3TBTA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (v3p, y4s)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
275
structure length
263
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPRSEVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 64
structure length 263
sequence length 275
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbtA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbtA01
3WDJA 4DQOL 1A7NL 3ULVL 2HFGH 1RVFL 3V52H 5IJKA 5F88B 4QWWC 2R2HA 2Q8BH 5DMKB 4K8RL 4NT6A 2WANA 2CIIA 1II4E 4YC2B 1GIGH 4Z7OE 4RGOH 3ULUL 2G5BA 5IBTL 1R3KA 4OLXH 4PIRF 3VI4E 3WIIL 4K9EL 5JPMA 2P8MA 4MAYC 4O4YH 2L7UA 4LOUD 5GSRB 5D6CB 1MCRA 5DHXB 2DYPA 3ZLQC 4EN3A 4NCDA 1KIUA 4B5EA 1GCFA 3UTTD 2AJXH 5DHYA 2J4WL 4FG6C 3C5ZC 5LQBH 3CXHJ 3EOAB 5FA4B 2YPKB 3PQYA 2BSTA 4P9HH 3ALPA 3O4LD 3MLRL 3PV6A 4YDIL 5CJ8A 2P44B 2PNDA 5CUSH 1FV1A 2VAJA 5GRZA 3SOBL 1LO4L 1NC2B 1SY6L 3V4PH 1I7ZA 4KROB 1NLBL 3ARFB 3TP4A 3WFBH 4ACPA 1BWWA 1RURL 2OM5A 3FFDB 2IAMD 2AQ2A 4U1MA 2Q6WB 4XP9L 3U9UB 1N26A 1OB1B 3V6OE 4MD4B 3RPIB 4FTVE 2F53B 4HUWB 4F15C 4L4JA 1CLYH 3DXAD 5JNYA 2ZG3A 2F8VA 1X5FA 3BD5A 4X6FA 1TCMA 3OXSB 4D9RD 3B9KA 2A9NH 1S7QB 5C0CA 5D6DC 4KKAC 2VQUA 4DZBB 2J88H 3F6LA 5DDHA 1JYXA 2ADIB 4LPVA 1U8HA 4OCWH 1T4KA 2IGFL 1P84J 1B0WA 2PR4H 4M7LL 3E6FB 4GAJL 4XPAL 4BSVA 5K9QG 5KSAB 2VLRD 1IILE 4YHZH 3KPLA 3L5JA 3KPTA 3VXNB 1F11B 2CXGA 3DX8A 5IW6B 3W5MA 5GSVB 3KLDA 4TSAH 5BQ7B 3TJHA 5TF1L 3UTZB 2D7NA 1MJ7H 1U58A 1WUNT 3HNTH 1A6WH 4RISL 1YJDC 4X98A 5D1XD 2ESVB 4FQPA 2JCCA 4DZ8A 3LKSB 4H0GA 1JGVL 12E8H 3EYVA 4HIEB 4XNXL 4JVUA 3NAAL 7CGTA 4WGVB 4L4TA 3BP5B 4AH2B 1R3LB 4PJXB 1QSFB 1URLA 1JPSL 1Z0MA 4XVTL 3SGDH 4UU9A 4UOW0 4AEIL 4NQDE 1DJSA 2AJUH 2A9ML 1MH5B 4LLDA 4HMEA 5E9DE 4OZ4B 3VWKC 3BEVB 1IGTB 4L8SC 5DVKA 5DC4B 1GC1H 4CVWA 4BZ2L 2D4FA 4M4RA 4ZTPL 1LEKB 3CIQA 4XTRD 4GAYA 1TQBB 1QQDB 4I0PB 5I2IB 4X6CF 4DKEH 1FNGB 4M6MH 4NCC1 3ZDXE 1F4XH 4CNIB 1BAFH 4JZJB 1OAXH 4NNYA 1DVFA 3OL2A 5I1KL 5MENB 5IKCB 2FNBA 4L8BB 4QXUL 3TBVA 5F88A 5LKNA 1R3IH 4H20H 4NIKB 15C8L 3FONA 3D39E 5DMKA 5BZWB 5BVJB 2Y6SC 2N1KA 4YHML 4LARH 2R8SL 5FV1L 4PJ7E 4LSPL 1ULVA 1OLLA 4FA8A 1X5XA 3K8MA 3QXWA 3BKCH 2WBJD 2BX5A 4OTXH 3OG4B 5GSRA 1OAQH 5D6CA 1ZV5A 4NP4H 5KVMC 4P5KB 1YEJL 1K3IA 4QHUB 5I76B 2XZZA 5FOJA 3GJFK 3WBDA 4HH8A 5DRZB 2YBRB 4P9ML 1I3UA 3EOAA 4XXCC 5FA4A 3SDAD 4HKJB 2YPKA 2QQQA 1BJ1J 1UB6B 4KI5C 4PYGA 2E5EA 4W68A 1ADQH 5I15L 3D2UB 4UINL 1MF2H 4ZUSB 5FM5O 3KPMB 1NC2A 4MJ4A 2HWZH 3VFGL 5FHBH 1C5DB 1CFQB 3IFNH 5ALCH 3ARFA 3TT1H 3QHZL 3FFDA 1PW3A 1JWSB 1MWAB 2Q6WA 3U9UA 4YHKL 1OB1A 4Y4HD 1A6UL 4MD4A 5FFLA 4K3JH 1B90A 4GRLB 3RPIA 2VITB 4OZIB 2WNGA 2F53A 4HUWA 2F5BL 4BELD 4LDOB 4MNGE 4PJCB 5SWZE 1P4BL 3OXSA 1S7QA 1MRFL 3OB8A 3VXSD 4DZBA 2ZUTA 1UM5L 4NFDA 2ADIA 1OY3B 4GH7B 1ZVSB 1DLFL 5KSAA 3E6FA 4HWEH 1BQLL 4DGYL 3TYFB 4U3HA 3HC4H 2CDGA 3VXNA 5IW6A 1HN1A 4NN6B 2K9UA 4NWUL 5GSVA 3Q6GH 1AY1H 1CLZL 5BQ7A 1JRHL 1A1MB 5D7IB 3IS0X 1YEIH 1U92B 5ID0B 4TPRH 2ATKB 4QCIB 2ESVA 3LKSA 1HXYB 5DYOB 3PF2A 5I18L 5ENWB 2GY5A 4RMSA 4HIEA 3LB6C 1S7RB 4C58B 4Y2DC 2DKUA 4AH2A 1R3LA 2DM4A 2NY0D 2APXA 2QTEA 3F5WB 1QSFA 3QT2A 4PJXA 3UYRL 4JRXD 2K7QA 1X4ZA 2XNAB 1MH5A 4OZ4A 3GJFH 3BEVA 1IGTA 4XP1H 4XMKH 3WO4C 4MJ2A 2VLJB 1AP2B 1LEKA 1JGLL 2J6EH 1RZJL 4QTIL 1QQDA 4I0PA 3QUYD 5J7CC 5I2IA 1BOYA 1IGJB 5EZLB 3SCMD 1FNGA 4P57B 4WWID 4CNIA 4JZJA 4O2EB 3T2QA 4OGYL 5MENA 5IKCA 1JZ7A 1KCKA 5F96L 1INDL 5M95B 3EUUA 4M03A 1WK0A 4L8BA 2BDNL 1JWUB 1IGIL 3MZGB 1FL3B 4EQ2A 5KVDH 4PJIE 4LCWD 5JTWA 4K3DH 4Z7QE 5BZWA 3GHEH 2PYFB 4KRLB 5BVJA 1X6NA 4Q58C 1SYVB 3DJ9A 1DL7H 1Q94B 4MS8D 2WWMD 4MCZB 5DS8B 3SDCD 4WO4D 5F7HA 1F58H 1SM3H 5M7QA 3CFIC 5HYQB 4ETQB 4P5KA 4QHUA 5I76A 3H7LA 2WIMA 1EA9C 5DRZA 3I9GH 4ELMF 4IHOB 5D5MF 3RTQD 2YBRA 3NFPB 1GHFH 3OKMA 1PG7W 4GLRH 4HKJA 1DLHB 3DYMA 3HI1B 1NCTA 3IAPA 4LRIA 4TTGA 4UV4L 3WHE1 5J0BA 4X9GA 3FFCB 1ND0B 2O5YH 3IT8D 3D2UA 4ZS6D 4HKZB 3W2DH 1K8DB 5DO2C 5DA0B 4I3GA 4ZUSA 3O11B 5DVMA 4LHUD 4RBPH 2X9YA 1C5DA 1I9RH 1CFQA 3JWDH 3C6LB 4JEGB 1JWSA 5CJOL 4D3CH 1MWAA 1NFIB 4U05A 5EOQL 3VI3F 1FP5A 1LWRA 4ODBD 2YK1H 1IGFL 4EN3C 1JPGB 4OZFH 4MB4A 4GRLA 5T1KB 2VITA 4OZIA 5IBUG 3L6FB 1FZOB 4PJCA 2AXFB 1JMXA 3PP3K 1Z9OA 2HVKB 2XZCL 3TA3C 5DR5H 3OF6A 3NCCB 5AYQA 5D2LA 3THMH 2CSPA 2FGWL 1JNHB 4S1SH 3RIFK 5IFAL 1ZVSA 1WFUA 4M5ZL 2EH7H 3EDFA 4C56D 4U6HB 1CXLA 2LU7A 3VGAC 1ZT4B 5IROA 3HI5H 4GQ9L 3TYFA 4IEFB 3QUXD 3DI2B 4WHYH 2AABL 4KTYA 5E4EC 1ZA3A 5EU3B 3LQZB 1A1MA 3T4AB 5D7IA 4K7PH 2HLFD 2Y06L 5ID0A 3TM6A 3QDJD 4PJDE 2HFEA 2ATKA 1I1FB 4Y19A 4QCIA 3REWB 1HXYA 3SQOH 5DYOA 5GHWH 2NY7L 5ENWA 5B4MC 3QFDB 2EIBA 2XFXB 2DWDB 4NN7C 3STLB 4WW2B 3WUWG 1YEHL 3SO3B 5JUEH 2I60H 3SGDI 1J12A 1FSKB 3VMNA 2FX9L 2XNAA 2IBZX 4FZ8H 3KG5A 2LU3A 5E8DH 2HFFB 5J11C 3MXVH 1IFHL 2VLJA 1AP2A 3NCFB 4FQXB 3P30H 4HAFA 4NM4L 4V3EB 1IGJA 2FD6L 5EZLA 2X4TB 2W38A 4P57A 5E4IA 4O2EA 1EO5A 2IPTL 2PW1B 2VWEC 1NLDL 3LHPL 4J4PA 4ESKA 5HYIA 2EECA 3SGKA 2C1OB 4MHHG 2V5MA 2DLGA 1FL3A 3CZFB 3MYZA 1AQKL 3BKJH 2IEPA 2PYFA 3MBXL 2ADGB 1Q94A 4MCZA 4ZPVB 5I0ZA 2HLAB 1ZEAL 5DS8A 5EFIB 4E9LA 2DQCL 4G8GD 4LL9A 3RGVD 3K2UL 5TDNB 1NC4B 5HYQA 1BQSA 25C8H 1Q1JH 4U3CA 1T7YA 3MLUH 3QULB 4ETQA 1XGTB 3B9EA 4OKDA 2XWJB 3ZHKA 4AEFA 4HH9B 3ZE1E 3RVTC 3OPZL 3MC0A 4X4MA 4IHOA 2KUTA 3NFPA 2YXFA 3T1FB 1DVFC 1DLHA 2HN7B 3HI1A 1S9KC 4N5EC 2DMCA 1NGZB 1A3LH 1WEJH 3W9EB 2V7NB 3FFCA 4HKZA 1K8DA 3HG1D 1J8HA 1NCDL 2AK4B 2OS7A 4JFPB 2AQ3A 3ARDC 4P5TB 1NAMB 1EFQA 4OFIA 1MCWW 3LKOB 3C6LA 4YC2C 3MNVB 5IT2H 4NRXA 2DQHH 3WFEL 3U4BH 1NFIA 5GGSY 4MX7B 3KGRA 1MJ8H 4Y4FC 2F54D 3MACH 1JPGA 1HYSC 4U49A 5FXCH 5T1KA 1IT9H 2W91A 3CPLB 5I73B 1K3ZA 3L6FA 1FZOA 4M1CD 1UWEH 5H37G 2AXFA 1E6OL 2HVKA 4JLRB 2X9XA 4XPGL 4M43H 1DN2A 1TFHA 3LIZH 1LNUB 4OD2B 5ALBH 3TN0C 1JNHA 1I1AB 3RWGB 4MXVF 1B3JA 5DD1L 4U6HA 2EIZB 1ZT4A 3BJ91 3RBGA 5ITFB 4KROC 3ARFC 3DARA 5LBSH 2H1PL 5EU3A 3LQZA 3T4AA 2IANE 1YEEH 3S97C 3PP4L 4JG1L 1L7TL 4OI8A 4G6ML 4NO0D 1Z3GL 1P53A 4BUGA 1I1FA 3REWA 4KTEH 1NFKA 3QFDA 2XFXA 3BGMB 2DWDA 3Q0HA 4GW1A 5I8EB 3STLA 3VWJC 4WW2A 2V5SA 3QWRD 1CGTA 4I0KA 1R6VA 3RDTB 5CIPA 5IBLC 3MLVH 4F58L 3T2NL 3QZWB 4OQTA 4RIRB 3QIBD 3BN9C 5FGCB 5KSAC 1MCNA 2HFFA 1IKNC 3KHOA 5LCVH 1HHJB 3QEHB 3KS0J 2DDQL 4TVPH 4FQXA 2WQ8A 5CEXB 3JV4B 3T0WA 4G42B 5DHVH 4DKAA 3BD4A 2X4TA 4U6YB 3KAAA 1RZFL 4ZD3L 2DS4A 2PW1A 5CEZH 4QXWA 4PJFF 3ZKSD 3KPSD 3ZKMC 4NQDB 1B2WL 1NFDB 3RVVC 5ADOL 2C1OA 5FCUH 1J5OL 4DTGL 5E9DB 1MPAH 1LO2H 1VENA 3CZFA 1TENA 4GAGL 4NHCH 3P2TA 5DQDL 2ADGA 3HNSL 5FM5M 1T22B 4ZPVA 5T5NG 2HLAA 5D2NC 4PJHF 5EFIA 5I8KH 3C08L 2V17L 5HVGB 1IEBB 2DQTL 3C8KB 3V95A 4CVUA 2CXKA 3VGDA 1TQBC 4U6VH 1FO0L 3QULA 4WGWB 5IV2B 3CNKA 1MLCB 2A0LC 2XWJA 5GJSH 4HH9A 3X3GL 1MIEH 4JZJC 4KZDH 3QHTC 1A3RH 3T1FA 2YEZB 2HN7A 5GS2D 1NGZA 3QI9B 3W9EA 3JWOL 2V7NA 4TVPD 3BT2L 4PJ7B 3WDIA 2BVPA 5C08D 2BXYA 1UKSA 3HB3D 1K8IB 3MCKB 1UM6H 4JFPA 1CCZA 3U48A 3BD3A 1AKJB 3BE1H 1NAMA 1GGIL 1Q9LB 3LKOA 2LU4A 1XT5A 1FFNB 3GKWH 4UIKL 5EC2B 4FFZH 2R1XB 1WAAE 1EXUB 4MX7A 1UXWB 1CIUA 3MBED 4JRYE 4E42B 3CPLA 3S36H 1IL1A 3WFCH 3QUMB 1CF8H 1N6QL 4JLRA 5EO0B 4HCRH 4O5LL 1VFBA 1OTSC 1LNUA 4OD2A 4LRIC 3OAZH 1I1AA 3EFFB 3RWGA 2Z4QB 2Y1VA 2FL5A 5C9KA 1TCRB 1TVHB 2EIZA 1G9NC 1PG7X 1WSST 5ITFA 5K9KA 4S2SB 2GK0A 4DEPC 4XAKD 4RAHA 5JIPA 4YXKH 2W0KA 2WSKA 4FABL 4KC3B 4JHZA 3UO1L 4MNGB 4GRWB 5DRXB 3EJJX 1UCBH 1T0MB 2FB4L 4OSUH 5GRUL 3BPOB 4GRLC 3V4VH 5DK0B 2FATH 3BGMA 4YJZL 4UBDD 5I8EA 1WZKA 1MCJA 2QSQA 3RDTA 1KEGL 1G84A 4YE4L 4NRZB 4P3WA 3QZWA 4RIRA 1WBXB 1I3RB 3BSZL 4QHNB 1CQKA 1I9IL 3FT3B 2BVTA 5IROC 5EORH 1HHJA 3QEHA 4YGAB 3DV6B 1U8MB 1RZ8B 3MGAA 4I5BB 4NN6C 3JV4A 5HTSA 4G42A 5AG8A 2E8ZA 3ARYA 2BP3A 4PP2B 4U6YA 1FGVH 3ARPA 1U8QB 4KJPC 4X80L 2JIXB 5DJCB 1UACL 4Q9CA 1JPTH 4UILH 4XBGB 3SBWA 4NQDA 1NFDA 5HPOA 3E6HA 3F7VB 5E9DA 3LOWA 5H94A 3RNKB 1J88A 3WIHH 3AROA 2FECL 3OAUH 1T22A 3R1GL 3LY6A 5HYJD 2EDFA 4E0RB 1A0QL 5IJVB 3MSPA 1IEBA 3C8KA 1DBMH 4QLRA 1LDSA 3LEYH 1KCUL 2PW2B 4KQ4H 5IV2A 4P2RE 1F4WH 4HGMA 5LWYL 1MLCA 4CUCA 2YRZA 4PJIB 4PJBB 4HPOH 5TPWL 4BZ1L 2YEZA 1DBJH 2V9QA 1YEKH 1HH9B 3OJ2C 3SGKC 1YNKL 2VXVH 4PJ7A 4PLKC 4YHYB 1K8IA 3FO2B 3MCKA 3ARBB 35C8H 5T3XH 4HPYL 1JZ8A 1AKJA 2XTLA 3HMWL 1Q9LA 4WTXA 1JZ3A 3WNPA 4YFDB 1KFAL 3GHBL 3QAZB 4PLNC 1G9MH 1JZ2A 4PJ8D 1A7PH 5IOPB 1FFNA 4LAQH 4YK4C 4RWYH 2CDEB 5EC2A 3PWPD 2R1XA 1EXUA 2D3VA 2NY3C 2WBKA 1CD0A 5E2WL 4YBQC 5KSBE 4E42A 4S1DD 3QO0B 4FTVD 4YHOL 3QUMA 2QHRL 3SDXF 4FXKB 1QTYT 5JW3H 3NABH 3HAEG 3EFFA 4Q9RL 4DGVL 2VXUL 1HHGB 3MRRB 2Z4QA 3ARRA 2NW3B 3U36B 5HI4C 1FCGA 1TVHA 4DFIA 4NQED 5B3JE 3OJMB 1ZWIB 3B6SB 3QDHA 4S2SA 3V4UL 3X11A 4C59B 1EMTL 5CHNB 3C6LC 4HG4J 3MV01 2C3HA 5JORB 1U8OB 4HUXB 5IVXE 5F70A 3UCRA 3HZYB 2GUOB 4MNGA 4L8CB 1A47A 5DRXA 2R4RH 1OQXA 1T0MA 1QSEB 1JI2A 3GMQB 1OD9A 3C5SB 5DK0A 2MFNA 1TTUA 5JXEA 4L4VB 5AZEH 3AMKA 3MGTB 5GZND 4S10A 5KAQF 5E2VH 4NRZA 3BRDA 1WBXA 1I3RA 4QHNA 1QRKA 5BS0D 3GFUA 3FT3A 4H0HB 4OZHF 4LCUB 4YFEA 5D70L 1HH6B 1OHQA 1U8MA 1RZ8A 4PJDB 4R4FL 1JWMB 2VXSL 1QBMH 4I5BA 3NCYS 2X9WA 5KJRL 2Q7NA 2YPLE 4PP2A 4MQ7B 3GSNB 1KEMH 2GSIB 1S5IL 2JIXA 5DJCA 4HV8B 4XBGA 4HULB 1S7WB 2DTMH 1MNUH 1XAUA 4QF1B 2DLFL 1DE4B 3G6DL 3QG6B 4OCRH 6FABL 3EYUH 4FFVD 2ICCA 1AHWC 5GS0C 1U3HD 2P42B 4WW2C 3RNKA 3SO3C 1MCQA 3WFDL 3D39D 2IPKB 4OD1H 4F37F 4GSDL 4E0RA 5IJVA 3G6JF 3GRWA 3DNKA 2OLDA 2FGZA 2R0KH 1WZ1H 4PB0L 5IB1B 2PW2A 5TE7H 1UWGH 3K46A 5FECB 1BFTA 1MJUH 4WV1C 4MDJB 1IZJA 5ECJE 3LH2L 2P5EE 1TPXB 5MEOB 3NFNA 5DD5H 4ODVH 4IRJB 2ARWA 5GISH 4PJIA 5C70A 5GGVY 1WV7T 4GRMB 3NFSH 3GI9L 1HH9A 5CEZE 4NUGH 3ULVF 4X9FA 3W0WE 4OQ1A 4QRUB 4EEEA 5FHAL 5JHLH 3AY4A 3FO2A 3ARBA 4JY6B 3PHSA 4JKMA 3O0RL 3F7QA 1I3VA 4PD4K 5FYJD 4MZ2A 3GB7B 4QEGA 4PPTA 1FVDB 1YYMH 5IOPA 2CDEA 1EO8L 1C5CL 1TJGL 4U1SB 5JXAH 1E6JH 4OLWL 1JF6A 4KAQH 2EKJA 4OCYL 1LGVA 2VDLL 2CMRH 3RWHB 4XC3H 1DEDA 1WT5C 1OAYH 2D7QA 2CKBB 2R29H 5SWZD 3DIFB 3MLTB 3W11D 5E1AB 1HKLH 4FXKA 4DW2L 3UZEA 4IDJH 3M45A 1HHGA 5FGBA 3TFKD 3MRRA 2XQBL 2NW3A 3U36A 4Z7VE 5IM7B 3S9DB 4OLEA 5E6IA 4DFHA 3X12B 4NN5B 4QRTA 4P5TC 4YDJB 1ZWIA 4Q9BA 5JQHC 2YHGA 3B6SA 3DSFH 5CHNA 5ANME 5GRJH 4MJ6B 5JORA 1U8OA 4HUXA 2OR9H 3PWJB 4U31A 4POYA 3HZYA 3SE9L 2GUOA 3VE0B 1HWGB 4L8CA 4P49A 4IOFD 4FQLH 3K1DA 1NCWL 4P2QE 4K3EL 3C5SA 4OLYH 4WWKB 3BEWA 4WFFE 2IWGA 4JY4B 4M9PA 4L4VA 4J3VA 5GS1B 4AMKL 3OTTA 3MGTA 4JKPL 4MA7H 1I1AC 2EEBA 1REIA 1WWCA 4UTBH 5ITBL 2IANB 3IU4H 4LCUA 4Q74A 1BZ7B 1ODAA 1UJTA 2GK2A 1HH6A 4M9OA 3H7BB 2FIKB 4PJDA 1JWMA 3H9YA 1OSPH 4JDZB 4LSQH 2VN7A 4QRRD 3FO0H 3PGFL 3QUZC 2R39A 1TTGA 1JI1A 1A6TB 4MQ7A 4U0QB 1QLRB 3GSNA 2NTSP 5F1KC 2GSIA 1LDPH 5DJ0B 4HV8A 2FJFB 4LCIL 1S7WA 2AJSH 2HKFL 5HHMB 1E28B 3QDGB 4PRNB 5C0FA 4QF1A 1C8PA 1DE4A 3QG6A 3T0ED 1OW0A 2HRPH 3RDTC 3VD4A 3X17A 4J3TA 1NBVH 2BERA 3QCTL 4KUZH 4N5UA 5E00B 2IPKA 2NY5H 5HD8C 4YDLC 2FR4B 4Y5VB 2E9BA 2VLKD 5EO9B 4Z7NE 2KBGA 4PRHB 4R2GB 4G6KH 4L1DA 5IB1A 3HNVL 1ZAGA 2CK0L 1RHFA 1J10A 1VCAA 3WHE0 3MRPB 4MDJA 3CLEL 3UTPE 1D5IL 2QQNL 5MEOA 3MTRA 3CSBA 4BFGA 4K94L 5DUPL 3BH8B 4IRJA 3NPSC 5BVPH 4GRMA 1OLZA 1U93B 4L5FL 4MLIA 1BHGA 3MRMB 5TDOB 1D9KC 3LEVH 1OAZH 4TNVF 4ZODA 4EDWL 4QRUA 4GS7C 1MCFA 4WNQB 5EWIL 1MFNA 2WWKT 1CGWA 3O2DL 5C09D 3ETBF 3GJFB 4JY6A 4CRPA 5HI5C 4N0FB 4OZGF 1T2JA 2MQ0A 4LLUB 3GB7A 2ZG1A 2NTFB 1FVDA 2VDMH 1W0YT 1U41A 5C07E 4F3FB 4HS8L 1BD2D 1R5WB 3KLAA 4U1SA 4KZEH 2XIDA 2W0LA 3GBMH 5J57B 2BVOB 5J89A 1U8NB 4JO2H 1IBGL 1YECH 4KRNA 1RJZB 4ODSH 3IFLL 2CKBA 1HKFA 2Z35B 5EZIH 3DIFA 3MLTA 2AJZB 3PV7A 3O8XD 3T65B 3BZ4B 5E1AA 3TZVC 3KJ6L 3RVXC 3QI9C 4OCXH 1TJIH 1AGFB 5JW5B 3SGEH 1LQVA 5IM7A 4I9WE 3UYPA 5CD3A 3X12A 3BX7C 3ZTJH 1OPGH 4YDJA 4EIZC 4F33A 1T0NB 4UNTA 1KJ2H 4JRYB 4MJ6A 5T3XE 4M3KB 3SY0B 3PWJA 2XG4A 3VE0A 5I8OL 1SVCP 1N6UA 1QFWH 4J3WA 3DTXB 3P3YA 2VDOH 1BWMA 2CUMA 4WWKA 3MXWL 4JY4A 5GS1A 3TCLB 3HFML 4HUMB 1CN4A 2LVCA 5TGBB 5EU5A 4OB5L 2F74B 1J1PH 2OJEB 4MNHB 4HWBL 3E8UL 1G1YA 4JZOB 3B5HA 4Z0BL 2OI9B 1B4JH 2VXTH 3FO1B 4NBXB 1A2YB 5CSBA 2IANA 1RZ7H 1CQYA 1DQLH 4R97B 2C9AA 1BZ7A 4UI2A 3H7BA 2FIKA 2F19L 5GRYA 2R1YB 4JDZA 4AIOA 4CN1A 2A77L 4WUUD 4LF3B 3V6ZB 3MRQB 1KNOA 4PJAF 3QCVL 1FFOA 1A6TA 1ZLVK 2J5LC 3GO1H 1QLRA 3MLYL 4OZFB 1T7VA 4Q0XH 4QHLB 4LHUG 5EU7E 1U42A 5HYFA 2FX8H 3BPOC 1T21B 5DJ0A 2FJFA 1G1CA 2VABB 4WEUD 5KVGL 5HHMA 1E28A 3QDGA 4ODWB 4PRNA 5JXEC 1J05B 2VZ3A 3C5JB 5E00A 1DQJB 2BJMH 2EC8A 1KIQB 2FR4A 1UJ3C 4Y5VA 1F42A 1CXHA 4P4KD 4PRHA 4KK6D 2DIBA 3LN5B 1C7SA 1P6AB 5KVFH 4MGXA 5AWNL 3PNWB 3ARWA 3MRPA 3CMOH 4ONHB 3RZWA 2Y23A 3BH8A 3A6CH 3J7HA 1H3GA 1U93A 5H35B 2P46B 3MRMA 5TDOA 1UZ6F 1A14H 2ZPKH 3CXHK 4Y5XB 1RULL 4LGRB 4B7IA 1OOAA 5ESQB 1LE5B 1AO7B 1XIWD 3EDEA 4WNQA 1EGJH 3PABA 3GJFA 4JY5H 4N0FA 5C3TA 5DSCB 2X70B 4P2RB 4LLUA 2H41A 3FO9B 3NZHH 2NTFA 3U46B 2J6EA 4QHMB 2PF6A 3PHOB 2X1PA 1OARH 1PBYA 4F3FA 1R5WA 3QPQD 2BVOA 3MZTA 1U8NA 5F3BB 1CFTB 3QEUB 5JQ6L 1T03L 1FAIH 5F6HJ 1RJZA 1M7DB 1NMAL 5D8JL 2BMKB 2WUBL 3AMLA 2Z35A 2AJZA 3BZ4A 4LOUC 4KQ3H 4F2MB 4Y5YC 2YKLL 2APFA 1AGFA 1ZE3C 5JW5A 3RA7H 2APTA 3B2VH 3IYLW 3NCMA 1OTTC 4YHYC 1KN2L 3LQAL 5IVOA 4WCYH 1PDKA 2BNRE 3N85L 4GXVH 4TSBL 4N0RA 1ZHNB 1P84K 1T0NA 4FQHB 5IMMB 5IGXL 3QAZC 5KSBB 4WW1B 4JRYA 3SY0A 4ZS7L 4NFCA 4NKMB 1A1OB 3QEGH 4X99B 3N50A 1FNSH 2BFVH 5DUBB 3DTXA 4JHWH 3LPWA 1AJ7L 2GEEA 4G7YL 2DBLL 1GAFL 5IQ7L 3MA9H 2C4FU 2B1HL 3TCLA 5KG9B 1A64A 4OCSL 5AZ2L 5T5FH 5TGBA 2F74A 2OJEA 5E8NB 1LO0L 4MNHA 1RIVL 3VU2A 1WFNA 4JZOA 3QG7L 2OI9A 5JIHA 3FO1A 1S8DB 1A2YA 4MAUL 3MRFB 4JFQB 1CLOH 1P7QD 3EZ8A 5IVXB 1NKOA 1RY7B 4U2YA 2C5DC 1K6QL 4F37K 2R1YA 1P9MA 4ODUB 4KHXH 4LF3A 3V6ZA 5ILTL 4OZFA 3NTCL 4FFYL 1T21A 3MR9B 2F5AL 2VABA 3P11H 4EI5D 4UIMB 1GYAA 3F58H 4ODWA 1TNNA 1KOAA 4P9HC 3C2AH 1K5NB 5FM8A 4UT6H 1J05A 3C5JA 1M05B 3DVFA 2VAAB 4G6AD 2RFXB 1NCAH 1DQJA 3NCJL 2VMFA 1ZLSH 3OKYA 2V2WB 2NX5D 1NAKH 4L8DB 2Y5TA 3G08B 1KGCD 5L7XL 4KKBC 3R4DA 3LN5A 4LNRA 2IPUK 1QFUL 1T1WA 1T80A 3PNWA 4LBEB 3ZL4L 4MQTB 3UAJD 1MFAH 4ONHA 1QBAA 4L9LC 3RZCD 3ZE0E 4DWHA 4OJFL 2VLLB 3CLFL 4PGCA 5H35A 4MMZC 4ODHH 1NGQL 1CU4H 4HT1L 5DMGC 4Y5XA 4ONGH 2DKSA 4GBXD 1OVZA 1T04B 3LS5L 4K3GA 5ESQA 1LE5A 1AR1D 1SJHB 1RMFL 5DJYB 1HEZA 1FFRA 4EIGB 4JFZH 3BRGC 5DSCA 2X70A 4P2RA 5K93A 5LAXB 2CIKB 2LABA 2Y07L 3FO9A 1AFVH 3U46A 1JGDB 2P5EB 2VDRL 3PHOA 4QHMA 3RQ3A 4F7MB 5C71A 5DHVB 1TETH 5GJTL 1KCVH 1CFTA 3QEUA 5F3BA 4JCLA 2JK5B 4JGUA 4B50A 1M7DA 1ZTXL 5C7XH 5C0JB 3W0WB 4IRJC 2BMKA 1CR9L 1FHGA 4M7KL 1RUQH 3HCVB 2WBJC 3IS1X 4CW1B 4F2MA 1A1NB 1YJDH 4EOWH 1MCOL 1WCQA 2B20A 5ETUB 3CFJB 3B9VA 3S35H 1W72A 3TEUA 1GC1C 1ZHNA 1X5JA 4FQHA 5IMMA 3GMMB 3QNZB 5KSBA 4WW1A 4H8WL 3I85A 5J8OA 2Y25A 1A1OA 4X99A 1G7JB 3CMGA 4KI1A 5DUBA 4DQOH 1A7NH 1RVFH 4PJFE 2XRAL 4MNQD 2EXWD 3ECBB 4N0CA 2FH6A 5HVHC 5DUML 3QPXL 2GHWB 2XV6B 4DK6A 4Z7VB 5KG9A 4K8RH 5E8NA 4IMLB 4Y4HC 4FQQA 4PJGE 4EXPX 3ULUH 1S8DA 5I6XB 2APBA 5IBTH 3MRFA 4JFQA 5I16A 3WIIH 1CZ8L 4K9EH 3QQNA 2QSVA 3KPQB 5IVXA 4R7NB 4FQ1H 3I02B 3D1MC 4PBWD 4NN5C 5T3ZD 4KK8C 4P2QB 4IRSA 5FOBB 2J4WH 4ODUA 1GRWA 1KN4H 4OUUB 2HT4C 3RWIB 4JFED 5T1LD 1NGWB 3C9NB 4HDIB 3MLRH 4UAOC 1BQUA 3MR9A 1F13A 2Z8RA 4UIMA 3F8UB 1RUKL 5GS1C 1K5NA 3UDWA 3SOBH 1BIIB 3AAZB 1YNLL 3VFVB 4Q6IB 1M05A 1NJ9B 2G75B 2P5WE 1HXMB 1NLBH 2VAAA 2RFXA 1JNNH 4EJ1C 4OGAD 1NUFA 5CP7B 2HTLD 4HIJB 3ULVD 2V2WA 4XP9H 4X4ZA 4L8DA 3QHFL 3G08A 1WF5A 4QXGL 3V7AE 2YUVA 4LFHD 2DF3A 2Z31D 3IDXL 4TUKL 1AR2A 4LBEA 4X5LA 4J8RB 2P49B 1MQKH 3M8OL 2AEIT 4H5SB 5FM4A 3P73B 2EZ0C 2E9WA 1CG9B 2IGFH 2NY4B 4X4YB 3NCYP 4XPAH 4ZFOB 1T04A 1UQSB 3SE8L 4WHCA 3SCMC 3TT3L 4WEBH 1SJHA 5DJYA 3LKQA 4ZOEA 4FQCL 5LAXA 3IGAB 1LVEA 2CIKA 4R90H 1YQ2A 4Y5VC 4HUKB 1JGDA 2P5EA 3QYCA 4F7MA 5DHVA 2LAGB 4R2GC 1JGVH 3MUY1 3WN5B 4XNXH 3H2WA 4BJLA 1FE8L 4MS8C 1AGDB 2JK5A 2BY0A 1KELH 5C0JA 4XVTH 3SDCC 1JPSH 3W0WA 4WO4C 2AJVL 1EEQA 4AEIH 3HCVA 4NSKB 1DVFB 1VDGA 1FDLL 2A9MH 4CW1A 1A1NA 3N1MC 1NCUA 3JV6B 4Z7UF 2CQVA 2XXMB 3ARQA 2PXYD 4WI6A 4BZ2H 3B5TA 3D3VD 2W9LA 5ETUA 3CFJA 4ZTPH 5F93C 1MI5E 4EXKA 4P46A 2PCPA 1HYRC 3RVWC 5C07B 1SBBA 1UB5B 4WFED 3VW3L 3GMMA 3QNZA 2XYCA 2Y36L 3INUL 1MIML 4ODTL 1G7JA 5I1KH 1MLBB 1PQZB 3QIWD 3L3HB 4TRPL 1FORH 1SJXA 1G7QB 4U4BA 3U79A 4QXUH 4G9FE 3ECBA 4IRSD 3DMMB 5H8DA 4GW5B 1DP0A 4Z7VA 2F9BT 5HHOE 5L2JB 4YHMH 4IMLA 2R8SH 4LSPH 3MNZB 5GGRB 3SGJA 1EIBA 4MLSA 4XAWH 3KPQA 4WFGE 3HE6B 4R7NA 3I02A 3QFJD 5B38B 3P0YL 1PKOA 1YEJH 3LCYA 4P2QA 5FOBA 4NJ9L 2XZQL 4OUUA 3U4EB 1H8NA 1UT9A 2YPLD 3RWIA 5BS0B 5EO1A 1NGWA 2XA8L 3C9NA 3O3DB 1C7TA 4HDIA 5B8CB 3GBNL 3QUXC 1RK1B 3O9WD 4X7TB 2P43B 5AUMB 4UINH 4HCRA 5F6IC 1H5BB 8CGTA 3TV3L 4HK3N 2FO1A 4FFEX 1BIIA 3AAZA 2HLFC 3C60D 4Q6IA 3AS1A 2J8UF 1NJ9A 2G75A 1HXMA 1JZ6A 2MWCA 2HT3D 3QHZH 2OI9C 4LLWB 1KCGC 5CP7A 4D9QE 4HIJA 3MOBL 2ED9A 2CKNA 3RKPA 2WUCL 5I1JL 4R97C 1A6UH 3BZDA 3BYTA 3JWDC 3X3FL 4WI7A 5SV4A 3L95B 4GAFB 1P9MC 2BHYA 2F5BH 4CDHA 3MLZL 1CE1L 1P4BH 3SKJL 4J8RA 4RFNB 1HQ4B 1CE6B 1MRFH 4H5SA 4JDTL 4JR9L 2XQYG 3VXUD 3H42L 5C8JB 1UM5H 4HFUH 3QZWG 2W1NA 1DLFH 1MEXL 1CG9A 2QLVB 4X4YA 4OM0L 1QD0A 4ZFOA 4AG4L 1R5IB 1UQSA 5H2BA 4DGYH 4TNWF 2YOCA 4GUPB 1GPOL 1QNZL 4Y4KD 3TGXA 2EDDA 1CLZH 3O6LL 1JRHH 3ZDYE 5F9JB 4PG2C 3IGAA 4EDXB 4TSCL 3KYAA 5CGTA 4JM2D 4RFOL 3I2CH 3OJDB 3R8BB 1RZIB 5I18H 1JL8A 3EYOB 2HG5B 3VCLB 3WN5A 2WM0A 5EBMB 5INCB 1ONQA 1OTUD 1AGDA 5DJZB 3HLAB 5D1ZA 2UYLB 5C6TL 4NSKA 2CH8A 1JIBA 3OR6B 2VRAA 3QIUB 2R2BB 4PRIE 2R4SL 3JV6A 4G5ZH 1MHCB 4Y5XC 1BGXL 5I66B 3WIHA 4U1LB 3HUJF 5KZCD 2XA3A 1RZJH 4QTIH 5C07A 2A1WL 1UB5A 1F4YL 5MERB 2BNQE 1E0OB 2OTUB 4YFLI 4NRYB 1KBGL 4OGYH 4XNUL 3EO9L 1PQZA 5F96H 3L3HA 1INDH 1IAKB 3QCUL 2ICWB 5I1GH 3DMMA 1D5XB 4YX2L 3AM8C 4GW5A 3SDDD 2C3WA 4QOKE 5A2JH 3MYJB 3NA9L 5L2JA 4KXZI 4YHLH 2BNRB 3S37L 2AEPL 4I48A 5D7SL 1HDMB 5GGRA 5KW9H 4BQ9A 1X5HA 2ADFL 4M1CC 3HE6A 5B38A 2H2PD 1FNAA 4JFDD 3KHQA 3PL6D 5DFWH 5MEQB 5DFVC 3NZ8B 4X0KB 5A1AA 3U4EA 2V9TA 3O3DA 2NR6C 2BSSB 2YMXH 5B8CA 4PRPD 4UV4H 1RK1A 4Q6YA 2V2XB 4X7TA 5FEBA 5AUMA 4R96B 4X9IA 4M93B 5E2TL 1CL7L 1H5BA 3VDBA 3EYSL 2VH5L 5I0DA 4JDVB 3K8KA 1BBDH 1BIHA 4LLWA 2DJ4A 3QDAA 4OFYD 5CJOH 5C0GB 3FMGL 5EOQH 4F57H 4J2XA 3ULUE 1PVHA 5C9JB 2EE3A 4OQTL 1EAPB 3T3ME 1KXQE 4LP4A 4WTWA 1J1OH 3EYFB 3O6MH 2XZCH 1IJ9A 4FQJH 1HQ4A 5F7NC 1CE6A 2FGWH 4U6XB 5IFAH 3CSYB 4M5ZH 1QFOA 5T5NF 4LPWA 4TTDD 1RU9L 5HHVL 3UDWC 2E7MA 1R5IA 2UZYB 4GQ9H 5CP3H 4OGXH 5D1ZD 3HE7A 4GUPA 3MV8D 3WXVL 5F9JA 2Y06H 3C8DA 4EDXA 5DGQA 4V3DB 2YZ8A 4OM1L 4KI5E 3OJDA 3UZVB 1RZIA 4CADB 1M1SA 5E5MB 3DETD 1AQDB 3EYOA 2HG5A 3VCLA 5EBMA 5INCA 1I7RB 3S98A 5K9OB 1ZHLB 4FNLL 4GKZB 5DJZA 3HLAA 4YXHL 4MVBA 1VEOA 4QRQB 1MVFA 2UYLA 2OYPA 4LPTA 4G8FB 5IB3B 3OR6A 3MJ8B 3QIUA 2R2BA 1BD2B 1CLCA 1T7WA 1MHCA 4TYUA 5F7FA 4JANA 5I1DB 1A6ZB 5I66A 1UM4L 4U1LA 5HBBA 4NM4H 2Z91B 2FD6H 3HZMB 5MERA 4JQVA 1MCIA 2OTUA 2O93L 4NRYA 3H6JA 2IPTH 2AV7B 4KKLD 1NLDH 1IC7H 3GM0A 1N5YL 3HB3C 3LHPH 2R56L 1IAKA 2C3XA 5MHSD 2ICWA 4X4XB 2DMBA 1XGYL 1LO3H 1AQKH 4X7FC 4E41D 5BRZE 5HDBF 5JHDD 3MBXH 4RMUA 2Q20A 3IDNB 3MYJA 5BW7A 2CDFB 3ILPB 2VUYA 2BNRA 5IEKB 1ZEAH 5D7LE 3MBEC 3OGCA 2DQCH 1HDMA 4ZXBB 4RAUA 4EUPG 3TO4D 2DQDL 4H1LG 5E99L 3WYRA 4PJFB 5BOPA 2LAAA 4XP5L 5MEQA 3HI6L 1AE6H 4M02A 2D0GA 3NZ8A 1EBPA 2VDNL 3OPZH 5DJ2B 4NHUE 1MFEH 4OLUL 2BSSA 2FEEL 4PJGB 2V2XA 3WHXA 4R96A 1MAML 4JQIL 4PJHB 1NCDH 4B7LA 3QDME 1I75A 2LE9A 4JDVA 3V0VB 4PJ5D 3G5VB 2UWEF 4I1NB 3WFEH 3L5HA 5C0GA 1NANH 5ICXB 2EYSB 3DUHA 4NQVB 1U95A 1C08B 1FZMA 3TVMB 1IC4L 4N1EA 1EAPA 5FO8B 3BQUB 1XGRB 3WNLA 4ELKB 2VN4A 4NFBA 4XVSL 1E6OH 3EYFA 5I17B 4A6YL 4AIZB 4U6XA 2P5WB 3BKYH 1IM9D 5DD1H 4N0YL 2RIKA 3CSYA 3HPLB 4M6NL 4NZJA 3JTTB 3TNMB 4HZAA 3O2VL 4Q6IC 3PWUB 1HINH 2IH3B 2ZJSL 2H1PH 4G59A 1MHEB 1JRHI 3PP4H 3ARGB 4B41A 1L7TH 2MHAB 1BP3B 1SJEB 4G6MH 1Z3GH 5I30L 3HC0B 1T2XA 2E7LE 2IH1B 4L3ED 1DUYB 2X4QB 4NOBA 4RA3A 4CADA 2NY2D 5E5MA 1G0YR 1Q9OB 4HUNB 5K9OA 1GGYA 1I7RA 1F6LL 3ARTA 3U9PH 1ZHLA 2NXYD 4LMQE 4GKZA 1XCTB 2NXZD 2E6PA 2NY1D 2PTUA 3M1BB 4LPUA 5F7YC 1JTOA 4F58H 5CKGA 3T2NH 2R9HD 1X7QB 4G8FA 5IB3A 3MJ8A 4YPJA 3VD3A 3NIGF 1ORQB 1QP1A 4W6YB 5I1DA 1A6ZA 3I6GB 2LVEA 5LXGH 3IDYB 4O58H 5TJWK 5LVEA 2DDQH 4XC1L 4U2ZA 2V5TA 4XPBL 3LD8B 1EFXB 3FB5B 2Z91A 3MGOB 3HZMA 5CJ5A 1RZFH 5D93C 4ZD3H 1AXTH 2AV7A 4HG4K 1NCCL 3VXRD 3WN5C 4NNPL 1B2WH 5ADOH 1T83C 4FQIH 2EYRB 4DTGH 3GMLB 4NO5B 3KR3L 1QRNB 2F8XC 4BM7A 4GAGH 3HZKB 1VEPA 2UVFA 3IDNA 1MI5B 5AAMA 3HNSH 2CDFA 3NN8B 3ILPA 1FAKT 5IEKA 1T5XB 3AXLB 2ZUWA 4ZXBA 3RGHA 2V17H 2DQTH 1J9CT 4HQQH 4LAJH 5FDYA 3VXMD 3T77B 1FO0H 3IU3B 2X4PB 4LU5H 2KZWA 4PJFA 3QNXA 3X3GH 2BNUB 1I7UB 1MCWM 3SJVB 5DJ2A 3U7WL 1QKZL 2ITCB 5ISZE 5C2BL 5HHOB 1KC5L 3UTSD 1UZ6E 3DMMC 5BO1L 4PJGA 3MO1B 3H9ZA 1QACA 3V0VA 1GGIH 3N1QC 1RIHH 3G5VA 4OBRA 4X6DF 4NO2B 2YD5A 1FC1A 3KWWB 4TNWK 5K59E 3PG2A 3ULSB 1VFAB 4UIKH 2FBJL 2JCCE 2EYSA 2VWEE 5ICXA 4NQVA 4ZPTB 1C08A 3SKNB 5GZNC 1G9MC 3CFEB 3BQUA 3QWQB 1XGRA 5C0NC 4N8CL 4ELKA 5K9QI 2QV2A 1DFBL 1ZXQA 3QXVA 5I17A 1N6QH 3NIFE 4MXQD 3EJYC 4AIZA 2C26A 5DJ6B 1DUZA 4K7PY 5B8CC 4LIQH 5GS3A 3AREB 2P5WA 2D31B 3W81A 3RWJB 4XHJD 1MSPA 1H5BC 5I75C 4R4NC 3KNBB 3JTTA 1MCLA 3TNMA 4DAGL 3UBXB 3PWUA 3B9AA 4KDTC 2IH3A 3PDGA 4Y7MA 5FYKD 1RUAL 3UO1H 4DJMA 3ARGA 1BQHB 5F72S 2MHAA 1E4JA 1INEL 1NMBL 1SJEA 3IRPX 4JKWA 4WI2A 2MQCA 3HC0A 4FFVC 1U3HC 2FB4H 2IH1A 5GRUH 2HFTA 1DUYA 2X4QA 5EU7C 1YPZF 4CVZB 1O0VA 3TWCL 1Q9OA 4WEMB 5EZJB 3GRWL 1VGEL 1XCTA 4RFNC 3S37X 1KUMA 3M1BA 4Z9KB 1HSAB 1KEGH 4PB9L 1X7QA 4ZAKD 1ROWA 3OKDB 3VRLE 3BSZH 3K74B 2D7MA 1EPFA 3LQMA 1C1EL 4X6BB 1ORQA 3I6GA 2FHFA 3S3PA 3K0WA 2ZCLL 2HAZA 5I1IH 1RFDL 1OAKH 1EFXA 3BMWA 3FB5A 5GRVK 1ZANL 3MGOA 4DK3A 4JFFD 3SEPA 5IHUL 4X80H 4UTAL 1UACH 1Q8MA 4M7LT 2EYRA 1JUFB 4YWGL 3GMLA 4NO5A 4MVBC 3BI9X 1QRNA 2W9DL 3MUGB 1JMZA 1U36A 3HZKA 4F7CB 4OZHB 1MI5A 2RBLA 5CLTA 2Z8WC 3NN8A 3R1GH 1J86A 5DA4A 5DK2B 1T5XA 3AXLA 1A0QH 1NPUA 2HFGL 2BNQB 5CGYD 5DQJB 3F7YB 5BV7L 4MQXD 1KCUH 2J3SA 3T77A 2UZIH 3IU3A 4NZUL 2X4PA 1ZVHA 3KPRB 5LWYH 2DQIH 2HTKD 4PBVC 4QRPD 5DURD 2BNUA 2L7JA 3MA7B 3ZHDA 4G9FA 1BJMA 5JMRA 1I7UA 4HK0B 4EKXA 5DXWA 1I3GL 1D5BA 3SJVA 1GIGL 4BZ1H 4F7PB 2ITCA 4QOKB 4HSQA 2VXQH 4P2OD 5HHOA 3VDCA 2AEQH 3O3AA 4NGHH 1U2HA 1PY9A 4O4YL 1Q9KA 1YNKH 1DQML 4UNUA 1C16B 1JNLH 4FP8L 5FDWB 3LV3B 3MO1A 4TVSa 2W92A 3BJLA 2AJXL 5BXFB 2GTWB 1EEYB 4HPYH 1KLGB 5HSFA 3HMWH 5LQBL 1A9EA 3MOQA 1UKQA 2BZDA 2JJSC 4PTTB 1KFAH 3GHBH 4NO2A 2FWOB 3KWWA 3ULSA 1VFAA 2BY1A 2BVQB 1XEDA 4TUOB 3SKNA 4W4NA 1S7XB 1CK0L 1I9EA 2ICWJ 2E8YA 3CFEA 2FO4B 1ACZA 2QJDA 3V4PL 1QPXA 2YD8A 5LGHL 4YHOH 3WFBL 2XY1A 2QHRH 1A6VL 3DVNB 1RQ5A 2BSRB 5DJ6A 1CD9B 1WITA 5ADPL 3BH9B 3AREA 4XVUD 4Q9RH 5D2NE 2VXUH 2D31A 4JG0L 3U30B 3RWJA 3IVKB 2N7BA 3K8LA 3OAYK 5D7JD 1O5DT 1Z9MA 3GSNL 3K3QA 4M93C 1J0JA 2DI7A 3KNBA 5CMAB 4OFKA 2VSDA 3UBXA 3E3QA 3V4UH 3MRCB 2K7PA 1EMTH 3H9SD 2ICES 4MQSB 4NZRL 2A9NL 4N9OB 2H9GB 1BQHA 4QHKI 3BHBB 4P23D 3FTGA 2IG2L 4OCWL 2PR4L 3O6FD 5I9QB 4CVZA 4YHZL 3CU1A 2D7TL 5EZJA 5EU6D 3PHQB 1X5KA 4WU5B 2VSCA 4TSAL 3DVGB 4MAYA 5HYEA 1G7IB 1HSAA 4PTUB 4D0BB 1BECA 1N7ML 2OQJB 3KPOB 3HHRB 4X6BA 1AC6A 1JHTB 2YC1B 5D70H 4R4FH 2VXSH 3P4MB 4XHQA 3QB7C 4IM8A 4NQCE 4I4WA 1YN6B 1X5GA 1N0LA 1F3JB 3T3PF 5AEAA 3S4SB 5GGUB 1S5IH 2O61B 1KJ3L 2DQEL 5E95B 4POUB 3SKMB 3P77B 1S9VB 1JUFA 2DLFH 4PRIA 3BDXA 4KVNL 2G60L 3FT2B 4ZTOH 3WDHA 3Q48A 2YA1A 6FABH 2HVJB 4G9FD 3MUGA 2IF7A 4PGBB 3WFDH 4DKEL 5C0BE 3L3JB 4LSTH 1BAFL 2V7HB 3EO0B 5GIRB 3MV9E 4Y1AD 4Y16D 4GSDH 2CKBL 4JM4H 2MSPA 2X89A 4RGND 2BNQA 4WY7H 5DQJA 3F7YA 4PB0H 2NY5C 3O8XC 3KPRA 5CEYA 1QUNA 3OAYH 3MA7A 4RMTA 5SWSE 4HK0A 4PD4J 1YYLL 1BREA 5SV3A 4YR6B 2DMKA 3MJ9L 4F7PA 5BRZB 1WGOA 3CJJA 4QOKA 3GI9H 4AEHL 4OTXL 5D7LB 4ZQKB 2HP4A 1C16A 4JFHE 1XZ0B 3LV3A 2JELL 1T5WB 5E8OB 5GGTL 4EBQH 5BXFA 2BHUA 3FZUD 4R0LB 4AY0A 4ZYKB 2GTWA 1EEYA 5C3LD 4KK5D 5L0QC 4PTTA 1XF1A 4LLMB 4ZXBC 1CDYA 1KTDB 2FWOA 2VDPL 3A6BL 3I3BA 1UEYA 1EO8H 1A7QL 4D2NA 2BVQA 1U3YA 1TJGH 4TUOA 4OLWH 4AM0B 1S7XA 4LVEA 3J8F7 4NHUB 4OCYH 1MF2L 4OF0A 3N1FC 2OZ4H 2FO4A 4JPKL 2HWZL 2QSTA 3IFNL 1A7OH 1ZA6B 2VZSA 3QEQB 4QNPF 3TH2T 3U4AA 1B0GB 3WO4B 5CFHA 2YPVL 3DVNA 4MXWL 2BSRA 5BMFL 4DW2H 3QDMB 3BH9A 2XKUA 3JZ7A 3MV7E 2XQBH 3IVKA 5D9SB 1MRDL 3VGEA 5EA0H 2I24N 5EB9A 5CMAA 1KG0B 1NDGB 4JAMB 4U3XA 4MAYD 3CDYA 5E0QA 1QA9B 3MRCA 4IDLA 2M2DA 3LN4A 1BFSA 2H9GA 1YA5A 2DQFB 3BHBA 4FG6D 3C5ZD 4I18C 4PJXF 3TVMC 1NCWH 4K3EH 3BQUC 1UXSB 3L1OL 4KJWC 4P99A 4NOFA 3DX6A 3HC4L 4I77L 3PHQA 4AMKH 4WU5A 1U3JA 3DHMA 1EVUA 2ITDB 1NUDA 4K71B 3DVGA 3NACL 4YPGB 1G7IA 4JKPH 3VG9B 4PTUA 4LLVB 3V2AR 5M94B 4KK6C 1IE5A 3DOSA 4LIQE 2AV1B 2MKLC 4PRID 1JHTA 1H3PH 3DRTB 3HN3A 2YC1A 3RHWF 3OBAA 1N59B 4IOSD 5LGJB 3QWOA 3P4MA 5DJDA 3RNQB 3V0WL 3PGFH 3RUGF 4MHHI 1LILA 4PYHA 3ARGC 1F3JA 3X13B 3S4SA 4XCFL 5GGUA 2O61A 2R69L 4LCIH 1S78C 4DUWA 4NWTH 3SKMA 1WZLA 2HKFH 3P77A 5FUCE 2EDLA 1S9VA 2NCMA 2J6EL 4OFVA 3FT2A 2HVJA 1QLEH 4PGBA 4ALAL 1CIDA 2E27H 3QCTH 3L3JA 1P4IH 2A2QT 2V7HA 2GQHA 3EO0A 5GIRA 5I1LB 1YMMD 3ILQD 3IDYC 3TA3B 5J1TC 4AZ8A 3HNVH 3OB0H 3LD8C 1E4WH 5GGRY 3CLEH 3GHEL 4FOMA 3ZYIA 1D5IH 2QQNH 1V3KA 3WD5L 2XN9D 2FRGP 4K94H 2OCFD 5DUPH 1I1YB 4L5FH 1A9BB 4YR6A 1MVUB 2O5ZH 5BRZA 3CVHL 4D94A 3ARVA 3DO7B 5D7LA 4ZQKA 3VWKD 4EDWH 1XZ0A 1T5WA 5E8OA 5EWIH 3HRPA 1OP9A 1RZGB 3QQ4B 3O2DH 1SBSL 3TBYB 4YDKL 5IK3A 2E9IA 5ESAB 3VFTA 4LLMA 5L2KE 4OZIF 1FCCA 4PJCF 2B1AL 2NY6D 5B22A 4N8PA 2H2SC 4AM0A 5D2LF 5ISZB 4NHUA 1EAJA 1CXKA 1I9RL 3IF1B 3IFLH 1ZA6A 1UA6L 3QEQA 1B0GA 1Q0YL 1BVLB 3KJ6H 3QDMA 4WTZA 4LPYA 2Y6SD 5JA8B 3EYQD 1H3UA 3CX2A 5D9SA 3GKZA 5D7IF 5EOTB 1RZKL 3N0PB 3HUJE 1KG0A 4ODXB 5EUOE 1NDGA 4JAMA 3KXFD 2DQGL 1NSNL 4V1DE 1QA9A 2DQJH 4YZFF 1DR9A 3THML 3TPUE 4JFOA 3D0VB 4EI5C 1CICB 5I8OH 4AT6B 4BQCA 2QQKH 2DQFA 2NW2B 1ZT7B 3IAGC 1N64L 5IQ9B 1UXSA 1Y18B 4G6AC 5EOCL 3MXWH 5MP6L 5DT1H 1BMGA 1UZ8B 4NZTH 3HFMH 1A3QA 4OB5H 2ITDA 4LKXB 4YPGA 3D85D 1OF2A 5TDPB 1UVQB 4HWBH 3E8UH 2GJ6E 1F97A 3AREC 1KTRL 2APVA 4JN1H 4LLVA 2PYED 2CRMA 4Z0BH 5I71B 4ZUUB 4AIXA 4X5WA 2ZUUA 1RI8A 4CBPA 2W0FB 2AV1A 3LRSB 3I6KB 3AB0B 3DRTA 4KDVA 1GL4B 3UAJC 3CFCL 1AGBA 4LHQB 1N59A 5LGJA 3E3QC 2F19H 2E7LA 3B83A 3RNQA 5CZKA 3DGGA 4M1DH 5IFJB 1JVKA 2VL5B 5JUEL 3QCVH 3QP3A 2BY3A 1NDMB 3FKUS 4TN9A 3MLYH 3X13A 1MHPH 1U8LB 2M1KA 1AR1C 3ARDB 4NKIL 4MJID 4C54A 1V7ML 3P30L 4M7JL 1W0VB 2AK4E 3VMOA 2ZUQC 3CD4A 4MCYB 2R0LH 5DF0A 4Y4FB 5IESL 4XPTL 3MODL 2HRLA 4Y88A 4LQFL 4F7EB 1X5YA 5BOZG 5C92A 5I1LA 4PS4L 3R06B 2ZUYA 3TA3A 2BCKB 5T1DL 5DVOA 1KCSL 5AWNH 3TN0B 1GZPB 1CFNB 1PSKL 3LB6D 4LSUL 3PJSB 5EH1A 4Y2DD 1W72L 3I75B 2X1XR 1A9BA 1JF1B 1MVUA 1YEFL 5DZLA 1FC2D 3NIDF 2X41A 5HGGS 3TYGH 1RULH 3DO7A 4GG6E 1MAKA 1RZGA 3QQ4A 2CLRB 2Y4SA 3TBYA 5ESAA 4K2UL 3I84A 3QRGL 2EXWC 1DQQB 1P6FA 5C0RH 4N9GB 5HGBB 2E9JA 2MOVA 2VR5A 3VWJB 1WEJL 3PWNB 4YHIB 3IJYB 4HJ0C 5ISZA 2VUOA 5JQ6H 1KENL 3IKKA 5C0AD 3RBSA 3UMTA 1NMAH 4M61B 5EIVA 5D8JH 5C2UB 3WKMH 3IF1A 4HD9A 2WUBH 5ERWB 1BVLA 2DQHL 1TZGL 1FYTE 2EH8L 3VGGA 3SPVB 1EUTA 5FGCE 1V5JA 3WEXB 1MJ8L 3MACL 3LQAH 3RKDC 2X5PA 2C1PA 4IIQB 5B38G 4ODXA 3JV5A 1U8KB 4TSBH 3PWVB 2M8XA 5HPMB 5IGXH 3GBLA 4BQ6A 1S3KL 1V7NL 2ICEB 4ZS7H 3D0VA 1CICA 4AT6A 1CT8A 3H3PL 2NW2A 2RCSH 1MCSA 1ZT7A 1AJ7H 3AVEA 1NFDE 5IQ9A 4U6TA 4HIHB 4DGIL 4G7YH 2DBLH 1GAFH 2MJWA 3OKEB 5IQ7H 5D2NB 2E7CA 5LBSL 1UZ8A 2HTLC 3ULVC 3E0GA 4HC1A 5AZ2H 5DO2D 4LKXA 5HDBE 1LO0H 1UVQA 1RIVH 1YEEL 4JHAH 3QG7H 5DZNA 3V5DA 2B4CL 4ZUUA 3U30C 1OGAB 4K8RC 2W0FA 1YY9D 3LRSA 4ZDHB 3I6KA 2X4NB 1F6AA 1GGTA 2H32B 1K6QH 1HCFX 1L9MA 3ULUC 2DYPD 4K9EC 4EN3D 5CZVH 5IFJA 4N5EA 2VL5A 2OP4L 1A8JH 4JN2B 4J6RH 3PQYD 4P59L 5I9QC 2F5AH 3ARDA 4PJ9B 1G7HB 5F9AC 2KZ1B 4Z77B 2YA2A 2QKIB 5F1NB 1W0VA 1G7PB 3S88L 2VISB 2IADB 2QQLL 4MCYA 4RMWA 1G6RH 4Y4FA 3CFDB 3NCJH 4BZYA 5CP3A 4F7EA 4NQCB 4N90E 4U33A 3G6AB 5CEZL 1TIUA 2ZKHH 5L7XH 2BCKA 4GMTH 4U1KB 3TN0A 3DURB 1GZPA 2VZTA 5I1CL 3ZL4H 4HBQA 1CFNA 5DGRA 5B4MD 4YHPB 5E1HB 2BSED 3PJSA 3NPZB 5D71H 4PUBL 5FYLD 2Z8VC 3W39B 1PLGL 2PXYC 3I75A 3VI4F 3B9KD 3CLFH 1JF1A 1ITBB 6CGTA 5C0BB 5C0CD 3D9AL 3F12B 4DEPB 1YNTB 1NGQH 5B3NA 8FABB 1K4DB 4HW6A 4OIAA 1BJ8A 4XWOC 5I74C 3LS5H 3MV9B 1EDQA 2F15A 2W9EH 4KHTL 1I9JL 1RMFH 4OD3L 2CLRA 5TFSL 3FQWB 3QIWC 1T0PB 4G6FB 3VFRB 5GGQH 3NGBC 2Y07H 3TJHD 4GRWE 3ZDZE 1DQQA 2VDRH 4N9GA 5HGBA 5SWSB 3GSXB 3O45B 4XPFL 3VWJA 1ITCA 5DLML 1LK2B 32C2B 3PWNA 5GJTH 4Q9QL 4YHIA 3IJYA 2OK0H 5JW4R 2Z92B 3S34L 1ZTXH 4M61A 1WBYB 4L4TD 1IKNA 1CR9H 4X8XA 4M7KH 5E7BA 5ERWA 4JZNB 3VDAA 3ROLB 4O02L 1VESA 1F11A 4R26L 3ROOB 3SPVA 2RQ8A 3BFOA 1MCOH 4OLZL 3UTZA 3WEXA 3IFPB 4UDTB 4ZMAT 1EJ6A 4LGPB 4DN4L 5DMYA 3UPRB 3A67L 4LKCB 3L3OB 4R0LC 3ZKXB 1S9XB 4NJAL 4FZEL 1U8KA 3PWVA 4RBPK 5HPMA 1CF8L 1W8OA 1BEYL 3RHWK 1LD9B 4HCRL 2ICEA 1J0YA 3BP5A 3O9WC 1FO0B 4KY1H 4LSRL 3RVTD 4HEPG 3SQBA 1ZGLP 2UVEA 3VD9A 5IEHB 4HKXB 1DVFD 2HYMA 2XRAH 1TLKA 2RGSA 1L8JA 5JW4Q 4HIHA 3EFDH 2HT3C 5HGHB 5DC9B 3OKEA 3MV7B 5D2NA 1OT1A 1BFVL 2N56A 1MCPL 1GH7A 4YXKL 1KPVB 4O9HL 3X14B 1EVTC 4KH2A 1QR1B 4EZMA 2HJLB 1CZ8H 1X5LA 4OSUL 1PG7L 5EU4B 4ZDHA 2X4NA 2H32A 2FATL 5CCKL 2GY7B 3LN9A 4W81A 5DZOA 3Q5OA 3IDMB 4XVJL 1HYSD 3I50L 5DJXB 2L0DA 3MMEB 2ILLA 4PJBE 1LE9B 4JN2A 2NYYC 1CVRA 1W0WB 4OBSA 4PJ9A 1MFDL 4R6UA 4WJ5B 3P9MB 4Y4KC 2AGJL 1EERB 1G7HA 2R15A 3UTTE 4Z77A 3MREB 2QKIA 5F1NA 4NPYB 3SKOB 1G7PA 1YNLH 3CK0L 4K71C 4YK4B 5KOVC 5HYSG 4KRPB 3ZDXF 2VISA 1NC2D 3VG9C 2IADA 2NY3B 3O4LE 3FN9A 3CFDA 4KROD 3ARFD 2CO6B 4X6DE 4NQCA 3G6AA 3FAXA 1QO3B 4HJGB 3QHFH 2CPCA 2E7LC 1UB6A 3UEZA 1NGYB 4U1KA 3IDXH 3DURA 3TC9A 2F53D 4WUKH 4J7RA 3OAUL 4PJ7F 3W39A 3P40A 3M8OH 1HHKB 3KPMA 4G3YH 5C0BA 2IC2A 3F12A 4S0SD 5IBLD 1QVOB 1YNTA 8FABA 1K4DA 3K4AA 3DXAE 3LEYL 1GGCL 3IXAB 3WS6C 3MV9A 4KQ4L 5KSAD 1I8MB 2XKNB 3TT3H 3OX8B 4D9RE 2E3VA 2E6JA 3FQWA 4Z76B 3IFOB 4FQCH 1N3NB 3VFRA 1JFQH 3RI5F 1XCQB 1F6FB 5CILL 4DKFH 1YEKL 3V6BR 2VLRE 5SWSA 1UH4A 3GSXA 3O45A 1QSEE 4C4KT 5E24E 2MNUA 1LK2A 32C2A 2ESVD 1YPZE 3IDUA 4HBCH 1FE8H 2Z92A 3Q2CA 3ZKMD 4L4VE 4LLAA 3RVVD 4BH7B 1QBBA 4CKVX 1WBYA 4YIQB 5F7EL 5I1HL 2AJVH 4HS6B 3FCTB 3GMOB 1QSFD 3ROLA 1FDLH 2CRYA 2H2PC 5F7UA 1WZMA 3ROOA 1LP9E 2ZCKL 2EDJA 5L2KB 1U92A 3IFPA 4UDTA 2XTJB 1F90L 1FZJB 4LKCA 3L3OA 3UPRA 1CFSB 2CJUL 1S9XA 3IKCB 3BGFB 3VW3H 3MV11 4I0PD 1LD9A 3D87B 1S7RA 3INUH 2A0LD 1N8ZB 1RZJC 2JB5L 1MIMH 1AHWB 1FO0A 2EE6A 4ODTH 4XNYL 2GITB 3F5WA 5F7LB 2FIRT 5IEHA 4HKXA 2JJTA 5MEND 2Y7QB 5HGHA 2BC4B 3MV7A 4E5XB 4WRLA 9CGTA 1SJVA 3HMXL 1KPVA 3X14A 2EE2A 3U83A 3WSQL 3HUJB 4HWZB 1QFHA 5EUOB 4MD5B 1QR1A 2HJLA 4APQB 4V1DB 4WV1B 5EU4A 3TPUB 3ZTJG 4RX4A 4ERSH 3T8XB 2DIJA 2PO6B 3HR5B 1RSFA 5AZEL 2KDGA 3IDMA 4NJ9H 2XZQH 5DJXA 4LSVH 1BOGB 1CICC 1JWUA 2FCBA 3MMEA 3LVEA 1EEUA 1MCKA 1LE9A 2XA8H 3TBSB 1W0WA 3NBNA 4X9BA 2R23B 1D6VH 3GBNH 1SYVA 2WMPA 2GJ6B 1OTSD 4WJ5A 3B8SA 3P9MA 4KKCD 4O2CB 1DSFL 3MREA 3TV3H 4NPYA 3D2UD 2VQTA 3IJHB 4YEFA 4JO4H 4QY8B 2A83B 5I71C 3V7AG 3TNNB 3DETC 1Q38A 3DYOA 3WE6B 4HJGA 1QO3A 2WUCH 5I1JH 3AB0C 3Q3GB 1MNUL 4KDWA 1EX0A 3X3FH 1NGPH 4NBZB 4EI6B 4PJIF 4OCRL 3EYUL 3HS0B 4Z7QF 1JGUL 1NGYA 3MLZH 4GRLD 1CE1H 3WXWL 1ND0A 1G7MB 1A4KB 3O11A 1HHKA 4JDTH 1BLNB 3OF6D 5GZOC 3U0PB 2XKSA 1QVOA 1MEXH 1WZ1L 4OM0H 4AG4H 3IXAA 2CGRL 4DVBB 3UJIH 1UWGL 1I8MA 2XKNA 3OX8A 1GPOH 5CKAA 1KACB 4GT7A 3AS0A 5F44A 4KKLC 5DD5L 3O6LH 2A6KB 3VXSE 4ODVL 4Z76A 3IFOA 3W82A 3TCXA 3ESUF 1A5FL 2WLZA 1XCQA 4TSCH 5J06A 5ACLA 2JE8A 2EIDA 3MRDB 2WZPD 5JW4N 3WV0A 4KJPD 1L6XA 2VDKH 4Y19D 1UH3A 1F3RB 3N1GC 4ZFGL 3VXOB 3O6KH 3CH1B 4BH7A 4N1HB 4GG6B 4YIQA 3MRNB 5E8PB 4HS6A 5C6TH 3FCTA 3GMOA 3TO4C 4X7SH 5J1SC 5EG6C 4PRDB 3OG6B 5BCAA 2R4SH 3QUZB 5EBWB 1BGXH 5L8KB 2MQ3A 5L2KA 4ZUWB 4NQTA 1FZJA 3ZKND 2YN5A 5JLZB 3DSNA 1CFSA 1J18A 1PAMA 3IKCA 4Z8FL 2VLJD 3LKNB 2A1WH 4JRXE 5EN2B 2AKRB 4DVRH 1U9KA 3G5YB 1N8ZA 1AHWA 1S5HB 2GITA 3M17B 3EO9H 4XCEB 1B9ZA 3MRGB 2H6PB 5HHME 3QDGE 4RSVA 1FYTB 2Q8AL 4LCYB 5D96C 4J4PD 2Y7QA 2BC4A 3EOTH 5FA3B 4YX2H 4YDLB 4E5XA 2EEAA 5J4MA 1RJCA 5HVFB 1QOKA 5D1QB 3CXDL 5GS2H 3NA9H 4X7CC 5AYUL 3QA3B 1E4XI 2V9RA 3HUJA 4HWZA 5EUOA 1P2CB 2J12B 4MD5A 5ESVB 3SDYL 2AEPH 5D7SH 4APQA 3OAZK 4V1DA 4WV1A 1YUHB 3FAWA 3VGBA 3ES6B 2ADFH 3VG0L 3TPUA 4IIQC 4PRHE 1I85C 1R24B 4LCWE 3NPSB 4POZD 2PO6A 3HR5A 5IB5B 3ZHLA 5HDQL 1D9KB 4Z7WE 3LRHA 1D5ZB 1P4LB 1BOGA 4GXUM 1IC1A 1IM3B 4GS7B 3TBSA 5F9OH 1FG2B 2OL3L 5SX5H 3T04D 4UTBL 2R23A 1NMCB 4MA1C 3KYOB 2GJ6A 3IU4L 2HMIC 1WBZB 4O2CA 5EZOL 3VH8B 4WFHD 5E2TH 1CL7H 3FFCD 2BK8A 5TDNA 2VH5H 2GJZB 4QKXB 1B6UA 1NC4A 2KQMA 5HHQB 1J8HD 4AK1A 1OP5K 1EEZB 1XGTA 2A83A 3DUSB 5SX4I 4UZGA 2NY2C 1LDPL 3C6LD 3FMGH 4KVCH 3WE6A 1WT5A 2A6DB 3Q3GA 2NXYC 5CIPH 1JP5A 2NY1C 4OQTH 4BH8B 4EI6A 1PX4A 5FYKL 3HS0A 1CBVL 1IAIM 3TZVB 3C2SA 4JO3L 2R9HC 1F5WA 5T1KD 1PYWB 4HGKC 4S0TD 3BPCB 2DJUA 5E2JA 2OJZL 2IQ9L 5CBEB 2VB5A 5IFHH 2AK4A 1B4RA 1A4KA 1BLNA 4UOJA 4JPWH 2QADB 4PJ9C 4P5TA 1QHPA 3U0PA 3S36X 3MNVA 2UWEB 1IGCL 3RL1B 1U6AL 3ZE1F 2MPAL 1AGCB 2A6KA 3WXVH 2EO9A 5ID1B 2O5XL 3MLSL 1JYWA 2I27N 43CAB 3MUZ1 1WIOA 4C56E 4OM1H 3MRDA 4X7EC 2EO1A 2OMBA 5EUKB 4F80A 4HLZG 1F4AA 3VXOA 4YXHH 3CH1A 4GG6A 1I8LA 2WINB 2ORBL 1DN0B 3MRNA 3QDJE 5E8PA 3VA6A 5AD0B 3U0WL 5GS0D 4O51B 4KJQC 4PRDA 3T0DA 3QUZA 5EBWA 3KLSA 2LFGA 2EEDA 4ZUWA 1UM4H 2J5LB 3GBML 4K7FB 4CN4A 2X1QA 3S5LB 1N4XH 5JLZA 4HLJA 4ZOBA 5JOPD 3LKNA 1WLHA 4ODSL 5EN2A 2B8OT 2AKRA 4FQXD 1XGQB 3RUGE 2A73B 3UTOA 1DBBL 3G5YA 1HILB 1MCHA 3FOLB 2VC2L 2XOTA 1S5HA 4OCXL 5F71A 3M17A 3OR7B 4XCEA 1OP5H 3MRGA 4PY8I 2R56H 2H6PA 1FYTA 5A16B 5K9JL 1XGYH 5FA3A 1DQDH 1OPGL 3JTCA 4NM8H 1UJ3B 3QR2A 3T0BA 5D1QA 1IGML 3QA3A 1S7SB 5CEXA 1P2CA 5ESVA 1B0RB 3CAFA 1O7SA 1V3LA 1MCDA 5FV2A 1YUHA 1YEGL 3Q1SL 3ES6A 4KJYB 3LZFL 5EIIB 3ZKXC 1R24A 2DQDH 4GMSL 1FH5H 5E99H 5IB5A 3V6FB 1D9KA 3HI6H 2VDNH 1D5ZA 1P4LA 1I4FB 1PEWA 1KJMB 4G8GE 1IM3A 1Z2KA 4ENED 4X5XB 1FG2A 4OLUH 3SE4A 2OZ4A 4N8VG 2JJTC 3KYOA 5GPRA 1IQWL 1BBJB 1IAII 1WBZA 1MAMH 4JQIH 3OKOB 3VH8A 1AO7E 4PFEA 3ZE2E 2IPUG 2DLTA 1MCCA 2GJZA 3JWOC 5HHQA 2AK4D 5JZ7C 2R0ZL 1EEZA 3NCEB 3DUSA 2HT2C 2X4OB 5DMIL 1KB5L 5GRWA 1H8SA 2Z8SA 2V5YA 3HG1E 5CD5C 3IAQA 3ORJA 1IC4H 4G9DB 4BH8A 2X10A 3TZVA 4Y5YB 3QI9A 2YUZA 4ZAKC 1PYWA 3SO5A 3UTTB 4XX1E 3BPCA 4A6YH 2YD4A 3T1WA 3EHBD 4OF7A 1S9YB 2F54E 4TQEL 2A38A 5DRWB 4N0YH 3O4LB 1I1AD 1DBAL 4M6NH 1J0HA 5E94B 4X6DB 3RL1A 3U7YL 3O2VH 4OCNC 4KRPC 4P3CL 1UXWA 5C6WH 4S1RH 1AGCA 5FGSA 4YZFE 3QJFB 2EDXA 5ID1A 3A6CL 3LKPB 3QNYB 1EK3A 43CAA 5I30H 1IMHC 4PGZA 3MROB 2IAMB 3S4SG 3RJDA 5EO0A 2YD3A 5EUKA 1NUNB 5F7KC 5E03A 2GJJA 1OD7A 5FUCC 2FH8A 2UUDK 3E2HC 3DXAB 3VGHA 1TCRA 1T1ZB 1DN0A 4QGTA 5AD0A 2CR6A 3NA4A 4UB0L 5CGYC 3NZHL 1FNEB 4O51A 4MQXC 3RDTD 1WAAF 1OARL 4MMXC 3ZYJA 3CX5J 1Q0XL 5HD8D 2HTKC 1FLRL 5TQ2H 4K7FA 1IQDB 3S5LA 4XC1H 5J1AB 2VLRB 2D9QB 1FAIL 1KYOJ 4XPBH 3LS4L 2JJUA 1XGQA 1YPZB 2A73A 4Y2OA 3P4OB 3N9GL 1HILA 3FOLA 2D4DA 3GSOB 2DLEA 5C6PB 3RA7L 1NCCH 4DN3L 5D1XB 5A16A 4WCYL 1LP9B 4NQDD 3KR3H 5FIEA 4CGTA 1KXVC 5E9DD 2EDHA 3F62A 2WP3T 1INQB 1UJ3A 2X6MA 5HHXH 5FF6B 3DV6A 2GTZB 1N0XL 4KK9C 1B0RA 1P1ZB 3KPSE 1NQBA 4BFBD 1FNSL 5JIIA 2EYTB 3O2DA 4KJYA 2XTJC 2EC9T 1U8QA 1B6DA 5EIIA 4L9LB 4MSWB 1ZKAA 5FYJH 3BGFC 1YQVL 2BRRL 2R2HB 3V6FA 1J11A 4XVUC 3F7VA 1PX3A 1I4FA 4NT6B 1KJMA 1K85A 4M4PA 1SMAA 2P8LB 5D7JC 4G6JL 3U7WH 5EDXA 1QKZH 4X5XA 1R3KB 1P7HL 5C2BH 1KC5H 4WTZG 3TBWB 4NUJB 2P47B 4FFWD 3DI3B 2VYRE 1UGNA 3B43A 3EJZD 5DI8B 5DHYB 1CL7I 2VOTA 4P23C 2R0WL 1GVIA 1AKJD 1LEGB 5HI3C 4APQC 5I1EH 1JBJA 3OXRB 4LK4A 4HGWB 2UUDH 2X4OA 4TVPE 2MCG1 2FBJH 4GW4B 3P11L 5C08E 3OZ9L 2X09A 4PJBA 1FVEB 2FEDC 3F7RA 4G9DA 2WBJB 4YFLF 2PO6C 3TH4T 1OM3L 4UT6L 3S3SA 4Y5YA 4N8CH 2VKWA 2ARJQ 4XMLL 3UTTA 3RWCB 2YZ1A 1DFBH 1FLTX 5L8LB 1IAMA 1OCWL 4CVXB 3SDAB 2HJKB 1S9YA 2H8PB 3AU1B 3O4LA 4KPHL 5E94A 4X6DA 4D9LL 1HOCB 1M4KA 1IEHA 1NL0L 4XP6L 3NOIA 1DZBA 3P0GB 3QJFA 1RUAH 4XWGL 3QO0A 5HVHB 3LKPA 3QNYA 5F7WC 1INEH 1NMBH 3BDYH 3MROA 1T1XB 2IAMA 2IFGA 4JVWA 3TWCH 4Y4HB 2B2XL 4XAKE 1VGEH 5CZXD 4PLOB 5JXED 3DXAA 4Y16C 1T1ZA 4KTDL 1VFMA 3ZZ1A 4RGNC 1U58B 4EQ3A 3E1F1 4K3HA 4X6CE 1C1EH 3VXSB 5KSBF 3RP1A 1G6RB 1IQDA 3B2UC 4L4TB 3KYKH 2VLRA 3RIFF 3WUZA 1QSEA 1RFDH 5C7XL 3GMQA 4UAOB 4M8VA 1ZANH 2Q7YB 1YPZA 2OSLB 1CXIA 1RUQL 3P4OA 4BK4A 5IHUH 1ZLUK 4LLDB 1YJDL 3GSOA 5TQ0H 4UTAH 1KF9B 2JIXD 5FB8B 1ZOXA 5D1XA 5EBLB 2P7TB 5B3JF 4UMGA 4EUPH 4IBLT 3S35L 1LP9A 4MDIB 3SHSA 2DTSA 2W9DH 3QQ9C 1I8LC 1H3VA 1INQA 4H1LH 5IVXF 5FF6A 2NY0B 2B0SL 1U2CA 4XB7A 4IS6B 1PKQE 5KVEL 4JRXB 1P1ZA 2EYTA 2QSCL 3QXTA 4QO1A 4LSSL 2XWTB 5BV7H 4L9LA 4MSWA 3TBVB 3IB4A 3I6LE 4NZUH 3FONB 1CFVH 1JHKH 3QUYB 3GJEB 3EKCA 5HYJE 1I3GH 2P8LA 3SCMB 4JREB 2Q3ZA 5KBNC 2XACC 2PN5A 3TBWA 2FEEI 4NUJA 4FQ1L 1DQMH 4FP8H 4U1HB 1I7TB 5DI8A 1OTTD 5D1QC 5E2UL 1EZVY 2GSGB 5L88L 2LV4A 1KN4L 4LCWB 3ARBD 4HMDA 5FECA 1HNFA 1LEGA 4J3UA 3OHXB 2DWEB 3OXRA 4HGWA 1J0ZA 3ALWA 4Z7WB 4GW4A 3SDCB 1HI6B 4MZ3A 4WO4B 1FVEA 1CK0H 2WBJA 3STZB 1KPUB 2X2YA 3JVGC 3FHAA 5F3HB 4FN0A 5LGHH 3RWCA 1JNNL 2NNAB 1A6VH 3UXFA 3QXAB 5F1SA 3SE4C 3FN3A 3PWPE 5BJTB 5ADPH 3RTQB 1GGUA 1NMCC 4CVXA 1QBLL 2HJKA 2VL4A 3SDAA 2X4UB 2H8PA 4JG0H 1AD9B 3AU1A 3GSNH 1ZLUH 3QISA 1LK3H 4OFPA 4LLQB 4PV9B 5DK3A 1HOCA 5E6ID 4N68A 2B7DT 2D03L 4RFEB 2QL1A 4LHUB 4NZRH 1MQKL 4FQ2L 43C9B 3RWHA 3JXAA 2YWZA 4NZDA 3UC0L 2IG2H 3HA0A 3LDBC 1T1XA 4NQEE 1QSED 4Y4HA 1IKFL 2D7TH 1UYWL 4WEBL 2CDGB 4B53A 4JM2F 4L4VD 3ILQC 5IW1B 4R90L 1XH3B 2QADC 3OKNB 1N7MH 2OXGA 4I3RL 1T66D 1F2XK 4Y8AA 4ZOCA 3VXSA 1KIPB 1G6RA 4C56B 4G80B 1WWWX 4KKBD 1KELL 3QUXB 2Q7YA 1MRCL 2OSLA 2VO5A 5BS0E 5F6IB 1KJ3H 2DQEH 3CSGA 3D48R 1I1CA 4Z7VF 4CU7A 3QDJB 1ADQA 5FB8A 3ET9F 5EBLA 2P7TA 2RJMA 4WDIB 4KVNH 2G60H 4MDIA 1T89C 5DMGD 5GXBB 4I8DA 2YR3A 4YGVB 1PEZA 4M48L 4R8WL 2NY6C 1Q72L 4IS6A 1XR8B 1CXFA 1MQ8A 4JRXA 3RJQB 3V8OA 3RUGB 2CKBH 1TJHH 1FORL 4OIIL 2XWTA 1FL5B 4ELME 3DUUB 3WLWC 5D5ME 3ARXA 4C83B 1CFBA 1EJOL 3WCYA 4ZG1A 3PUCA 2DM3A 4HWUA 3EYQC 1AI1L 3KYMB 3QUYA 3GJEA 1YYLH 2FLRT 5J3HC 3SCMA 3MJ9H 4IRJD 4KWUA 4XCCH 2OXHA 4XAWL 1ACYL 4AEHH 4K94C 5DFTA 1VA9A 2JELH 3PDOB 5GGTH 2ZZUT 4U1HA 1I7TA 2FZ3B 3VI3E 2GSGA 5EO9A 4M1GH 4LCWA 2YSSB 2MKWA 3OKMB 4NKQB 2XZAL 3GM8A 3OHXA 4MYWB 4O2FB 2DWEA 2VDPH 2DAVA 4OUOA 3A6BH 4MS8A 3QH3B 4P2YA 4Z7WA 2ENYA 4LASL 2FDBP 1A7QH 4G8GB 3SDCA 1CS6A 1HI6A 3RGVB 2K3TA 4WO4A 2WWKO 3STZA 1KPUA 4O00A 4JPKH 3U7AA 5FYJE 5F3HA 2ADJB 2NNAA 2YPVH 3QXAA 4MXWH 5T33L 5BMFH 4ZUTB 5BJTA 3RTQA 3QJHB 4Z7NF 2X4UA 1AD9A 2BXZA 1MRDH 4KV5F 1WCBB 1CD1B 4LLQA 4NC2B 4PV9A 3STBA 3HG1B 3LRGA 2R1WB 2D0HA 4RFEA 4LHUA 4KK8D 1FIGL 5D2LB 1ZHKB 43C9A 1U8JB 1X6LA 5F6HI 4HFUL 2HT4D 4KMTL 3T65A 5B39B 3L1OH 1KIRB 4FS0A 5KTEL 1ZMYA 2BVUA 2F54B 4I77H 3KLHD 4WWKD 3T0AA 4Y8DC 1ZA3B 3NACH 3RX5A 5IW1A 4Q2ZB 1XH3A 3OKNA 2HFEB 4Y19B 3I2CL 4XT1C 1G0XA 5TE6H 5JR1L 2AEWA 2QBWA 3CVIL 1KIPA 2IAND 1CDJA 2VE6B 4C56A 3V0WH 4G80A 1ZHBB 3QUXA 2Q86B 2JB6B 1MFCH 4OF5A 4CJ0A 2IAMC 1FIEA 2YD7A 4G7VL 4XCFH 4G5ZL 2R69H 5F9WB 3QDJA 1KLUB 4NO0B 5CJQL 1EHXA 4QRRE 5FYLL 4WDIA 5HHMD 3QDGD 2EZ0D 3VFNB 5IG7B 3WLBB 4ALAH 4XI5D 2HH0H 4YGVA 1M6OB 2I07B 3OGOE 1CDIA 4LHJB 1XR8A 3U1SH 3RUGA 3MRQA 1H0DB 1I8IB 3QIBB 4GG8B 2AJYL 3T0EE 1JCKA 1FL5A 3DUUA 4QHLA 3VFOB 5I1GL 1MFBL 4C83A 3P0VH 4PRHD 4R2GD 3H0TB 2ZSWB 3LMJL 3KYMA 3WD5H 4HWNA 4YHLL 3B8YA 4X7DC 5L9DL 2VLKE 5IMOB 1QR4A 3CVHH 4PG9B 5KW9L 5D1XC 3BKML 3LAFA 3KPSB 4JFXB 4PG2A 1KIQA 3PDOA 2FZ3A 1A7BA 1SBSH 2OBGA 2VQ1B 4TUJB 3RVWD 3S7GA 2YSSA 4YDKH 1X9QA 5IP4A 5FYJU 1AD0B 4O2FA 3MCLH 2YMXL 3QH3A 3CDGB 4HC1L 4LVHC 2B1AH 1JV5B 1KCRL 4G8GA 5IJKC 3MLWH 3RGVA 4LVOB 3QXDB 5C09E 1MCBA 2A6JB 4XTRC 1J8HB 2PKDA 4MXVE 2ADJA 1UA6H 1BBDL 1EV2E 1Q0YH 1AO7A 1YY9C 4NRXB 4UNVA 5E70A 4ZUTA 1L4IA 4F57L 1BD2E 3QJHA 4XPHL 1WCBA 1CD1A 1J1XL 1X3DA 1RZKH 5A2LH 3HG1A 3PGCB 1J1OL 2DQGH 4H88L 5C08B 1NSNH 2R1WA 3O6ML 4P5MB 4FQJL 3LQAC 4PR5B 4YUEL 2WY3A 1ZHKA 3OQ3B 4RAVB 1U8JA 4JRYD 5T3ZH 1K4CB 3AM8A 4TULL 3O2WH 3UPCA 5GGVL 3S35X 3UYOD 2EE9A 1N64H 5B39A 1KIRA 1SEQL 4LDEB 4OGXL 1J0KA 5EOCH 2F54A 3MBEB 3NVQA 5MP6H 3FQUB 1Z9SA 4IRZL 4XGZB 2L4OA 2BOCB 3ZTNH 4Q2ZA 3SDAC 1RIUL 3OKLB 1NEZB 4HF5L 1BVKB 1WTLA 1J8KA 4OT1L 5J9PB 4NKMA 3AFLA 3S8WA 3CFCH 4NQSB 5EULV 4HXAH 1LO5B 2VE6A 4GW1B 3ULVH 4WVRA 1BF8A 1ZHBA 3B9KC 2Q86A 5CIPB 2JB6A 4U0RB 1T2QL 4KXZH 3O41B 1E4XL 4NKIH 1MREL 1KLUA 4NO0A 5I8CB 1V7MH 2H45A 3T09A 4J23A 4WUUE 4PJHE 4M7JH 4X6CB 3VFNA 5IG7A 3TJHC 1L7IL 3WLBA 1JZ5A 2DL9A 1M6OA 2I07A 5K33A 4LP5A 5IESH 4XPTH 3MODH 3QWRA 4LQFH 4OV6F 1IC7L 4PS4H 1H0DA 1H3WM 1I8IA 3QIBA 4JGMA 1CI5A 4GG8A 4PP1D 5D7KE 1T6VN 4BFEA 4XNZC 3VFOA 5ACZB 1XMWA 4PY7B 4H25B 5T1DH 4ZNCD 4GOSA 1KCSH 3DWTA 4YDIH 1LO3L 3LPFA 4GJTB