3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
5IK3A 3E6HB 3KLSA 3SKNB 3DNKA 1BQLL 2CSPA 5ICYA 2FGWL 5DSCA 1I7UB 2PR4H 4NZUH 3VRJB 3S97C 1QEWA 2WWKO 5GRJL 4HCRH 1OSPL 3QH3B 2J6EH 4KROB 2ITCB 4KV5F 1INEL 1JGVH 3KYOA 2NXZB 4LU5L 6FABL 3T65B 5JZ7C 2UWEF 2NX5E 2CDGB 1WEJL 1NAML 1HHKB 1T6VN 3OXRA 2RAMA 2F19H 2FWOA 4PJ7F 1HILA 3C2SA 3VMNA 1A47A 4FMKA 4D0CB 3UMTA 3RVXC 2BNQA 2P24B 2MCG1 2VLJA 5E7FA 2NMSA 1KELL 1N2RB 1C5BH 1UM5L 2GJJA 5LCVL 3CJJA 4LSSL 4X5WB 2DDQH 1KIUA 4HGWA 2GI7A 5GS0C 2ZCHH 2V5YA 2EH8H 2VKXA 1HILB 1FNGA 2Q8BH 1OAZL 1JUFB 1FLRL 2FO4B 3DXAD 2Z93B 2P7TA 1HNFA 3UROR 4PJHA 2HJKA 5DO2C 4OM0H 4GFTB 3MUGA 1TZHA 4K71B 1A3LL 3VWJA 1S8DA 1XCQB 5GGTH 1GPOL 1AR1C 2CJUL 2HLFD 4LARL 3SDAC 1I9RL 3QIWB 1PQZA 4ZFOB 1F58L 1NC4B 2ZUYA 3H42L 5IB2A 1G9EA 3ULUF 2KQNA 4WUKH 3Q6FB 3WJJC 3SDXB 3E1F1 3C5ZD 3GSNA 4PJXE 4JQIL 4OT1H 1U8NA 4B41A 2IPTL 4OM1H 4I9WE 1EHNA 4PY8I 4I4WA 3ZE1F 5CLWA 3HS0B 1ZANL 2XWJA 4OD1L 3CMOL 2X1PA 4UBDC 4Y16B 4RMSA 1NDGB 3RNKB 3MCLH 4U1IB 2JELL 1KC5L 1ZSDA 4TUKH 3C6LC 3KXFE 1OTTC 1U58A 1WIOA 2BNQD 5FYJH 3VE0B 4JFFE 3Q5OA 3RZWA 3RAJL 5GGQL 3BI9X 4OSUH 4PDCE 3BIKA 3DUSA 2DD8H 1L6ZA 3QEQB 4K3JL 3W0WB 5DJ0B 5FYKL 1T3FA 3RUGA 3FOMA 1JUFA 3QIUD 4YFEA 3HUJB 3OX8A 4JLRB 1ZLSL 1WWBX 3V8OA 1MRDH 4IRZL 2JCCB 3QFDA 4JZOA 4EOWL 4LVNB 1Q9KB 5JNYB 1YNLL 1F2XK 3HUJE 3WIIH 4X7EC 2WINB 4WTWA 4FQQA 4XMLH 2YD7A 2X4UA 3QXWA 2R0LL 3OKNA 1T89A 4WRLA 4PRHB 4F7PA 1KLFA 3QDJB 2PW2B 2D2OA 5HGHB 3U0PB 5FYKD 2XKSA 1G7MB 1HXMA 2CMRH 1WGOA 4YEFA 2P46B 2D7TL 3GFUA 3HE7B 4MA8L 5D1ZC 2R0WH 3RKPA 3OAZH 1AC0A 1LP9F 3P0GB 3WEXB 5SWSB 1J86A 3P4OA 4I3SH 4NN5B 3LN5A 1ZLUH 4G43B 4X9IA 4GRWH 5CP7B 3FO2B 1FG2B 3QUMH 3P40A 4Z18A 4YHNA 4M9PA 3HG1E 1I7RA 3QXUA 2QTEA 4ZS6D 4WWID 4MDJA 5DRWB 1MCRA 4U1NB 3ZHKA 5DHYB 5T3ZD 2FHBA 4JKLA 4IJ3B 2K7QA 3DO7B 4X6DB 3LIZH 2FZ3B 5GS0H 2MSPA 1H8OA 1PJ9A 4JJ5B 2ZUWA 4KKBC 4JFZH 3PWPB 4D0DA 3JVGC 5CJ8A 4FFVC 4P3DA 3L3IB 1MWAA 4K94L 1FL6B 1KBGH 4PP2B 1IGMH 1NAKH 5IFJB 2H32A 4WW1A 3HC4H 5CJOL 3LB6C 3OKEB 5A1AA 1KCVH 3ARVA 1XF3B 1MF2L 1OCWH 3NA4A 4M93C 3OKLB 3TBTA 1S7TB 4JQVC 4LCUA 4ZUUB 1O7SA 3MNZA 4X80L 1D5MB 5GGSA 3FQWA 4Z7WB 2DD8L 1IKNC 1IRAY 4A6YB 1P84J 1P4LB 5KW9H 5HYQB 3RUGB 5I18H 1U8KA 4F15C 3KJ6L 5E9DB 4ELMF 3S37X 2AAVA 3N1MC 3WLWC 1HEZA 4R9HA 4DFIA 5AAMA 1BJ1J 1LK3L 2A73A 1F4WH 3SOBL 1KJ2L 4MJ6B 5E2UL 3V6FB 2BP3A 4BH7A 2BY0A 3FO9A 1ZWIA 5FK9B 4K7FB 3WD5L 5EA0L 5KN5A 2P24A 5E8PB 4HH8A 1HNGA 2EYSB 3SEPA 5MEND 1UZ6E 3FQXB 3IRPX 4NT6A 3EO0A 3IAPA 3N85H 2EXYC 4XNUH 4H8WC 3MR9B 3WFZA 3HZMB 3UJJL 1I1AD 5EOQL 5I15L 5JORB 3OKOA 4O4YH 1X6LA 2DQDH 4QXWA 3IVKB 5DVLA 2UWEB 3F6IA 5DTFA 3LKQA 3B9KC 1OGAE 4R4FL 3BE1L 3RIAK 2H3NA 1XF4A 4HK0A 2ZUTA 5E8NB 5JDSA 4WWKB 1Z9SA 4RWYL 2AXHA 1S9XA 1HE7A 3BKCL 4XWGH 1MCIA 2VDKL 3GRWL 1K4DA 3FB6B 4YHLL 5DFTA 4YGVB 2F19L 4AQ1B 4LSQL 4GRLD 4KDVA 3QUML 4LHJB 2WIIB 4RMRA 4JO2H 2X70B 4OV5A 3QUXB 1MWAL 2ZOLB 5JIHA 2F58L 2ICCA 4L5FL 1NLBH 3GZKA 2C3VA 1C5BL 1UM5H 2APWA 3TV3L 4OLXH 4KTEH 2EE9A 4LQFH 4KGLA 5DD5H 3DV4A 4DTGL 5FIEA 3AROA 3VGHA 2IAMC 5A16A 3IDJB 2VQ1B 2AK4A 3TO4D 1CLZL 3C5ZB 2F53D 3QI9B 4JCLA 2GUOB 2GTWA 2HFFB 4AIXA 5I75B 4GW4B 4XZUA 1YA5A 5DQ9A 2A6JA 4G9FA 4NUGL 1OP3H 1JWSB 4QRPE 2K1MA 1ZKAA 1Q72H 2RBLA 2ADFH 2CJUH 5CSGA 5J13C 4I0PB 5KS9A 5GGVH 4O02L 2XN9A 2VZOA 1G1CA 4JKWA 3U4EB 4HLJA 2DL9A 2GEEA 3K2UL 1T03H 4ODVL 4P2OD 4XH2B 2JIXA 3MYZA 5KW9L 3ULUD 1RZFL 2Q86A 3BUYB 1WISA 4JM2C 4S1QL 5FB8A 1P5UA 4P9HL 1ZS8B 4RA3A 1P69B 1BD2D 2EIBA 3GNML 4Z76A 1JP5A 2Q7YB 3JTSA 5JOFA 1JGEB 4WFFD 5DD0L 3MMEA 4TQEL 3U36B 1B6UA 4XC3H 2OZ4L 5T3ZH 4HUVA 3P9LB 2C4XA 4MJID 2DLGA 4PRIB 3MLZL 4TUKL 2E7LC 1DVFD 5IGXH 1JRHI 2B4CL 4FQXB 5MENA 4MX7A 5GJTH 1OGTA 5I1HL 5B38B 3GJFH 4RX4A 4TSCH 1A5FH 4U6TA 3IFPA 3MMEB 4Z7NE 2D03H 4G3YL 1A9BA 1YNKL 4H20L 4YHOL 5HGHA 3I6LD 1RUKH 1BVLA 4MAYD 4CVZB 3PDOB 2VLKA 5E2TL 3QDMA 3QIWC 4JY4A 1AD9B 2HFEA 2BVOA 3DARA 2J2ZA 2X40A 2QJDA 4GUPA 5EU5B 1GIGL 5HYJB 1E4JA 4BSJA 4HWEL 1T83A 3AMLA 5HHMD 4G59A 4WGVB 4HIIB 3KPRD 1MRDL 1JWUB 1TZGH 1XGTB 4NO5A 2OX5A 4Z7UA 4KK8C 4CL7A 2A83B 2X89A 3LKRB 2SEBB 1N4XL 5C0CE 3S4SA 2NXYC 1CTOA 3S8WA 3EFDL 2DWEB 1PDKA 1FQ9C 1FCGA 1EUTA 3OZ9L 4PJEF 3FFCB 5IW3A 5BXFB 2YPKA 1KXQE 4K3DH 1AIFB 3I02A 3GGWA 2WBJC 3REWB 1QOKA 5CEZD 5A2LH 4I0KA 1SVCP 5KANG 5IB2B 3HAEG 2EDBA 1X9QA 2VDQL 4YQXH 5TDPB 1C16A 3OR6B 1J0YA 1TNMA 5FYLE 2IGFH 4QCIB 3BP5B 2DQEH 3F7YB 5SWZB 5BVPH 4FA8A 4RMTA 2UZIL 1DVFC 3QNZB 3MZGB 1ZLVK 2X4SA 1EO7A 5EC2A 5FYJU 3KPMA 1K5NA 4HIHA 3X14A 1LQVA 4MJIA 4Y0GA 1D9KA 3ARWA 3DX6B 3KXFD 4HDIB 1W72A 2EDFA 4ELKA 4JZJA 4K07A 1EAPA 3S96B 1J8HA 3L3OA 1HSAA 1FJ1B 4FTVA 2AJZA 4JM2B 5AZ2H 2F8XC 5ACLA 5EIIA 2NY6D 1AXTL 4HPOH 4I77L 5E6YA 5FO8A 3H9SA 1FFQA 2ZG3A 43C9B 4JZJB 1QFUH 3E6HA 3SKNA 5J0BA 1JCKA 1W0YT 1MCEA 4MDIA 1BWWA 3K0WA 3QJHA 1D6VH 5DD0H 5DQJA 3NTCL 4YHKL 4GO6B 1LO0L 2XY1A 1S7UA 1FC2D 1N6QH 3MO1B 1QFWL 4KMTL 2PO6D 3TIEA 3BOVA 1BQLH 5F1KC 3L95B 2IADB 5DWUH 1J0IA 1MRFL 2R4RL 4UT6L 3MUHL 1JPSL 1TTGA 1JZ8A 3D2UB 1BQHB 2OYPA 5GRJH 4TRPL 3L6FA 2ICEA 2KZ1B 4WUUA 2VXTH 2ITDB 3VH8B 1JGVL 3K1DA 4OBSA 3P0VH 3HPJA 5IM7B 1GGUA 3QNXA 4ODBD 4AL8L 4PR5B 3WIHL 3K8LA 5C09E 2ZG2A 5C0BB 5F7LB 5B38A 3RIFF 3MGTA 3QIBD 1BFTA 4XBPB 5ICZA 3GB7A 3B9DA 3O0RH 3VFTA 3SDXA 4U2YA 2A0LC 2E8YA 1QZ1A 1JNNL 2KL6A 1N26A 3OKDA 3GO1L 3VD5A 3WFHA 3QEHB 2EH8L 3UAJC 5A3IC 4IHOA 3TYFA 3OPZL 1ZT7B 4IEFB 5D1QA 5BRZE 3SE9H 3VFMB 2EECA 1VADB 3DV4B 3GMOA 3QDAA 4LEOA 2XFXB 1ZMYA 2DQDL 4X7SH 5C3LD 4U1IA 1F4YH 1UM6L 3G6DL 3MFFA 4G42A 5D96C 1VKXB 5H2BB 4NQCB 3BE1H 5GGTL 2IJ0C 4Q2ZB 3RVWD 2YMXH 4JN1H 4JFQA 2XOTA 4JO4L 1LEIB 4JVPA 2Z8RA 1R24B 2XFXA 2VZ1A 2VXVH 4JPVH 5C0JB 3CDCA 1MLBB 2XY2A 1OTSC 3WKMH 3KNBB 2R8SL 1RIVL 4PS4L 4OZHA 2NZIA 3B6SA 4HUNB 3L3OB 1BJ8A 4JQIH 3MV8D 2EC8A 4UDUA 4R4BA 3CVHL 2A9NH 4M1GH 3ZDXF 4HPOL 2YD3A 4U1SB 1FDLH 3MGOB 2VDPL 3SKMA 5GS0D 1FO0B 1IGYA 2CD0A 4WW2A 3LEYH 1GGYA 4HW6A 5CSBA 4KRNA 5CCKH 3FCTB 4Y4HC 5GSVB 4PR5A 1IM3A 1NUFA 2BK8A 3UZEA 1F3JB 1MCHA 2NY2B 2VLRE 3CU1A 3GMLA 1DBAL 3LSOA 4G6AD 4UNUA 1TVHB 3WIFA 4KDTC 3TZVB 5BMFL 5DWUL 4V2CB 1T7YA 3U79A 3M17A 5T3XE 4KZEL 4NWUL 1M7XA 4M02A 4WWKA 1ZGLA 4PRAA 1S5HA 1IQDB 1UZ8A 4O2EB 5HY9A 1FN4A 3SQBA 4FQJL 3U7YH 3BAEH 5T1MA 2HA1A 1VFBA 1CFSA 3OHXA 1JHLL 4JDVA 1MELA 4GG6F 3C08H 4HULB 3MRHA 3BGFB 3QIBA 3NAAH 4KJYB 3FOLB 4KY1L 4TQEH 1C12A 5DXWA 3SDAB 4P2QE 2ESVE 3DV6A 2NW3B 3SGJA 4PV8B 1QBLL 4OF8A 2ZG1A 4Z6AT 5D2LB 4RIRA 2O5YH 3UX9B 5KSUA 1CFTB 4WFEE 3GGWB 4WV1A 3HE6C 1E27B 2DLIA 4MA7L 4KKNA 4YHOH 3RIFK 2DQTH 3PWNB 4H0IA 3V6ZB 1FE8L 1HKFA 2AVGA 5I74B 5K9QG 4XMKH 5JHLL 5AYUH 3FB8A 4FG6C 1WWCA 5DLMH 2IBZX 1BECA 1U3HA 2EE3A 3ET9F 4JN1L 5CJ5A 2V6HA 4PRIE 4JCMA 5HDBF 4LMQE 1EO8H 4YIQB 4RQQB 1PFCA 4S1DD 3V9FA 3OKMA 1RIVH 3ARFB 4F7TB 5KAQF 2JJSA 1OT2A 3VFRB 3IFNH 1AGFB 4QYOA 3Q5TA 4L4TE 5JXAH 1Q0XL 1CR9H 1VGKB 4OLZL 4KKLC 5BV7L 1EBAA 4LGPB 5DF0A 1RIUL 2A77L 1RZ7H 3W11D 1NKRA 5K93A 5DRZA 1JYXA 1ZVYA 3LEYL 1WSST 5KVEL 2NCMA 2W91A 1FZMA 4UIKH 1EX0A 4OCRL 1BIIB 2BSSA 2ICWI 4U49A 3V6OA 2Q20A 3E2HA 5L8JB 1MCDA 3SE3C 1W72L 4UDUB 2N4IA 4BK4A 2OL3A 3FB5B 3PWPD 2WP3O 1RQ5A 4OCWH 3OR7A 3CXHJ 3MOBH 4ZUVB 3O2DA 3T2PA 1NL0H 1V5JA 1ZLWK 1FNSL 1KG0B 3GK8H 4DOHB 1YMMB 1S7QB 5GGRY 2EYRA 5L88L 2R15A 3MA7B 3PV6B 3RKDC 1L9MA 4QF1A 4YHPA 3WHXA 4Z7VF 3SPVB 1F3JA 3O6LL 4PGEB 5AZ2L 3MCKA 2JB5L 3MREB 4KHTH 1R3LA 3MNVA 2W0FA 4QWWC 1SYSB 1K4DB 3FB6A 2JJTA 2AABL 2F5BH 4G6AC 4KHXL 5JR1H 5ISZD 4NRYA 5CP3H 5CJXC 5GSRA 4JRXE 3GJFK 3M17B 1T20B 3CSBA 1IT9L 2D9QB 2GCYB 3KPRE 3EOAA 5FDYA 4AG4H 2UWEA 2Z92A 5DTFB 2L7JA 3S3JA 5EO0A 5HHNB 1N5YL 4M00A 4X5XA 4Y4FA 5I8CA 1J5OL 1N2RA 4ODTH 3UXFA 4JANA 3UYRL 1R3KB 3O2WH 5F7HA 4GQ9H 1R3JB 5CWSB 4AT6B 4I1NB 4FMFA 4PREA 1YEEH 4U1HA 4GBXD 2NYYD 4XAKE 4NNXA 4HS3A 1FORL 5I1LA 1CICB 3C8DA 5ITBH 1UJ3C 15C8L 3TO2B 3MFFB 1JJUA 1WC7B 3J8F7 4PV9B 2NZ9D 3JV5A 1ZVSB 4LSQH 5JOEA 4IIQB 1CK0L 2NY3D 1F58H 2J8UE 1GZPB 4R7DB 5DJXA 1QUNA 1J7VR 1ZHLA 3LQAL 5C08D 1MHPL 5EOCH 3U4BL 1ORSB 3DX7A 1GZQB 1XH3A 3IDIA 2WUBL 4PV9A 4P59H 1A6TA 4FFZH 3H3PL 1KIPB 2VTFA 3QB7C 3HMWL 1K3IA 2ZCKL 3QRFM 1RZ7L 3SE9L 1BJ1H 4HK3J 5L9DH 2IQ9L 3L7FB 4PJ9C 1MI5A 3EJYC 4ZNEE 5KZCD 2Z91B 2WANA 1AGFA 5HHMA 3ARDC 1BFOA 1J18A 2APFA 3GSVA 2A73B 2F15A 3ULVC 2WM0A 2FYYA 1TQBC 1U42A 2AI0L 2EDRA 4HS8H 3BQUA 1F02I 3QDME 3CC5A 4ZOBA 4YXLL 5HYSG 4PB9H 3SO3B 3TA3B 1MJUH 3QCTH 1X5GA 4XNQA 5IVOA 3QR2A 4PRAB 4LRIA 4JAMB 2Y1VA 4OB5L 1DSFH 2AP2A 2W1NA 4N8PA 4HZLA 3OF6A 1RUML 5ENWB 1KYOJ 3FJTA 3L6FB 2HN7A 1B3JA 2ATPB 2OJEA 3KWWA 5CCKL 3MRJB 1Z2KA 4X6EB 5I1KH 1KJVB 1KV3A 4AM0A 3FOLA 4XMPH 4EZMA 2JKXA 1A14L 1QA9B 1JF1B 1KJ2A 1RZGA 1L0XA 3DX6A 3O2WL 3SJVE 1DLFL 3O8XC 4U0QB 1UYWL 5FUCC 1LQSR 4JFDB 1FYTB 3W2DH 4N9OB 2VC2H 5I17A 3EYSL 1P7KB 3GSXA 3HA0A 3BKJL 4RDQG 4J4PA 1H3XA 1A0QL 1MPAL 1EGJA 1DTUA 1GGCL 3C09B 3U7YL 4PJCE 4N0FA 3B2UC 2R29H 4IMLB 3PWPA 4PJ7B 3UYOD 1G9ML 4U6VL 3B9KA 1JPFB 2LTQC 3M07A 4M9OA 4R96B 4OGXH 5HVHC 4X7TA 1G7IA 1RU9L 4LNRB 4XXDB 3PP3K 3V7AG 5C6WH 3X3GL 5INCB 1BAFH 2W9LA 5GS0L 1OB1A 3CFCL 4XVSH 4Z7QF 3HI1A 3SHSA 1CDYA 3GSUA 1IAIH 4HQQL 3MRMA 1R0AL 5EUOB 4Z7QE 4NM4H 1JN6B 3L3JA 3SDCB 1QBBA 3DMMB 3MRDA 4PY7A 2OS7A 4OKDA 5IJKC 3MZTA 3IJHB 3C60B 4G6MH 5GZND 1GH7A 4FQLL 4LSTL 5ERWA 3MUZ1 1DEEB 2ZCLL 2BSRB 3NPSC 3LQZA 3PWVA 4RNRA 4LIQE 4YK4B 4PJDA 3IFNL 1XGYH 4PJCF 1KJMA 2EDJA 3O11B 3OAZK 3WSQL 2R9HC 3RHWF 3GHBL 3Q48A 4HWBL 4MXQA 3GMNA 3LVEA 2HFTA 5FM4A 5D7KD 3RWHB 3WNMA 3RL2B 2V2TB 2BNQE 1VB9A 4V1DE 1SVZA 4HXBH 1G0XA 3LEXA 4HEME 3MRKB 1Q1JH 4HGKC 5LGJB 3VWKC 2XICA 3KLDA 1Z3GH 3J7HA 4NPYB 1OF2A 5IBTH 2XWJB 5CINL 1E0OB 4N68A 4WV1B 3S36H 2OMNA 1I1YB 3P11H 1TLKA 5TDNA 4HUUA 12E8L 5ESQA 1R3JA 4L3EB 4HC1A 2X41A 3KPOA 1HKLL 3MV8E 3D2UD 2VC2L 2NZ9C 1PLGL 1U8OA 4OF0A 5DR5H 5HD8D 1OAXL 3DVGB 2FSEA 3R8BB 4PG9A 5DJCB 2AK4D 1LEKA 3KLAB 4PJFA 1IMHC 3TO2A 4ZMAT 3X3FL 4PJ5E 4AMKH 1DBKL 1TJGH 5DEFB 1XGUA 3QIBC 3O81A 5DUBB 1CGTA 5I1CH 1YNLH 5GJSH 3MXVH 4XP5L 2AJ3A 3RVWC 3QNZA 2HRPH 3TVMB 1ED3A 4MQ7B 2VLRD 2GYSA 2GFBB 2NNAB 1WIUA 5I1DB 4ZSOB 1WWAX 3RNQA 3FT2B 1MH5B 4QRPB 5D93C 1N0LA 5IR1A 1YJDC 4S11A 5TE4H 4ERSL 5F96H 2AKRA 5GS1A 5I73B 4FQ2H 4LCCC 5EUOA 1YEEL 1JF6A 3QUMB 4UINH 1QHPA 4MA8H 1XR9B 5CJXA 3KYMA 2VXQL 2A6IA 4G6ML 5IVZB 4XXDA 5BRZA 3U46A 1F6FB 4GG6B 3IDMA 2XNAB 4YK4C 1X5IA 3QXDB 4ZO8A 5D72H 3ARGD 1WVZA 1CYGA 5LBSH 3VFOA 3ZL4H 3O4LE 3JUZA 3D0VB 4MD4A 1YQ2A 3BN9C 4FFZL 3VXRB 2CIKB 1XF4B 5TF1L 3VXRD 4PRPE 4NCC1 3O6FB 4PRNA 4UIMA 1V8HA 1U8HA 1FNEB 3AM8A 5C0IA 3RZCD 4L3CA 4MQXD 3STZA 4YXHH 3REVA 4POUB 3VG9C 5FUCE 2D4DA 3MRBA 1G0DA 4QOKB 2W0KA 1HINH 1KBGL 5I8KL 3EO0B 4KTYA 5I2IB 2E27H 4APQB 2Z9TA 1YC8A 2FGWH 1CICC 3U6RB 4EQ2A 5MEQA 4PJCA 2CUMA 3PHQA 3WFEH 1JHTB 5K9JH 2FBJH 1B4JH 5E2TH 5KSBA 3QPQD 3NCFB 3KPNB 5HJ3B 3FFCA 5BXFA 5IQ7H 2YD8A 3T3MF 3FT3A 3NCMA 3U6RA 2EC9U 3SDAA 4HXAH 4XCYB 5I1AB 3V5DB 1U3HC 5C0EB 5B39G 3P4LA 4PJGB 3U4AA 4YUEH 4Q6IB 3UTOA 4S1SH 5IB3A 4J3OC 4NJAH 4O00A 1P4BH 1A4JB 3N50A 3EDJA 5H2BA 4CMHB 5DHVB 5IOPA 1KCUH 2R2BB 4HJJL 1BREA 1ZT1A 1RSFA 1M7DA 2Z4QB 5HYSB 4M8VA 3T4AA 4K3DL 4HIEB 1CD1A 1I85C 2I27N 4M7KH 2VL4A 5DK0B 5IT2L 3R4DA 3BJ91 3E0GA 5F96L 3GHEL 3R0NA 4L9LA 1MFBH 3HNSL 5F9OL 5C0FB 1EFXD 5C08B 5IFAH 2IGFL 3F6LA 2B4CC 4PJDF 1FO0L 5FFLA 5BVPL 5CLTA 3O4LD 1BMGA 2K7PA 3HAEB 3DXAE 3DROA 5C0FA 5JQ6H 4MXWH 3RU8H 4S1RL 4NC2B 3I6KB 2Z92B 1DBML 1VERA 1C08B 3VXSB 4X4XB 2C1OB 3V0AC 4LQFL 3M8OH 5HHOE 3NGBC 2N7BA 2DLEA 4UB0H 2IMNA 3PABA 3OAYH 5IMKA 5GPRA 1A6WL 1UKTA 3L5XL 1TENA 4LOUC 4LEXH 5JW5B 5CIPB 3CXDH 4BUHA 1IEHA 2PUQT 1N6QL 4I48B 1OTTD 1KTRL 1EH9A 3SKJL 4QRQB 3C5ZA 3GMOB 4FXLA 4LCCA 4Y2DB 2KZWA 3O41A 4DEPB 1FG2A 3O3EA 2GJ6B 4NO3B 5B39B 5C0GA 4KZDL 4WUUD 1T2XA 1CGUA 5IFHH 1D5IH 4YEEA 3QRGH 4J3SA 5M95B 3FONA 1U91B 2A6DA 3VXMB 3O8XA 2WP3T 4CMHC 4NO0B 1K4CB 5FGBC 2KQMA 3S3PA 2XZQL 2KUTA 1MIML 3PL6C 3DUUB 4WY7L 5IVXE 4ZQKA 3I75B 5DUBA 1IGCH 4WU7A 4ZPTA 5B8CC 1IGFH 1CGVA 5EU6D 5DQ9B 5TE6L 2ADGA 3ZMRA 1X6NA 3T4AB 5IP4A 3RVUD 3C60C 1NDMA 2ZNXA 5CEZL 1EHXA 2XTJC 5I1HH 2XKNB 3QIWA 4Y16A 4KQ3H 1CDIA 4TYUA 2ARJB 3HR5B 2GSIB 1DL7H 3HUJA 3T65A 1ORSA 2CRYA 3LQZB 3UTPD 4LHUD 1WQVT 1ROWA 5BO1H 5C0CD 3VWKA 2F54D 4BH8A 5EWIH 4V2BA 4E41D 1I9JH 3BP4B 5DZNA 5BOPA 1JPST 1TZGL 2VABA 1GYAA 2AERT 3U4BH 3WUWB 1AY1H 3T2QA 3QFJE 4J4PC 3RU8L 3MRDB 1CU4H 4LLAA 1G6RA 1I9EA 3ROOA 3GMNB 2HJFB 3MLSL 3IYLW 2DMCA 3ILQD 1P2CA 3DLQR 4HT1H 4OZIB 3RWEB 3GMRB 3MRRB 4NM8L 4I5BB 4U0RB 3HC3L 3P4NB 3MRIA 1JZ3A 1ZA3B 1R3HB 2CDEB 4LAQH 2P7TB 3FN0H 3RVVD 3SKMB 4HC1H 4JHWL 4JREB 5D7JA 1EEYB 4GKNA 5C0IB 1CQYA 2Q3AA 2P47B 4P57A 1P4IL 4M03A 3T2OA 4OZIA 5E6ZA 1G84A 2F5AH 1OL0A 1XFPA 2DQCH 2AI0H 2ENSA 3SDYL 2JCCA 2XQYG 4JZOB 2Z35A 1LHZA 3RY6C 1YEIL 3VH8A 5MHSD 3RDTB 4LSRH 4PB9L 3UTQB 2XXMB 1J05B 4N8VG 3SN6N 5B8CA 2WWKT 1A1NA 4HUWA 4HUMB 1K5NB 4RWHA 4MLSA 1AXTH 5GIRA 1FAKT 1SBSH 3NIDE 4JFDD 5JW4N 5C8JB 1KJ2H 1LDPH 5DK3A 3JSSA 3RGVA 4MVBD 1N7MH 3ARZA 4M4PA 3INUL 4P2QA 5CEXA 5IIEB 3BPCA 1W0VA 5DZLA 5IMLB 5F9JA 3MV11 4PJ9A 5J57B 5EU6A 2FCBA 2AJSL 5ICXA 3BP6A 2XACC 1OCWL 2FJFB 3SQOL 1PGRB 2W9EH 1QPXA 3DX8A 5JNYA 1DLFH 1WBZA 3RDTD 2AXGA 4ZUTA 2FJHB 1TPXB 4HUUB 3MLRH 3D18A 4H1LG 4X6CB 1MFEH 3BPLB 1MCLA 1DE4A 3QFJD 3BIAX 1ZA6B 4RBPK 4XVJH 1NGPH 2CGRL 3I2CL 3F62A 2V17L 5FKPA 2QR0A 5FOBA 3DI3B 2ICEB 2EEDA 8CGTA 3BZ4A 2CLVA 1DQTA 1NMBH 5EU7C 4V1DD 2Q7YA 4NQDD 4PJHF 4FZ8H 3PL6A 5H37H 4K55A 1Q0YH 2ARJA 1HHIB 1RIHH 4U6HA 3SE3A 4LRIC 3W0WA 1FYTE 3DURB 1I4FB 1TMCB 2FIKA 4QKXB 4XVSL 4EEEA 3OPZH 4Y8DC 3VDBA 3HB3C 1INQA 4F7EA 4WVRA 4YH6A 1NBZA 3U7WH 2LU4A 3S37L 3KPSB 1CE6A 5A43C 1RULL 4E5XA 1R5WB 2EYTB 3T0EA 4HZAA 4QXUH 4OBRA 3ZE0E 3RGVD 4KI5D 2B2XL 5C6TL 4LLYB 1DN2A 4RISL 4K7PY 5IEHA 3B9EA 4M1CC 3MOBL 4P2QB 4Z5RB 5F8RC 4RZCA 3GB7B 1R5WA 1QLRB 1H3GA 4ODVH 1WWWX 1CT8B 3QQ9D 4HKBA 2O5XL 35C8H 5EORL 5DMGD 3IDYB 1WBZB 1RK1A 4HFWA 5FA3B 3RY6A 3FTGB 3JV4B 5DD5L 5KVMC 5FHAH 4X99A 4ZNEA 3ES6B 1H0DA 4L8SA 4R0LA 4EVNA 1KB9K 1WAAA 2G60L 3QI9A 1HQRA 3T0XA 1N5AB 1RFDL 4MD0A 1TZIB 2GFBA 2X10A 3CXDL 2DJ4A 3MBEB 1B0WA 1E4WH 1UC6A 3OKDB 1TVBB 4OCXL 4BM7A 1XGPB 3HPLB 3RIAF 3QXDA 3SE8H 4H20H 1HH9A 2I60H 4G8IA 4BZ2H 3KPMB 1OWWA 2VZTA 3MLRL 8FABA 1BFSA 4GAGH 4L9LC 4Y4KA 4GS7B 4CVUA 3KYMB 1BVKA 2YR3A 4Y4FC 2FB4H 3AFLA 1KXVC 1I85A 1JWSA 1F2QA 3TM6A 4V1DB 4RGMC 2DQGL 3DSFH 1I7UA 1AXSB 4EBQL 1LK2A 4NYLB 5KAQG 4MZ3A 2CR6A 2DKMA 4KDTA 2OZ4H 5T3ZL 4FZ8L 3JTCA 4PJAB 2GIYA 2F74B 5IJVB 1LO5B 5DK2B 3UTSE 2BHYA 2Y6SD 3S4SG 3UDWA 5DK0A 4OF6A 4KUCD 1NQBA 3T0AA 4PGDB 3BZ4B 1WFNA 4WW2C 3STZB 2X70A 4X4ME 2VDMH 1QO3A 2ATPA 4OV5B 1P7QD 2DQEL 4XWOC 2UZIH 3T8XA 1E6JL 3ES6A 3DGCR 1NCAL 2VLME 3G6JF 5HPMA 5GS1C 3KDMA 2AV7A 4P5TC 2R1YA 1M6OA 4R8WH 5LBSL 4ODSL 4Z95H 1VPOL 2R2BA 1ZLUK 4P5TA 5LKNA 2GSGA 5I9QC 4LLUA 5JORA 1S3KL 2VB5A 3KPNA 1MHEB 5C0BE 4AK1A 2FBOJ 1JYNA 4WTZA 3LKSB 5BJTA 5BVJB 3BW9A 4OM1L 4HT1L 4OLZH 1WF5A 3ERYA 1ONQB 3KLHC 4LSVL 4QCIA 3KPOB 2NX5D 1A9BB 3OB8A 5FOJA 3IAGC 4DKAA 2UWEE 2H8PB 5HYFA 1CLYH 5F7UA 3LKPA 1ACZA 3KXFA 4R26H 2APBA 2R4SH 2COQA 2EO1A 1KIPA 3L7EA 4KMQA 2DQCL 2VXUH 4TRPH 5MERB 2C26A 3H7LA 3HE6A 5C2UB 3N06B 5GGRB 3DVIA 3GBML 3NCJH 4RDQF 1AGDB 4N1EA 2DYPD 2PTTB 1I7TA 4NZTL 1MCCA 4X9GA 2IF7A 1LE5A 5HHOD 4HG4K 4B7LA 3SGJC 4U7KA 4XBEH 1I3GH 2F5BL 3L3HB 2X4PB 3QDHA 1KB9J 3ARBA 4POYA 1NAMB 2FX8L 1T4KA 3DXAB 3DJ9A 3EJJX 4YHKH 1FNAA 1YN7A 3MNWA 2ZSVB 1LO0H 1PEWA 1KFAL 1YY8A 3PF2A 2EDDA 4PJ8D 3LD8C 1JFQL 4AG4L 1MFNA 1YY9C 5KSBE 4PRHA 4F7PB 4LCYA 2HT4C 5J9PB 3MJ8A 2IH1A 1QYGH 4JFEE 3GHEH 3X3GH 4WWKC 3EYUH 4U6YB 5JPNB 4M3JA 2CMRL 4HUXB 4NO3A 1DQLH 3BKMH 3PWUB 4L8SC 1MJ8H 4NM4L 3WN5C 1P7QA 1EBPA 3AXLA 4FP8L 2G5BB 4GRLB 3OXSA 5IJKA 3HZVB 1J8HB 1HSAB 4FTVB 2DWDB 4MSWA 1OAUH 4WI9A 5D6DC 4DGVH 3K2MC 3RPIA 4C54A 2FWOB 4GH7B 4NRXA 5D70L 5KS9E 2OXGA 3VFPA 1JWUA 3PWJA 1IEBB 5BZDB 3TPUE 3P77A 4S1RH 1ND0A 3D85A 3LQAH 3CVIH 1H5BB 4MNQB 3I9GL 4ZFOL 1QSVA 5IMKB 4PGCA 4PLKD 5C1MB 3LHPL 5T1KA 3ROOB 3GSNB 3DV6B 4M3KB 3T0EC 1NBVH 1IGTA 4Y2DD 4G6KL 5E2VH 1Q8MA 4QHLA 1NFDA 2H2PC 3JV0A 4U31A 3D85B 1W0VB 1YEHH 1E28A 2ORBL 1N0XH 2E7CA 1CGWA 2VDLH 3CLEH 5FGSA 1H15A 4P5TB 4E0RB 1Q9LA 3SJVB 3R0MA 5BZWA 1R24A 4MMXC 1Q9OB 1S7XA 2YXMA 4UU9A 3MRQA 4QRRE 25C8H 3MNZB 2EEAA 4NPYA 4FZEL 1PD6A 2P8LA 3DVFA 3RJDA 3FFDB 3Q6FA 2BRQA 4NWUH 3D48R 3LPGA 4X4ZA 5HSFA 5L0QC 4MAUL 3ZKMD 1ZOXA 1BFOB 2VLJE 1FVCB 4KH2A 5I1LB 4WHYH 2YBRB 1JZ4A 2AEPL 3FT2A 2R1XA 5DUPH 4PJBF 3O2DH 5GS2H 2VDPH 2ZUVA 4R0LC 2DM3A 3C08L 4CKVX 1VGEH 2AXGB 5EBLB 5C08E 3MJ9L 3W39A 1D5MA 5GGSB 5CD5D 1KTDB 2EDXA 2FX8H 3LD8B 4M62L 1OPGL 2Y23A 1IGFL 2DF3A 5TFSH 5FV1L 3WD5H 1TNNA 5F8QC 4LVNC 1MVFA 1I7TB 2O5YL 1LGVA 4QXTA 4JFPA 2UV3A 2B7DT 1S9VB 1NKOA 3LPFA 3FRUA 3R8QA 3MRJA 5D7LB 3NABH 1FL3B 4Y4KC 5I15H 1MLBA 4R2GD 2X9WA 5CGTA 1F3RB 4FQ1L 3DWTA 4UINL 1KULA 4RFOH 1G7JA 1S5IL 2D7OA 4EN3B 3V4VL 2D7QA 4RWYH 4WFED 1JK8A 4NRXB 3E6FA 5EZIH 1JHLH 3C9NA 1WJ3A 2QQQA 4F37F 2HT3C 2Z35B 5I1JL 1BOYA 2DM4A 4PJ5B 3BQUB 5ITFA 2E9BA 5AWNH 3PL6D 4ODWA 4M8QB 4X4YB 4WHYG 4PYGA 2VUOA 4ZTPL 4UTBL 2GCYA 4YDJB 4G5ZL 4QOKD 4L8SB 4N5EA 3F5WA 4OJFL 5FA4A 2MKLC 5ITFB 1T7VA 4YR6A 5IB3B 5HVFB 3C8KA 3QFJA 2E7LA 3M45A 5EZLB 2DQTL 2R0KL 1UA6H 2VDML 4UT9L 5FXCH 2ORBH 1ND0B 4LASL 3RKDD 1K8IB 4XMKL 1TCRB 4Q9QH 4F3FB 1KJVA 3NN8A 3HG1A 4Q2ZA 1WICA 3QQNA 1FFPB 1P6FA 4HAFA 4GS7C 3LKPB 5T3XH 4LARH 1YN6B 2E27L 1NL0L 4G6JH 1I8LC 4NQDE 4ZFOA 3EO9L 2F8OA 1PZ5B 5FGCB 5F7DA 4HWZB 1WCBB 4PJXA 4M7LH 3RL1B 3DECA 3OX8B 2YUZA 4JLRA 3VFWA 3DX9A 5DFVC 5BZWB 3HB3D 4TULL 5EFIA 4HWUA 4ZFGH 1QP1A 3QEQD 2OI9A 2DIAA 1IC4L 3D9AL 5DMIL 1KC5H 1QRNB 1NAMA 5HHPA 1FGNH 1KOAA 2PW2A 3G5XB 2Y06L 2PNDA 4OZHF 1TJHH 4NBYB 3W0WE 2X4NB 3QULA 2VR5A 3OG6B 4R26L 5IBLD 4DVBA 3UYRH 4GQ9L 3MRPB 4F33B 4ZXBA 5EUOE 1KEML 5L8KB 4JKKA 1GVIA 4IDJL 1BQUA 1MI5E 1H3UA 5HGAB 3VXNA 2OI9C 3GMPA 3IU3B 4Z7VA 4JY4B 2HKFH 2NXZD 1KCSH 4PJ5D 1DBBL 3MNVB 3WKNA 1CG9A 1JGLL 1GCFA 2C7UA 5IEKA 3T0VA 2XA3A 2F54B 3V0WL 3OXSB 3VXUD 2EDQA 1N64H 5MENB 3TN0B 2DB8A 1LP9A 4I3RH 5C70A 4KRPC 3BQUC 3TJEL 4U1MB 2DTMH 1WIPA 5GRWA 5DT1H 4YFDB 1FNGB 3N1FC 4UV7L 1LK2B 4NYLA 1C1EH 4PJDE 1FV1B 3RGVC 3QCVH 1EMTH 4BFIA 2JJSC 2VERN 3LH2H 5FA3A 1I1AA 1JPTH 2XG5A 4FXKB 4E42B 1RHFA 4XCEB 4RMQA 3U1SL 3PWLA 5B4MD 4NO5B 3KGRA 3AS1A 5IB4A 3S37H 3IDGA 1A1NB 3EZJB 1SM3L 5D6DA 1YEKH 2CIIB 4JFXA 1YMHA 2NY7H 4LASH 1YUHA 4PRHE 2BVEA 1T1YB 3P73B 4NHUB 2CKBH 3QDJE 4Y89A 4K8RC 4V1DA 2VH5L 1LVEA 3A6BL 3TCLB 3LZFH 1NCTA 5K9OB 1F11A 1U6AH 2YA1A 4J1UA 1TTUA 1B0RB 5D7JC 4KV5E 1AHWB 3ALPA 4P5TD 4DCQB 3W82A 4P59L 1TETL 1EGJL 3MROA 4X6DF 4MQSB 1ACYL 1UADC 1PBYA 4RAVB 5C0NC 1UJTA 2J6EA 3ESVF 3ZE1E 1D5IL 4ZAKB 2E7HA 3ARBC 4XWOD 3QH3A 5MEOA 1PYWB 3FO9B 4BFEA 5KANI 3JTSB 1CVRA 3QUYD 5EZOH 1T0MB 4Z7VE 2OR7A 5DJ2A 1HINL 4MXVF 3HC4L 5CJOH 5B22A 4TOYL 2Y06H 4FFWC 5E8DL 4HWBA 4K2UH 4U4BA 4F57H 4FQHB 3QWRA 4H1LA 3B43A 3BHBA 4FN0A 3FCTA 4GT7A 4WDIB 2D9CA 3EUUA 4OV6F 3RA7H 1T4KB 2O5ZH 3DXAA 4P4KD 3T3PF 4AZ8A 1TITA 1MJUL 1D9KB 2PYEE 3T3PE 3MCG1 3IJSB 3ILPA 4CNIA 4Y4HA 2HTLC 1JI1A 4J23A 2DRUA 2H9GB 5IVZA 4CW1B 4NJ9H 4EJ1C 3MYJB 5HGBA 2X7LB 3FQTB 1F4WL 4HIXL 4LPYA 3VXQB 1RUAH 3C5JB 2QQKL 3PP4H 1UJ3A 4BH7B 1S8DB 1TFHA 4OGXL 5DDHA 3HUJF 4PJ8A 2X9YA 3CFKB 5EA0H 5DD3L 1WC7A 3UJIL 2VLLA 4PRHD 3MV9B 3GO1H 4NDMA 3V5HB 4G7VH 2IQAA 5KJRL 2NXYB 1LO4H 1T89C 3H9HA 1PX4A 2C5DC 3AM8C 1AGBA 1U8QA 3TN0D 1MRCL 4Q97A 3EIFA 3BISA 1ZVHA 5F1IB 1SM3H 3IS1X 3KPSD 4IDLA 4ODHL 2NY7L 3U9UA 1S5IH 3QQ4A 4HK0B 1MY7A 4ZFFA 4XGZB 4Q0XL 2YK1H 4QTIH 4X6FA 1XF2A 3BVNB 3GJFA 4P46D 2UYLA 1AHWC 2H6PB 3BRDA 1YDPA 2C3XA 1DVFB 1X5AA 4LLWB 1KPVB 5F9DC 4OZHE 2DMBA 2GT9B 4K94C 2Y07H 1TVBA 2V9QA 3MJGX 3MLTA 1NCBH 3VXME 4OZIF 3D39A 1EXUA 4L4TA 4RAVA 2W38A 4KUZL 2A9NL 3BXNB 5HI3C 2A38A 1I1FA 5EU3B 1TQCB 2ZUXA 3RX5A 3WN5A 3SGDI 5D1XB 3O3DA 1ZV5A 4UB0L 4JRWA 5FYLD 4MMZC 3CK0H 1X44A 3ULVF 2VLKE 2OJZL 5CJQL 1I8MB 1G7PB 2NY1D 3TH4T 4R97B 1UM4L 4F8QA 2MQCA 3IKKA 4JAMA 1CD0A 2PYED 5C92A 5DJYB 1FIGH 1UG9A 3QPXH 4ZTOH 1MREL 5DEGA 4K2UL 3GIZL 1UACL 3B5TA 4W6XB 4MCZB 5IHUH 3F8UB 4N8CL 4PJ7A 3TA3D 4NRZA 2AW2A 3FB7A 4QRUB 5ABDE 2J6EL 1XGYL 3LB6D 3U0PA 1IGTB 1ORQB 2H2PD 1S7SB 3I2CH 4JM2F 1I9IL 2ILLA 4JY6B 4JFPB 3QI9C 2Y5TB 3O2VH 3MV9D 4NKDA 5I1CL 1IC4H 5H37G 4M6OH 4U1MA 1KENH 2DJSA 2HRLA 3OKOB 4TSBL 3LY6A 2EDOA 1R3IH 2FGZA 5F7YC 1U8LA 4IRSD 5DD3H 4WV1C 3G5VB 3WLWD 4CU8A 5JHDB 4PRPA 1T5WB 3HE6D 1D9KC 1C5CL 4YLQT 5IB5A 1I1AB 3T09A 4EQ3A 1YNKH 3TYFB 3NFPB 1HSBB 1NLDL 4X9HA 3O45B 1FVCA 1DQDL 5CGYD 3T08A 1FE8H 1LNUA 2A2QT 1RULH 4BK5A 1OAYL 1DBBH 4P5MB 4O51B 3R1GL 4K3GA 1A3LH 3ZE2F 4HWEH 2OM5A 4Q0XH 4QTIL 5BO1L 4AJ0A 4QHKI 5TDNB 2ZPKL 4JDZB 3HR5A 1IKFH 4Z7UB 1UENA 4CVXA 4WTZG 1DR9A 3ARXA 2R2EA 4LVHC 5ALCH 4PJ8C 4GAYA 3DGGA 4Y5XB 4L8DA 3ARUA 3TVMD 4UUJA 5FDWA 2G2RB 3U1SH 3OF6D 4YNYA 3CFBB 4OTXH 5HHPB 4M7JL 1Y18B 4P3DB 2EXWD 2Z8SA 5EBMA 4BA8A 4OCRH 1QLFA 4LCWB 5EU6E 4EDWL 1UM4H 1UZ6F 4Z8FL 3FOMB 4I0CC 4OQTL 4ZODA 1MNUH 4X6DA 2OLDA 5IROA 1GPOH 4ZOCA 3VXTA 2F5AL 3FB8B 43C9A 4RNRB 4LP5A 3IFOB 4ONOA 1F6AA 2CO7B 3WFEL 4MAUH 4WO4A 4ONFH 1QD0A 3MX0A 1GHFL 3C6SB 2F74A 3UPRA 4K3JH 1LEGA 5GRVK 3TZVC 1T1ZB 2YPVL 4JE4B 2OQJB 2YN5A 4R97C 3K4ZA 1TIUA 4YE4H 2LFGA 1VGEL 3ABZA 1W2KT 4MXQC 4R90H 3CIQA 3GI8H 3ZE0F 2E9JA 3LV3B 5H94B 2H41A 5HGGS 3VG9B 3QFDB 4X7FC 4ZYKA 2NY5L 5A2FA 1CT8A 5JPMB 4K7FA 2IAND 1I7ZA 3QAZC 4K71C 3KJ4C 2CO6B 4X5XB 4M7KL 1NANH 5D1QC 2X4UB 3T0EE 2VLLB 5TPWH 4GW5A 4RBPH 5E0QA 1KT2B 2FECL 1WAAF 4FQPA 4JR9H 1MFBL 3HNSH 2R69H 1E6OH 4FABH 4WFFE 5E4EC 5F9WC 2ZJSH 4ZUVA 5MP6L 3T0EB 4QNPE 3TPUA 2ZUSA 4KAQH 4PJ5A 1ITBB 5GRUL 4PRBA 3WNPA 3WLBA 4XC1H 15C8H 4EUPB 3VG0H 4G8FA 5IR1B 5JIKA 2XTLA 1F97A 4C56D 4LCIL 4DKFL 3V7AE 2QQNL 2VDRL 3S5LB 2WIIA 2XN9D 4BZYA 5I0DA 2ESVD 3SDXE 4X98B 1I1AC 3NFSH 5CUSL 4MNQD 4WJ5A 2H32B 1DVFA 2WUBH 3VA2C 1PVHA 1SJXA 3TIDA 4Y5YB 4HGMA 2V5RA 2R0LH 2CLVB 3W81A 3W5NA 2EZ0C 2VQTA 4JFZL 4LPCA 3GSOA 3IU4H 5F9OH 3VCLB 3IDJA 1LEGB 3L5XH 4X7SL 4GLRH 5JOPE 1JE6A 2DJUA 4PGJA 5DHVA 4PJEB 5H8DA 1MCOH 5T5NF 2DLTA 4ZNCD 3VWKD 2CK2A 1P4LA 4D0BB 4N0CC 5DD1L 5SWSE 1Z5LA 3EYQC 1T7XA 4G7YL 1RJYB 4PGBA 4LSPH 3VXTB 2AJVL 4XCYA 4KVCH 3CU7A 4Y19E 3DX8B 4JGMA 4LLDB 5EC1A 3MA9H 4YBLC 1P6AB 3O4LB 4K8RD 2R39A 4ZXBC 3P9LA 1ZVSA 4FFVD 3C60A 1I3RA 4WI5A 2HFGL 1T83C 4N5ED 1LO3H 1PX3A 2NW2A 2R23B 4PB0L 5HD8C 5C0DA 3RWGB 1NCBL 2GITB 2CIKA 1S9VA 4TULH 1WLHA 3U30C 5JLZA 5AD0B 1XCTB 4M48L 1Q94B 3TIEB 5K59E 3RZCB 5T5NG 2Q76A 2P45B 3HG1D 1NCUA 1JIBA 4R3SB 3ARBD 2DLHA 3MRBB 4PJAF 1OLZA 2OJZH 5CJQH 5I1KL 1A7NL 5DJAA 5HDQH 1NAKL 2LU3A 2Q6WA 1CFTA 1U0QA 5JMOC 4LSUH 2XZCL 5E00A 3UCRA 3S35X 2ITCA 1RZKC 2BVTA 3FHAA 2BXZA 2LE9A 3QA3A 1S9YB 3DETC 2YPLB 2NY2D 5HDLA 1I8LA 3BPNC 3P0YL 4P23B 4H26B 4KROC 4RMVA 1KCSL 3JWNC 3MCKB 2NXZC 1LWRA 1CD9B 2C3VB 2VXSL 2XZAL 3HMXH 3O45A 4X9BA 1NMAH 3QWOB 1J1OH 1OAKL 4LDEB 3H0TB 4XCNB 5T1MB 1B90A 4MVBA 1RZGB 2P44B 2WBKA 3QUYC 1FH5L 2DWDA 2FEDD 4MSWB 1LILA 3V6OE 3O3AB 4YHLH 4L9LB 4FXKA 4ENEC 1U3JA 1EZVY 3NMEA 4N5EC 1UJ3B 1J1XL 3ULUC 2G75B 5DJ6A 1VEMA 2DBJA 5GS3A 1BPVA 1VEOA 3BW9B 4IM8A 2NY6C 2Z4QA 4OFKA 3BUYA 2ADJA 1RU9H 3QIWD 2DDQL 4KUCF 3O3DB 1WFUA 3REWA 4QT5A 4XP4H 1C5CH 3QBTB 1F3DH 5T1KB 5E2VL 1FLRH 3DBXA 3L3IA 4XNUL 3W39B 3BPOB 2P42B 1IAIL 4KK9D 1IAII 5C0JA 4Q6IA 1FSKB 3VXUA 2A83A 4MA1C 5DO2D 1BFVH 2V5TA 5JHLH 5DJ0A 3WO3B 2IFFH 4I9WD 3BP7A 2YBRA 2C1OA 3JBG7 4NUGH 4D2NA 5J6HB 4R4BB 3VD9A 4LSPL 2UZYB 3CDGA 4O02H 4G9DA 3MRMB 3ULUE 1QRNE 2FJGB 4XVTL 4KROD 2BVOB 5JPNA 4G80B 1JRHL 1S9WA 1ACYH 1KJMB 1SJVA 4U6XB 3BDXA 1I1FB 5EU3A 1XGQA 1AQDA 4RSVA 4YHIA 5HVGB 2BCKA 1KPUA 1O5DT 1PEZA 4LSVH 3H8NA 4Y16C 5J56B 3QEGH 1CG9B 4NP4L 1YPZA 3LMJH 3F12B 4MJ5B 1OGAA 1MJJA 3UTSD 4H25A 5I8OH 3MLUL 4JFFB 5E8DH 1SEQL 4FXGB 3OKNB 3VFGL 1VACA 2VO5A 4OQTH 5C0AE 3UAJD 3F5WB 1KPRB 3IJHA 3MJ9A 1QQDA 2OP4L 4QRQA 1A6UL 2H9GA 3PXJA 4JDVB 1CICA 1FPTL 2W65B 2ZNWA 3UBXI 3F12A 1Q9KA 4PJEE 4PJBA 4WU7B 5I2IA 2IBZY 3TBYA 1BWMA 4K3EL 3GMQA 3QJFB 3RY5A 2HT2C 2HJFA 4JANB 3I6GA 2W60B 1UWXH 1U91A 2A6DB 2AABH 1TTFA 5FA4B 1LDPL 3ZKXC 3MV9A 5ETUB 3VW3L 1OTSD 3QHFL 4R6UA 4PJ9D 4W81A 3P30H 5KSUB 2VDOH 4JQVA 4XTRC 3QUZD 4P3CL 4J6RH 1FZJA 2W9DL 3RI5K 3EFDH 1I8IB 3MV7E 3UJIH 5D8JH 1JFQH 3SY0B 3SQOH 3LQMA 4G7VL 1RZKH 1Z9LA 4B7IA 5GRVL 1EEUA 1I3VA 5GJTL 5EUKA 4KJQC 1SY6L 4XCFH 1MCWM 5DEFA 3RVXD 4WI4A 5ADOL 4KK6C 2UYLB 1MHHB 3UJTH 4Z7OF 3VCLA 5CJBA 1ADQL 5DEZA 4YZFE 3QDGD 1NAMH 3F7YA 5E2WL 2G9HA 1U8OB 2BMKA 4CN1A 2QKIA 3GSNH 1QBAA 2BVUA 2G2RA 2CKBB 2QQNH 2VDRH 3V6OC 5DA0B 5TE7H 3WUWA 2NQCA 2FO1A 3DRTB 2LV4A 2CDFA 4JJ5A 4M5ZH 5CEXB 2IALB 3DMMD 3NZHL 3GRWA 4M7LL 2XG4A 4IJ3C 4NQDB 1VKXA 5E9DA 3QG7H 2YS4A 2AXFB 3TVMA 2HLFC 3SDAD 1H3TA 5C09B 5CAYB 4B5EA 3TH3T 3ZDYE 2G60H 2W07A 2A0LD 4OKVB 4GBXA 4M4RA 3FO0L 2PCPA 5B8CB 4DGIH 3VXPB 4PJHE 1NCCL 4WEBL 3V0VB 3SKUD 4CW1A 2BVQB 3P4MA 1IC7H 2EDHA 4UNVA 3QHTC 4I13B 4AEHH 5D2LF 4Q9RL 2DYPB 3WEXA 5TQ0L 4RISH 2P49B 4KRMB 1OQOA 3MSPA 2OP4H 1BVLB 4KVCL 3MGTB 25C8L 1QACA 1AD0A 2MOVA 2ZKHH 4NO2B 2CIIA 1PG7X 3C8KB 3QFJB 4CDHA 4JN2B 4GG8A 3FQNA 4EI6A 4CADA 2R1WA 3MPCA 1U95B 3GMPB 1WUNT 4ZPVB 1QKZL 1L0YA 4I2XB 5DHYA 2OK0L 3RPIB 4AYFA 4E42A 2V9RA 4FQXD 1PQZB 4BQCA 5JW4R 1VADA 1QVOB 4UZGA 5B39A 1OQXA 3RWIB 3VD4A 3AUVA 4LFHD 4LK4A 5I76A 4V3DB 5K33A 3V5KB 5MI0B 3O0RL 1NBYA 4ZO7A 5J1TC 3P4OB 2MHAA 4LAJH 4LSUL 4WCYL 5M7QA 1YEGH 5F6IB 5IW6A 5C0AB 1VFBB 1RZKL 1JZ7A 3STBA 1LD9A 3LRHA 2JB6A 4O4YL 1JF5A 4HHAA 5D7SH 4APQA 1T66C 4J1UB 3V7MA 4JB9H 3UBXA 1L7IL 3P0YH 4FQ1H 1GGIH 1SJHA 1GZPA 4R7DA 1YEKL 1OAYH 3HZYB 5DC4B 3PG2A 4NQVB 2XZAH 3IT8D 4XTRD 5DQDL 1RVFL 5FB8B 2OQJA 1G1YA 4JO4H 3WYRA 2PTTA 5J6HA 2CKBA 1JI2A 4JZJC 2DTSA 3GSUB 4LLVA 4NSKA 2MQ3A 4PP2A 1KTDA 4R4ND 3V52L 2VMFA 3S98A 5GSVA 4JFEA 1UWGL 4JY5H 1HOCA 1U92A 1XF1A 1P1ZA 3CFIC 5EIVA 1V7ML 5CEYA 1EGJH 5BV7B 5FK9A 5ERWB 5EFIB 1EO5A 3OHXB 1BX2A 4C57C 4LLVB 4TNVF 5E1HB 4MAYC 1A2YB 1HQ4B 5HHVH 4Y4HD 1NPUA 4U1LA 1UXWA 2IAMD 3C6LA 4GMSL 3UYPA 4LF3B 4D8PB 2AQ2A 1N59B 1HDMA 2WBJA 3BPNB 4P23C 3QA3B 1OGAD 3CH8A 4NQTA 3RVTD 2AQ1A 3ARGA 3OWEA 3A6CL 5C09A 4GW5B 4L9DA 3QUKB 1NBQA 3HI5H 3LSOB 5F88A 1U36A 5E6ID 1LMKA 3PWLB 1F4XH 1G7HB 3LEXB 3CFKA 1YY9D 3VGDA 1ETZA 2HLAB 4FQJH 2AJYH 3JWDC 2J8OA 5HPMB 4DN3H 5HJ3A 3SE4A 1D6EB 2DQHH 4ZDHB 4NC1C 3S6CA 3ELAT 2A1WH 2HVJA 4QRSA 1RUAL 1CF8L 1WZMA 1CN4A 4KKAD 1CLYL 1JGDB 1Y0LB 4XNYH 3HRZB 3I50H 1CDUA 5HHME 1RJYA 4PGBB 4Z7UF 4GG6E 5MERA 5TF0A 3D87B 4O58L 2E7BA 3UPCA 1U8NB 5TDOB 5EN2A 3W9DB 1Y0LA 4C4KT 5L8LB 1Y6MR 9CGTA 2NW2B 2R23A 2BNRE 4JB9L 1CGSH 3WFDL 4EI5A 4CUCA 3JV6B 3ARDA 3MV01 1DL7L 2EZ0D 4EIZC 1HQ4A 4K3EH 3WFBH 3QG6B 4YDVB 2YK1L 5I1EL 4YFLF 1BF2A 5ADPH 4RGNB 5FGCE 3RX8A 1A1MA 3D3VE 2DQFA 4NRZB 3NFSL 5GGVY 3VXMA 5C2BH 3VGAC 3V79C 1S7VA 3WHE0 4YC2C 3VI4F 3NIDF 4OFIA 3HFMH 2NY2C 4LSSH 4UILH 4WEUD 5CMAB 4AQOA 5B3JF 3EFFA 2ZCHL 2ADGB 1S9KC 1G7QB 3DTXA 1OD9A 1T1XB 3EYUL 1PG7W 4MWFB 1EFQA 3C6SA 2P48B 1QEWB 4LPWA 2O61A 4JKMA 2C3WA 4KWUA 4NIKB 4P2QD 4Y5VB 5F7NC 4DQOL 4OI7A 1HI6B 5HHQA 4PGEA 2JJUA 3RWFA 3GSRB 5AG8A 2CKBL 4XWGL 1Z0NA 5IB4B 2PTVA 3A67H 2R56L 3CUPB 1CDJA 1T21B 3RDTA 3GIZH 3MUGB 1S5HB 4O2EA 1V7NH 4FQIH 4QOKA 5D1XD 1UVQA 4BFIB 1RHHB 4MDIB 4X4XA 2AEPH 5IEHB 1XGRB 4Z7OE 5HGBB 1CFBA 1FFNA 4QHLB 5BVJA 1KT2A 2NY3C 2XXCB 4GAJH 4HGWB 1P9MC 3KYNB 5SWSA 5SV4A 5J4MA 1B88A 1NGQL 2V7NB 3HZMA 4QHUA 5E94A 2JJTC 3HE6B 5ICZB 1CLZH 2YUXA 3AGVA 3CLEL 2D0FA 3O6FD 4ZOAA 1H5BA 5TFSL 1UT9A 3G6AA 2FNBA 2R9HD 3PGCA 1HZHL 4OLYH 1BOGA 4UDTA 2ZZUT 5TQ0H 3BZDA 5FUZH 3NABL 5E95B 4LVOB 3KLAA 2IBBA 4RA0C 3RAJH 4LEOB 3UTTE 2W92A 5E8EA 1B9ZA 2QSVA 3EO1A 4JPKH 3R06B 1W0WB 5GISL 3V4PH 4EI5D 3OJMB 1YEFL 4YX2H 4HXAL 4JPWH 2GSIA 4GAYB 2HVKA 3O2DL 4JDTL 4HS6A 1NC2B 1IKNA 1EJ6A 2WK2A 2WUCH 2BY2A 2JE8A 1A7OL 5TGBA 4KHXH 5JR1L 2UVEA 2DQFB 4U3HA 4DAGL 4LOUD 3ROLA 4F15B 5C2BL 2DBLH 1D3CA 2BSRA 5LWYH 1QSFE 1UB5A 2BFVH 1PSKL 4P9HC 4B0MM 4HV8B 2PETA 1A7PL 1BIIA 2BSSB 4PP1D 4YDLB 4GUPB 1OP5H 3S5LG 4OZ4B 4OTXL 3D2UA 3QO0A 5C07E 4TUJB 1BFVL 4JQXC 4W6YB 1ZLWH 2C4FU 5F7FA 4EN3C 4DGYL 1U8MA 2EDNA 4FFEX 5I9QB 3CX2A 4JREC 4FQHA 1VCAA 5FEBA 5DQJB 3T0WA 4NBXB 2ERJB 4U6XA 5KSVB 1M7IB 5IW1A 5LGJA 2ESVB 2HN7B 4OZIE 2H32H 4JRXA 1S78D 2E9IA 4YXLH 2B39A 3U36A 4PY7B 2YEZB 1GHFH 3H2WA 1KCGC 3N9GH 1FRGL 1OARL 3JTTA 2IH3B 5BCAA 4Z77A 5IWLA 2WLZA 1FDLL 1JNJA 5FHAL 1YYLH 1J1PH 5FGBA 2IANB 3PHSA 2ZCKH 2AS5M 3BKYL 5DD6A 4J7RA 4JFDA 1MHEA 1MHHA 1QLRA 2BY1A 4Y8AA 1OHQA 2FO4A 3FQNB 1HWGB 4OF3A 3MXWL 3G6AB 1SEQH 3VFGH 4L3ED 4L4VA 3VFSA 5L2KA 2Y7QB 4XMPL 1V3KA 2IANA 4HJGB 4D9QE 4W4OC 3L9RA 2PR4L 4KRPD 4BKLA 5CHNA 4URTB 5EB9A 3FO2A 1G7PA 5IUSA 2EH7L 3C5ZC 1RZ8A 3CLFL 3MACH 1A6AB 1A3RL 4X98A 2L7UA 4IMKC 4LU5H 5CSZB 1MQKH 1RAMA 2DQUL 4QRPA 2NLJB 3NACH 2APTA 5IVXB 4KJPD 3K8MA 3IJYB 1Z9MA 2P5ED 4OCNC 4V3EB 1DUZA 4XPAH 1KN4L 4OIIL 1RUMH 2XWTA 3LAFA 2A1WL 4NKMA 1S7UB 2ZUQB 3PNWB 5I76B 3JUYA 1I8MA 5IVXA 3VXMD 3D85D 4LVOC 5INDA 4MD0B 5ICYB 3O11A 1MRFH 3E2HC 1J0ZA 4YDLC 5IKCA 1Y6NR 3QHZH 2G9HB 3EOTH 1JZ5A 3U2SB 1A7PH 4LRNH 2HKFL 4Y2OA 2ZOKA 2ZUUA 1EAPB 3ROLB 1HHGA 2F9BT 2PYFA 1IEAB 2LABA 3FQRA 5D1ZA 1NJ9A 3OXRB 2GK2A 4DGYH 4LSTH 3CZFA 2N56A 3U46B 2J8UF 4HEPG 3PHOA 4WHCA 4PRDB 2V2WA 3WJJA 4LLYA 5I30L 5I6XB 3RWHA 4NOBA 4JFOA 1T20A 2BSTA 4M8QA 3VFUB 4MJ5A 1VPOH 3QDJD 3QEHA 1JFMA 1JNNH 1RZJH 2QBWA 1S7WB 3NCCB 5ALCL 4MB3A 3VGBA 5DS8A 2E8ZA 4XPBH 5J3HD 1V3MA 5C3TA 3JWDH 3WSQH 1KB5B 4OLXL 5HHOA 1HEZB 3TN0A 1NGZB 3FTGA 1YYLL 3JV4A 3JXAA 1CS6A 2NR6C 4G42B 2C4FT 4HS3B 3TBYB 3OB0K 1WBYB 4MDJB 2MTPA 5IBUG 1WCBA 4Y5XC 4PP8C 2WBJD 4J3WA 3GBLA 1IC7L 3PWNA 1A7NH 3O3EB 2YMXL 1HDMB 1KJ3H 1N59A 2BNRA 2WBJB 5CBAB 1H8SA 4Z78B 5F9AC 2CUIA 3WFHB 4F57L 1PZUB 3TBTB 4P23D 2NY4D 2R56H 3L3KB 4U1GC 3RVTC 3RA7L 5FYKE 1ZA6A 4OLEA 4A6YL 1FL6A 3THMH 3MRGA 2JF1A 3IAQA 1U93B 1ZT4B 5CEYB 1JHKH 5E6IC 1JGUH 4ZAKA 3Q5YA 2OK0H 3AB0C 2CH8A 2YOCA 1XIWA 4JO1H 2P5EA 3GSQB 4HWBH 4C56A 3B9KB 1NGQH 1EDQA 1IQWH 1IT9H 4I8DA 1AXSA 1T2QH 3U9PL 2FX9L 3VJ6A 3WXVH 4KTDH 3KR3H 4GSDL 5KOVC 1MHCB 5JW4M 3JZ7A 1Q1JL 1REIA 3GUTA 2GKIA 4PP1C 3WUZA 5FOBB 2B4CH 4N0YL 3NPSB 1NGWB 1I3UA 3EZ8A 4ODUA 3IVKA 5FGRA 3WXWL 1A9EA 4D3CL 3IU3A 4JG0H 4Z7VB 3VWJC 3BFOA 1A4JA 4G8GA 4NQEB 4LCWA 4OUOA 1YPZF 2QHLA 2X44D 4P4KB 1KPRA 4YX2L 3PABB 1D6EA 1GC1C 3MGOA 3PDOA 1S78C 3WNKA 4LCIH 3UTSA 1AO7A 1SEBA 1NBZB 5LGHL 5F89A 3VXRE 2OBGA 4RCAA 1M7IA 4PRPD 5IW1B 4JG1H 1J10A 5E8OA 4X99B 1SMOA 1D9KD 4LPXA 1D5ZB 5SWQA 1BM3H 4LLUB 4PRIA 2X4OB 1FHGA 3HCVA 1PG7H 1DP0A 4K3HA 1OAZH 2C7UB 1URLA 4JHAL 2EYSA 1QLEH 3AVEA 3G5VA 3RL2A 2OTUB 5FCSH 4MA7H 4GMSH 2VZ3A 4RZCB 4OGAD 5F72S 2X42A 5TH2A 2W65A 4QF1B 1CFNA 3QUXA 4XCCH 3PE9A 1A7BA 1GL4B 5FM5M 3ARDB 4JFHE 3WNLA 1S7WA 5DLML 4Z0BH 4CRPA 1K6QH 4XP6L 5MI0C 3ESUF 2YRLA 3OSKA 4TTDC 4HS8L 1Z9OA 3L5HA 1IM9D 4DW2L 3HZKB 3IFPB 3MLTB 3MUY1 1FYTA 5J1SC 3TA3C 4RX4D 3LN4B 4F9LA 3MRGB 5DGRA 3ECBB 3O6MH 4X0KA 2J88L 4MYWB 4K8RL 2C9AA 1RIUH 2A77H 4KRPB 2X2YA 2C3GA 4N1HB 4JFFD 4WDIA 3B2VH 5J12B 1ZHKA 5KVEH 3MRCA 2YD5A 1A21A 3O9WA 4YBQC 3HZYA 2GITA 4XPGH 4JM2A 3CFDB 5EOTA 1X7QA 4G9DB 4TNWF 3L7FA 1OPGH 1KLGB 3W9EB 4KQ4H 3NIFE 5FYJL 3BP4A 3K80A 4IOIA 5AZEL 3WJLA 3T2NH 1BZQK 1XIWB 4HIHB 2R4RH 1UCBL 4UT6H 4N0YH 5EOQH 4ONGL 1S7XB 4P2OC 5IMMB 3RVVC 1XH3B 1DQDH 3MO1A 2AQ3A 4NCC2 2H26A 5IJVA 3WFCH 3P0VL 5SWSD 3R1GH 4PTTB 5CKAA 2F53E 3V95A 2I26N 5F6HI 1M1SA 5LG1A 1AQKL 1FYHB 1GRWA 3MYJA 3IDXL 4P4RB 3PGDB 4JRXB 3WN5B 3IXTB 2JJWA 4GRLC 1IC5L 3MBEC 1KENL 3D0VA 4MD4B 3D69A 5HVHB 3MLVL 3RUGE 3FQXA 4NT6B 2VDNH 4HLZG 5CWSA 4DZ8A 1OY3B 1SMAA 4JFHD 4KTEL 4UTBH 3ZLQC 1PG7L 2EIEA 3SKOA 4ACPA 3CPLB 1E4KA 4M7JH 2HKHL 3H9SD 1UH4A 3U0WL 1A6WH 4O9HH 5SWZA 4FXGA 2VAAB 4NHUE 4IHOB 1BIHA 2IFFL 5ISZA 4TVPD 5KVGH 5DC9B 2IPKA 5E00B 1ZE3C 1AGCB 3OKYA 4PRPB 1OP3K 3EYOB 4P2RA 5HI5C 3G5YB 1B0GB 1CK0H 1L7TH 4LL9A 3MV7B 4MA1B 3QIUB 1FNHA 4QY8A 1R3HA 2NLJA 4MXWL 4XVUC 2VOTA 5CZXD 5DI8B 2XQYK 3GMQB 1QSFD 1YEDB 1NBYB 2DOCA 4PPTA 2FRGP 1DANU 2QHRL 3OJDA 3TCLA 3TJHC 1CXKA 2EO9A 4PIRF 2YN3A 3PP3H 2FJGA 3L9RB 1MCSA 1K8DB 5L9DL 5IMOB 4D0DB 3BVNA 5C07D 4EI5B 2D0GA 5DI8A 4OUUA 4N0CD 5C0AD 3O9WD 1X3DA 4NQSB 3GKWH 4S0TD 1WFTA 1HYRC 3MLZH 1F90L 1U8KB 1Z3GL 3MRQB 5J8OA 4NQCD 3L95A 5BRZB 3UEZA 2Q8AH 3DYOA 4LPTA 1GC1L 1QNZH 4MNGA 2XN9B 4G9FE 3L7EB 4DUVA 1XF5A 4MHHG 3RY4A 3DBXB 2DI8A 5HYEA 2BHUA 4A6YH 4XNXL 1MAMH 4OIAA 4ONHB 3B5HA 1YQVL 2PW1A 4WTXA 1OAXH 4E41E 5LAXB 3WIFB 1DSFL 3VXPA 3BEVA 2MNUA 3T0ED 2D4FA 4LCYB 2WSKA 2UZXB 1WEJH 1HCFX 2AJZB 4J12A 3FRPA 4M1CD 4AMKL 4YO0A 3DRQA 4LHUA 1FP5A 1HHJB 3D69B 3QNYA 5IHBA 5HVWA 5CUSH 4WY7H 4P5KA 2NXYD 4MCZA 3WXVL 5J1AA 3Q0HA 5GRYA 3QO0B 2FH8A 5GHWL 1PSKH 5D93B 2B1HH 4QRRB 3ARGB 4OGAC 3DRQB 2HAZA 3S36X 1M71B 4KPHL 1Z6JT 1GXEA 4K23L 1S7SA 2VDQH 5KG9A 1S9YA 3DHMA 2IAMA 3EYSH 4HCRA 4H1LH 5D4QA 5KSBB 1RD6A 1BEYL 1LNUB 2H1PH 4FRWA 2MKWA 1RJLB 2VKWA 5DD1H 4GQPH 2ARWA 4Y1AE 1EEYA 3OQ3B 4KVNL 4TTDD 2UVFA 4CGTA 4I0PC 1OSZA 2XWTB 5I19H 5JHDA 1FNFA 1I9JL 1U93A 1ZT4A 1G7IB 4LNRA 5KVFL 1JL8A 5DZOA 5J11C 1J88A 3N9GL 1I8IA 2DKUA 3H9YA 2NTFA 1J05A 1H8NA 5JMRA 5TF1H 2QR0B 4N90D 4F7CB 4HD9A 5ANMB 1H0DB 1K8DA 4HIJA 5BQ7A 3P9MA 3IU4L 2CQVA 4MCYA 3NVQA 1TCRA 4IS6A 1N7ML 1HHGB 4L8CB 3O8XD 1JZ6A 2RFXA 1NCWL 1P7KA 3KS0H 3GKWL 3WL9B 1U8JA 4XVUD 5DVNA 1LO2L 3BDBA 3BEWA 4N0UE 4G7YH 4RFEA 5A3ID 3HNTH 1A4KB 2W9EL 1MJ7L 4QGTA 3B2UD 3MRPA 4ZXBB 4HKJA 4BFGA 2QLVB 1RJZA 1JN6A 2CLZB 4OSUL 3TT1H 2OTWA 1T0MA 5GRZA 4Q6YA 2VXSH 5A16B 5CGMA 3S34L 2X4QA 4PJIA 4XPTL 5T1KD 3VDAA 5I71B 3O6LH 1RUQH 4WU5B 2Q86B 3TO4A 1XIWD 2MPAH 4TUOB 2OI9B 4KHTL 4JKPL 1RZIB 1BZ7B 3TF7A 3GSQA 2NTSP 1OOAA 2HTKD 2R1WB 1FNEA 1KCUL 1OAQH 2HH0L 3I6LE 3DRTA 4PJ8B 2I07B 2I5YL 1U8PA 3VGFA 2AV7B 1RIHL 4JY6A 5I8EB 4Q58C 4ELMA 2YPLA 4NZRH 3X17A 3TCXA 4RGOH 3T2NL 4U3XA 5FYLH 1NCNA 1BLNB 4WUUB 4M6MH 4KI5F 5D7SL 3EOAB 3JVGA 3ALWA 1S7RA 3S9DB 1QO3B 3SKOB 3HMXA 4JRYB 1OSPH 5C0RH 3IDGB 1FO0H 3TNNB 5B38G 5HI5D 2ICWB 3KDMB 4JPVL 1CXLA 1IILE 3KYAA 4NGHL 1QR1B 5CEZE 2V7NA 4NN6C 3ZSSA 2AJUL 5HHOB 2X09A 2MCPH 4MXVE 3G5YA 1BF8A 4KJWC 1YMMA 2D7NA 4N8VB 2ADIB 2O5XH 35C8L 2NTFB 4HBCL 5HPOA 5IQ9B 4HAGA 4XPBL 5H35A 5GGUA 2J4WH 1UVQB 5CHNB 2ID5A 4TTGA 1RJZB 3NGBB 3QEUB 1NFDE 4FFYH 4G43A 4KK6D 1JMZA 2HTKC 2EEBA 5IF0A 2YSSB 4QGYA 4ZG1A 2VYRE 2IQ9H 5BV7C 1F13A 4O9HL 4D9RE 3SDDD 4YHYC 5I8OL 3K74B 4GG6A 5DMGC 1MVUB 1A6ZB 4MAYB 1NC4D 3TNMA 3UPAA 5T3XL 4UOW1 4ZUTB 1IBGL 1YEJL 3TFKC 1QRKA 1KCRL 5C7XH 2VAJA 1MJ7H 1SYVB 3EO9H 4HJ0D 5DMJB 3VGEA 1ZHKB 2YPLD 4XVTH 4A2LA 2AGJL 3D1MC 4S2SB 1HWHB 1M7DB 4P48A 3E2HB 2Q6WB 3GBNH 1YJDL 1C7SA 1R5VB 1T0PB 2HJLA 3IETB 5GISH 3BAEL 4XPTH 4ZSOA 2HP4A 3BH9B 2IPTH 2J12B 2E6PA 3UC0H 3S88H 1EXUB 4HSQA 4I5BA 3QUXD 3VFNA 3RZCA 4WHTA 1LK3H 5EDXA 1QSEA 4P3CH 4P3WA 3HZVA 1YECL 2FX9H 1N6VA 4UT7L 1IGCL 1UGNA 5E8OB 2D3VA 2VN4A 1B2WL 1F90H 4PRDA 1T7WA 1E4WL 3SBWC 3V0VA 3TGXA 2N1KA 1GC1H 1QNZL 3PHQB 4PBWD 4O58H 1LP9B 2KPNA 3NZ8B 2P4AB 5ECJE 3MOAH 1CE6B 2FLRT 1HXYB 4S1DC 3P73A 1HXMB 3VXSE 2ZSVA 4ORGA 4FQXA 1N8ZB 4AL8H 4TUJA 1NCAH 4KKLD 4J8RB 2DICA 2MWCA 4AY0A 4PG2A 4YDJA 4OZFG 4G8EA 2DTML 1U8HB 1G9NH 1P2CB 4FNLH 2AJUH 4BQ6A 5I73C 1FFOB 4OCYH 4X6EA 4H0GA 1KSRA 3U30B 32C2A 4U1GB 3F7RA 5F1NA 3TV3H 4B53A 3FFDA 4HFUH 3QWOA 3K7UA 4Z0XA 4G8GD 4L1DA 4E41B 4HS6B 3FN0L 3PQYD 1EFXA 4NQXB 2DWEA 4X6CA 3PJSA 4NO0D 3UJTL 2A6KB 1F4YL 1UM6H 3G6DH 5EBMB 4UNTA 5EH1A 5ACMA 2FD6H 1P4IH 1KYOK 4J3XA 4XRCB 1Q9LB 4YDIH 3SDDA 3HRZA 2XT1B 4P9ML 2RJMA 1VESA 1E6JH 2WBWB 4G9FB 4ZD3H 5FO7A 2Z0BA 3LS4H 1CD1B 2FYYB 3PGDA 2ADJB 1CIUA 4L4VB 4NZJA 4POZD 4M1DL 4DN4L 3DMMA 4YJZL 1CZ8L 2EDEA 2EH7H 3CLFH 1JPGB 1OW0A 2H26B 1JNLH 1IAKA 3K2UH 3K4AA 4AENA 2Z31C 1YEDA 3QG7L 5C9JA 2OMBA 3L5WA 2JB5H 2YPVH 3HN3A 4OZFH 3UP1A 3X13A 1PKOA 5D5MA 3GNMH 3WCYA 1G9MC 3FO0H 1SQ2N 3MRLB 2EIZA 3P4MB 3ZYZA 1XGRA 1F00I 1IQDA 1UZ8B 5F44A 3QUZB 3I6KA 1IGML 4ZO6A 5DFVD 2F8VA 1K3ZA 1SHMA 2DQIL 3NBNA 1U58B 1FNLA 3NIFF 5CINH 2OR9H 3S4SB 4XAWL 4M6NH 1WTGT 3F7VA 4JPIB 4LHQB 1VFMA 3VRIA 4KKCC 2HT3D 2DL2A 1AQDB 1D5ZA 3BKML 3QUYB 4GMTL 1MFAL 5CIPA 1HKLH 5DQDH 4W68A 5HYJA 1GIGH 2JCCE 5E4IA 5J11B 4RIRB 2Y5TA 2JK5A 2YZ1A 3ULVD 3WE6A 4KKBD 2DMKA 4XBEL 5EBWB 4ZQKB 3VXQA 3PP4L 3QXTA 3BO8A 2XQBL 5I1IH 2CRIA 4PG9B 4Y19A 4YPGB 3V4UH 3NCEB 2VL5A 3ZTJH 1I8KB 3FO1B 4ZS6C 1T04A 5LWYL 5LJYH 4E5XB 4IRJD 1AGEB 2KH2B 5L2JB 1MUJA 4CMMA 1TZHB 3JWDL 5CS7A 3SCMC 2JIXD 4N0UA 3C9NB 4L8BA 4Y16D 3V5DA 4ERSH 4YHNB 1L7IH 4O51A 1K9TA 5CBEB 4OGYL 32C2B 1Q9WB 3FMGH 5FUOL 5C0CA 1JVKA 3FQUB 3FRUB 1ZLVH 4PV8A 5D70H 3O9WB 2VLJD 3ZKMC 3GRWH 3OJDB 4OKVA 1G9NC 1OD7A 1AY1L 4XPFL 2FHCA 5IV2B 2ZSWA 3S96A 2NX5B 4G8GB 1IAKB 4QO1A 4X6DE 1ZTXL 1RY7B 4XHJC 2KBGA 4XHQA 1OM3H 4BSVA 1IEAA 3FQRB 5D1ZB 2APVA 2ERJC 2J8UA 2X4SB 1AXIB 5DUPL 2BX5A 4U2ZA 5DYOB 3BD4A 1NDMB 1AD0B 3AAZB 2PXYB 2R1XB 2AEQL 5D7JD 4ODWB 3QUZC 3QNXB 1UFUA 5I8EA 3NOIA 3QUZA 3NTCH 1YPZE 2V5SA 3KHOA 1NANI 3U9PH 2BRRL 2XYCA 3KYKL 3CH1A 4OCSL 3I3BA 3ARYA 8FABB 4KMTH 5D7LE 3QPXL 4ZTOL 5F88B 3IXAB 3LKNA 4MS8C 3MLPA 3GSRA 5GGQH 1KB5A 3F7VB 4MNHB 5DRXB 2P5EE 4YO0B 1A3RH 3UO1L 3EDEA 5ACZB 1TQCC 2AK1L 1ZT7A 1YZZA 5D1QB 5F1OB 5HHNA 4FFWD 5C07A 4D9LH 3EHBD 2FLBT 3LN5B 4QRTB 5DA4A 3BJLA 3OGCB 4P9HH 3RWJA 3O6FA 1A6AA 4UIMB 5D2LA 1CGYA 3BWAB 2F53B 4AH2B 1AI1L 3NFNB 4Z7WE 5GSRB 1CF8H 1G9MH 5BW7A 3QT2A 4N5UA 1P4BL 1RV6X 3LN4A 4DOHE 4OQTA 4XC3L 5E08H 4ZFZA 3EYVB 5J6GA 5C0EA 5SWZE 3CDFA 2E5EA 5CILL 3OAUL 1FVDB 2VE6A 4NC0B 1FBIL 3RFZC 1T0NA 5IW6B 4NBZB 4BFBD 1PKQB 1X5LA 4XNZC 4ODXB 2AXJA 3LDBB 3GEWB 3BGMA 1XGPA 3HPLA 3KPPA 1QLFB 3L3DB 1AR1D 4F9PC 3FT4A 5L0QB 3EOBB 5D7KE 1XR9A 4C55A 4AIOA 2JJVA 4NN7B 1JNHA 5ITBL 5E5RB 2HWZH 5EOCJ 3MRNA 3QXVA 4JM2D 1EZVX 2CRZA 3VA6A 1JTTA 1D5XA 3H0TA 4XCNA 4Z95L 4IRJB 4R96A 1HIMH 3H9ZA 4L29B 2WIMA 3EGSA 1S3KH 2M2DA 1U92B 1JRHH 4MNGB 3O6ML 1O7VA 1U9KA 5F7DB 3GHBH 4WWKD 5ID1A 4DK3A 4U1SA 5EIIB 2FJFA 2YZ8A 2EDTA 1T1WA 1QSZA 1RI8A 1V05A 2EKSB 1KCLA 1MIEL 4YQXL 1G7HA 3T1FB 2AK4B 5DJDA 4XPGL 5IBLC 4LEXL 4LPVA 1OGAB 4U33A 1DQJA 4QOKE 1SJEA 1NGWA 2YD9A 4Y19D 2VR4A 1KEGH 2A6IB 4WI2A 1HXYA 1WTLA 2DLFH 4NUJA 1NEUA 3VFNB 5BMFH 2YUVA 2P5WE 5DRNA 1KPUB 4YZFF 12E8H 4TVPH 5H94A 1V7NL 4FQIL 2O93L 4PJAA 1OW0C 1RZIA 5HTSA 5F71A 2J3SA 4JPIA 5C9KA 3HR6A 3ZKNC 4G8FB 4S2SA 4H26A 2YHGA 4LCWD 4X6BA 4DFHA 5E5MB 5F3HB 2VNCA 4GAJL 3EDFA 4HZLB 5SWZD 2W60A 3TP4A 2FEEI 3UTTD 3GI8L 2X7LA 3FQTA 3EFFB 4XT1C 5LXGH 3F58L 3SDDC 2WWMC 4E9LA 1MAKA 3C5SB 3KHQA 3SJVD 3MRHB 4XP5H 2YC1A 3DO3A 4OI9A 4Z9KB 5DJ8A 2Q1EA 5DURD 1KELH 4OLVL 1INDL 4Y19B 4YPGA 5FUZL 2EDKA 3IDNB 4GJTB 3UJJH 1MCQA 1VHPA 5SV3A 3KPTA 4FQ2L 5KOMC 1E6OL 4QHUB 5E94B 1MHCA 1T6WA 3W2DL 4HKXB 4K7PH 4NKOB 4OLUH 3SDCC 1JTPA 2NY6B 3C6LD 4J4PD 1FZJB 4FP8H 2VISB 3MTRA 3GSXB 3JV6A 1X5HA 1RZJC 3KPQA 3BPCB 3BMVA 1OT1A 4K9EC 4MJIB 1AIFA 3O4LA 2R2EB 4X4MA 5KVGL 2E7LE 3BPOC 3FONB 2Z31B 5INCA 1XEDA 3VWJB 2QV2A 5EUKB 1IGIH 4UI2A 1IM9A 2DIBA 4UV7H 1YDPB 1AKJD 3ULVH 2C3HA 1NLBL 1P53A 4X8JA 2GJ6A 1DCLA 1TZIA 1NGXA 1QHOA 3LHPH 3RWFB 1EMTL 3MJ7B 4QRRD 2BJML 3OKLA 5J89A 2M26A 5D7IE 2FATH 2J5LC 3PQYA 4EDXB 2VLKB 5JUEL 4OZGE 1MFDL 2MFNA 4K9EH 3BYYA 2PXYA 3MXWH 4D0CA 1DN0B 2JELH 4ZS7L 4WENB 4J8RA 1FC1A 1S7VB 4MHHI 3RBGA 1Q72L 3KLHD 3VRIB 3A6BH 4EXKA 2IPUG 2Q76B 2ED9A 4APQD 4NFBA 4WEMB 1PKQE 5K9JL 2EXWC 2V2TA 1U6AL 5DUMH 5C0GB 2IH3A 3AY4A 5F6HJ 3TBVB 1G6RB 5DHVH 2OJEB 5JQHC 2H2SC 2EDWA 3FKUS 5IB1A 4PGCB 4P4KA 5F70A 4HMEA 4M48H 5FF6B 2YA0A 2RHEA 4WHDA 5D9SA 5HI4D 3I6GB 3QQ9C 2I9LB 1AE6L 3RWDA 2I9TA 1MCJA 1E4XL 4GKSB 3F7QA 4OD2A 1RURH 3IDYC 3AREA 4KQ4L 7CGTA 4XNMB 4E0RA 1NFKA 4OAWB 5LQBH 4Y4FB 2QSCH 2AJSH 4K7PX 4DKEH 2XKNA 4Y1AB 5I0ZA 4RGMB 4QRRA 1DDHB 1LO4L 2BC4B 3ZKSD 4C58B 3M1BA 1YMHB 2KKQA 4AEEA 4F2MA 2B1AL 3MJ7A 4OLUL 2G75A 1ZGLP 3IF1B 3HMXL 1GGIL 2DQUH 3SDDB 1U8JB 2GW5A 1MFCH 2V5MA 4BYHA 1II4E 5GIRB 5IMMA 2P8MA 3RJQB 5C09D 4R4NC 1R3KA 3VI3E 3P9MB 4NC1E 3CZJA 5BS0A 2BDNL 4M43H 5E70A 1WZ1L 4XXCC 4U05A 2UUDH 4LPUA 5KVFH 1HYSC 4HWZA 4PJXB 4ZTPH 3DI2B 3OKKB 3H9SE 3G6JA 3EO1B 3CD4A 3CMGA 2VLKD 3ZDZE 4HUXA 4N0UB 1CE1H 4XH2A 5JUEH 1G6RH 2E3VA 2BERA 4BQ9A 3QNYB 4ZD3L 2HWZL 1OAUL 3CGTA 4JFYA 1BZ9A 5EO1A 1QFWM 5CD3A 4CBPA 2B2XH 4JJHA 4AENB