3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
b'KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
4QRQB 1VFMA 3LKOB 1RZGB 3N9GL 1WV7T 5ICXA 5HXMA 2AS5M 3FONB 3L3JA 1EVUA 4Y1AD 3BPNC 3QWRD 2VAAB 5EIIB 3C6LD 1INQA 4PJAE 4OIIH 1J8KA 3BDYL 1NFDE 1S7RA 4N68A 3MODH 2AK4B 3MRKB 4IRJA 3RPIA 3MNWB 1U8MB 4XCEA 5I1LA 4BFGA 1YUHB 3EAKA 5SWQB 4G6JL 4JRXE 3O0RL 1I3RB 1QLRA 3HZYA 4OF8A 5IW1B 1RUPL 3M8OL 5CMAA 1EGJL 2VOTA 1MCRA 2Q87A 3PHQB 5H35A 4K9EL 3HI1A 3I84A 2R1WB 4Z6AT 5JHLL 2BC4A 4YBQC 4PYHA 4YFLF 4LNVA 3DO7B 3DV6A 3I50H 2EH8H 3LRGA 3MREA 3MPCA 5IQ9A 1OP3K 3RWFB 5I8EB 4ZS6C 3IXTA 4J3WA 5HVWA 5D2LA 4XRCB 1PQZA 3H8NA 1A14L 3N0PB 3QI9C 2O5XL 4LPWA 3QH3B 4QHLA 2YD3A 3QIUB 5ID1A 1S7XA 2YK1H 1D6VL 1A6WL 2R0KL 2BSED 4JFOB 2NLJA 2G5BB 3HZVB 4X98B 3VWKA 4CW1B 3PQYE 4ODTH 4F3FB 5L8JB 2A6KA 4EN3D 4HIHA 5C70A 1I7TB 4BK4A 1B90A 1J7VR 4U1NA 2NY5C 3E2HA 4NKIH 4X5WB 2IPUK 1CQKA 1CICC 1ONQA 4R4BA 1IRAY 43C9A 3TCLA 2X42A 3G5ZB 4U1KA 5BRZA 2B4CC 3MLRL 2QV2A 3PL6D 4DOHB 1JYWA 3VDCA 1KSRA 4X7DC 1HNGA 4NKOB 4HDIA 1GGIL 2W60B 3DRTB 5CJ8A 4AQ1B 1N5AB 4WW1B 4XP1L 4EBQH 1Q1JL 1VHPA 3KXFE 4PJAA 1YC7A 1L9MA 1XGPB 2QL1A 2YD2A 3U0PB 1BQHA 5TDNB 5ICYA 1F4WH 1RIVL 4R2GB 1IAIM 2EDOA 3P9LB 5MEOB 4FRWA 4HBCH 3EYQD 5DEGB 4WWKC 2ZKHH 3WIHL 3MV7E 3MNVA 3QCUL 1T2QL 1NBZB 1T22A 5FO8B 2H32A 3MRRB 3WFEH 1P9MA 4JFFB 2ENYA 3MYJB 4JQIH 5I1AB 5D1QD 3RWGA 5F9OL 5BO1H 4XPGH 4YIQB 4ELMB 1HIML 1DBAL 4NQVB 3EO9L 5F1NA 5L88L 4O2EB 5CKGA 5DQJB 3RGVD 3IDNA 4E41B 4MWFA 2FBJL 4XPFH 2ICWI 3IDXL 3VJ6A 3WHE1 3ULVH 4RAVB 2R4SL 1TTFA 4FQ1L 4NGHL 3LKQA 4KKBC 5D1XC 3KDMB 2DQEL 4U2YA 1OGAD 2Y5TB 1MCSA 4OQ1A 2XA3A 1SMOA 3DVGB 4P4KB 3STZA 5EG6C 4BSVA 3ARQA 4DKEH 4HH9A 1JVKA 3O3EA 4LLYB 3D9AL 3TIDA 4DCQB 3MNZA 1A7PL 3SY0A 1AC6A 3BZFA 1BIIB 2VL5B 3U4BH 1R0AL 5KJRL 2A6IA 2BNUB 3PQYA 1U8KB 5E2WH 2AXGB 2YC1A 2DBLL 5F88A 5DC9B 5DRNB 1XF4B 3EYOA 1CFQA 4WCYL 4LLMA 2MSPA 3GHEL 1I9JH 3S37H 3L5XH 5DJAA 1HHKB 2CO6B 5C0RL 5H8DA 4S1QL 1Q9LB 1TVHA 3EYUL 2PUQT 3MR9B 2R69L 4UIMA 4MAUH 4MNQB 1F2XK 2ARWA 4HPYL 2V9QA 5IROC 2J1KA 3TT1H 5ICXB 4XPAH 2VN4A 2PO6D 3UP1A 5I1IL 3DXAE 3L3JB 4K94H 4WI6A 3D39E 5LCVH 3W0WD 4V3EB 1UFUA 1INQB 2NTSP 3FQNA 1PG7L 1DQMH 4GUPA 4IRJB 3RPIB 2VLKE 4MXQD 5I2IA 1X5AA 2D0FA 2IAND 4X6DE 2WW8A 4PP2A 1CXKA 5CEZD 3C6LC 3HZYB 1RUQL 4PS4H 5B21A 5H35B 3HRPA 3HI1B 5JOPD 5JQ6L 3ORJA 1PEZA 5CILH 1JMZA 2BC4B 1G0YR 3PWNA 2R4RH 1H8SA 3OJ2C 3DV6B 3MREB 5IQ9B 1PEWA 4XB7A 1KUMA 5C0IA 5E6ID 1DLFL 1MHPL 5EU5A 4M5ZH 1B0RA 3IXTB 4QXGH 2P47B 1DBBL 5D2LB 5FA3A 1PQZB 4L3CA 3WCYA 3MLSL 1OAKH 3LQAH 3SKMA 5E70A 1MCWM 4QHLB 4JFEE 5FM5M 1QRNE 2LABA 3FOMA 4UTBH 5ID1B 1S7XB 2ZCLL 3IKKA 4GAJH 3AS1A 5FA4A 1CG9A 2NLJB 5FUOL 2MCPL 1GOFA 5C08A 1MWAA 3VWKB 3JWOC 1CLZH 5DJZA 1SBSL 2OJZL 4O00A 4WHCA 5HDBF 4OCRL 2X4QA 4JO4L 2A6KB 3O2DL 4YQXL 1AI1H 1X5HA 4HIHB 1URLA 2XQBL 2P5WD 2AXFA 4J4PA 4U1NB 1WITA 3E2HB 4GMSH 5GIRA 1NUNB 1GGCL 4LDLB 3EDEA 4P4RA 5A2LH 1ONQB 4R4BB 5I8OH 1QFWI 4POUB 3TCLB 1N8ZA 43C9B 5BRZB 4U1KB 3R4DA 4M6ML 5T33L 3V6OC 5KVDH 5ETUA 1H8OA 2YSSA 4O5LH 1B9ZA 4HF5H 1D5ZA 4RISL 1G0DA 3CU7A 4FQIL 1GZPA 4HDIB 2EDBA 3VG0H 1XF3A 2AP2A 1KJ3L 2IFFH 3T0XA 4Q0XH 4PJAB 4YDIL 4ZS7H 1BQHB 5ICYB 1KXVC 4JN1L 1CDCA 3KGRA 1U3JA 4PJEF 2WNGA 2DQTL 1EXUA 3V4UL 4NWUH 3K0WA 4X6DA 5DFVC 5C0BE 1J9CT 2VH5H 4LL9A 3WJJA 3OKNB 3KPQA 3MNVB 2WQRA 1GGUA 1T22B 2PKDA 2H32B 3UYRH 3KR3L 5DD3H 4Z7WB 1QFWH 1CWVA 3RWGB 1BZ9A 1W0WA 2DLEA 5BS0E 1PYWA 3G5XA 4YR6A 5F1NB 3EYQC 4P9HH 3T8XA 3IDNB 2BNRD 3VJ6B 1FDLL 5GS0D 5D1QC 5A43C 4HUNB 3IDGA 4P46A 3LKQB 1FZJA 5TQ0L 2YPVH 4XMLH 4OV6F 5IGXL 4JFEA 5HVGB 3JVGA 1QRNA 3RGVC 1PSKL 3QHFH 3S3PA 1U6AL 1WZ1L 5TPWL 3STZB 4BSVB 4HH9B 2D7TH 3JV4A 3O3EB 1BD2D 2AEQL 5FYKE 4C83A 3I6GA 3TIDB 3U9PH 4EKXA 3MNZB 4XXCC 3SY0B 2HLAA 1VA9A 4YHLH 3BZFB 1E4WL 1BFVH 2GQHA 1U3ZA 4PYGA 4P3CL 3PQYB 3ZDXF 2VC2L 4RGMB 2YC1B 5F88B 2V2TA 1ADQL 5E9DE 4NCC2 3EYOB 1CFQB 4L3ED 4LLMB 3PP4L 4NWTL 1RK1A 1E4XI 4XAWH 2J6EH 3FMGH 5DJAB 2UZIH 4UBDC 1KTLA 4XNMA 3WFDH 1TVHB 2JJSA 2YD7A 2FGWH 5C07D 4OIIL 4FP8H 3U0TA 3MODL 5KSBF 1NQBA 25C8H 5EU3A 4LCWD 3L5IA 4Y5VA 5DJDA 3BPLB 3FQNB 3VXSE 5EIVA 4GUPB 1CDIA 5FUCE 1E4XH 3DETD 1UA6H 5I2IB 4PP2B 3EGSB 1IM3A 3OAZH 3D25B 3IB4A 1ZMYA 3I50L 2EH8L 4RMSA 4QCIA 3HHRB 1I7RA 5FK9A 4MXQC 3PWNB 1G9EA 3CIQA 1CGUA 1AQDA 5EOCH 1L0XA 3TF7A 4ENED 3P4NA 1T0MA 2ENSA 1ERNA 3ARBC 1SYSA 2E6JA 5C0IB 4PB9H 4H20H 5EU5B 3VXME 4U6YA 2YK1L 1B0RB 1CDHA 5FA3B 4M61A 4L3CB 4AIXA 2L4OA 4IMKC 4UAOC 3SKMB 1KEGH 1HEZA 5DO2D 4ODTL 3FOMB 1FG9C 3TFKC 5E6IC 4JHZA 5FA4B 3BWAA 3HRZB 4Y4HD 1CG9B 4LIQE 4X0KA 4P5TA 4FFZH 5C08B 1MWAB 4NKIL 5DJZB 1I8IA 3SGJC 2X4QB 3K74B 2FX7H 1RVFH 4PJGE 3ARTA 3DMMD 5GIRB 1MNUH 4CU7A 4P4RB 1C5CH 1PBYA 4D0CA 5K59E 4ODBD 5I1GH 5E7BA 3HKFA 4IDJH 2G60H 4EBQL 1N8ZB 4GT7A 4HKJA 5ELIA 1F4WL 5ETUB 2YSSB 4BJLA 1D5ZB 4JDVA 1GZPB 3ZTNH 4I18C 1XF3B 1NCWH 3MRFA 4HBCL 2ZKHL 1FL5A 3MJ7A 3VXSA 2X6MA 4OLXH 3WFEL 4JQIL 1EXUB 3VXTA 3QG7H 4X6DB 5BO1L 4XPGL 3IDYB 5FYJE 4R97C 3KPQB 3TWCH 2BNQE 2HG5A 2XOTA 4G42A 5HHQA 5BCAA 1IM9A 4XPFL 5TE4H 1FO0A 3QZWA 5CJBA 3ULVL 3UTPE 1FN4A 1BZ9B 1ORQB 1W0WB 3CFJA 1OARH 1PYWB 1F97A 3G5XB 4YR6B 5IVZA 4XNUH 1NLBH 3T8XB 1CS6A 4XMKL 1GOHA 2R29H 4OZGE 4YDJA 5C6PB 5T5FH 3VXMA 4TNWK 2D03H 4DKEL 3HUJE 3IDGB 4P46B 1FZJB 4FN0A 4TUKH 3ET9F 4ZODA 3U4BL 1OAYH 3Q48A 3C5ZD 2F53E 5E2WL 1LE5A 1EAPA 5AG8A 3BP5A 3WD5H 5AYQA 4XAKE 1BFSA 5EU7C 4C83B 3JV4B 1UKTA 4NSKA 3I6GB 2D9QB 1I9JL 3QG6A 5GS0C 3S37L 4M43H 2HLAB 3L5XL 3W5NA 2XWTA 1JZ4A 3VCLA 5F8QC 4XMPH 2V2TB 4MZ2A 4U3HA 4QHUA 3WKMH 4JFDE 4KGJA 1RK1B 4PJGA 3DVIA 3E0GA 4MAUL 4DAGH 3IJHA 3OF6D 4ZUWA 4FZ8H 3MGAA 1YNTA 3TBSA 5EB9A 1ZHNA 3TT1L 5CJ5A 4XPAL 1M4KA 3TA3A 1VB9A 4K94L 2LU3A 1MI5A 1MCLA 3OX8A 3FN3A 3N1MC 1DQML 4DUXA 3KPRA 3U0TB 3BH9A 4H0GA 3I02A 5EU3B 4PGZA 4Y5VB 5D7JA 5DJDB 5T1LA 2NY0D 1FC2D 2E27H 4PS4L 3SDCA 2ADIA 1T7ZA 5LAXA 4QRRD 3MRBA 3QI9A 1FO0H 5CILL 2DM2A 4J23A 4YC2C 2R4RL 1IM3B 4N0YH 3UROR 3QQ3A 2Q8AH 1MFCH 1YMME 4Z7UE 4M5ZL 4QXGL 4X7TB 4UDUA 5FK9B 2BCKB 2NW3A 2DJ4A 4OZGA 1AQDB 1OAKL 3LQAL 5DHXB 4MQXD 3P4NB 1CXHA 1T0MB 2IMMA 1SYSB 3D87B 2ESVD 3HUJA 2ZP0T 4UTBL 4U6YB 4GAJL 2APWA 3SJVA 1EHAA 4M61B 1CICA 4PTUB 3QFDA 1CLZL 2UZYB 3M07A 5TE6H 1HEZB 3O8XC 5IT2H 4ENEC 3N85H 3KYKH 5I1DA 1AI1L 3BWAB 4HEME 4XXDA 2DWEA 4X0KB 4P5TB 3UAJD 4GMSL 1I8IB 1YQVH 5I8OL 3MLPA 1J1PH 1HI6A 1SMAA 1MREH 3RBGA 5JOFA 4G8GE 2EEBA 3FZUD 1E4JA 5KVDL 4O5LL 4HF5L 4D0CB 5D1ZA 4X4ME 5HI4C 4UNVA 3VG0L 4Y1AE 4LSQH 2IFFL 2MQ0A 2E9BA 4NHCH 4Q0XL 4ZS7L 4HKJB 1U41A 4MS8D 1W8NA 3E8UH 4LQFH 2IAMD 1QSEE 1AKJD 3G9VA 4JDVB 3C2AH 1TIUA 1QRKA 4NWUL 2VH5L 3F8UB 3MRFB 1EEZA 2VQUA 1FL5B 2QSCH 3MJ7B 3VXSB 1AGBA 5HDOA 4EUPA 3UYRL 2DI7A 5DD3L 1JJUA 1QFWL 5D1XA 5GHWH 3X3FH 3VXTB 2YR3A 3U7AA 5IBTH 3WYRA 2IFGA 3FQTA 1TNMA 4P9HL 4G42B 1FZKA 5HHQB 4UU9A 1IM9B 4YHZH 1FO0B 3QZWB 3WUWA 1FN4B 2NY5H 4GW1A 3RZCD 5A3ID 4YHKH 4ZXBD 3MLXH 1U8QA 3LH2H 5IVZB 4XMLL 4HUKB 4YDJB 1PX4A 5EA0H 1P84K 3QHFL 1JYVA 3VXMB 4I2XA 3IAPA 4C55A 4L5FH 2D7TL 2B4CH 3ULVF 1X6NA 4Z18A 5CP3A 3U9PL 5FCSH 4YHLL 3O11A 5DEFA 1BFVL 3VXQA 1LE5B 4YX2H 1EAPB 3MLVH 4OKDA 4NSKB 4RMUA 2J88H 3QG6B 3BFOA 4XAWL 2J6EL 3FMGL 4WWID 1DQDH 2UZIL 4I3RH 2XWTB 3VCLB 3BPNB 2UWEE 3SDDD 4HJ0D 2IBBA 4KI5F 4PJCF 5K9KA 4JO3H 3WFDL 1F02I 4QGTA 4E9LA 1CFTB 2FGWL 4OUOA 4MDJA 3IJHB 4ZUWB 4FP8L 1YNTB 4X4MA 2EE3A 3K81A 3TBSB 2R0LH 4Y1AA 3QWRA 4WU7A 1ZHNB 3C6LA 25C8L 3TA3B 3BZDA 2L0DA 1MI5B 2EYRA 3TP4A 3OX8B 5C0CD 4PJDE 3MYZA 3KPRB 3BH9B 3BI9X 3BN9D 2C1PA 3K46A 3LB6D 1E4XL 3QAZC 3I02B 1UA6L 2BVTA 2EYSA 4UOW0 3WEXA 5D7JB 2O93L 3QUYD 5T1LB 2CDEA 3IFLH 4BH8A 1UEMA 1MCWW 2NY6D 3SDCB 1SEQH 3SDXF 1TQCB 5B3JF 2ADIB 4X9FA 4JG1H 5LAXB 2CLVA 3QI9B 2LFGA 1MFEH 4KVNH 3TBWB 3QQ3B 5EOCL 5I19H 3Q3GA 4G6AD 2JJTC 1WSST 1S9XA 1WIOA 5JW3H 4PB9L 4H20L 1UEYA 1JHLH 4APQD 5IMKA 1R5VA 4UDUB 3UTSD 4Y4FD 1OGAE 4QRPB 5DHVH 3HE7A 1U8OA 1TITA 4PRNA 1KEGL 1FLTX 1KCRH 3HUJB 4NKQB 3SJVB 1CICB 1QPPA 4FFZL 3QFDB 1MLCA 5DXWA 4NNXA 1ZA6A 4MQXC 3U6RA 4EN3A 2R2BA 3O45B 5I1DB 3V6OA 1W0VA 4FABH 5EBLA 2FX7L 4XXDB 2DWEB 1RVFL 2WK2A 2OQJB 1LQVA 4D0DA 1U93A 4OZIA 4NBZB 1MNUL 4DVBA 4CMHB 1C5CL 4TUOB 1TVBA 3HG1E 1HI6B 1UACH 5I1GL 4IDJL 2G60L 4CMMA 5JOFB 4OTXH 4A2LA 2W92A 3PL6A 3VMNA 4WFGD 2CR6A 2C4XA 3UAJC 3QUXD 1NLDH 4PJXB 1JE6A 5D1ZB 4WWKB 3ZTNL 3EOYG 3PHSA 4X7EC 1NCWL 2PW1A 3RHWK 1YYLH 4AY0A 4PJDA 2AJZA 3O2WH 3QEGH 1OB1A 4DGVH 1CZ8H 4OLXL 1E27A 1RJYA 3PWVB 4JDTH 3VI3F 1OQOA 1A7OH 4V2BA 3QG7L 3RWEA 1EEZB 5CEZE 3TWCL 1A6AA 3P0YH 1AGBB 4EUPB 5D1QA 5JOPE 5EO1A 4MHHG 1SQ2N 2IAMC 5D1XB 5AWNH 5TE4L 3ZHKA 1I8LC 4JZOA 1UKSA 4JPIA 1OARL 2AXJA 1EO7A 1KACB 3JWOH 1RJZB 1KCLA 2HJFA 4B0MM 3FQTB 4XNUL 1NLBL 3BIAX 1FZKB 1YY8A 2R29L 4JE4B 4UU9B 5T5FL 3FB7A 4JRYE 3I3EA 3LVEA 4ESKA 3ARFD 2D03L 3WUWB 1ZHKA 2FEEI 4GW1B 4KVCH 1OGAA 4MXVE 1U8QB 1JCKA 4TUKL 1T6WA 2DL2A 2XWBA 2J7LA 1OAYL 3WD5L 3D69A 2VWEC 4I2XB 3ULUE 1UJTA 3CUPA 3VD4A 4GFTB 4WV1A 1I85A 4M43L 5JIPA 3O11B 5DEFB 3VXQB 4BA8A 4KKLD 5JA8B 2VXQH 3QA3B 4XMPL 1PD6A 2MHAB 4XTRC 2C3VA 3O6LH 3WKML 4L8CA 3GM8A 5DD5H 4EXPX 5BVPH 4PLNC 3F62A 2ID5A 5I66A 4DAGL 4KROD 3CH8A 4FZ8L 3G04A 5K9KB 1CR9H 3UEZA 1SBBA 1FGVH 1WLHA 4P48A 1I9IH 2WLYA 1T04A 4MDJB 1LILA 2WLZA 4XZUA 5TF0A 2PO6A 5DFTA 1QSVA 4Y1AB 1GGYA 4WU7B 3W0WA 4HJ0C 3C6LB 3WS3A 2Z8SA 5AG9A 2EYRB 4MHHI 3PGCA 3WLBA 2LU7A 2PXYD 2E27L 5IVOA 3SHSA 4HMEA 1UB6A 2J5LC 3V95A 3FB6A 4BFIA 4F33A 4MXQA 4U3CA 3QRFM 2C1PB 2IANA 3F7QA 1FO0L 1ZOXA 2A6DA 1HHIA 2EYSB 3WEXB 5DZLA 5IF0A 1KPRA 3F12A 2CDEB 2PF6A 2FNBA 2I07A 3NCYP 4N0YL 4BH8B 2Q8AL 3HA0A 1NDMB 2CRYA 3RAJH 2YPLD 1HHJA 1MFCL 2GJZA 2CLVB 3S4SG 3QBTB 3LB6C 3S6CA 2W38A 3OQ3B 3OV6A 3QRGH 3SDAD 5LXGH 3L9RA 5J1SC 2Z8RA 1DQQA 2BNRE 3QUYC 5KOVC 5E6IA 4JRYA 1YEGH 1BP3B 3Q3GB 1TZGH 2NY6C 3BSZH 4POZC 1S9XB 1AO7E 1ZVYA 2I9LA 5IMKB 1R5VB 4NZTH 3JV5A 4H26A 1A7NH 5KVGH 4DGIH 3J7HA 3HE7B 1U8OB 1MIEH 4PRNB 5TE6L 3BMVA 3THMH 5IT2L 4W4OA 1P5UA 1T7WA 3N85L 4G6AC 1A6UH 3KYKL 4CN1A 1NANI 4YGAB 3BYTA 1T0NA 2AJUH 4PBXA 3NGBC 2WP3T 1MLCB 2A9NH 4NNXB 1ZA6B 1YQVL 3U6RB 5C92A 1J1PL 4EN3B 2R2BB 2P5WA 1MREL 4L3EE 3RNKA 5JW4Q 1W0VB 5JXED 5EBLB 2OL3H 1B4RA 4ODUA 1NCAH 4D0DB 1U93B 4I18A 4OZIB 5F70A 4DVBB 2WQ8A 2ZNWA 3OAYH 1TVBB 1OD9A 2W91A 4JPKH 1LO3H 4LSQL 1UM6H 3QJHA 4CMMB 5IM7A 4NHCL 3PL6B 5C07E 3VWJA 4MCZA 4YAQA 3DGCR 1MCNA 4LQFL 3E8UL 3PGFH 5BZWA 3C2AL 1NANH 4HJJH 1H3WM 3SCMD 1J0ZA 2PW1B 1MCDA 5D7IE 3TM6A 5E6ZA 3WUZA 2QSCL 1OB1B 4ONHA 4Z0BH 1BEYH 5DJYA 1RJYB 4WVRA 1AGFA 3X3FL 2F5AH 5D7LE 5GHWL 1VFAA 3RWEB 4MQTB 3IU4H 1QSZA 2M2DA 5IBTL 1A6AB 2BK8A 5D1QB 4RDQG 3OKOB 3O3UN 1T7YA 1MAKA 4JZOB 4PJFE 5DJ8A 3W39A 1S9WA 2NY5L 4JPIB 4Q97A 3RGVB 4YHKL 3C60D 3MLXL 2HJFB 3LH2L 2BNRA 5DK2A 4YEFA 1YY8B 3OPZH 5EA0L 4OM1H 3FB7B 3EZJB 3X17A 4LGRB 4L5FL 1G9NC 2B4CL 3U7WH 1OGAB 5DZNA 4R9HA 4UNTA 2XWBB 2DM7A 1V5JA 1WBZA 5F1KC 3D69B 3CX2A 1ZK9A 3MLVL 1XFPA 3CUPB 2YS4A 3ARFC 3T65A 1ZHBA 5EC1A 4NQDE 4R26H 1HSAA 1DQDL 3AY4C 4I3RL 5IESH 1QUNA 2IQ9H 4L3EA 4JO3L 2H45A 1DUYB 1EH9A 2C3VB 1W0YT 4UIKH 1WC7A 4L8CB 3S9DB 1BOYA 2EDTA 2YZ1A 5I66B 2OXGA 4WEMB 3QR2A 4HGKC 2R0LL 4KKLC 3G04B 2R8SH 5C07A 1T04B 2G9HA 4HLJA 4XZUB 3J8F7 2HT2C 3ERYA 1QPXA 2PO6B 4FQPA 1ZV5A 4KROC 4JLRA 3W0WB 2ZCHH 4LCWA 3V8CA 3WS3B 3T4AB 1N64H 5D7IA 4K7PY 2D4DA 3PGCB 3WLBB 5GS1A 3EUUA 1NUDA 3IFLL 1UB6B 1SEQL 2X4NA 1VSCA 4I4WA 3FB6B 5D7LA 4F33B 1N0XH 4JG1L 4PRAA 2IANB 1JNHA 2A6DB 4KK6D 3H2WA 1MFEL 4KVNL 5IF0B 4XCNA 3F12B 2I07B 3TBVA 2PXYC 5I19L 3OGCA 1HHJB 3F5WB 2GJZB 4XP9H 5JW3L 5GS0H 4UT6H 4UAOB 1JHLL 4HH8A 2F54E 3NIDE 5H37G 5BQ7A 1X9QA 3L9RB 3PXHA 1DQQB 4KUZH 5E6IB 4TVPD 3QEQE 2MMXA 1KCRL 3TBYA 2I9LB 2R1XA 2ZG2A 3CZFA 5EN2A 4H26B 3SKOB 1GHFH 1KN4H 3A67L 3SDAC 1CD8A 5MI0C 3NFSH 4O2FA 4Z7OF 4Y4HA 3BAEH 4FABL 4FQXD 4NQDA 3KPMA 2YWYA 4OF7A 1T0NB 1RZIA 1KIQA 5JIHA 1VEPA 3OKLA 2X2YA 4PJ5E 3V6FA 1UACL 2P5WB 3RNKB 4KXZI 4OTXL 2AV7B 4QGYA 3DMMA 3WHXA 4ODUB 4JG0H 3FN9A 1LO5A 4I18B 2IC2A 3FO9A 1NLDL 4NO5A 3QXDA 3QCTH 3UYPA 2OR9H 3QJHB 4I13B 1YYLL 3VWJB 3O2WL 3QEGL 4MCZB 4BQ9A 5JXEC 5E5UB 5A1AA 4DGVL 1P84J 1CZ8L 4YAQB 2NY2C 2R2CA 2DI8A 2WIIA 3WO4C 4JDTL 4P2CG 5BZWB 3FT4A 1A7OL 4I0KA 5MENE 1S9YA 4ODHH 4XH2A 2X4SA 4ONHB 3P0YL 5DJYB 1LP9F 3UO1H 1TFHA 1AGFB 4KXZH 4QRRE 5AWNL 5HDLA 1V05A 3PXJA 1VFAB 3SCMC 3JWOL 1CYGA 4Q58C 1LDSA 3P4LA 4BQ8A 4JKWA 1TLKA 1Q9OA 4K8RC 1CIDA 4XPTH 2CUMA 5EOQH 1OSPH 2F54A 5DJ8B 3W39B 1S9WB 4ZFFA 3P9WB 4KVCL 4NQXB 2BNRB 5DYOA 3BRGC 5DK2B 1OP5K 4P3DA 3CJJA 1MF2H 4AJ0A 3T1WA 3T09A 3WIFA 5J4MA 2XXMB 3C5ZA 4TUJA 5H37H 3C60C 3GNMH 1WBZB 2VXQL 5C0GA 1P4BH 4I1NB 3O6LL 4PJ7E 3T65B 2DM3A 3VFNA 1ZHBB 2IF7A 2YEZA 1X3DA 4I3SH 5EUKA 2Q6WA 3K8MA 3KPPA 5DD5L 5EC1B 5BVPL 1HSAB 1RZ8A 4PJ5A 4ACPA 1FAIH 4L3EB 2FEEL 1CR9L 5T3ZH 4DK3A 1FGVL 1WC7B 2NY3C 3JXAA 4XBPA 1I9IL 2GK2A 3OF6A 3PDOA 2H1PH 3S97C 2HFTA 2DM4A 3GSVA 1IKFH 5C07B 2G9HB 5JW5A 4J8RA 1IGTA 3JTSA 3F58H 4Y8DC 2EC8A 4YC2B 4U31A 4AYFA 5DUBA 2LVEA 4LCWB 4JM2F 5I6XC 2NW2B 4LF3A 2HLFD 5D7IB 5EZOH 1KCKA 1CDBA 2JJTA 2X4NB 4I4WB 4QRRA 3RAJL 4RX4D 4PRAB 2FR4A 3AC0A 1JNHB 5EUOA 4M7JH 1LEKB 4UDTA 3S3JA 4XCNB 3QRGL 2OLDA 3TBVB 3UXFA 4HIEA 5LXGL 4GAGH 3OGCB 1YEGL 1TZGL 3BSZL 4NPYA 4F7PA 2OXHA 4LNRB 2G2RA 3G6DH 1Y0LA 4NZTL 4KK6C 1AY1H 1A7NL 2GIYA 5BQ7B 5KVGL 4DGIL 4HW6A 1MIEL 3THML 1KYOJ 5FAAA 4DQOH 4WI7A 3TBYB 1FFOA 2R1XB 1A6UL 5GGSA 3CZFB 3VGDA 2V2XA 5EN2B 2OS7A 3TPUE 2Y1VA 2AJUL 4RWYH 1C16A 3RHWF 2A9NL 3FKUS 3ZYZA 1A6PA 4U6VH 4CADA 5KS9F 4Y4HB 4NQCD 1VADA 5F1IB 1F45A 2OL3L 3KPMB 5GZND 1RZIB 1KIQB 1NCAL 2CDGA 3SPVA 1E6OH 3OKLB 4A6YA 1MHHA 1WWWX 4JR9H 3V6FB 5I75B 1AHWC 4JPKL 4XBGA 1AXTH 1LO3L 4M8QA 3I6LD 1UM6L 2Y5EA 3DMMB 5GGTA 3WHXB 4FQXC 4S2SA 1LO5B 3FO9B 1XMWA 4M5YH 1EERB 3U1SH 1QR1A 4NO5B 3QXDB 3PGFL 4M7ZC 4HJJL 1JZ3A 3RNQB 1XCTA 4MS8A 1FZMA 2IAMA 1AKJA 4Z0BL 1BEYL 3GSRA 3UMTA 4MMZC 2WIIB 3TC9A 3CFCH 2F5AL 1JF1A 4QTHA 5E8EA 2X1PA 1S9YB 4ZYKA 3IU4L 4RMQA 2X4SB 2ZUUA 4HWBA 5CIPH 3BIKA 2W9LA 3MMEA 3WHE0 4P0DA 3LN9A 1W72A 1AJ7H 2FYYB 1EEYB 3SGEI 1R3JA 2EDQA 4LP5A 2BDNH 4UV7H 4J1UA 1JNJA 3MCKA 1Q9OB 3OPZL 4OM1L 3S36H 3RZCA 4ZXBA 3U7WL 3OHXB 2OI9C 5D96C 5DYOB 5EBWA 4P3DB 1NDGA 4P2RD 4GSDH 3WIFB 4WFEE 2XTLA 4OLVH 3TPUA 4QRUA 3TH3T 3C5ZB 4TUJB 4R26L 5IESL 1X6LA 2IQ9L 2QSTA 3ABZA 5C0GB 3SGEH 3RUGF 1A4JA 4UIKL 4PJIE 3VFNB 2YEZB 5EUKB 5F7LB 2EE6A 4NJAH 2Q6WB 3KPPB 3SDDA 5GGTH 1RZ8B 2E7LE 2I24N 5JZ7C 1IZKA 2R8SL 3K3QA 2R1YA 4NM8H 4X4XA 4XBPB 3L95A 5EFIA 5A2FA 1U8JA 1A3QA 3BP6A 3IU3A 4S11A 5GPRA 5LBSH 2ZCHL 2HMID 3GSVB 1Q72H 3VMOA 1N64L 5C0CA 2CK0H 3VMPA 2DKSA 5C09D 5JW5B 4J8RB 5DVNA 1IGTB 3JTSB 2ORBH 2OMNA 3KJ6H 1N0XL 2ZPKH 4K23H 4QF1A 5DUBB 1I7ZA 1L7TH 4LF3B 1KCUH 3QUYA 2NY0B 3VRLF 4IOFC 4XWGH 5JIKA 4QRRB 4K3GA 1T5XA 5HYSG 2J8HA 2FR4B 4XP9L 5GS0L 4UT6L 4PLKD 5EUOB 4KZDH 1PKQA 2HLFC 4UDTB 4JY5H 5CZVH 4HIEB 4KUZL 1B4JH 4PGCA 1R6VA 3G5VA 4NPYB 4APQA 2P1YA 2H3NA 4QXWA 3UTSA 4F7PB 4Y4FA 1KCGC 1Y0LB 4OFYD 1FIGH 5D93B 1E6JH 1MUJA 1GHFL 5MHSD 1KN4L 1IZJA 4OF0A 5F9WB 2V5RA 3EFDH 3CCHA 1FFOB 3NFSL 3ZE2E 2NXYD 3BAEL 5GGSB 5DD0L 1BF8A 1EPFA 2V2XB 5SV3A 4WW2F 3KYMB 1WAAF 3FFCE 1U0QA 1ED3A 2C4FU 4ZG1A 5D2NE 4CADB 4JDZA 4KDTA 4PJIA 1RV6X 1VADB 4PRPD 3CMGA 2CDGB 4JG0L 2A2QT 4PGBA 3SPVB 1DVFC 1ZSDA 2Q7YA 3R8BB 2FWOA 4A6YB 1R5IA 3OKEB 1MHHB 1QP1A 2ZUQB 4LVHC 3QCTL 5F7MC 5FUZH 4XBGB 1OSZA 4M8QB 4N8PA 5JNYA 3E6FA 1T89C 3QUXA 4R4FH 3WS6C 4AIZA 1BVLA 4NZRH 4Y2OA 4IHOB 1F3DH 4MLSA 1QR1B 4Z76A 5FGSA 3VFWA 1K4CA 2YN5A 4MVBD 4GG6E 4ODHL 1FZMB 1EBPA 1P4IH 2IAMB 4Z7NE 1AKJB 3GSRB 1F5WA 4GO6B 5DSCA 1OLLA 2P44B 3UO1L 3RIFK 1JF1B 2GHWB 2X4UA 1T5WA 3V52H 5KSVA 4QTHB 5D5MF 1IEHA 5E8EB 4ZYKB 1F58H 4OV5A 3IKCA 3GJFH 3BIKB 3MMEB 4XPTL 4F7MA 1M7XA 5EOQL 2LTQC 5JTWA 1OSPL 1R3JB 3ILPA 3ZE1F 4LPXA 1JPFA 2ICCA 1N6VA 3MCKB 3MX0A 3SQBA 3QFJD 1EJ6A 3NN8B 1I8KA 4LQ1A 3WN5C 2HTLC 3RZCB 1MF2L 3AY4A 1U8HA 4ZXBB 2X1XR 3BPCA 3LN5A 5ESAA 5TF1H 2D0GA 3H9ZA 3OWEA 3GNML 4PY8I 1DR9A 5EBWB 1P4BL 4U6TA 1NDGB 3CFDA 4PGDB 5C6WH 3LDBC 4OZHF 4I3SL 4M1CD 3TPUB 4QRUB 5C0DB 3GKWH 3T2PA 1FAIL 1A4JB 3QQ9D 4G6MH 4WI2A 5T3ZL 3SBWA 3GJFK 2H1PL 5CJXA 3SDDB 1N3NA 5E4EC 4NN5C 5L8LB 2DKUA 4GXUN 3BRDA 1UYWH 1FRGH 5E7FA 1IKFL 2EDDA 2FX8H 2R1YB 5K9JH 3L95B 5EFIB 4G6KH 3REWA 1U8JB 2DLTA 5ESVA 3BP6B 3F58L 4JREC 5HY9A 4GKSA 2ZSWA 2R2HA 3ZDYF 3EJZD 1OD7A 1F90H 1EHXA 3D3VD 2AEPH 4GG6A 3FAWA 5EZOL 5C0CB 2PXYA 4RGND 1QSFD 1UQSA 1UT9A 4U1IA 5CD3B 1JGDB 1G9NH 4QF1B 1QA9A 3BISA 4EJ1C 4F80A 2IBZY 3ZTJG 4XBEH 5FGRA 2HMIC 3QUYB 3FO0H 4M7JL 4NCDA 3R0MA 2NY6B 3SGDI 4LAQH 3CDYA 4WU5A 4GAGL 3PJSA 1T5XB 5DMJB 4MD0A 3V4PH 1DDHB 5JW4M 1NMCB 5FB8B 4TNVF 3G6DL 3OZ9H 3SDAA 1MRDH 2WP3O 3H3BC 1PKQB 4J3TA 1AY1L 3GJFB 3RY6A 3P30H 1A0QH 3OMZA 4DQOL 3O4LD 3C5JA 4PGCB 3G5VB 4YHIA 4APQB 3UTSB 5MEQA 4NP4H 4Y4FB 1V3LA 3NGBB 3QDMD 2XZCH 2VLJE 1KB9K 1MUJB 3BDXA 4JPWH 2AEIT 4NKDA 4RWYL 2WMPA 1S7UA 3QO0B 1OHQA 3CCHB 5I9QC 1T2XA 4U6VL 3GMLA 5BW7A 3BXNA 1YN6A 3SGDH 4I3GA 4L8SC 3WFCH 2B7DT 3OXRA 1WTGT 5JHDE 4XHJC 5CP7A 1ED3B 1E6OL 1QYGH 1A6ZB 4GBXD 4JR9L 2VRAA 4ZUVA 5JXEA 1AXTL 4MZ3A 2D7MA 4ZAKD 2NXYC 5IVXE 1G7LA 4IBLT 4PGBB 4LMQE 3RVUD 1ZSDB 2FWOB 4M5YL 1R5IB 3U1SL 2R15A 5DJ2A 5GRWA 1YPZE 1BQLH 1OSZB 3TN0A 5JNYB 3E6FB 2UV3A 2DICA 3QUXB 3DX6A 1QBAA 4AIZB 5I1EH 1FNSH 2HWZH 3HN3A 4KQ3H 5EO0A 4Z76B 1P4LA 1K4CB 1D5BA 3CFCL 3MUGA 4GOSA 2DQCH 3C8DA 4Y5YA 3KYOA 5IB5A 2Y72A 2RAMA 2EECA 1NFDF 5DSCB 4AEIH 1AJ7L 2X4UB 5KSVB 1T5WB 1J86A 3WIIH 3X12A 2BDNL 4UV7L 5LGKA 2A1WH 4OV5B 3A6CH 4FFWD 3IKCB 1IE5A 1J0JA 3N1PC 3S36L 4F7MB 3C60A 4KY1H 2OBGA 3ILPB 3ZTJH 5A16A 4OFIA 1JPFB 5HYJD 4HK3N 3L5WA 5KVEH 4TVPE 1VDGA 4GRWE 3ARFB 5E00A 3HNVH 4KJYA 4OCNC 4WUUD 1DLHA 2FRGP 1I8KB 3UTQA 2XWJA 4C56E 2VLJA 1U8HB 4BQBA 2AKRA 3BPCB 5L8KB 4GSDL 7CGTA 4NUJA 3E3QE 4NRZA 3LN5B 4OLVL 5ESAB 1J05A 1NGQH 4NOBA 4HS3A 4FQLH 2ATKA 2K3TA 1JI1A 2BHYA 4ZNCD 4AEHH 3BZ4A 1EO5A 3UZEA 3MV9D 4Z7QE 3QDJD 3LKPA 2VDMH 4NJAL 2G5RA 1D5MA 4MNHA 5FGBC 4PG2A 1BVKA 4KHTH 2APXA 1NGPH 2VB5A 1KPUA 4NM8L 5IVXA 4XNXH 4KROB 2YUWA 4M3JA 1N3NB 5J56B 1CFVH 1T21A 3ARRA 3QXAA 3MRMA 4U4BA 1YPZA 4J3OC 5LBSL 4X5LA 1CL7I 5DQ9A 1Q72L 3G6JA 4YHOH 2CK0L 2GEEA 4JO1H 3S35H 3REWB 5IMLA 4K8RH 2ORBL 5ESVB 5HY9B 2X4RA 2ZSWB 3KJ6L 4GKSB 2R2HB 2ZPKL 1YECH 4K23L 3F6IA 5C6TH 1L7TL 2GK0A 1KCUL 1U42A 5F97E 5ANME 2PXYB 4PY7B 2ZUVA 4XWGL 4CUCA 2AW2A 3S5LG 1UQSB 4U1IB 1QA9B 1GGTA 1BWMA 4KZDL 3BT2H 2JLLA 4YHPA 2I60H 4ISVA 4JKLA 4JY5L 4RGNC 5CZVL 4WU5B 4FXKA 4LGSB 4PD4K 4LDOB 3PJSB 1B4JL 1CL7H 4NBYB 2XTJD 1OTUD 4IRSC 2VZOA 5F9AC 2HKFH 4LFHD 3SDAB 4LPUA 4NUGH 1FIGL 1E6JL 1L6ZA 2ZUTA 1DFBH 4WEUD 2QTEA 3AGVA 4FQHA 3S5LA 1CD9B 3EFDL 4YHIB 2B39A 1K85A 1NCBH 5MEQB 1MJ8H 3E3QA 3QDHA 3QP3A 2H2SC 5I16A 3RJQB 5IFJA 1SJEA 4XVSH 1MVUA 4LEXH 3UTTE 4G5ZH 3MA9H 3GMLB 3BXNB 1YN6B 3MSPA 3ULVD 3OXRB 4JCMA 1PG7X 4RFNC 5CP7B 2JB6A 1AIFA 1MCPH 1YEIH 5FUZL 2DMCA 3WO4B 4R4FL 2BXYA 1L8JA 1G7LB 1QFPA 3EHBD 1FYTD 4NZRL 1Q0XH 3OJVC 3U79A 4IIQC 4I0CC 3NIGF 5DJ2B 4GBXC 1EDQA 4KI5D 4UI2A 3V7MA 1HK6A 1CGWA 3TN0B 3FJTA 3K2UH 4ALAH 3C2SA 3HR5A 3DX6B 1P4IL 3L3HA 4X80H 5EO0B 3RVUC 2PYFA 3K80A 1P4LB 5CGMA 1D5BB 3MUGB 2XY2A 3V52L 4GW4A 2O26U 4Y5YB 4KPHH 3KYOB 1NMAH 5L7XH 2FDBP 4P23C 5IB5B 1F58L 3L5HA 1WIUA 3GMNA 2R2EA 1A2YA 5DMIH 2UVEA 1CDGA 1D3CA 4P2QD 4LKXA 3PWJA 4U0QB 3X12B 1FFQA 3G6AA 4HHAA 1EX0A 4KJWD 4NZJA 2NQCA 1JL8A 2OZ4A 2QR0A 3C60B 5A16B 4XNQA 4G7VH 5TF1L 4HKZA 3L5WB 3ZZ1A 2B1AH 5E00B 3MRHA 4KJYB 1DLHB 2RQ8A 1CE6A 3UTQB 2XWJB 2AKRB 3HI6L 4NUJB 4NRZB 4YPGA 1J05B 4HS3B 3GKWL 4CVXA 2ATKB 3ZYIA 3BZ4B 4G6ML 2VLLA 2YA1A 1WGOA 1J1XH 2YMXH 4QHKI 3KS0J 4X6CE 5IIEA 2CRMA 4D3CH 1D5MB 2IMNA 3UBXG 4MNHB 4HUWA 1BVKB 1NSNH 5JMRA 2ZCKH 4PRHD 1UYWL 1FRGL 1KPUB 3SO3C 3I6LE 4XI5D 5K9JL 3QXVA 5IVXB 1VGKA 3I85A 1DJSA 1BECA 3IJYA 4G6KL 1T21B 1TPXC 3PDGA 1JV5A 3LHPH 4YFLI 1T80A 3QXAB 3RVVC 3MRMB 4FFVC 1WICA 3ELAT 1F90L 1T1WA 5IJVA 5DQ9B 2AEPL 3G6JB 3TVMA 3BWUC 3VG9B 1MH5A 4CVWA 2X4RB 5IJKC 1G9NL 3CSYA 5D6CA 3DARA 3F7YA 5E8NA 2GK0B 3IDIA 4XBEL 3VXNB 2AQ2A 3FO0L 2YPKA 2JJWA 3DURA 1D9KD 3Q6FA 4HUMB 3CPLA 2CRZA 4LAQL 2HRLA 1IAOA 4RX4A 3LS4L 3KLDA 4YHYC 3CX5K 4O58H 4DN4H 3V4PL 3IAGC 4MAYD 4OGAC 1UM5H 3OZ9L 1MRDL 4YHPB 2OZ4H 4ISVB 1F3JA 4CAGA 3N06B 4FXKB 3P30L 1MCJA 1NGXA 4UT9H 3U36A 2MKWA 4NP4L 1NEZG 2XZCL 1J8HD 2PW2A 4JPWL 4GRWB 4Y5XC 2P8LA 4FQHB 1BX2B 3PUCA 3S5LB 5E5RB 1KTRL 3FHQA 2RGSA 2XTJC 1OTUC 4P2RE 4XVTH 1KB5H 3WFCL 3OKKA 1AFVH 5I16B 1RZKC 5IFJB 2VLRE 1SJEB 4AK1A 1MVUB 3D1MC 2XA8H 1QYGL 3C8KA 1T89A 3GMOA 4NQCA 2P43B 3WS6A 4FQXB 2EEAA 5I0ZA 1GOGA 4LARH 3RIFF 4M7ZB 2CKBA 1ETZA 1AIFB 3MRJA 4QLRA 5T1KD 5DRWA 1HKFA 2BY3A 4JQXA 1BQLL 2BP3A 2VO5A 1A21A 3ETBF 4EI5D 3B43A 1GAFH 2W1NA 5I1EL 3HNTH 1FNSL 2HWZL 4I9WD 4KQ3L 3ARGC 4HXBH 3OJDA 2E7BA 1CLOH 4L9LC 2BVYA 2DQCL 1A1OA 3AVEA 3ZKMD 4XNYH 3HR5B 1JGLH 3L3HB 3EHBC 1Z3GH 4KTDH 5D4QA 1JTTA 4L4TD 2PYFB 4AEIL 2P5EE 4LPCA 2N7AA 4GW4B 4RGOH 2APTA 3WIIL 1AGCA 3ZSTA 2A1WL 5SWZE 3GMNB 2R2EB 2XICA 3A6CL 3QPQD 4QHMA 3LCYA 3NCJH 1P53A 3QXUA 1NAMH 3OSKA 4PJEE 5D96B 3PWJB 4KY1L 2VUYA 4HIIA 3BEWA 2E8YA 4F15B 3BKMH 4IOIA 2OM5A 5KVEL 4NRYA 3G6AB 1CTOA 4HHAB 3GEWB 4PGJA 2YUXA 2VJXA 3HNVL 1Z9SA 1SM3H 5CSZA 1EHNA 2PTTA 4RRPA 2QR0B 1OM3H 5KVFH 1PY9A 4QY8A 1I1CA 2QLVB 4XNQB 1NGQL 4HKZB 1QVOA 4FQLL 4NFDA 1EGJA 3KJ4C 3MRHB 3KNBA 4NN7C 4P2RA 4AEHL 4KJWC 5DC4B 3RBSA 1CE6B 2VZ3A 4POYA 1TENA 5F6HI 2VDML 3CXHK 4S1DC 4N0RA 4CVXB 2DIBA 1KJ2H 4X4ZA 3O6FD 3JZ7A 4KHTL 3QUZD 1NGPL 2CKNA 3GGWA 5F7EH 1KB5B 2JTDA 2VLLB 1DN0A 5H94A 3C87A 3ROLA 4RA0C 4XNXL 3SKNA 1A1MA 5IIEB 4NC1E 1CFVL 2J2ZA 5I17A 4WFHD 3MJ6A 4HUWB 2BERA 1WCBA 4HKXA 2AI0H 4YHOL 5C1MB 4JO1L 5D71H 1VGKB 2HFGH 4OCSH 3S35L 4RFEA 3IJYB 4K8RL 1JV5B 1U8PA 5L2KD 4PY8J 1FP5A 1QACA 3S96A 4HC1H 5K59F 1YECL 5GSRA 3AM8A 1T1WB 5IJVB 5C6TL 3HCVA 5SX5H 4N90D 5KZCD 2DWDA 4NQED 3NPSC 3TVMB 4LBEA 4HCRH 3SKJH 1X7QA 4I8DA 4WENB 3PP3H 5D6CB 3VXPA 3F7YB 4NQUA 5E8NB 3IDIB 1HH6A 3BT2L 4RAUA 3Q6FB 2YPKB 3DURB 1LD9A 1B2WH 2I60L 5SWZA 3CPLB 1HCVA 1IAOB 5K9OA 4PJEA 1CL7L 4G9FD 5EU6D 2HKFL 5LQBH 5HHOD 3VXUD 3S37X 1FSKB 1T1ZA 4NUGL 1F3JB 1D9KC 3HMXA 3QFJE 1DFBL 3L3KA 4M6AA 1UZ6E 4UOJA 4FTVD 1HE7A 5EOTA 1NGXB 3B9EA 4L8SA 4ONOA 3U36B 1GYAA 1DQJA 1MCCA 1NCBL 4OFYA 1PJ9A 1MJ8L 3EW3B 2Z4QA 4LGPB 5J1TC 3MV01 5CJOH 3WIHA 4HGWA 2PW2B 4JFXA 5J57B 2P8LB 4XVSL 1MCQA 4LEXL 5SX5K 4OZGF 2K7QA 3MO1A 4G5ZL 1I1FA 3MA9L 4TPRH 2CIIB 3OKKB 2WZPD 1MY5A 4LVHB 3PP3K 4J12A 4RFOH 3AB0C 1BHGA 1MCPL 3C8KB 1YEIL 3GMOB 4NQCB 5B38G 4PRPA 1NUGA 2PYEE 3AMLA 4PJBF 4R3SA 2CKBB 3DIFA 3JSSA 1ETZB 3ZDZF 1Q0XL 1Z9MA 3BDBA 5DRWB 4D9LH 1A22B 4MX7A 1UH3A 35C8H 4KHXH 3K2UL 4ALAL 3LD8B 2ERJC 2KDGA 4X80L 4IDLA 5I73C 1UVQB 4MVBA 4BFEA 2BOCA 1CD0A 3D3VE 3JUZA 4JVPA 3MUY1 1A1OB 4Q2ZA 5L7XL 4KPHL 1NMAL 1HDMA 4EI5C 3A6BH 4FFYH 2LTQB 5DMIL 1EIBA 5KSBA 1MFDH 3K8KA 3N50A 2Y6SD 2KUTA 2AK4E 3C9NA 2I9TB 1AGCB 1KCSH 1KLGA 4QHMB 3HMXH 3L6FA 5T3XH 3R0NA 4JGUA 3IDUA 2HFEA 3T04D 1YMHA 4HIIB 3BEWB 4G7VL 4IOIB 3QFJA 3LQZA 5FOJA 4NRYB 2B1AL 3UDWC 3LDBB 4OFVA 2FH8A 3QPQC 1H3PH 5CSZB 1OT2A 4OCMC 3MCLH 4YNYA 4P57A 2PTTB 4HJGA 3QDME 4Z7UF 1B6DA 4QY8B 2ZJSH 4Y16D 5FGBA 1N2RA 1QVOB 4PRBA 4TN9A 3KNBB 4P2RB 3TF7C 3TJHA 2HJLA 1J1XL 1QD0A 3OG6B 2YMXL 4LLWB 3ISWA 4WTZA 4J2XA 1HOCA 1CLYH 1C5DA 4D3CL 2PTUA 3BO8A 2WWKO 3U30C 1NSNL 1ACYH 2ZCKL 3GGWB 3WFBH 1DN0B 4I77H 5H94B 2Z8WC 1WISA 3LAFA 3ROLB 4PD4J 4YPJA 3SKNB 1A1MB 3OTTA 2OTPA 5I17B 3LHPL 5FV1L 3VH8G 1OTTC 2BY1A 1WCBB 3O6FC 3DX8A 3QUZC 4HKXB 2J12B 3MOQA 4LPVA 1N0LA 2XPGA 4RFEB 4DGYH 4DUWA 1U8PB 3PNWB 4ZFGH 3UTZA 1X5GA 3GBMH 5AAWA 3S96B 2AV1A 3C08H 3VE0A 3D3VA 4DOHE 5GSRB 2JCCF 5C09B 3HCVB 3BHBA 1QSFA 3O3AA 4M9OA 2DWDB 4JY6A 4I5BA 3HC4H 5JMOC 4UQ2A 4LBEB 1A6VH 3VFVA 5FYLD 4OLZH 3DYMA 4MDIA 3VH8A 4O58L 4DN4L 2RHEA 3MRKA 3VXPB 3OKDA 1HQ4A 1UM5L 1HH6B 1U8MA 3P3YA 1YUHA 4RAUB 5JQHC 1LD9B 2OZ4L 4HULB 1I9EA 1MEXH 1A7QH 1CGSL 5K9OB 3KYAA 4PJEB 3P11H 4UT9L 3D0LA 4ZS6D 4JFFE 3NZHH 5DHYA 1T1ZB 2ZG1A 4LSRH 3X14A 1D7FA 1DN2A 3QNZA 2VITA 3O4LA 3L3KB 2DQHH 1JZ6A 5EOTB 3OJMB 4ZNEE 4L8SB 1DQJB 3QDMA 2C7UA 4XVTL 1KB5L 2ED7A 1AFVL 3GSNA 2VXUH 1UCBH 4JFXB 4JHAH 2XA8L 1P1ZA 2NXYB 4JVUA 3MO1B 1XGQA 1I1FB 4LSVH 1K8DA 3MV9E 4LARL 1LGVA 1JBJA 4IIQA 3ZKXC 4GBXA 4R96B 3RPKA 4X98A 3WNOA 3V5KA 4ZAKA 4PRPB 5FOBA 1E4KC 1CQYA 1GAFL 3C09C 3MJ9A 3B4NA 2VMFA 3HNTL 3EDKA 4R3SB 4JANA 3DIFB 2F15A 1KTDA 3FQUA 4CU8A 3VDAA 2UWEF 1KJVA 4HXBL 1CLOL 1K6QH 4NFCA 1JYNA 4MX7B 1NC4A 4Q6IC 2Y23A 4QXTA 4XNYL 3VGFA 4DUVA 1B3JA 1JGLL 2CJUH 4GS7C 1Z3GL 4KTDL 1YEFH 1ADQA 2BOCB 3TZVC 4Q2ZB 4RGOL 1HDMB 4WW1A 5E6YA 4O02H 5JR1H 4PJDF 4N9GA 3NCJL 5KSBB 1FCGA 1NAML 3X3GH 4Y2DD 3RY5A 5MEOA 2FB4H 3SGKC 4HS8H 4JM2D 5DVMA 3C9NB 3BKML 1G7MA 3CGTA 3BRFA 12E8H 1KLGB 1UWEH 3L6FB 2X40A 1SM3L 4M4PA 5LGJA 1K5NA 5EO9A 4NIKB 5HYJA 1YMHB 2VABA 1OM3L 5KVFL 1VENA 1KEMH 1MFNA 2X7LA 3QFJB 3LQZB 5JUEH 3KPNA 5KANI 3GSNH 2Y07H 4WUUA 3VXRD 4ZNEA 2GY5A 1VFUA 2DQUH 3MBEA 3GBLA 4Y0GA 4YNYB 4P57B 4HJGB 2XQYG 3EFFA 5GZOD 4X9BA 2FL5A 1N2RB 4PRBB 1M05A 1KF9B 2YXMA 4N9OB 1KJ2L 2Q76A 5E08H 3L7FB 4OF6A 2VR9A 1UJ3A 5F7EL 2GAZA 3MV9A 3QDJA 4N0CC 4XX1G 3LS5H 3ULVE 5L2JA 1HOCB 3K4ZA 4DCQA 3AROA 3CX5J 2AJVH 1C5DB 3MJ9H 3BO8B 1PAMA 3AAZB 2VL5A 4Y7MA 3RWIA 4I48A 4ZFZA 4F7EA 3ARSA 1I1YA 2AI0L 3BEVA 5DRNA 3WSQH 5D71L 5M7QA 2HFGL 4OCSL 3CVIH 5IJKA 1FYTE 3KPSD 4B7IA 1I3GH 4N8VA 4WIQA 1WBYA 1IKNC 4HC1L 4KI5E 1ZT7A 1O7VA 4PJCE 1I9RH 1DL7H 4KRNA 5IEKA 2XPGB 4I0PC 4RMTA 3IAQA 4OLEA 4HCRL 5BRZE 3OGOE 3SKJL 1OAUH 3UTZB 2AV1B 3VE0B 3D3VB 4JFHD 4X7SH 1PVHA 4RGNB 3BHBB 1QSFB 3O3AB 4JY6B 4I5BB 1B2WL 4UQ2B 4MLIA 4QHKJ 5JPNA 2D0HA 1G0XA 5GGSY 3VFVB 1AC0A 3D2UD 4P2QE 4WHYG 1UZ8A 4MDIB 3VH8B 4CJ0A 3QSKB 2GITA 5LQBL 3OKDB 1HQ4B 2V2WA 1U36A 1OPGH 4MQSB 5C86A 5D6DA 2VQ1A 3DO3A 2VDRH 1KPVA 2VZSA 5FM8A 3SDXE 1XF5A 3DWTA 3D0LB 1KLFA 1XR9A 4Z7WE 5CJOL 1U58A 4HIXH 5DHYB 1JZ8A 1GIGH 2CR3A 3X14B 1RURH 3QNZB 2VITB 5FHAH 3O4LB 1FFRA 5EIQA 3QDMB 2C7UB 2IGFH 4RFNB 4TPRL 2W0LA 4PJ9D 1CFNA 1H3GA 2VZUA 4OCYH 3GSNB 1ZLSH 4YWGH 4QRTA 4MXVF 1C8PA 4RFOL 1P1ZB 1XGQB 1QHOA 1INDH 3ULUF 1K8DB 1MHEA 4BM7A 2AEWA 5BOZG 4IIQB 4GBXB 3AXLA 3GMRA 4ZD3H 4PRHE 5C0EB 4S0UC 4D9LL 3V5KB 4ZAKB 3ARDC 3NA9H 4QHNB 5BOPA 35C8L 1YEJL 3NH7H 5FOBB 4KHXL 4X6FA 1FYTA 2FIRT 1E0OB 2B5IB 4JANB 1CGXA 1KTDB 3FQUB 1OF2A 3RFZC 2P24A 4PJCA 1KJVB 2XG5A 1NC4B 4QXTB 3SE3A 2R0ZH 3QCVH 3A6BL 4FFYL 2ICWA 3TCXA 2E5EA 4GAFB 1MFDL 3T77A 3ILQD 5DFVD 4YDLC 1KCSL 1AD9A 4P2QA 3B5HA 1MSPA 4N9GB 1HH9A 4X8JA 5HGDA 3HMXL 9CGTA 5B8CC 5T3XL 4GMTH 2XQYK 1GH7A 3VD7A 1F6FB 1RZKH 1SJHA 4F58H 3CMOH 1G7MB 3OKNA 1W2KT 2CO7B 2CDFA 3SDXA 2HVJA 1H3PL 4WHYH 4WO4D 5LGJB 1K5NB 5EO9B 3MCLL 4Y2DC 4Z7WA 5HYJB 1T1XA 2VABB 4M00A 1XGRA 2ZJSL 4FQJH 5LVEA 1JI2A 2DN7A 2X7LB 4AMKH 1J8HE 1GGBH 4JM2C 4QEGA 3KPNB 4U7MA 4WUUB 5CLWA 3MBEB 3IGAA 3MBXH 4OF3A 4Q9CA 3EFFB 5EBGA 3RY4A 1DQLH 2FL5B 2BVPA 1M05B 3WE6A 1CLYL 4ZUTA 2AABH 1VFBA 2PR4H 2Q76B 4FHBD 4XMKH 1UJ3B 1JNLH 2VDPH 1ACYL 1CK0H 2GAZB 3MV9B 3C8HA 3QDJB 1HXMA 3WFBL 3T4YA 4I77L 3JWDC 5F6IC 1KCVH 2P7TA 5L2JB 5GZOC 3T0EC 1WEJH 4PRHA 2H26A 4UBDD 3RWIB 2DLFH 4I48B 5C08E 1ACZA 4ZFZB 1FC1A 5DD1L 4F7EB 1CLCA 1NL0H 1I1YB 3BEVB 5SWSD 1CTNA 4DGYL 7FABH 2NXZD 4N8VB 1UWGH 2ZNXA 1WBYB 4RMVA 4ZFGL 3GBML 3C08L 3O4OC 1U8IA 5MERA 1ZT7B 2ZUSA 1IAMA 1PLGH 5EULV 5IEKB 3HC4L 4ODXB 5F6HJ 4WFFD 2VLME 4FOMA 1A6VL 4OLZL 4M9PA 4YJZL 4JVWA 2DS4A 2BHUA 1FPTH 1D9KA 3TBTA 3GUTA 3RI5K 5JPNB 3QUMH 1MEXL 3B2UD 1A7QL 4JQVA 2KQMA 3ARZA 1UZ8B 3P11L 1X5YA 4MAYA 4Y4KC 5E56A 2IEPA 2GITB 3WLWD 2V2WB 4LCUA 4Y5XB 3NZHL 2YA2A 4YBLC 4AZ8A 4PGEA 4Q9RH 2VQ1B 4LSRL 1KPVB 3EGSA 4MJ2A 2XTJB 5C0AD 2DQHL 2MOVA 3D25A 3V0AC 3ARBD 1XF5B 1J8HA 1XR9B 4PJFF 1U58B 3LOWA 3DYOA 2VXUL 1UCBL 2DRUA 3FHAA 4JHAL 4ZUUA 5IEHA 1GVIA 1P6FA 4JO2H 4LSVL 3TFKD 3B8SA 4E41D 4OJFL 1CFNB 5HGBB 4QXUH 2C3XA 5CS7A 2F8OA 2ZZUT 4QRTB 4ERSH 3WNLA 3UYOD 3SN6N 3MLTA 1DTUA 3QWOA 1J87A 3BZEA 2P42B 1MHEB 3TESA 1G1YA 4PJ9C 3ARED 4RAHA 4NJ9H 1KJMA 3HRZA 5T1KA 4WDIA 3AXLB 3GMRB 3FRPG 3DTXA 3IF1A 1K6QL 4EI5A 3CLEH 5I1CH 4X5XA 3VFTA 2QQKH 4X6FB 1FYTB 2CLZA 5F44A 1JIBA 3BD4A 2CJUL 4XWOD 1OF2B 2P24B 4PJCB 1EMTH 1YEFL 2A9MH 4MJ5A 3ZT5A 2A0LD 2J6EA 1T1YA 4OZFG 4QRSA 5ADPH 4L4TA 4O02L 5JR1L 2ICWB 5FKAA 5L6YH 2IADA 3X3GL 2WINA 3T77B 2FB4L 2OMBA 3OR7A 3CVHH 4XB8A 3T3MF 4HS8L 3VXOA 1FORH 3BUYA 3HAEG 2JKXA 2OJEA 3SQOH 1AD9B 4P2QB 12E8L 4OLWH 1HH9B 4X8JB 3MFFA 5HGDB 1UWEL 4G9FE 3BE1H 1IGFH 1JWUA 2C4FT 4MD5A 5IOPA 3VXUE 3NOIA 3ILQC 2X4OB 1JP5A 3L1OH 1SJHB 1KEML 1JTOA 4BSJA 4NN7B 5KVMC 3BYYA 2G75B 5JUEL 2C3HA 5IB3A 3EYSH 4X7CC 5ACMA 2CDFB 5A2IH 3SDXB 5I30H 2HVJB 3BQUD 3GSNL 2Y07L 3VFSA 4FTVE 2X1QA 1Z5LA 2DQUL 2NNAA 1JWMA 2KPNA 5DUPH 1T1XB 2VR4A 4X4YA 3HAEA 1XGRB 1ORQA 3NIDF 4KAQH 5E08L 3IGAB 4WO4C 1S5HA 4HUXA 3LS5L 4X9IA 2BVPB 3WE6B 2AJVL 2EKSA 3O6FA 5FHBH 3MJ9L 4ZUTB 1VFBB 3QUZA 3UZQA 2PNDA 1ZAGA 1MCIA 1RHFA 1HXMB 5DQDH 1J0KA 4CN6A 3T4YB 2P7TB 3WSQL 5J1AA 3CVIL 1I3GL 3PWPD 4PRHB 2H26B 5IR1A 1YEDA 3JV6A 1I9RL 3B6SA 1DL7L 3X11A 2FIKA 4Z77A 4ZTPH 1M7IA 4MQ7A 4YHNA 1GC1C 2FO4A 1ITBB 2DBJA 1OAUL 2P46B 4WW2C 4KKNA 1VPOH 1U8IB 2YBRA 5MERB 4X7SL 1KXQE 3RP1A 3T2QA 4BZ1H 1OT1A 1WT5C 5CLTA 2VIRB 2NXZC 1Z9LA 3LN4A 3OL2A 1U92A 1D9KB 5GSVA 2HT3C 2FECI 4QTIH 3P73A 3TBTB 3GUTB 1OPGL 3KLSA 3ZYJA 5HI5D 4HFWA 2FLRT 2VDRL 4G9FA 4OZFH 1PKOA 5EU6A 4D0BA 1J0YA 4OBSA 4MAYB 5HHOA 3CVHB 3VXUA 1YC8A 3VGAB 4LCUB 3F65A 4HIXL 3HAEH 1GIGL 4PGEB 1RURL 4FTVA 4JRXD 5FHAL 5GGVY 3B2UC 5E1AA 5IHUH 4X99B 2IGFL 5JDJA 2MPAH 1D6EA 1J8HB 3WLWC 3AB0B 4X7TA 4OCYL 2BCKA 1ZLSL 4YWGL 1MRFH 4ZUUB 3ZYOA 5IEHB 1EVTC 3O8XD 1INDL 2VDQH 4MNGE 1IAII 4Q9BA 2GTWA 1UB5A 3KLHC 1NGYA 4PTUA 4ZD3L 2AVGA 3MLTB 1MQKH 1V3KA 3QWOB 4NRXA 3BZEB 4HWNA 3NA9L 3ZSSA 1F4HA 2ERJB 3NH7L 4FA8A 4Z7OE 4PJ7F 1K2DA 5C0NC 1KJMB 3KHQA 5T1KB 4WDIB 1TCMA 3RRQA 4LVOC 5J89A 3DTXB 3IF1B 4HSQA 1H3XA 5HI4D 4EI5B 4ZO9A 3VRIA 4WHTB 2NYYD 5ENWA 2DQIH 4X5XB 3VFTB 4QYOA 2EO1A 2R0ZL 3OAZK 2CLZB 3QCVL 2H8PA 3SGKA 3AREC 4P4KC 3PABA 1L0YA 3S88H 5F96H 4MA1C 3TPKA 4MJ5B 5EH1A 1IAIH 2Z93A 3MZTA 3NIFE 5DEZA 5T3ZD 3NBNA 2XRAH 3B9KD 1T1YB 4QRSB 4IJ3C 4RCAA 4XT1C 1MI5E 4L4TB 5FKAB 4F7TB 2OTUA 1FFPA 2IADB 2CQVA 1G1CA 4Z9KB 4XWOC 2WINB 3TO2A 4GMTL 1JHKH 3OR7B 3KPRE 2WANA 1RZKL 3VXOB 3BUYB 4F58L 2OJEB 3GSXA 3CMOL 2A0LC 3KXFD 1WJ3A 3MFFB 2X9WA 3VRJA 1JWUB 1LP9E 2EIZA 2YD8A 4MD5B 5IOPB 3RWHA 1A3RH 4FQJL 4AMKL 1GGBL 4OZFB 3WFHA 4Z7VF 5IB3B 1ZT4A 5J12B 4XP4H 3VFSB 3MV7D 2X9XA 1Z5LB 3I3BA 1KGCE 3MBXL 2NNAB 1JWMB 4OIBA 1XAUA 1YA5A 4Y16A 4X4YB 3HAEB 4EI6A 1DQLL 4KJPD 2MQCA 4JKKA 4IRJC 2HVKA 2AABL 2PR4L 4OCLC 4WGVB 5KG9A 1EO8H 5E8OA 4OZ4A 3BQUC 5L0QB 5F7UA 2VDPL 1JNLL 1RI8A 1CK0L 4QRPE 4E5XA 2ZUXA 1S5HB 3CU1A 4HUXB 1KCVL 4MNGA 4G9DA 3ES6A 1IMHC 5J0BA 2EKSB 3O6FB 2WBJD 2R9HD 5C9KA 3SJVE 1WEJL 3QUZB 1Y6MR 2DLFL 4DZ8B 4MA8H 4LP4A 3V6ZA 1NL0L 2NR6D 5J1AB 3FO1B 3CC5A 4TSBH 3NVQA 1VEOA 4WRLA 7FABL 5IBLC 1UWGL 4NZUH 1BFOA 5EBMA 3T2NH 5DA4A 1Y18A 5B39G 1YEDB 1J0IA 4RBPH 4B5EA 5IR1B 1G9MC 1QNZH 1MJJA 3JV6B 3B6SB 3GJEA 1LDPH 1LNUB 3X11B 1PLGL 5F7NC 3MOAH 2FIKB 1NCTA 3HMWH 4KQ4H 4Z77B 1CFTA 1M7IB 5L2KB 3QYCA 4MQ7B 4YHNB 2FO4B 2BJMH 2YBRB 4S10A 1FCCA 3CFKA 4YBHA 5KZCB 1FPTL 2C5DC 4NQEB 4PJXE 3KPOB 1AGDA 3SDYH 2W0PA 4H0HB 1VFOA 3CFEA 1XIWD 3QUML 1IGIH 3LN4B 4ZFOL 5DZOA 1KC5H 1U92B 5F21B 2NY1D 2E8ZA 5GSVB 3P73B 1WK0A 5JPMA 3DXAD 4HFWB 3D39D 4Q9RL 4MCYA 3KVQA 4G9FB 4UT7H 1ZWIA 5EU6B 4D0BB 1LP9A 5HHOB 4FXGA 3VXUB 3T0AA 3MCG1 4XVUC 3V4VH 3RWDA 3ZE0E 2VLKD 4NHUE 2Z92A 3IYLW 4RBPK 5IG7A 4FTVB 5C3TA 1QBBA 2RR3A 5HI5C 3RTQD 3TBWA 5E1AB 1BM3H 1M71A 2WAHA 2XKSA 4G8IA 4JO2L 4YE4H 1WFUA 1D6EB 1K3ZA 1LHZA 4QXUL 3KYNA 4ERSL 1RU9H 4QRPA 1YEHH 4P2OD 4HMDA 3C09B 2ZWLT 4I2XE 5E2UH 3ZKNC 4JJ5A 1P9MC 4NJ9L 3MJGX 2GTWB 1UB5B 3LEVH 1NGYB 3D85D 4F8TA 4M6OH 4NRXB 3MRQA 3CLEL 5ESQA 5I1CL 5KS9E 4JFED 4GS7B 2QQKL 5ERWA 1QRND 3O45A 1WBXA 1K2DB 1VEMA 3KPSE 4PJIF 1MCHA 1CF8H 1O7SA 1KIUA 2OQJA 2B0SH 4HK0A 1EMTL 2A9ML 3VFPA 4L4VD 4TUOA 3VRIB 5ENWB 2EDNA 5DK3A 4WNQA 1DSFH 2ZOLA 4QYOB 5K33A 5B8CA 1IEBA 3GZKA 5ADPL 3NZ8A 4B53A 2H8PB 5FYLH 3PABB 4P5MB 5L6YL 4JFHE 2Y36H 1WZLA 4PJXA 3MV11 5C71A 2K1MA 3CVHL 4WWKA 1XF2A 3CH1A 4HFUH 2Z93B 1FORL 3ZMRA 4OBRA 2NYYC 1CT8A 3W11D 5TFSH 3SQOL 4RGMC 3MJ8A 4Y2DA 2OTUB 4OLWL 3NCEB 5FEBA 1FFPB 3BE1L 1IGFL 2I5YH 3TO2B 5IP4A 2FEDD 4JM2A 2EIDA 3PWVA 3TNMA 3L1OL 1MFBH 1EK3A 2CUIA 3DROA 3GSXB 2PCPB 3EYSL 1I4FA 3B9KC 5I30L 2OSLA 4R4NC 3VRJB 2EIZB 5CBAA 4GRMB 2GTZA 3OAUH 5DUPL 3RWHB 4NHUA 5IWLC 2ZG3A 2XKNA 3WFHB 5C0BD 3VXRA 5J6GA 1ZT4B 4NKMB 1JN6A 4KAQL 1IC7H 1RJZA 3RWCA 2BVQA 5I8KH 4ZSOA 3BPLC 4Y16B 4EI6B 3D6GA 5FGCB 5C9JB 1DP0A 5FHBL 3NFNA 5BS0D 2HVKB 5KG9B 5E8OB 4OZ4B 1HSBA 5IV2A 4R8WH 3TT3H 3QJFA 4E5XB 4K71B 4XTRD 4BQ6A 1XR8A 5DQDL 1O0VA 5DT1H 3ZE2F 4MNGB 4G9DB 3ES6B 2FHCA 4KJPC 2IH1A 2YN3A 5DHVA 5FM5O 4OIAA 3RI5F 3QA3A 5KS9A 2JJUA 3V6ZB 1L4IA 1MOEA 1KBGH 2MHAA 3WXVH 3KPSA 3BGAA 1RUKH 1K9TA 3CD4A 5FCUH 3CC5B 4ZTPL 3V6OE 3LQMA 4GXVH 5IROA 1BFOB 5EBMB 4JKPH 2WBJC 2R9HC 1Y18B 1VPOL 4OZIE 1MJJB 2ICWJ 5K9QG 3GJEB 4BZ1L 5E9DD 4DEPC 3S8WA 2NR6C 3IRZA 3O6MH 5CBEB 1D5IH 1EJOH 1F4AA 3L7EA 1I1RA 3CFKB 2VTFA 5F71A 4XC3H 4P2YA 4QTIL 5JO5A 1AGDB 2EDYA 3F6LA 4L29A 2Y9RT 2BY0A 3CFEB 3EZ8A 4GG6F 3EJYD 2QQQA 3D2UA 4GKNA 3OR6A 2LE9A 4PREA 5DTFA 4S1SH 1MAJA 5IBUG 1YNKH 5CFHA 1ZS8A 2GCYA 1ORSA 5JPMB 4G8EA 1WFNA 4MCYB 1OP9A 1FE8H 1QHPA 2R39A 1XIWC 1ZWIB 1LP9B 1R3LA 5IHUL 1NDMA 4MB4A 4FXGB 4POZD 3JWDH 5F7YC 4HZLA 1J12A 1NGWA 2NY1C 2MPAL 1IT9H 3RWDB 5B3NA 2Z92B 1QEWA 5IG7B 5HD8C 2UVFA 2UYLA 2KBGA 4HQQH 1MRFL 1MPAH 4XPHH 2FECL 3EDDA 1M71B 2MKLC 4G8IB 3ZL4H 4JFZH 5B22A 2VDQL 1A64A 3PE9A 3KYNB 1L9NA 2A6JA 2J8UF 5JW4R 4ONFH 3IDYC 3RTQC 1MQKL 3QIBD 5DK0A 4JGJA 1FFNA 5F9JA 1KFAH 1T7VA 3IJSA 5IB4A 4YDKH 3QISA 1ROWA 5CD5D 1R3HA 4JJ5B 3ZKSD 3AMKA 3F7VA 5K9QI 3A67H 4U7SA 1F8TH 3RUGA 1RJLA 4O2CA 3MRQB 4P2OC 5ESQB 4J3VA 5F89A 2DQIL 5ERWB 3T0DA 1WBXB 1DANU 1CGVA 1NUFA 2V9TA 3JTCA 3S88L 4ZOCA 2AGJH 2XFXA 4HK0B 5F96L 4P46C 3VFPB 4KK9D 5F1OB 4WNQB 1IAIL 3MLZH 1LMKA 2ZOLB 4RMWA 2XRAL 5B8CB 1IEBB 3Q5TA 4LRNH 4U6HB 3NZ8B 1RSFA 2EDRA 4Y19D 2NZ9C 1DCLA 5DFWH 1JHKL 1CE1H 4ODVH 1XF2B 3CH1B 2PTVA 3W0WE 2EDHA 1CT8B 5FECA 3RL2A 3MJ8B 4Y2DB 4DKFH 1CN4A 4JM2B 4BKLA 3TNMB 1JYXA 3PWUA 1A3RL 1H8NA 1IC1A 2IANE 3DROB 5D5ME 3VFUA 2CRIA 1HYSD 3R06A 3W11C 1I4FB 2FHFA 3DI2B 1AXIB 3HE6D 4WO4A 4XP4L 1Z2KA 2OSLB 5GRXG 1HN1A 2JJSC 5TE7H 5CBAB 3OKOA 2GTZB 4KMTH 3DYPA 2FEDC 4NHUB 3UJIH 3GRWA 5E5MA 2XKNB 5J6GB 3VXRB 3RGVA 1JN6B 4W68A 3RWCB 1QQDA 3DUHA 2BVQB 4WJ5A 5F6IB 1EO8L 1BF2A 2BNQD 1A6TA 4H8WC 1HWGB 4ZSOB 2FBOJ 1G7IA 4XXCA 1JPTH 4IRZH 3Q1SH 3GIZH 3UTPD 2EE2A 3NFNB 2M26A 1HSBB 5IV2B 5FXCH 2QADD 4MA8L 3QJFB 8CGTA 1XR8B 4F57H 1T6VN 1O5DT 2HT4D 2DJUA 4OZHE 4WW2A 4TSBL 4MYWB 1WAAA 2IH1B 4NZUL 1S7TB 5DHVB 3T2NL 1ZANH 3EO0A 1WT5A 5KS9B 1QNZL 3P2TA 2F53D 4S0TD 5SWSA 1DUYA 1LDPL 3KPSB 4XAKD 2E6PA 3MOAL 3HMWL 4KQ4L 5CGTA 5TJWK 2P5WE 1JZ2A 1FNGA 3DGGA 2HT2D 3QT2A 3G5YA 1GXEA 5CHNB 2BJML 3FQXA 1VKXA 3MLYH 3S36X 1CGTA 4Y88A 3U4AA 3CZJA 3MUZ1 3SDYL 3MRCB 5C8JA 2OL3A 4JFDD 1IGIL 1T0PB 5LG1A 3LIZH 4YBLB 3L7EB 1KC5L 3ZDYE 4WUKH 1NGZA 5JO5B 4L29B 3T4AA 3WMSA 5D1ZD 1LO0H 3D2UB 4GKNB 3OR6B 4UT7L 4JGMA 3N1QC 4PREB 5DTFB 1A4KA 1JMXA 4RWHA 4L1DA 32C2A 2E3VA 1ZS8B 5D5MA 2IPUG 2GCYB 3V4VL 1ORSB 5C0AA 3GRWH 4G8EB 3IXAA 3ARBA 3EJYC 2ITDA 1QBMH 1R3LB 2GUOA 1BM3L 2Z35A 4O51A 4HZLB 1NGWB 1X4YA 3F5WA 3HS0A 4JHBA 4YE4L 5H2BA 4IMKA 4YH6A 3HC3H 1QEWB 3NA4A 4O9HH 1RU9L 2UYLB 3IVKA 1YEHL 2BX5A 3TFKA 4PJ9B 4U0RC 5EU7E 5EOCJ 1WUNT 1YMMD 5E2UL 4K7PH 1GC1H 2Q1EA 5FUCC 5DLMH 4QWWD 4KK5C 3LEVL 3SGJA 3SKOA 1QFWM 2A6JB 4M6OL 4OCWH 3WL9A 5DK0B 1FFNB 5F9JB 3AREA 3IJSB 5IB4B 3U0WH 3S4SA 4OZHA 1BD2E 1R3HB 4Z7QF 3F7VB 4HXAH 3PWPE 4P9MH 1CF8L 4OSUH 4AQOA 5HHPA 1PW3A 2B0SL 1FIEA 3RUGB 1RJLB 4O2CB 4KRMB 5IQ7H 2FLBT 5F89B 2COQA 3QIBC 1DSFL 3CDFA 1IL1A 2AV7A 2FZ3A 4G3YH 5FYLL 5CD5C 2NY2D 2XFXB 2Y36L 5I1HH 2BSSA 1TQBC 1R3KB 4HFUL 3P0VH 2B8OT 5HJ3A 5TFSL 3RVWD 4KK8C 1B0GB 3K8LA 4G8GD 3UZVB 2IBZX 4ORZC 2I5YL 2N4IA 2F58H 5I1JH 1IGJA 2HP4A 3T3PF 3W5MA 1CXLA 1PG7W 1EAJA 1MFBL 4KK9C 4LCWE 5FECB 1F42A 3GSQA 3RL2B 2M1KA 2J4WH 4AG4H 2JF1A 2X1WL 4BQCA 4K8RD 3QXWA 3ZHLA 4BKLB 3OAUL 1QSED 1FNLA 3PWUB 4HUVA 3VFUB 2H6PA 3BQUA 1LO2H 3R06B 2UY7A 1IC7L 4WO4B 3TA3C 1RIHH 3TLRA 5I8KL 3VA2C 1VESA 3TIEA 2EICA 4NDMA 5E5MB 3JUYA 1HYSC 4NQXA 1QQDB 3OAYK 3TO4D 4WJ5B 3HE6C 1A6TB 4R8WL 3TT3L 4LSPH 5D7JC 5I1KH 1G7IB 5DT1L 1CDYA 2OP4H 2EH7H 3SDCC 1EZVX 1TQCC 1YZZA 4U33A 4KWUA 1UCTA 5IFHH 5HTSA 1AGEA 5E2VH 2L7UA 1BD2A 1KBGL 2VYRE 5DS8A 2NY3D 3BPOC 3HE7D 1F3RB 3WXVL 4QNPE 1RUKL 4WW2B 3PWPA 5FCUL 2JELH 3ARXA 4GXVL 1F13A 3T1FA 4JKPL 2X4PA 3EO0B 5I74C 1NJ9A 3F7RA 2QADC 5SWSB 4FNLH 3RKDC 2NXZB 2QEJA 4PP1C 2HT4C 1FNGB 3DGGB 3O6ML 3G5YB 1BQHG 3FQXB 1D5IL 4FZEH 1VKXB 1EEQA 1EJOL 4XC3L 5J3HD 5E94A 5EWIH 5T3ZE 4LVEA 1JGVH 3ZLQC 5GRYA 5C8JB 4GJTB 1RJCA 2OL3B 3L3OB 2XKUA 5DGQA 1ZA3A 4LCYA 4S1SL 1YNKL 1NGZB 2UZXB 4JZNA 2DLIA 2NW2A 2DYPD 3NCMA 4OB5H 4PJHF 4CMHC 2AJXH 4HKBA 3WKNA 2DL9A 1FE8L 1NFDA 4OD3H 1A4KB 3JWDL 4G6FD 4X8XA 5JIIA 32C2B 5D5MB 1IT9L 4JRXA 3L3IA 5C0AB 2N7BA 4R0LC 5ISZD 3IXAB 1LEKA 5D1ZC 3ARBB 2ITDB 4HQQL 2DTMH 2GUOB 1MPAL 4XPHL 2Z35B 2DAVA 4O51B 3ZL4L 3HS0B 4JFZL 1MLBA 5H2BB 4LNRA 4N5ED 4YO0A 2R56H 1G9MH 3O8XA 3IVKB 4OAWA 4ONFL 1U3HD 1FL6A 5EDXA 5ALCH 2BXZA 1KFAL 4YDKL 4LVOB 1FZOA 4BUHA 3LSOA 3MRNA 5IMOA 4EIZC 3WL9B 1F8TL 5FIEA 5E99H 3AREB 2VE6A 3S4SB 4OZHB 5DD0H 3ALWA 4MA1B 5F1IA 4WI9A 4LRIC 4X6CF 2AGJL 2NCMA 5HHPB 1TTGA 3BP4A 4QWWC 4U1LA 5GRJH 1L7IH 5CCKH 4TNVK 4ZMAT 4JJHA 4IJ3B 1A1NA 3MLZL 4KC3B 3INUH 4LRNL 1IL1B 2FZ3B 4K55A 3GSWA 2OYPA 4B41A 3FFDB 1TMCA 2BSSB 2ILLA 1CE1L 3NIGE 3QIWD 4ODVL 3B9KA 2VDNH 2X10A 3HG1D 3RNQA 5HJ3B 5F7KC 2SEBA 4WI3A 4DKFL 5IWLA 1LEIB 1JPGA 3BKCH 1FBIH 3H3PH 1IGJB 4R97B 3HZMA 3JV0A 3KXFA 3GSQB 3ME0A 4WI5A 2QSQA 2XN9D 3RVWC 4KDWA 4AT6A 1S7RB 5TE7L 4KMTL 2H32H 3UJIL 4XCEB 2FYYA 5I1LB 1EEYA 3VGEA 4HUVB 2H6PB 3BQUB 5EUOE 3MV7A 1QLRB 2IH3A 5CMAB 3TIEB 5T5NF 1Z6JT 4NDMB 5E24E 2V17H 1JPTL 4IRZL 4LPYA 3CDGA 5HGAA 3IFOA 5HHXH 2DIJA 3Q1SL 3OHXA 3GIZL 1ZE3C 1CXFA 2O5YH 2DLHA 1OCWH 4JHWH 4M4RA 4UB0H 4UZGA 5HYEA 3SKUD 3M45A 2ESVE 3RU8H 1MVFA 3W9EA 4JRYD 1J0HA 4F57L 2WBJA 2OTWA 1LK2A 2EYTA 4WI8A 5JZ7D 1JWSA 5B4MD 1AGEB 1ZANL 3TO4C 1A9EA 1BD2B 5DS8B 5TGBA 3ULUD 1MCBA 3PWPB 3H6JA 3T1FB 3HPLA 2X4PB 3MLYL 4L4VE 1NJ9B 1CDJA 4CNIA 4IM8A 4MD4A 3GDBA 1V8HA 3HE7C 5IW3A 5F3BA 3LIZL 4YZFF 5J11C 2J3SA 4WUKL 2AXHA 4F2MA 1YY9D 2AQ1A 1QZ1A 5E94B 1XIWA 1LO0L 4IOFD 1CGYA 5I71C 2CIKA 1ZA3B 2EDLA 4LCYB 4EN3C 4EDWH 2W0FA 4DZBA 3VWJD 4C4KT 3BH8A 1UGNA 1CD1A 3DXAA 4JZNB 5J3HC 5GS2H 3D39A 3U46A 3GRWL 4HKBB 4DFIA 1NFDB 1QBML 3QO1A 5IW6A 3PL6C 5KAQG 2VLKA 4YXHH 3B5GA 3WNMA 4JRXB 3L3IB 4X6EA 3RTQA 3HC3L 4O9HL 3BP7A 1X5XA 2RIKA 4JFYA 5CIPA 5DI8A 2O61A 3F7PC 2CGRH 2VWEE 2YD9A 2OR8A 3GB7A 3PV7A 1U95A 1IVLA 1MLBB 1IQWH 3S35X 4K7PL 1MJ7H 1GC1L 4MJID 3VA6A 1HKLH 4YO0B 5DLML 1IGCH 3O8XB 4P2OA 5EPMA 5F7HA 4K3EH 4OAWB 5GRUH 2A83A 3MROA 1FL6B 2ESVA 4OCWL 4MWFB 3U0WL 5HHVH 3ARUA 1FZOB 1AO7D 2QQLH 3FB8A 2D9CA 3D85A 4HXAL 1HZHH 4P9ML 3LSOB 2MWCA 4N5EC 1DVFD 3WNPA 3KYMA 4OSUL 3MRNB 1JF6A 5IMOB 4WY7H 1MWAH 5IQ7L 1U3HC 2YXFA 2XACC 4LSSH 2VE6B 3O2VH 4LSUH 5F7WC 3NCCB 4ZOBA 4G3YL 4NYLA 3NCFB 4YHMH 3BP4B 4L4VA 4U1LB 2RJMA 3W81A 5I1HL 3OKYA 3Q5YA 2A6IB 1F00I 4UILH 3OKEA 1A1NB 5SX4I 2CK2A 3P0VL 4FFEX 3RZWA 3DX7A 2V6HA 1ZGLA 3GSWB 4KDVA 5ITFA 5DMGD 4WV1C 4IHOA 3AFLA 1FG2A 1TMCB 1CVRA 2F58L 1I85C 5I1JL 2QQNH 3B9KB 5DRZA 2X70A 4N5UA 5GISH 2SEBB 1WWBX 5C0CE 2J4WL 4AG4L 4UIMB 1DQTA 1I8LA 1JPGB 5T1MA 1HYRC 2QJDA 4OFKA 3HZMB 4WTXA 3QIWC 1HQRA 3KXFB 1LO2L 4GQPH 2OK0H 4K3DH 1II4E 1RIHL 4V3DB 3B9AA 5SX4H 4AT6B 4MA3A 2HTLD 5MP6H 5JW4N 4DN3H 3CFBA 5C0BA 4OKVA 1CBVH 4URTB 5D7LD 2PO6C 2EDXA 4ETQA 3MV7B 1EHLH 1PKQE 5INDA 1OAZH 1SYVA 4BUGA 1AH1A 2IH3B 1UZ6F 5I1KL 4LSPL 3NN8A 4EEEA 2VQTA 4B50A 2OP4L 2EH7L 5HGAB 3UTSE 2BVEA 3CDGB 3IFOB 5BS0A 1V3JA 4YUEH 3T08A 5GJTH 5IFHL 3S7GA 5E2VL 3PF2A 3P40A 1IJ9A 4PGDA 3W9EB 3ESVF 3CLFH 2WBJB 3WBDA 5JOEA 2OTWB 2JELL 1RUAH 1LK2B 2EYTB 1WWCA 5C0DA 3BKJH 1EFXD 1JWSB 4N8CH 3QXTA 4DEPB 4XP6H 1A9EB 5D7SH 4FNLL 5TGBB