAYB 1RZFL 3TZVC 3BZ4B 2GITA 3ROLB 1A3LH 4NGHL 5D6CB 5T33H 1LDPL 3BQUC 3OAZH 1J05B 4TTGA 3FONA 3QA3B 3QDJE 3DMMC 4LIQH 1JPST 3RVUD 4ZAKD 1BZ9A 3CDYA 3DSNA 1T89A 2VL5A 4L4TD 1ZVYA 2XRAH 4NT6A 3T65B 1OAUH 4N1HB 2R1XB 4MCYB 1WSST 4FP8L 1S9VB 2ZOLB 5JQ6L 5IG7B 5C2UB 3C5JB 4Y5VA 4RWYL 3OL2A 1F3DH 1Q9WA 5TFSH 4XPAL 2QKIA 3FN3A 3QAZC 3A67L 1KIQA 3C6LC 3GIVA 1ZS8B 3IRPX 5I8OH 1F6FB 3B2UC 2CUHA 5I1JL 3O3DB 2UY7A 1NFDE 3BP4B 1X7QA 1K8DB 3S3SA 3BH8A 1C5BL 5B21A 1SJHA 4GQ9L 1BAFL 3KPOB 4Z78B 3I02B 1CXKA 3TFKA 2H1PL 4OD3H 4F58L 1AHWA 5CINL 5CD3B 2Q86A 4UV7H 4N0FA 5D7SH 4CL7A 3BP6B 3RWDA 2XQBH 5DK3A 4YDVB 1IVLA 3PJSA 3BPLB 4LAQL 1L9NA 2FBOJ 3W0WB 2OR8A 4JN2A 2AEQL 3LQAL 3TWCL 2D7PA 2X4QA 5I74C 5LXGH 1R3JB 4U1IA 2YD2A 2P5WA 3L3IB 1NGQH 5CEYB 4F7CB 4M3KB 4PBWD 5L9DH 3EYFA 4ZO7A 4FOMA 3KPSB 1YYML 1L6ZA 4QKXB 3WS6A 3RVTC 3RIAF 1GHFH 4ZFOL 4NQED 4X7TB 1NUDA 2X44D 1P1ZA 3NA4A 2E7LA 4WHYG 5FIEA 5C7XH 3ECBA 4JRXB 4IDJH 4M1GH 5CBAB 3VRIB 3DURB 5F21B 1F11B 3OAYK 5F96L 3TZVD 1BFVL 1KCSH 2ORBL 4RDQF 5DWUH 5TDNA 4U1GB 3BQUD 4YFLI 2J8UB 1DLFH 2PNDA 2UVFA 4P99A 4HKBA 1B3JA 1BJ8A 3UBXB 4HFWB 3RWGB 4TQEL 4ZOEA 3BN9C 4EIGB 4GRWB 1MPAH 2ICWJ 3BHBB 5KS9B 1RZ8B 1FNGB 4I48B 2ATPB 5EWIH 2NY6B 5C0GB 2JB6A 4KY1H 2AI0L 1S7XA 4ZPTA 1I9EA 2HP4A 2XNAB 3DV4B 2EE6A 1TXKA 1RZIA 5AAMA 4AEHH 4JAMA 3OZ9L 2BJML 4RAUB 2FGWL 5ICXA 5J7CC 3ALPA 1N26A 1OAYH 3B9KC 3WFHB 3C6LD 3QEUA 3WLWC 1DSFL 3MRQB 5GJSH 4ODTL 1KEGL 3G6AA 2DYPB 4TSBL 1EVUA 1YNKH 3ULUL 1BBDL 5A16A 2O5ZL 4JO4L 2HKHH 3S36L 1EBPA 4UTAH 4G80B 3A0OA 1U3HA 5CAYB 2CRYA 3IDUA 3NIDF 3C6SB 3WXVL 4K7PL 4QRQB 2F5AH 1CGXA 3LAFA 1A7RH 3O6FB 4TVPE 3GMLA 1EZVX 2V2WA 4PP2B 3T1WA 1ZLVH 3JUYA 1MHCA 3VW3H 2F54D 2JJWA 1KIRB 5T5NF 1NBVH 2JF1A 1I3GH 2NZ9C 4RZCB 5D70H 1KSRA 3BGMA 1F4YH 5LGHL 3KPNB 4ZYKB 5FGBC 5JW3L 3R06A 5DJ0A 4KRPB 1FYTD 4P57A 4Y16A 1A47A 4JFQB 3V6ZB 1RU9H 2W60B 3V4UH 1KJ2A 2DQUH 4YDJB 1JI2A 4OV6F 5GS0H 3LS5H 5T1LD 4I0KA 4QYOA 4MAUH 4R2GC 3EYVB 2VDOL 4G5ZL 4XP6H 3MLYH 2VLRE 3PNWA 4F3FB 4X7FC 3DXAB 3DX8A 4MJ5B 5ETUB 1IGTB 3ULUC 3BPNB 2B2XH 1CXIA 3E0GA 1OTUC 3LSOA 3ULVH 3F8UB 3OBAA 4NM8H 3FQUA 2ZSWA 4Y4KA 5D2NC 3BN9D 2GJZA 4WWID 1IFHH 3RTQB 3P9WB 5I2IB 4GW4B 3E2HA 1I3RA 3F65A 1A9EB 1U95A 5ICYB 4KUCF 4M48H 5JIIA 1MCOH 3GJEB 1RJYA 1DBKH 3BEVB 5JW4N 1JI1A 3S88L 3Q3GA 4WI5A 1BQHA 4U2YA 3T09A 5F9JA 5T1KB 4P3CH 4P5TC 5DFVD 4LLQB 5DVKA 5BXFA 3GMPB 4U6VH 3MO1B 2AJ3A 1BX2A 5ELIA 4XXDA 5DTFB 4J3OC 3QH3B 3R1GH 2AV7B 4MDIA 5D8JH 5AEAA 5IMKB 4BQ9A 5BCAA 3MTRA 2DQHL 5T3ZE 1WISA 2VZUA 2X4SA 2XFXA 3UTQA 4KHXL 2Y7QA 3LKPB 4GKSA 5J13B 2YPLB 3E3QA 3CX5K 2EXYC 2P5ED 4H0HB 2YKLH 1N6QH 4GMTH 1Q0YH 3X17A 2EH7L 2HVJA 2VLJA 4IRSB 4PJ7E 4UT7L 2QADB 4J2XA 1KACB 3QO1A 4PV9A 2IBBA 2AJVH 3C5ZD 4EBQH 4MDJB 2NZ9D 5DK0A 4ODUA 3GI8L 1IC5H 2ITCA 2AXHA 4OF7A 3U0PA 5EFIB 2GY5A 4YHMH 3C5SA 4P4RB 4LSTH 5DD5H 2E9JA 2VYRE 4Y2DB 1CD0A 2DOCA 2HN7A 2Y72A 1KN2L 2OL3B 1JPSL 3K81A 5CHNA 3GSXB 4ZTOH 5CLWA 4MJ6A 4PJXE 5MEPB 1S5IL 4R2GD 3GMOB 1PVHA 5C0BA 5I1KL 3HLAB 5F71A 4XP1H 3SE8H 5KAQF 1CICA 4P2QE 5DUMH 1I7UB 4PJ8B 3BDYL 1E6JH 5F72S 1H3PL 4YHYB 5HPOA 1QPXA 2D7QA 4Y89A 3B8SA 2F74B 4P23D 2HTLD 4D0BA 1FDLL 5I9QB 3HA0A 3EZ8A 3A6CL 4MNHA 3OG6B 1ZGLB 4KZDL 3DO7B 2NMSA 5DJZA 1NEZB 2AK4A 5D1XA 2ZUVA 3TT1H 4HPOH 1K5NB 3EFFA 5DO2C 4U33A 5IFHH 2HJLA 2ICCA 3EFDH 3KNBA 4WTWA 4NRYB 2EYRB 4APQC 4N0UA 2QTEA 3F7YA 4YDLB 3I84A 1TZIA 5IVXA 5HTSA 4ZUTA 2MQCA 4WWKA 4JG1H 1WEJH 5I6XB 5EUOB 1DL7L 2GEEA 1MLBB 3SCMC 3F7VB 5KVGH 3LHPL 5C6TH 1UWGH 2DQGH 1KT2B 1FO0B 1EPFA 4U3XA 1PJ9A 3CZFB 5DHYA 1ODAA 3B6SA 1DUZB 3VWJD 1WV7T 5IB1A 1NBYA 1QP1A 3F7RA 3TIEA 3WKNA 4Y1AD 5HYQB 2XZQL 5HD8D 2E7BA 5EOTA 4JFYA 1IKNC 4PRBA 3UJTH 4JY6B 1E4XH 4J23A 1RVFL 2J8UF 3DHJA 4WV1B 1BJMA 3UYRL 5JUEL 1LD9B 2RCSL 4DAGH 1BJ1H 2E8YA 1U6AL 3GFUA 3WN5C 3BP7A 5SV3A 5BQ7B 2ZSVA 1MJ7L 4GRWF 4UB0H 2OZ4H 5KS9F 3WE6B 2VLKA 1JMZA 3OKLB 4PGZA 4ZOCA 5C0AE 5DMGD 5FYKU 4HCRH 4U7MA 3OSKA 5LVEA 5F89B 1F3JB 4UTBL 1EMTH 4QNPF 1UT9A 2VAAA 5GISH 4M7LH 2BERA 4LCCA 4F37K 4HFUH 2KUTA 1DQQB 3P9MB 4LLUA 4JFEE 3ARGB 3KDMB 1U8MB 1A1NA 3CPLA 5E8PB 2GSGA 4G6KH 1I1YA 1V7ML 3FT3A 2CRMA 4HIEB 3V0WH 3V4PH 1U2CA 2DMBA 3HFML 5ENWB 3GNML 1JF5A 2C7UB 5EULV 5EZIH 1A7PL 4NCC1 1XR8A 1HDMB 2VTFA 5E8DH 3ILQD 5DO2D 4M43L 3W2DH 1A6ZB 1HE7A 4PJHB 5IEKA 4APQD 2VXUL 3BXNA 3Q6FB 4YR6B 1AR1D 2VQTA 3W9EA 5C0JB 1M6OB 4Z6AT 1MFEL 1U2HA 4IRZL 5JDJA 1DBJL 4PJGE 2ZCLH 5TH2B 3FO1B 3SCMD 4MHHG 3S37L 3A6BL 4JFPA 3MJ7A 5J1AB 1ED3A 4JKPL 3GBMH 4JANA 3P4OB 1LE9B 2H32B 1PY9A 5I15H 1YC8A 4GLRI 3ORJA 3HC3L 4OCWL 1OAZH 4V3EB 1NCWL 1IM3A 4G6AC 1LEIA 4LSUH 3UTTA 4CVZB 1NUGA 4EVNA 5GS2H 4UIMA 1UWXK 3QQ4B 1UKSA 2NY2C 3V5DB 3VWKB 1D5XB 2P49B 3BKMH 1VHPA 5HDOA 4PRIA 1QBML 4DJMA 4OZFB 3CVHL 3AS1A 4B53A 3GSNH 5FGCB 1YN7B 3DVIA 4AT6B 1X5GA 3LDBC 1QPPA 4HW6A 4LLYB 1R3KB 3SKNB 1U3JA 4O02H 3T0BA 4L9LB 5F7YC 4BKLA 2Z8SA 1BZQK 4GS7C 1FVDA 1VCAA 3CX2A 4KJWC 4LSQL 5FK9A 1MCJA 3MYJB 5IB3B 4Y5YA 2VIRB 2QSTA 4EN3B 3LQMA 4P4KA 5DLML 2BRRL 1F00I 5KSUB 3G6DL 4H1LG 4I2XE 1P9MA 4XT1C 1I4FA 4PJFA 3NH7L 2VXSL 3X3GL 1EHLL 3MLZL 4DGIH 1L8JA 4UAOC 5TDOB 1C08A 4DN3L 3WCYA 5F9WC 2MSPA 2JLLA 2VO5A 4GAGH 5HYFA 5M7QA 3LY6A 5A3IC 2C9AA 1U3ZA 3GSUA 2HA1A 4D8PB 5BS0B 4HJJL 4FZ8H 4R9HA 1NKRA 35C8L 4FFYH 5ICZB 4XPTL 4XTRD 2WSKA 1MFCL 3T8XB 2HFGH 3PGFH 1KJ3L 5ESAB 4KVNL 4MD4B 1YZZA 3IFLL 2C4FT 3QCTL 1LK2A 2X4OB 1FV1B 43C9B 3OKOB 4C56D 2F9BT 3CFBA 3ALXA 4XP5L 1F4WH 5AYUH 2PYFA 4Q0XL 1QFWM 1A1OA 3RNKA 1JPGA 2R0KH 1NCBH 4YE4H 3H3PL 1PYWB 4HWEL 3F7PC 2NY4D 4IRJD 4NJ9H 5J1TC 1GCFA 1A7OH 3UTPE 4N8PA 3GK8H 5FAAA 2EDTA 4LCUB 3D2UB 3KPMA 4S1DC 5EOQH 5GS1C 3N1PC 5FYLH 4A6YH 1D3CA 2WINA 3NFNB 4PGEB 5HHXH 4MS8A 4YGVA 3TN0B 2JJTC 3RZCB 1FQ9C 1LEGB 3KPRA 3KXFA 4BSVA 1UB5A 3Q6GH 4PYHA 3Q48A 3T2QA 5D7JD 4NZJA 5FO7A 2UY6A 1HINH 4OSUL 4LSVH 1J0JA 2GJ6D 4GBXA 5FYKH 4NQSB 1FP5A 4QT5B 3MV8D 4NOBA 4JY4B 1HHHB 5FUZH 5CILL 1HKFA 5ADOH 1UM5H 1JNHA 4EIZC 4I13B 3WFDL 3NCFB 5DVOA 4JVWA 4O5LH 2BNRD 1VPOH 5A43C 2IH1B 5ILTH 2A77H 4RSVA 2Y36L 2DKMA 4UQ3B 1NCAH 1CL7H 2E27L 1N59A 5KVEL 3ZYZA 2PW2B 2Z93B 4BQBA 1T21A 2FRGP 3VFGH 1RULH 4PB9L 5DD6B 3E8UH 1KLGA 4ETYA 5EIIA 3QXTA 1XZ0A 2LABA 1WZMA 2NTFB 2V2XB 1PKQA 4MWFB 5HVHC 4PGDA 4I5BA 4I0PA 2FJGA 4LASH 2QR0A 4XVJH 4XRCB 4YHNA 4ZFZA 3QIWD 1F90L 3U4BL 1QFOA 4XNXL 3BH9A 2NY1C 4YFDB 2GQHA 5C70A 5J6GB 4R7NB 3MRRA 2XI9A 4JFFB 1W2KT 4QXTB 1AGBB 1TZHB 3MLSL 3ARQA 1RK0B 3U36A 3EYQC 4LEOB 5FF6A 3T4YB 4D0CB 2APFA 3O6MH 3INUH 1QTYT 1J0HA 2FB4H 3GGWB 5EUKB 5FM5M 4CU7A 1DJSA 5EU6A 2DICA 4PJBA 2ZUQB 3U82B 1A6VH 3RI5K 3TO4C 3PP4L 4NRXA 4DFIA 4RAHA 4I77H 4PJDE 1I8KB 4BK5A 3L7FB 4J8RB 3SJVB 2XICA 1KB5H 3ARSA 1P6FA 4GAYB 1CLYL 1X3DA 2BNQA 1MHHA 2YPVH 2OQJA 1VGEH 3HE7C 1EO5A 3HPLB 1BGXH 3NIGE 4PRHB 3MLRL 2J8HA 2IPKB 4LVNB 1LO0L 2EDXA 4EZMA 2Y1VA 1PZUB 5BRZA 3LKRB 4WFGE 4BFEA 1U8OA 4MZ3A 2VC2L 1MCWW 4CW1B 2OZ4A 2J6EL 1IGIL 3FOLA 3QUZB 1JUFB 4D9QE 3GMQB 5MENB 4F37F 4QOKD 1DLHB 4X6CE 4LPVA 2HYMA 4DWHA 5BO1H 2I27N 4PJHF 4HCRA 3MJ8A 3IYLW 3PUCA 4M6ML 3T4AA 4N8VA 1OSZA 5H37H 4KKLC 1OGAE 2O5YH 3T3PE 3IRZA 3MV01 3UPCA 4LLVA 4YXHH 2GTWA 5BVJB 1T66C 4PLJD 5EZJB 4WO4B 4L8CB 2C3VA 4M8QB 1NLDH 3HPJA 1CFQA 4P3DB 3QCVL 5AUMA 4MB5A 1MCLA 3JWDC 4FA8A 2D31B 4XI5C 5EC1A 4YFLF 5EU4A 5D1ZC 4OIIH 1SEBA 2A6JB 4ESKA 2NY1D 1IC7L 1OW0A 5J12B 3CVIL 5IF0B 2D4DA 3OKKA 2NLJA 1VACA 3PP3H 2CIIB 4EUPB 1UM4H 4HKXA 3VFVB 1N64H 2HKFL 3EYQD 4A2MA 3RWFB 4TUJA 3DVNA 3RUGA 5ITFB 1SYSB 2OP4H 1LO3L 1I3UA 3UTSD 1NMBL 1TTFA 1AXTL 3MCKA 2EEDA 2OTPA 5DEGA 4PBVC 2BCKA 3MNVB 3KYOB 2B1HH 1GGIL 3L1OL 1SYVB 1A6UL 1XFPA 4RRPG 1OARH 3H7BB 5EORL 4HUXB 1JTPA 1JV5B 5EU5B 1M7DB 3GSNA 2P8LA 3FB5A 4EQ2A 5E2VH 1RZGB 1EFXA 3U7AA 3E6FA 1LEKA 1T22B 5J3HD 2CMRL 1DBMH 4X6FA 5DMKB 4OZ4A 3QXDA 5KTEH 4V1DB 5GSRA 5E6ID 1CS6A 3H6JA 5GRUH 1AO7A 1I8LA 2BX5A 2FECL 4JQVA 5C8JB 2RR3A 4MXWH 5CD5C 4XWGH 4K3JL 3IXTB 4NQEA 1IQDB 1SM3L 3UDWC 3KLHD 1ZSDA 5HI3C 1BEYH 4KAQH 3AY4A 4O51A 4G8GE 3OB0H 4HDIA 2V7NA 2DM2A 4WUUB 1HCVA 3HZVB 1T66D 4PJEF 4MA7L 3HAEH 3N9GH 2AJSL 1ZV5A 4Z0BL 1PSKL 4JM2A 4E5XA 5CGTA 1FFPA 4BQ8A 3QNZB 5K9JH 5JTWA 1S7TB 3I6KA 5DEZA 4PG2C 5D1ZD 2RBLA 2VUOA 4LU5H 1O7SA 1UJTA 1YEIH 2KL6A 2ZOKA 4UU9A 1P7KB 1QLFA 3CZJA 5TQ0H 3CC5A 1BVKB 1UXWB 5C0RH 2QL1A 4NC0B 1OD7A 4L8SC 2ADJA 1RFDL 1ZTXH 3QRGH 5EO0A 5CSZB 3BW9B 3L3JA 1BFOA 3UJIH 2GITB 1EEQA 4KTEL 2LQRA 1FCCA 3K74B 3M8OL 1AIFA 3FONB 3KWWB 3RX8A 1BZ9B 3OJ2C 3THMH 2F5BL 2Z8WC 1H0DA 2VL5B 2Y06H 1P4LA 2IAMA 5BW7A 2D03H 4NT6B 1MFDH 4CVUA 2MJWA 4PG9A 4L29A 3KJ4C 1VESA 5JXEA 1S9XA 4Y5VB 2CO6B 3W82A 4YX2H 1Q9WB 2ZUWA 4WEBL 2QKIB 1RZJC 1R3LA 3SQOH 1OQXA 1KIQB 3GIVB 2CUIA 3S3PA 2DBLL 2MFNA 3QCUL 3OX8A 2D9CA 3SGKC 4MXVF 1WZ1H 3KPTA 1V3MA 3NTCL 4FZEH 4FS0A 5TQ2L 3ARFC 1X7QB 1ORQB 1OL0A 5IWLA 2XWTA 1FYTA 3BH8B 1SJHB 2XZAH 3JTTA 2NX5A 4U49A 1I9JL 4FQLL 4ZODA 3BRFA 4ZPVA 4GMSL 2HTKD 1AHWB 4PDCE 4OKDA 4HUKB 2Q86B 4N0FB 4OZIA 5T1LA 2UZYB 1YJDL 1SVCP 4L3CA 3RWDB 3U7WH 1XGQA 5KJRL 3WS3A 2R2CA 4XAKE 4XCYA 1WCBA 2JELH 5K59E 4F57L 4V2BA 1UWEH 4JDVA 4JRYA 4JN2B 1FZOA 1Y6KR 4XNQA 2X4QB 1IARB 1A64A 2YK1L 1TQBC 2PXYC 1BOYA 4U1IB 3N1GC 2P5WB 1WBYA 4I3SH 3JSSA 4B5EA 2YN3A 3EYFB 5E0QA 1KF9B 1MCKA 1KPRA 4OM0L 5EIVA 2GFBA 5I1GL 2PR4H 3H9SE 2EO9A 3I6LE 1P1ZB 5T3XL 3ECBB 4QGYA 1K85A 1KCUL 3P0VH 1IC1A 2FEDC 2X70A 4D9RE 5F70A 2J8OA 5TDNB 2V7HA 3WLBA 1QQDA 4HKBB 4X4XA 3RY6C 1J8HE 1BOGA 4M1DH 5T5FH 4G42A 4UILH 2G60H 2FSEA 2JB6B 1S7XB 1YJDC 4ZPTB 1KB5A 5JA9A 4X4ZA 3LS4L 2A6IA 1KG0A 1RZIB 3B3IA 4JAMB 4YLQT 1MI5D 4G9DA 3STBA 1HWHB 3QEUB 2PO6A 5D93B 2WWKT 3B5GA 3K4AA 5E9DD 5FB8A 5A16B 3TCXA 1B4JL 3QWOB 4RBPH 5GRJH 3MQIA 3CLFL 3SBWC 1SJEA 1U3HB 4RMWA 4JM4H 4U1NA 3TJHD 1U8IA 1D5ZA 2LU4A 4M7JL 1ROWA 4KK9D 1MFBH 3HR5A 3GMLB 1EK3A 4ZFGL 2V2WB 4OLYL 5EBMA 2K7QA 5HJ3A 5E2UL 2VUYA 1JRHH 3ULUE 2DMCA 1MHCB 1GGYA 2DLIA 1GH7A 3HC4L 3BKJL 3V52H 5CZXD 4BA8A 3BGMB 4XB8A 3QWRD 5D2NE 2PXYD 2HT4D 5DUBA 4JFDD 4P23A 4NKOA 3OWEA 1G6VK 4Z77A 4LHQB 5IHLB 5DJ0B 4P57B 1MEXH 2R4RH 4Y16B 3FFCA 5K9QI 1KJ2B 3CDFA 2J88H 4AIOA 3RIFK 3S4SG 4PJCA 2V9RA 4EI6A 4QYOB 4XPFH 3EKCA 4HIJA 3PNWB 4X9HA 3DX8B 2CKBH 2J5LC 4LSPH 3AGVA 5B8CC 1KCRH 4ONGL 2DDQL 3LSOB 1U92A 3FN9A 1A7QH 1JNNL 3RVXD 4L8BA 3FQUB 2ZSWB 4Y4KB 1NSNL 2GJZB 3T2PA 2YRZA 3EGSA 3E2HB 1I3RB 1DN2A 5FO8A 3RDTC 4JO2H 1U95B 3S35X 3TVMB 1NL0L 2X1WL 3U30C 2EECA 5I18L 4WUKL 1RJYB 4G8EA 2UZIL 3ARXA 3WNOA 1FBIH 3Q3GB 2Y25A 1BQHB 4KUCD 1W8OA 3VXSA 5F9JB 5HSFA 1XCQA 4Y1AA 3D3VD 3FN0H 4KKBC 4JDTL 3WJLA 5BXFB 3MNWA 2AJ3B 1BX2B 2NR6C 2XN9E 1T03H 4XXDB 3EO0A 3MRDB 4QRPD 3HI6L 4MDIB 3LCYA 4ZSOE 3UYOD 1RUPL 1S5HA 1YNLH 2CR3A 1Y0LA 3BPLC 1CFNA 2VDML 2V2TA 5LAXA 4N1CA 2X4SB 4MD5A 2R9HD 5C0DA 3L3HA 1NGZA 4GSDH 5C6PB 3UTQB 1UZ8A 1FPTH 3QUKA 2QBWA 2Y7QB 4GKSB 1NFDA 2F58H 2PTTA 3GZKA 4YBLB 4HXAH 3RWIA 4CJ1A 2HVJB 2VLJB 5IJKA 3R4DA 3CFJA 4WJ5A 1SY6H 3ZHLA 3NFSL 2A1WH 1EO8H 3QO1B 4PV9B 4OF3A 3D0VB 1J86A 5HHPA 1TJGH 3HAEA 4ODUB 3KYKH 4MAYD 5KSBF 2RB8A 4RISL 4OLUL 2ITCB 2V5YA 3U0PB 2E9BA 1EUTA 1QBBA 3C5SB 3G5YA 3O41A 3WIIH 4U1GC 3O9WA 2D7OA 4P48A 5F9OL 3VJ6A 4J1UA 1ES0B 2HN7B 5CHNB 3HCVA 5EU3B 1UGNA 2PYEE 5HI4C 3MRCA 4ZOBA 2ED9A 2XPGA 5ACMA 1CICB 3CFIC 3CH8A 1HH6A 1CBVL 1A21A 5HDBE 1ZEAH 5ITBL 5CSGA 4D0BB 1CZ8L 4JHWH 2N4IA 1ZT4A 1H8NA 4MNHB 3UPRA 1P7QA 5DJZB 4NWUL 1BP3B 2AK4B 5D1XB 3SDYH 4HH8A 3PL6C 3EFFB 2HJLB 3FL7A 4TRPH 3AXLA 3KNBB 1D5IL 4GKNA 3MXVH 5DD1H 4N0UB 3F7YB 2P24A 1TZIB 5IVXB 4Z7UA 4EOWH 3O6FC 4JFZL 4ZUTB 4W4OC 4WWKB 3SEPA 4LDEB 1T7VA 4J3TA 2ZCHL 3S6CA 3K0WA 2D7MA 2AGJH 4JJHA 1NEUA 3H9HA 3W0WD 1L6XA 3TPUA 4P2OC 2ZZUT 4NNXB 1T2JA 5DHYB 3B6SB 1T7WA 1S7WA 3KPSD 3LD8C 2VDNH 5IB1B 4JQIL 4IIQA 5LBSH 1MCQA 3TIEB 2KKQA 2FBJL 5IVZA 5FYJD 1V3JA 2IF7A 5EOTB 3MODH 4PRBB 4GAFB 4JRXD 4KRLB 4YHKL 2ZNWA 3N1FC 3SGJC 4M1CC 3QXAA 1OWWA 2VKXA 1BFSA 1NGYA 1MCIA 3BP7B 4LPCA 1Q38A 2ZSVB 3LVEA 3P2TA 1AP2A 2YA1A 4PJAE 2VLKB 2A83A 4GXVL 5LCVH 1UCTA 1PG7H 3BUTA 1A5FH 3L3GA 1LO2L 3QFJE 4LMQE 1JGLL 2EDRA 2FATL 2NY6D 4KGJA 2FJHA 2WBKA 2VAAB 3NPSB 4Z18A 3VD5A 1NFIA 4F7EA 4NYLB 1QFWL 4U1SA 4LCCB 2QLVB 5D2LE 5J9PA 3L9RA 2VLRA 2XZCH 1A1NB 2GSGB 4X6DF 2ZNXA 5F1IA 3FT3B 2X7LA 4EJ1C 4LLDA 2QQKH 4DVRL 1J87A 3DOSA 5JIHA 2DYPD 3AM8C 3UXFA 1X9QA 4WCYH 4JZJA 1XR8B 4P2RD 5L8LB 1RI8A 3P4NA 5TPWH 3NCJL 2NTSP 5TF0A 5IEKB 4N0YH 1RD6A 4TSAH 3SO3C 3L3OA 3BXNB 1G6RL 1FL3A 3W9EB 4OFVA 3O6FD 3VFRA 4LSSL 4Q6IA 3QBTB 4WI7A 5D7JA 4IRSC 1JYXA 1ADQL 2QADC 2EC8A 3LEYH 4JFPB 3MJ7B 1ZLVK 1ED3B 2IEPA 2GJ6A 3MACH 4JANB 3TBYA 3QPXL 4HD9A 4D3CL 5HI5C 5ADPL 1UYWH 1IM3B 5CJQH 1RJLA 5EDXA 1LEIB 3UTTB 4KRPD 2VXTH 4UIMB 2E7HA 2BNRA 5TE7L 1TTGA 2DD8H 1TNMA 1AY1H 4RMVA 4Y2DC 5DQDH 5JOPD 1I9RL 1RZ7L 4PRIB 3WSQH 5BZDA 1RZKH 4N8CH 4M1CD 3DXAD 5JR1L 5D7IE 1JYWA 3QIUA 4O00A 4HC1L 4BKLB 5ESQA 1FVDB 4R6UA