3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
3JTTA 2B5IC 1LQSR 1W72H 2P5WA 4H25A 2AV1B 3CCHB 4AZ8A 3D2UD 1P7QD 1T5WA 1WWBX 3AS0A 3RZWA 1FN4A 5DRXB 3CFEA 5K9JH 3WFZA 2B0SH 3AROA 4PV9A 5F7WC 3VFGH 2WLYA 3KYKH 3MRBA 2EDFA 3GSUA 2Z8RA 2ITCA 3QQ4B 5HJ3A 4U1LB 4YK4C 1JYVA 4JFFE 4YXLH 4RMRA 3DO7B 1RUKL 4AT6B 1RJZA 2V5TA 1ZA6B 3HMWH 1M7XA 3KPQB 2VLME 2BNRB 3EHBC 4M93B 4WUKH 3FQNB 2HH0H 4LFHG 4WJ5A 4AIXA 2WUBL 5IB2B 3ZT7A 5TGBA 1ZA3B 4M43H 2IQ9H 5C0RH 2CGRH 1OD9A 5I66B 5F7FA 3LD8C 4Z8FL 4M4RA 3LKNB 4QGYA 1QHOA 4DZ8B 1TJIH 4WWID 3W9EA 2AXFA 5K9QI 4JFHE 5DJ0A 2EDRA 5EBLB 3RNKB 4X6DB 4GKZA 5A1AA 1JHKH 5IFAH 3GMMB 1NANI 1VADB 1JGDB 4K9EH 1SYSB 2YRPA 2CSPA 3MGOB 4XPBH 5DJ6B 3W39B 3N06B 1YQVH 1ZWIA 1EVUA 1MCKA 2CK0L 3FONB 4Z5RB 1JL8A 1YJDC 5IBLD 4MA1C 4PJIA 5F9DC 3CK0L 4XNMA 3OB8A 1RK0B 1J11A 3I2CL 1HIMH 4OFYD 1ZT4B 5F6IB 2ADGA 4UQ2B 4HKJB 4XP4H 3P0VH 5FB8A 3LKQA 3P4MA 5C0FB 4XP5H 4XCFH 4NBYB 5JNYB 1Z9MA 4C55A 1MFAL 1FNSH 3AS1A 5HVHC 3TIDA 1J0YA 4KJQC 4QXWA 1CL7H 3ME0A 4P3WA 2CLVA 1AGFA 4R7DB 5FV1L 3RL2B 2AGJH 4KTDL 1YMMA 3TNMB 1IL1B 2GITA 2Y1VA 3GSUB 3OR6B 4HKZA 4HFWB 1LEKB 2DLTA 3OGOE 3UP1A 4UINL 1EMTL 4DK3A 4PY8I 5E08H 4A6YA 4PP2B 5BRZB 3TA3B 4MXVE 5K9KB 2XICA 2GSIA 2VNCA 1MJUL 4TUJB 1K4DB 3CH8A 1FRGL 1Q9OB 2XWJB 2XZQL 4LLYB 3P9MB 4HUXA 2ICEA 5CHNA 5HI4D 4ZTOL 1J0ZA 3AXLA 4AEEA 5I1AA 4EI5C 1N0XH 3GMRA 2V17L 5J1SC 5D1ZB 4X4YB 3ETBF 1OTSC 5DR5H 1T4KB 5FKAA 3QPXL 1WV7T 2AJ3B 3I50H 3WL9B 1QNZL 2J7LA 4XNYL 3A67H 2CKBH 2I26N 4P4RA 3ZDZF 4Y4HD 3EYVB 3MROA 5F8RC 5KG9B 3ARFB 4Y2DC 5IMOB 2XWBB 4OCMC 3C5ZA 2Q76A 5JPNB 2FX8L 2OTUA 1G9NH 4HIJB 4JFZH 5MEQA 4LBEB 1DANU 4WI3A 5FGCE 4X7SH 4ZODA 4HKBA 3ZKXC 2DIJA 4L4JA 5F6IC 2ERJB 3KR3L 3BP4A 2HFFA 1FDLL 3C5JB 1MF2L 3REVA 5IIEB 1ZLWK 3WSQH 3FB8B 3SDCC 4KZEL 1IGYB 3U46A 1EFXD 2A73A 1EA9C 1XGPA 4KJPD 4TSAH 1YZZA 4NQUA 4FFEX 3PWNB 3QDJB 2RHEA 1CFSB 3TH2T 4PJFF 1BVLA 4YFLF 4L3CB 4RBPH 4DVBA 4JKWA 1C5CH 4G6JL 3O2WH 4F8TA 2NCMA 4RFOH 2Y7QB 2J8UB 3LN5B 4YE4H 4RAHA 3T09A 4R4BA 2YPLA 2ZWLT 2YK1L 2A83A 4Y16C 1NCUA 3U9PH 5HVWA 1MOEA 1UZ8A 4C4KO 3MTRA 3F7RA 2P49B 1KPVA 4I18B 1AGCB 5FK9B 1K9TA 3LKQB 3P4MB 2YD1A 5C0FA 2GJ6E 2R4RH 3KLSA 2A6JB 5I9QC 5I17A 2DQTL 3D1MC 3T77B 5JHDB 3VW3H 1FFNB 3QUKA 3IJYB 1XCTB 4KY1H 5ITFB 3SY0B 3IDGB 1AGBA 3VXPB 2YD4A 4JG0L 2EKJA 5IBTH 2HG5B 3ILQC 5C9JA 1QO3B 2VLKD 5D7LA 1QFUL 3K8MA 3SDDA 1A7BA 2X1QA 3SQOL 3OKOB 1RUPL 5DT1L 4N0UA 2BMKA 5F8QC 4P46B 3S36L 4E5XA 1H3TA 3OKLB 1RFDH 2BVPA 5IIEA 5FGBC 5GGUA 5T1DL 1VENA 3KLDA 4LPXA 1FP5A 4I4WA 4KKBD 2DQUL 1QR4A 1CXFA 5F44A 2Q8AH 4HV8B 4YHYC 3NGBB 3STLA 1LO3L 3QEHA 5BMFL 1QSFB 1GYAA 1RZ8B 3EKCA 4XCCH 5EFIA 5TDOA 2K7PA 5LGHL 5J6HA 4M6NL 4BELD 5BXFA 4EN3A 4CN4A 1KNOB 2MKWA 3LAFA 5TQ0L 2KL6A 5CBEB 4XZUA 3VFUB 1CD0A 3DUSA 4ZUTA 1QFWM 4RFNC 3EDKA 3EDFA 4OZIB 1J18A 2B1AH 1SM3L 2LFGA 1QSFD 4TVPD 4WFEE 4YDIH 3MXWH 3BP6B 4QF1A 2XTJC 3HC4L 2E6JA 3CNKA 3GSRB 2LVEA 4U2ZA 1BQHG 4V3DB 4PJXA 2IPKB 5HHPB 5GJTL 3ZT6A 1MUJA 3GJEB 2KZWA 4P46D 1R24A 2PTVA 4FQCH 3CSGA 4WTZG 2XA8L 3QUXA 4ESKA 5I1IH 2VZUA 3C60A 4M8QA 3SKJL 5KN5B 2GJ6D 1QD0A 1U93A 3VCLA 3A6CL 3BMVA 2ZG2A 3PQYD 2ZCKH 4JFPB 2WBJA 2VDLL 4PS4H 4YXKL 4NN6C 1OM3L 4PRHE 4F2MA 3QI9C 4L9LA 2J2ZA 3HI1A 1A2YB 4M02A 5E5RB 5HPMA 3ULVH 4JFDB 1KB5B 3TYGH 1MWAA 3H3PL 1TVHB 1JPSL 4HWEL 1DBAH 4KK6D 1IAII 4XPGL 3OAYH 3O6FD 4U33A 4O58H 5J06A 1XGTA 2HWZH 5FF6B 2DQDH 2XN9A 3RP1A 3STLB 1IGFL 4KI5C 5DEZA 2HA1A 4NWUL 4CJ0A 3IFLL 3S7GA 4DN4L 3KPOB 5EU3B 4NJ9L 1KLFA 4FTVE 4KWUA 3ARDC 1MQKL 1YECL 5HDOA 2A0LC 3EJZC 3MV9D 1MPAH 4XCYA 4U1HB 1IGML 3RUGE 4UQ3B 4R90H 1IM9A 1H15B 4XNZB 3TFKC 5ESQB 3KJ4B 1SYSA 2J4WH 4IOFD 3MRRA 1RJZB 3A6BL 4HBCL 4G6AC 1E4KA 4GQ9H 1V7ML 5C3LD 1U8QA 4UV4L 4KXZI 4K8RL 4ZSOE 1F90L 4NGHH 1WICA 3ZE2E 1NC2A 4HUWA 3MBEA 1L7IL 1C5BH 4GUPB 1CU4L 3BPCA 3DJ9A 4ODBD 3VXTA 2F5BL 1B3JA 1RVFH 5FOJA 5JQHC 4E0RA 4KU1A 2CLVB 2VRAA 5IG7B 1RU9H 3QXDB 4ZO9A 3V6ZA 4YHYB 2EDQA 3G6JB 5ID0B 1BIIB 3UEZA 2C4FU 4D0CA 1SY6H 3T3ME 5D7JD 3DVIA 4A6YL 2QEJA 1ZK9A 1MCFA 3IDJB 2JCCF 5D6CA 3PWLB 4XX1G 5BS0D 3LEXA 5ADOH 5D6DA 3INUH 4P23C 2DKUA 1X3DA 2ORBL 1RZJC 2DTSA 1DVFB 2X4OA 4RGNE 4PLOB 3BZ4B 1UJTA 2HJLA 4Z7OF 3CVIL 1D6EB 4GAFB 1HNGA 2DKMA 4YBQD 3IDXH 2JELH 2IQAA 1TVDA 1JHLH 4ZUWA 3KAAA 4CMMA 5DC0A 2DAVA 2PW2B 3GBLA 3VFPB 4OCXH 5D2NE 1I1RA 3PP3H 3D48R 3UJJL 4TOYL 3RL1A 2FJFB 2FHFA 2RGSA 1KIRA 3BEWB 3U0PA 4YHNB 5MP6L 4JRYD 4NN7B 1HSAB 5GGSB 3ULUF 2NLJB 4XBGA 4P2QB 4I0PD 4HZAA 5EG6C 3C9NA 1T1YB 2FWOB 3JTSB 4HUUA 1IILE 3MA9L 4KRMB 5I74C 4Y1AA 5DHXB 3DX6A 3VGHA 3W0WE 3NTCH 4M5ZH 4JZJC 5CD3B 5IF0A 1LE9B 4GRWH 4KVNH 5GRXG 3FKUS 3MV7B 4MQXD 4JFHD 1WC7A 3G5YA 3ABZA 3K46A 4MAUL 1OT2A 4OB5L 2V5SA 5ADOL 3T0EE 1ND0A 3BVNA 2OLDA 3WXWH 2VN4A 5GGVH 4G5ZL 3RZCA 3FT3B 2HVJB 3V4VL 3MFFA 3OAZK 2NX5B 3MV11 1IEHA 2GEEA 2DQCL 3HFML 5EU7C 4ZAKB 4J3OC 1WFNA 2NY5H 2N7AA 1QLFA 1T0MB 2GY5A 2PN5A 3S34L 4F7PB 1UFUA 4WV1A 5DDHB 2ATKB 3EOAB 5TFSL 3BD3A 1NCCL 5FYJD 4LGSB 3ZKNC 4BJLA 4JN2B 2H1PH 4I5BA 1F11B 2XG4A 3JWNC 4UT6H 4G6MH 5I71B 2WLZA 1DCLA 1YJDL 1F90H 3WFEH 1DFBH 4JDZA 2GUOB 2IG2L 1RK1B 3VD5A 3JVGA 4F7EA 3RNQA 2YPVH 1JP5A 4R97B 3RWEA 5DVLA 1AD9B 2VLLB 1MLCA 5I9QB 4PGDB 1CGWA 4GW5B 2QTEA 2GCYA 1F4XH 2HLFD 2BSSA 4YHZL 1OP9A 2K3TA 1I1AA 3DMMA 4E42B 3M07A 4O4YH 5C07B 1EBPA 3WN5B 1EAPB 2A9MH 2VDOL 2ICWI 1U8OB 2F53B 2Y9RT 1JGVL 4OZHE 4Y19D 1RIHH 2M8XA 3ESVF 4ZO7A 5DRWB 1NKOA 3U2SB 2DQGH 4PJDF 5DK2A 3PWVB 4N8CH 4ZG1A 1KCSL 4HZLB 2NY2D 3FFCD 2D31A 3LN9A 1HH9B 1GRWA 4OZFH 5I17B 5JMOC 2C26A 4OCSL 3DNKA 3UTSB 3SCMC 4I3GA 2NXZB 5H94B 3T0DA 3O3AB 4Y7MA 3NAAL 2NX5A 1TVBB 1FZKB 3IFNH 4BSWB 5E2VL 2CLZA 3T3MF 3FQRB 2BY1A 5HDBF 3KXFD 5HGHA 5FDYA 1EHNA 4R8WL 1G84A 5JOEA 3IFOA 3KPSE 2D0GA 4JFFA 3E2HA 3MRKB 2IAMB 2C3GA 1YEGH 4LDLB 8CGTA 5IEKB 4XZUB 4NQVA 3VFUA 1RJLB 3VDCA 2B39A 3NPZB 4DW2H 4A6YH 1S5HA 4MXWL 2WBJD 1SY6L 4IIQB 3L7FA 5DQ9A 2Z31C 1JPTH 3GMPB 4NN5C 4RAUB 4F8QA 4IBLT 2BVTA 3QHZH 4Y19B 4OAWA 1MWAL 1FYTB 1U9KA 1KFAL 3F7VA 1UH2A 2ATPB 3EW3B 4P3CH 4PJBF 1MFNA 1L0QA 2P24A 5GRUH 4OLVL 1SM3H 4YDIL 2WINA 1R3HB 5TF1L 3F6LA 4FTVA 2CO7B 3KJ6L 3ECBA 2WIMA 2R2HA 2X4RA 1UWXH 4YH6A 4PV9B 5C71A 4WW2F 5J13B 1U8PB 2EDNA 4JGJA 12E8L 5ICXA 3FQWA 1MRFL 3VFWB 3MRLB 1EBAA 2L0DA 3P11H 3PGCA 3WO4C 3UYOD 4G59A 3Q3GA 1S9YA 1BOGA 4TPRH 2AJUH 3BP7B 1ES0B 1JTPA 4RDQF 5MENA 4QRRD 1NCWH 2X89A 4WVRA 5HHOA 1IQWH 4DW2L 4HWBL 1KF9B 4PPTA 5D9SB 1I1YA 5FYKH 4R3SB 3T2NL 2PUQT 4Y2DB 3O11A 4KJPC 4NKIL 4DVRH 4BH8B 4FXKB 5F9WB 2QHRH 5B8CC 2D03L 4YXHL 4R8WH 2EECA 5I71C 2V7NA 4XMLH 3CH1A 3S36X 1S9XA 1TQBB 3V4PL 1XF1A 3Q48A 4RQQB 4WUUB 1PKQB 4ZNEE 3TBVB 3CUPA 3QDMA 3QB7C 3IAPA 4N0CC 4QRPA 4HX1B 3TT3L 1OQOA 1RZIA 4TRPH 4C4KT 3DX9A 3MRPB 3HPLB 3QDGA 3NCMA 1KJ2H 2JB6B 3I3DA 3MXVL 4I77H 5F71A 2BSRB 3BYYA 2AERT 2L4OA 1OL0A 4XCEA 5F9JA 5I1EL 4HCRL 4JLRA 1JGVH 5HHVH 4KV5E 3JBG7 3PWPD 4DTGH 2XN9B 1S7VB 5GZOD 2GSGB 3CFJA 4GJTB 1HXYB 1XGRA 1U92A 4ZYKA 4PB9H 3QEUB 4NRYB 5AUMA 4EZMA 2IPUG 5C8JA 1HYSD 1NQBA 3RJQB 1QBMH 3C5SB 1MFDL 1T03L 1KCLA 1MAJA 2ZOLB 4M1CC 2YZ1A 4J3WA 4MA8L 4OCNC 4APQB 2Q1EA 2EO1A 3S97C 4NRZB 5HYJE 4X7TB 1B0WA 1GC1L 3LQAC 1FLRL 3EYQC 5E2WH 4ZOEA 4NQSA 1JF1B 3HZMA 5JW3H 2HKHL 4H8WH 1OGAB 5EULV 1GVIA 2APVA 2OTUB 1BBJB 1EO5A 4HIXH 3HCVA 3G9AB 5IBUB 1DFBL 2C3VA 5TE7H 3DV6A 4OGXL 4GRWB 1YEGL 3H9SE 1K5NB 2R56L 3B43A 3BWAA 5L2KA 1RZKL 3OB0H 1YEFH 1KXTB 4E41B 3HB3C 2E7BA 1J1OL 3MODH 4G6FD 4ZSOB 4R4ND 1LO0H 4KXZH 3MJ9H 2DF3A 4PGEB 2VZVA 3GMPA 1UYWL 1GZQB 1UXWB 3TF7C 1YPZB 4QRSB 4KRPB 2VDQL 3QXUA 4PLKC 5D1XC 1DQMH 1LP9A 1LK2A 5E9DE 3JXAA 4G8IB 3ZL4L 2X2YA 1A02N 3ROOA 1U2CA 4POZD 4U3HA 1MCIA 3NFSH 4QY8B 1C8PA 1G7HA 3OQ3B 5LBSH 2E27L 5CZKA 3PL6C 4HX1A 5HHQB 1A5FH 4WW2B 2OS7A 2QHRL 1H9VA 1A3LH 5D93C 3QNXB 1BZ9A 1UCBL 4OJFH 2CKBB 1JIBA 3IAGC 5C08A 1HH6A 4M5ZL 3KLAA 2WWMD 5SWQB 3BP7A 5DJXB 1DUZA 3MLSH 2FL5A 3UDWC 2OM5A 3E3QC 4ODUB 2J6EA 4FQXA 5F96L 3TN0C 4K2UH 1F2XK 4Z78B 1HNFA 4U7KA 4JB9H 3SGKC 1G7MA 5EOQH 2CDEA 2Z8SA 3QCTL 3CFBA 2H2PD 3X13A 3IJYA 4DCQB 2XZCH 3UTPE 4M7JH 3U79A 2DM3A 1JNJA 3JUZA 3Q1SH 3GI9L 2JELL 5EBLA 5HVFB 4UMGA 3OJVC 3C87A 3GSWA 3RWGB 5TF1H 5HYEA 1AHWC 3T2PA 1I3GH 4ZFGL 2Y36H 1UEYA 5FHAL 4NM8H 3MRPA 4E41E 2ORBH 2FEEI 1IGCL 3O6FC 5L2KB 5JW4N 1B0RA 1N4XL 1L7TH 5KVDL 1SBSL 1CS6A 1CGXA 4PJ5A 1DBJH 1JK8A 1UWXK 3SDXB 4L8SA 1BFSA 3TPUE 5EZOH 1TZGL 3JWOC 3BXNA 4JPWL 2CRMA 1CLYL 5DD1L 5IVNA 3O2DA 4ELKA 2GQHA 1HQ4B 5E56A 1V5JA 5F88A 4MMXC 2VQ1A 3QUYA 1CD1B 3RNQB 4KZEH 1NEZB 1NUGA 1W8OA 2CDGB 2NX5E 3NN8B 5BS0A 5I1HH 2YPLE 4PJFA 3ZYZA 1KBGL 5IQ7H 1IL1A 2GITB 1PG7L 3H7LA 3OG4B 1F3DH 3T0EB 1V3KA 3MV9B 4I2XA 4H26A 1KIRB 3MA9H 2NY1D 5GSRA 1G7IA 4Y5XA 2YHGA 1GGTA 2X70B 2BK8A 4GBXA 5F1KC 2AEQH 5T33H 3FAXA 3OKEA 3BDBA 3T04D 1EV2E 5B8CA 5FA4A 3LRSA 1AXIB 3CMOH 1IZKA 4TVSa 3H9YA 3PWJB 3CFDB 1NDMB 3B2VH 1ZT4A 4TN9A 4NQEB 2GFBA 4KQ3L 4Y8DC 2ICEB 2JE8A 2Q7YB 3MLUH 3VFTB 3MUHL 1MPAL 2P8MB 1ED3A 3L95A 1NFDB 1YEKL 4OKVB 3HPJA 5JUEL 5T1MA 3NVQA 5KW9L 4LCUB 5J1TC 4LPTA 2A1WH 5D7LD 3O4LA 3SDAA 3SDXE 2Q7NA 3QIUA 1WEJL 1S9VA 3WUWG 1OAYH 2IAMC 2YZ8A 4LAJH 2H41A 4K9EC 4TNVK 2JCCE 4ZFOB 3CU7A 3MMEB 3VXOB 1WWCA 2BOBB 5F89B 4D9QD 1DBAL 5HHXL 4NWTH 1F5WA 1NJ9A 2NTFA 43C9B 1LO4H 1HQRB 2CKNA 1ZHLB 2I5YH 2QJDA 1RVFL 2CH8A 2GUOA 5CCKH 3MJ9L 4FQHB 2PYEB 3VXRA 1CT8B 1FO0A 5DLML 2GYSA 1UC6A 3BUTA 2YXFA 2LE9A 2VYRE 5JHDD 3QEQA 4QHLA 1WAAF 4RMQA 4R2GC 1ORSA 3TJHC 5KAQG 5H35B 4LPCA 5CD5C 1G7LB 3QCVL 3GSWB 3RWGA 3B6SB 2CXKA 5EU4A 1ZE3C 4JFQB 5D6DC 3I3BA 4MDIB 3L3HB 3MRRB 4TUJA 2EC8A 2A1WL 3KPRB 5DQJB 3ILPA 1IGCH 2Q8BL 1U58A 2W0PA 4QXUL 4YHOH 4UUJA 3ZO0A 3HZKB 1KEMH 2JJSC 2VDNH 5GS1A 1YECH 4OJFL 3FHAA 1MHCB 4JREB 3F65A 3ARFC 2RAMA 5KS9B 3RBSA 1P84J 1KENL 5E9DB 2OCFD 1KB5H 3MJ8A 4NZRH 2E27H 4PRNB 5DUBB 5LBSL 2WP3T 2CGRL 4PLJD 4ONFL 2IQ9L 4U2YA 3LEVH 3PHQB 4KI5E 1UA6L 3V6BR 5EIIB 3WIIL 4HH9A 1MAMH 1DBKL 3MRKA 1LO3H 3VD9A 1CXKA 5HYJD 2DQUH 5IKCB 1Q9WA 3CXDH 2WSKA 4N5EC 1XFPA 3KGRA 2AJZB 4NQVB 5EU6B 2APBA 2RJMA 1CDHA 3MA7A 2J8UA 3I84A 3W82A 2A9NL 5I1HL 4MD4B 1D5XA 1VFAA 1E4WL 4ZS7L 5HGDA 1SYVB 3LY6A 3O8XD 5B38B 2C7UA 5F21B 3MLVH 4JR9L 4ZDHB 1Q0YH 5L7XH 3SQOH 3I02B 2R8SH 3KPRD 2BY3A 4XNQA 4WHCA 3EBAA 4MWFA 4FFWD 4XWGH 4PJCE 1ITCA 2P45B 1CCZA 5SWSD 1A7NH 4CVZB 1R6VA 4EI5D 1QSVA 2AJSH 4LPWA 1QBML 1T03H 2OMNA 3QDAA 3SCMB 2AK4B 1U36A 1P7QB 2CXGA 3VJ6B 1AR2A 3TCLA 3C9NB 3JTSA 1MCEA 4DTGL 2X7LA 1L7IH 3HE6D 4LKCB 1A14L 2B2XH 4KROC 1KPRB 1QEWB 4NJAH 2NY2C 4WEBH 2LTQB 5DJDB 5ALBL 1A4JA 3ZMRA 1BEYL 4NKQB 5LAXA 3RWJA 2C9AA 3D69A 5I76B 4XCCL 1G1CA 2BFVL 1M7IB 5IB5A 3BP5A 3R06B 4NCC1 1BZ7B 2NQCA 1OF2B 1P7KB 1HOCB 5T1DH 1NGQH 1YY9C 4P49A 2A6KB 4LSSL 3R1GH 3DURA 4G43A 1MCCA 1NAMH 1B4JH 4TSAL 3TEUA 4QOKD 4AEHH 4WTZA 4CGTA 1HCFX 5SWSB 3MRNB 4GRLB 5D7JA 3V0VA 3HCVB 3FRUA 2QSVA 5FYKD 3OKNB 5ETUB 3DX9B 3V5DA 4XBGB 4OGYH 4CU6A 3ARXA 4P2RD 3BWAB 4IS6B 3ARSA 3WDIA 3MRFA 5I1LB 2E3VA 4QF1B 4PJ8A 2E9JA 4PJIB 4HJJH 4JDZB 4L4VD 3IDNA 1B9ZA 5I30L 3DUUB 1E28B 1BLNA 1V3JA 1ZA3A 4XNQB 5CSBA 3C6LA 2FX8H 3ULVL 4UOW1 5D2LF 4UTAH 1VFBB 3WNNA 1ZVSB 1KCSH 3QDGD 4KJWC 3CXHJ 4NNXB 1J0IA 1KPUB 3SDCA 2UWEF 1CFVH 3E2HC 2YA0A 3GMQA 1UCTA 2QADD 2QR0B 5HTSA 3CDGA 4MCYB 3S5LB 4NGHL 2ADFH 1GGBH 3RL2A 5INDA 4XP9H 1CFNA 1U8JA 3KXFE 3PP4L 5E4EB 1KTLB 3X3FL 3PIQB 1FV1B 1UGNA 1HHHA 1U91A 4PJBA 4WV1B 5DDHA 5A2IH 1QRNE 4G6KH 4TNVF 3GSQA 3OX8B 3N0PB 3UX9B 3THML 4P9MH 1NLDL 4FFYH 1T83A 1AY1L 5FB8B 4FQXB 2BVEA 4GAJH 1CXEA 1Z5LB 1DQLH 3HC0B 3X3FH 2D7OA 1JWSB 4QO1A 5GGRA 3K7UA 3ULVF 5IB5B 2CDEB 2CIIA 1UM6H 2FO4B 2UZIL 3S9DB 4K7FA 2VERN 3HNVH 1KTKE 1OAZL 3MGAA 2ARJA 3FQRA 1AO7A 1JE6A 1OAKL 3OZ9L 4S10A 1J88A 1JF6A 1F02I 3M17A 4OZGF 1AE6H 1W0VB 4JFXB 4EVNB 3KPOA 2HN7B 3BPNB 4N0FB 5EU3A 4WI7A 1UJ3C 4PJAF 4JZNA 4NUJA 5D71H 4LGPB 5C09A 1EK3A 4HAFA 3UZQA 2X1WL 4WIQA 3VJ6A 1JPST 1BD2E 5H37G 4MA7L 2FHCA 5IB1A 2EE2A 4XGZA 3RQ3A 4ALAH 4OQ1A 5DMJB 3FOMB 3O41A 5IEHA 3ARGD 4TULH 1KTRL 1GGUA 4YEEA 1LO2H 3JV4B 3WHXB 5C7XL 3VU2A 3LDBC 3ZDYE 4M1CD 3RIFK 2AJYL 4O4YL 2R1XB 3MLTA 4Y4FA 5HDQH 3U9UA 5JXED 4P23B 4OD2B 1IQWL 5IVOA 2X1PA 2DLHA 4FTVB 1IAOB 1CDIA 3QUMB 1A4KA 3FO0L 4OZHF 5IVXA 4PTUA 4FABH 4PIRF 4NQDD 3OKMA 3U6RA 4QRQA 5FDWA 1IQDB 2VDKL 4AJ0A 2JIXD 4QCIB 5C0RL 4MZ2A 5HHMB 2DIAA 2UZXB 3UJJH 12E8H 2OL3L 3OXRA 4MD0A 4DVBB 1OPGL 4F15C 4J2XA 3VRIA 1Y6NR 4WFGD 5FUOH 4DJMA 4GW4B 2PR4L 1ZXQA 4NQED 3ZE1F 3DVNB 3P9LA 4RAVA 3IDXL 1XF4A 1YN6A 2I07B 3MJ6A 43CAA 4E41D 2VABA 1YEHL 5TQ0H 5IW6B 1A6TB 5JW5A 4OI9A 4XAKD 1U3JA 4XXCC 3AB0B 5JORA 5JW4Q 2R23A 1CL7L 1KPVB 2Q87A 3TO4D 5IVZA 1ZKAA 5T1KA 1WFTA 1PKOA 2IFFL 4ZO6A 3IFPB 1AO7B 5T1MB 3HZYA 1KLGA 3WLBB 2XKNB 4H0IA 2IPUK 2XG5A 2J8UF 5KSBE 2CO6B 4X7EC 1T3FA 2GTWA 4RFEA 3T08A 1MHEB 1EH9A 1R3LA 2RFXB 4OB5H 4JY6B 4UU9A 2A0LD 3O2VH 3MLYL 4MNGA 2IALA 4ZS7H 3CX2A 2E7CA 5D7LB 4P2QE 5HHME 1OAQH 1UQSB 2EXYD 4UT6L 5B8CB 4J3XA 3TN0D 1NCCH 3L5JA 4YFEA 3IXAB 4V1DE 5EZLB 1YEIH 3C08H 1FFPA 1VCAA 2ZNXA 3BZ4A 3C60C 4NPYB 5TJWK 4YDLB 2FJHA 1PD6A 5EC1B 1PW3A 4X6DF 4Q9QH 3T77A 3VFTA 4L3AA 4JKKA 5LQBL 1BQUA 4QT5A 3U0TA 2VZ1A 3ARVA 5I66A 2ENYA 4Z0BL 1J7VR 1KCGC 2AVGA 4Y8AA 5LVEA 3VFOB 1B6DA 2BERA 2NW2B 2R2BB 1BX2A 3NOIA 3PHQA 4L1DA 4C54A 4P5KB 5HHMA 4AL8H 2BSED 1MCHA 3SQBA 2V17H 3LN5A 3U36B 4H5SB 4XNZC 5IK3A 1J8HE 4KK8C 5EUKA 4M5YL 5HJ3B 2MHAB 2Y25A 3HG1D 4MB3A 4OZGA 4JRXB 5IHLB 1VKXB 1CE6B 4WFFD 1IJ9A 2BVUA 4JRWA 2VABB 4Z95L 4TSCH 3TBYB 1E4KC 4XCEB 5MP6H 1U8HA 1U3HB 2GTZA 2ICWB 5GGTA 3AB0C 3DWTA 1RUAH 1EVTC 3U9UB 4S1QH 4MXQC 4XVJL 3V5HB 3QDMD 4JVPA 1ONQA 2VTFA 1UJ3B 3L5XH 4PTUB 4FFZH 4M9PA 2ZUQC 1OM3H 1FFOA 1Y0LB 4JKPL 3B8SA 1G7JA 4OCWL 4XVUD 4EEEA 1XGYL 4FQIH 4FTVD 4HKZB 5BZDA 3IJSA 3E3QA 2GJ6B 1ACZA 2EEAA 3LDBB 3TP4A 1FGVL 3B3IB 4BSVA 4KRPC 4NM4L 4U6TA 5DMIH 3HI6H 3HLAA 1T0NB 4ETQA 3SJVE 2UVFA 2DQCH 3HFMH 5H2BA 4IDJL 4ODUA 1XF4B 1YN6B 4RGMC 3O4OC 2JB5L 3GUTA 3HE6B 2QSQA 3BKML 1T80A 2Z35B 4YPGA 2YPKB 4X83A 1GZQA 1UXWA 5HI3C 1E4JA 1FE8H 4ODXB 1QNZH 4MQXC 1MFBH 5I15H 3RBGA 3TIEB 3V6OC 1OGAD 3GIVB 1FNHA 1LP9B 2BZDA 4J1UB 1HE7A 4X6FB 1SJHA 2V7HB 3FJTA 4KHTH 3DTXA 5SX5K 3HNSL 2Z0BA 1DDHA 4WUUD 2DQFA 4JPKL 3FFDB 4RWHA 4LVNB 3LPWA 1DSFL 5F97E 5AYUL 1MIEL 4FZEH 4GMSL 4P59H 4HIJA 1KB9J 2VIRB 5I2IB 4XCYB 3L5HA 1N64L 5DK2B 2IALB 4U3CA 3QPQD 3H3BC 3GHBH 4LU5L 3FAWA 5E2UL 3O3EB 1CF8L 3O6LL 2YUXA 5DJXA 3LKRA 3VXSA 3GRWL 3HC3L 4JFDE 3VXUD 3L7FB 5DQ9B 4CJ1A 1S9KC 3W9DB 1OVZA 5JA9A 2E6PA 3IDNB 3QT2A 4WFED 5DJAA 3VGDA 1CD1A 5KAQF 4QT5B 3RVWC 5CGTA 1VFBA 2C4XA 2F53D 4M8QB 3WFDH 1RZ7L 3QZWA 4MAYA 4O02L 3QHTC 2B1HH 5K9OB 2H3NA 3X11B 3IJSB 4NN5B 3TNNB 2NY2B 2VXTL 2ZUWA 2EH8L 3J7HA 5ALCL 1NGZB 4JFEB 5E2TH 1OCWH 1U8PA 4R4BB 3CSBA 3TGXA 5EC2B 4OZIE 5J3HD 4WDIA 5ID1A 1C08B 4AG4L 4GAYB 1HHHB 3WEXB 4JPVL 4QRTB 1FNGA 4PGBA 3SJVA 2BNUA 1LEIA 3TYGL 3VW3L 4QRPE 1YDPB 1CQYA 1R0AL 3BSZH 2R1YA 3BJ91 4IRJB 3G04B 4X99A 4JDVA 1MY7A 5IBLC 1HDMB 5MERB 3UBXG 1IBGH 2EYSB 4LPUA 3RA7L 1KV3A 4LQ1A 1M7IA 1R5IB 4PLJC 5HBBA 1XGRB 3BFOA 5B38G 1KPUA 3V0WH 1ZT7A 3VXNA 2XA3A 1YYLL 4OKVA 2EIZB 2CLRA 2Q3AA 1IFHH 1NFIB 5I19H 1BFVL 2RQ8A 3OMZA 2ZCHH 3S5LA 2OK0L 3ZLQC 5EOQL 5FUZH 4D3CL 4OGZA 1QLRB 5HGGS 5GHWH 4IOIA 3U4BH 2FR4A 2Q8AL 1JUFB 1TZHB 4RISL 4PBWD 5C0AA 3QQ4A 1CI5A 5MENB 5DA4A 1JWMA 4LCCA 4XWOC 1AGDB 4Z76A 1NGYA 4R2GB 3HZVA 5LXGH 1K2DA 1JFQH 1HI6A 4UOW0 2XXCB 1QA9A 2APFA 4LLVA 4ZPVA 5CJ5A 3BWUC 4NQXB 2WIIA 2X4QA 2PW1B 1IGFH 4AK1A 4NQEA 1YEIL 3HRZB 3FOLA 4U1MB 3U83A 1NC4B 3BZFB 5FECB 4HV8A 2Z31D 5F7UA 4F37K 1CFBA 3RVXD 3QIWD 5HI4C 3PGDB 4HK3N 4XPGH 4JY5L 1A7RL 2GIYA 1YNKL 3CUPB 1HHIB 1P6FA 5FO7A 5ILTL 3HAEG 4XB8A 4XAWH 2H3NB 2M1KA 1NCAL 4GG8B 5C1MB 1CFNB 4KROD 1AI1H 5E94A 7FABH 4LIQE 1UWEH 5FCUH 1A6AA 4Y2DD 1KGCD 3BIBX 4Y1AB 3DYMA 1DQJB 4OIIL 5KVMC 4UT9L 4LLQB 3NCJH 4UB0H 2QKIB 4J4PA 2C1OB 3QPXH 2X9XA 5DUML 5I1IL 1WC7B 3G5YB 4HGMA 1JF5A 4FQ1H 3HC0A 1Q9KA 3F7QA 1OAUH 4KMLB 4ZAKC 1NMAH 4L5FL 3DI2B 1GC1H 3DSNA 3R4DA 5FUOL 8FABA 2DLGA 1RUQL 5IVXB 4H8WC 3L5IA 3KYMA 5LWYL 4HH9B 1DQDL 1H3UA 1NC4D 3NIFE 5D7SL 3ROOB 1JTOA 4X6DA 3MV7D 4O2EB 3B6SA 4L4TE 1FG2A 1JWUB 4RGOL 1PQZB 3BO8A 4L9LB 3ZSTA 4X6CA 3SKNA 4UNVA 2DM4A 3PJSB 1AGDA 2J88H 3FOMA 3O41B 3RUGF 2G60L 1QLEH 3UYRH 3VG9B 2ZG1A 1XR9B 4JDTL 3A0OA 5GS1B 4Y16D 4NQXA 1HHGA 5CLWA 4KJWD 4JVUA 1MVUA 5BOZG 3DROA 4LGRB 5HVHB 3BRFA 3VFRB 3EO1B 4U4BA 2CLRB 3DGCR 4IRJC 1ZHBB 2EO9A 1XIWB 1P4IH 1GPOH 3OSKA 4YK4B 5F9OL 1M6OA 3DUHA 1GJIA 1I7RA 2DBLL 3O6KH 4I48B 2EH7H 4LCIH 4KKLD 5ERWA 4IOSD 3ARTA 2IH1B 3VMOA 3KLAB 2ZCLH 3LIZH 4M7LH 5DTFB 5EORL 4XNUH 3G5VB 1IC5H 4JRXD 1V3MA 3QJFA 4LLAA 3KPLA 2X44D 4U6XB 2JJTC 3RU8L 1AR1D 3QXVA 2HKFH 2PKDA 3QR2A 4RDQG 3ROLA 4CVXA 5E1HB 3D5OF 1D5IL 5GGTL 1PX3A 3MV8D 4HS6A 2RB8A 1F4HA 3UTSA 2GFBB 2ICCA 2ZUYA 2E7LC 3HRZA 3ZKMD 1NGXB 3IDIA 3TO4B 1ED3B 3SEPA 3EOBA 1C1EH 4FQJH 5IVXF 5I1GL 5CJXA 1AFVH 2ZOKA 5I1DA 3UO1H 5IHZB 3DBXB 4XC1L 2HJKB 4RA3A 5DR5L 4ZUVB 1S3KL 1KB9K 3LHPH 4W70A 4JPIB 4Y4KB 2GTWB 4RFEB 3D18B 1EX0A 3MOQA 4FQLH 2GW5A 4Z77A 2XTJE 5FCUL 1S5HB 4MNGB 1ZAGA 1CGVA 4O2CA 2X7LB 5E95B 3PWLA 4PJ5B 3SDXA 2P48B 1XH3A 5EZIL 5E08L 4OCYH 4HKBB 4OLYH 1NJ9B 5F1IB 5D1XB 1AXSB 1U6AL 4NPYA 3C6SB 2VXUH 1T89C 3MJGX 1MHPH 2HFTA 3GSXA 3KXFA 2UWEA 2ZJSH 2VQ1B 2J88L 4HS8L 1M71A 1FFRA 2PXYD 2OX5A 3EO1A 4U1GC 3BKJH 3UPRB 2JJWA 4X7SL 2H2PC 2X09A 4NZJA 3F7PC 1FNSL 3DHMA 3U7YL 2D2OA 2O93L 1UXSA 4OBRA 4ZPTA 1G6RH 2ESVE 1BJ8A 3QDMB 5KOVC 3T0EC 4PJBB 1B0GB 5I73C 1HYRC 4M4PA 3O45A 3S3PA 1UKTA 3QJFB 4OM1L 4TTGA 4AQ1B 2W9LA 5FUCC 3PJSA 2MHAA 3IDJA 1CIDA 1KJ2B 4X80L 3V95A 3FO2B 1FAKT 3W0WA 3O9WC 3TO4C 2G60H 2J1KA 1SMAA 1T7YA 4OAWB 4Z7QF 4XC1H 5ALBH 4U1NB 1ND0B 3BVNB 3VGEA 2XFXB 4U05A 5CGYC 4JQXC 3GSNA 4LSUL 3W9DA 4NFBA 1FNAA 1VGKB 4ERSH 1TJIL 4G42A 2Z93A 5JHDA 3KHQA 5FXCH 1MJ7L 1PLGH 2VWEE 3JZ7A 1U2HA 4NQCE 2IG2H 1AGBB 4P5TA 5DK0B 5JHLH 5LGJA 2MPAL 3FT4B 4LL9A 5ICZA 1ZA6A 4MD4A 2ADJA 4XAKE 2P7TB 2IBGA 4HWUA 3QRGL 1J1PL 3WHXA 2X4NA 4G6AD 2FLBT 4GG6F 2XQBH 4UB0L 1G9NC 3OKLA 4EDWL 1J12A 5F9OH 5HGAB 4L4TD 4S1DD 1N6QL 5DHYA 3BGFC 1B90A 3QDHA 4CADA 4P23A 3MRGB 5D7IE 4YR6B 4Y5YA 3IKCB 3BAEL 4RMUA 2A6DA 1W0WB 3LH2L 2XN9E 4AH2B 3MUGA 3FQUB 4KJYB 5BO1H 5GGVL 4I13B 3WYRA 5K9OA 4X5XA 4HGKC 3VH8B 3LVEA 4PJCF 4LEOA 3LMJH 5EZJA 1G6RB 1KJ3L 2WQRA 3DVGB 1B0GA 5C70A 2DQEH 2FX9L 4YZFE 4KTEL 5CBEA 3WIHL 4JHBA 3FRPG 4JQIH 4EUPG 5IFAL 4Y4KD 5IOPB 4OFDA 3L3IB 1INDH 1WZ1H 4JGUA 5DXWA 5DJ2B 5T1LA 5DJDA 4NP4L 1KENH 1DEDA 1NGWA 4P2OD 2YBRB 4Z8FH 2LAAA 3IB4A 3FFCA 4HUVB 2N4IA 3BE1H 5DUPL 4K94L 2VXSL 4MQ7B 5MI0C 4PJXB 3GSXB 2D7PA 2E7LA 3GIZL 1FE8L 4L29B 5DJCA 5J6HB 1TVBA 2X4UA 4QRUA 1AD9A 4PP8C 3QUXB 3DURB 4G9FE 2NY3B 4N0YH 5T5NF 3QZWB 3FO9A 2WZPD 5C9KA 5CZVL 2GHWB 2IMMA 4LHUD 2ZCHL 5ICYB 3K81A 1IQDA 1XIWC 5JPMA 5CP3A 2J8OA 4U1HA 2CJUH 4TTDD 3SE8H 1YNLL 2OZ4A 1MREL 3WEXA 4PJ9A 3G6DH 2F53A 1EO8L 4IIQA 3VG0H 5ADPL 5TPWL 4ZUUB 3T0XA 4OM0L 4JDVB 4OZFA 5C0CE 2EDDA 4ONGL 4YAQA 4AQOA 1FVEA 4JZOA 4UILL 2OR8A 3EYOA 1WCQA 3NPSB 3RY6C 4NO5B 5BVJA 2QADB 1VSCA 1T7ZA 4HF5L 3IF1A 3RUGA 5L6YH 3FRPA 3VG0L 5ADPH 3VXQB 4R0LA 3DRQB 3L1OH 3BZEA 1QLRA 1IC4L 2MSPA 1CBVH 1H0DB 5DWUL 3K1KC 3QH3A 3QG7L 1OGTA 3S98A 2RCSL 4KAQL 1K3ZA 2OYPA 3CIQA 5E1AB 1WIOA 4OZ4B 1V05A 2FJGA 3RY4A 3WFHB 3GBNH 5CZVH 2MWCA 4P2RA 1KJVA 4O5LL 5KSAA 1QSZA 1EZVX 5E8PB 5F9WC 4E9LA 1IGMH 4W81A 4P4KB 1U8QB 2AEPL 5GXBB 4HJGB 3ARGA 4YO0B 4PV8B 1TFHA 4LF3B 5DD0H 1CG9B 3U7YH 4FZ8H 2R4SH 3MV8A 1E27A 5CP7A 5MEPA 1MRCL 5LCVH 5TF0A 1DP0A 4XBEH 5FM5M 1EEZA 4N8VA 3BSZL 4YHNA 4LEOB 5C07D 2R69H 4LHJB 5J12C 1K85A 2H6PA 2F58H 3K1DA 4FQPA 4HUUB 5D5ME 4ONGH 4DEPB 5D7IF 3JWDL 4QNPF 2R0KH 1X7QA 5C6WH 3F62A 4WCYL 5AYQA 4DGIH 1JZ7A 1N5AA 1X5IA 1T2JA 5F1NB 3ZTNL 4DKEH 1YEEL 1Z0NA 2V2TA 1AP2A 1F00I 3CSYA 4BZ1H 4HEPG 4KROB 1KIQB 3RWCB 5FM5O 4WEUD 2H8PB 4Z9KB 1S3KH 5HVGB 1BZQK 2J3SA 3QNYB 2BVQA 2G2RB 3UO1L 5BOPA 2D7NA 4PJAA 1CZ8H 3N1FC 3WJJC 4ONHB 2IAND 2NZ9C 2V5MA 4YUEH 4P57A 1WBXA 1F3RB 1T7XA 2KQNA 4BM7A 1ZGLM 4M7JL 2X70A 5D7KD 3QUXC 1OW0A 2OL3H 2VMFA 1N64H 1XCQB 3FTGA 2AJXL 2FEEL 1CLZH 2HVKA 5I1CH 4XP1L 3KYOB 4R6UA 3MO1A 1J8HA 4XGZB 3QUML 3Q6GL 1FL6A 1PEWA 3STZB 1F2QA 2EIBA 4X8JA 5HYJB 1EERB 2VAJA 5F9JB 4K7FB 4I3SL 4L8BA 3RVXC 5ACMA 4NNYB 2VJXA 5CJBA 2EH7L 4OV5A 1UH4A 4NO5A 1CIUA 1U92B 1X4ZA 4ZYKB 5DZLA 5JXEA 3CCHA 3MV7E 2VDML 3HUJA 2O5YL 4NQEE 1I1CA 4MJ6B 3RAJL 5TE6H 1ZANH 4K55A 5C2BH 3RKDD 1T21A 5HI5D 3I6GA 2NLJA 1NGZA 4JFEA 3WE6A 3H2WA 2QADC 5D5MA 1O7SA 4BK4A 1S7QB 2BY0A 5E1AA 4NQDE 5JOFB 4PGBB 1CVSC 5DFTA 2EZ0D 3CAFA 5IF0B 5CD3A 2XQBL 4XBPA 1T1ZB 3OG6B 2UYLA 1WJ3A 5C08E 1J1PH 1PKQE 1QYGL 1CGSL 3CXHK 4CU8A 2DIBA 4GXVL 1NSNH 4P4KC 3UTQB 3HNVL 5IB2A 1ZGLB 1FVDA 5D2LB 4HWZA 4I0PB 4U3XA 3EOBB 2JK5A 3ARED 2ZUUA 1W2KT 5AWNH 3L9RB 5LWYH 3EYUL 1QLFB 1T0MA 3FZUD 4EI6B 2NY3C 3HA0A 3GMNB 1RUQH 2Z93B 3KYAA 1MJ7H 1PLGL 2NXYC 5BXFB 2HKHH 2NW2A 3S88H 3NIFF 2X4PB 4F9LC 1N6VA 3I6LE 4M00A 4XPFL 3ULUE 2NMSA 3ARQA 3N1QC 4CW1A 5FUZL 1JYNA 1FCCA 3BH9B 3ULSA 3TF7A 3FO2A 1IT9H 1NBYB 1RIUL 2BY2A 1KPRA 4EXPX 5ICZB 2XKUA 5DFWH 4ODVH 3ZDXE 1JMZA 5I1EH 1MHCA 3QIBB 3ZTNH 4DKEL 1TQCB 3TN0B 1S7XA 4HT1L 3ARGC 2VE6B 4PR5B 3G08A 1ODAA 4U0RC 4M9OA 3PGDA 4GQPH 1KG0A 1QVOA 1G6RL 2F8OA 3S96A 2YRZA 5H94A 4CADB 3KPSA 4JPVH 1HOCA 2BX5A 4PYGA 1B6UA 4GRWF 4AH2A 4FABL 2Q6WA 2FD6L 3TLRA 4BFBD 4MS8D 4LRIC 4I9WD 9CGTA 1CGSH 3UBXI 2VUOA 3PABA 2EDYA 1GIGH 4W6YB 4LCWD 3X14A 4YX2L 5EOCL 5J89A 3PUCA 1D5XB 1ES0A 1VFAB 15C8L 4OF3A 3SGKA 5DD0L 2FGWH 4TULL 3ARPA 1XF5B 1PZ5B 3QDGE 4YDVA 1MFCH 4PJ7A 4C56A 4HUWB 4X8JB 3D25B 5C09E 2X05A 4BFGA 2B4CC 3KJ4C 4R4NC 5DVMA 3VXTB 2VL5A 3GHBL 4OI7A 4XMPL 1FC1A 4EI6A 4PLKD 4XC3L 4BZ2H 5IG7A 2DLEA 3LHPL 1SJHB 2V7HA 1JYXA 2FEDC 4KAQH 3BX7C 5ISZD 5T3ZE 5D7IB 2QR0A 5TE4H 4O2EA 2EE3A 3T65B 2VITB 4POZC 3QFJE 2F53E 5SWZB 3GKZA 1ADQH 3RVUC 3SBWA 1H8NA 2KQMA 3L7EA 4YNYB 1I7UB 5L6YL 4NN7C 2HLAB 4TQEL 2P7TA 2XZAL 2VH5H 2VLRD 3WIFA 2DB8A 3QUYC 4Z7NF 1IM3B 3SKMA 1NMAL 1OCWL 3D9AH 4MCZB 1CT8A 1FO0B 1CZ8L 2OI9A 3BP5B 1Z3GH 4MB5A 3UTQA 2Q86A 4Y5VC 3MBXL 5ANMB 2F54E 3H3KA 4Q9BA 4NKDB 5EUOB 2YSSA 4JCMA 2EEBA 1N59B 2AK1L 3JV6B 3U0PB 2DI9A 1RZFL 1R3IL 5BQ7A 2P8LA 3CXDL 3SOBL 5B21A 3GRWH 4UTAL 1T04B 3ARDB 1T2XA 2BXZA 5HHOE 4POYA 5EIVA 1A9BB 2FGZA 2I9TA 1H3VA 2LABA 4WW1B 3LEVL 4BK5A 2Q3ZA 3K4AA 5DF0A 3OKKA 4WEMB 5T5FH 1JHKL 4BH8A 3D39B 3NA9H 2E9WA 3GDBA 4PR5A 1QTYT 2A6IB 3PDOB 4PREB 1IGJB 2EIZA 4F15B 3TZVC 4NO2A 3QO0B 2JJUA 2AXGA 1JFQL 1Z6JT 4QHLB 1N5YH 1T0PB 3FFDA 5KVGL 1F4YH 5F7MC 5C0DB 5CWSA 4KRNA 1NCDL 4NZUL 4LAQH 4QXUH 4YHOL 3WUWB 2I60L 3DUSB 4RISH 4U1IA 1T89A 3SE9L 1PAMA 3X11A 5IKCA 4OF6A 5HHNB 3OGCA 3MNVA 1WCBB 1RI8A 3ULVC 4XVUC 1CFQA 3C09B 4U1GB 1I9RH 5DD3H 1HH6B 5EC2A 3UTTD 3VXSB 1CLCA 3GBNL 4KRPD 4ODHH 4EUPB 4P46A 1S7VA 1SYVA 4P3DA 2BXYA 1I9EA 4HFUL 5DVOA 1YA5A 4HPYL 4QWWC 4WFFE 1A64A 5L8KB 2OI9B 2UY7A 1IC4H 3D3VE 3C5SA 1B4RA 4MWFB 1J8HD 4PRPB 1IAIH 1IAOA 3QUMA 5T3XL 4WO4B 2AV1A 3S37H 4HJ0C 2ZUSA 5C0NC 2DQHH 1K4CA 4QRQB 1FZOA 4ODTL 5FDWB 1JZ5A 3HE7C 3CFEB 4NWTL 5A3IC 1FORH 4L8DA 3SDAC 4FQ2H 4Y4KC 4WHDA 3EOTL 2AS5M 2ZZUT 4XI5C 4FNLL 5BW7C 3DI3B 4V2BA 4TUKH 4JR9H 5KSAB 4QEGA 1H3GA 2IFGA 3SBWC 1LEGA 4Z76B 5LAXB 3RWJB 2X9WA 3RDTA 1EGJH 3MR9A 3C6SA 5IVZB 4BYHA 2WUCL 2WIIB 1M71B 3UTSE 3U0WH 4HWNA 3PNWA 2UWEE 4UIKL 3GM0A 4KK9C 3U4BL 4C83A 3QIWA 4O51B 1XIWD 4GLRI 3TA3C 4KHXH 4OSUL 4ONHA 4LARL 4TTDC 4F7CA 5A43C 1NMBL 3U1SH 1NPUA 3FRUB 2VDKH 4FZEL 3MFGB 3RWIB 3V5KA 4RIRB 3W2DL 4N0RA 3WN5A 1MJJB 1ZSDA 3LZFH 3VFSA 3FONA 2FBJH 4IS6A 2ADJB 5J7CC 3CVIH 5JOFA 1PG7H 1EAJA 4HG4K 3PWJA 4RAUA 2LV4A 1KTDA 1CE6A 2AJYH 4P9HH 3M1BA 3QEGL 4GSDH 2VXUL 2XIDA 2WWKO 4KV5F 5BV7B 3ES6B 3EDJA 4PRHA 2C1PA 4QTIL 5GGVY 3ARFD 2W0FA 3IFPA 4LVEA 2LQRA 5BVPL 2HJFA 4HXBL 1NKRA 3LH2H 1OF2A 3V52L 4N90E 4MCYA 5FYLD 1RZ7H 3O6ML 4LCUA 4C57C 3CVHB 3TM6A 3VXRE 1OP3H 2P5WE 3DIFA 4EOWL 1ZVHA 4IIQC 5EPMB 1NEZG 1YEKH 5ISZE 1MCSA 5DTFA 4CUCA 3EJYD 3MYJA 2JTDA 3NPSC 4DGYH 3C8KB 2P5WD 4ZTPH 1WBZB 5AZEH 3WDHA 3KPMA 1OAZH 5CIPH 2AQ3A 2HFFB 3ALPA 3BH9A 5DJYB 4Y1AE 2DQIH 4JJHA 4PGCA 1CL7I 5I1LA 3JWOL 1BIHA 1HQRA 4XWOD 5FYLE 5IWLA 4K8RH 1AJ7H 2CIIB 3O8XC 4ELMF 4XT1C 5FOBA 4B50A 1PYWA 4I3RL 5I75B 4J4PD 5A2KH 1DSFH 4Z95H 5IHZA 4GXUN 4JRYA 3MUGB 5IJKA 3OR7A 4J3VA 1OSZB 3T4AB 4I18C 3QYCA 5KW9H 5CZXD 5DSCA 2X4RB 4P5KA 5KBNC 1BGXL 1ZGLP 1NAKL 5L88L 1JHTA 3HPLA 4QTHB 2ADFL 1KTLA 1UCBH 1IGTB 5IK3B 1GGCL 4CN1A 4Z0XA 2BSRA 1CLYH 1INQB 3UTPD 4X6DE 4LSRH 1MVUB 4Q74A 4XXDA 4MA7H 1UKSA 3FFCB 4HUVA 3SPVB 3ZDZE 5IR1A 4XB7A 3MGTA 4JFOB 1GAFL 4G9DB 3RI5F 4GMTH 3UTSD 3MRIA 3H3PH 5D7LE 4JDTH 3RZCB 3HPJB 3D25A 2HJFB 5K59F 3KNBA 1F8TL 3VWJD 4ZAKD 1PEZA 3UTZA 4X4XA 4QRRA 2I5YL 5ERWB 5DD5H 2GAZB 3VD3A 3SGDI 3NCYS 3I6LD 4Y4KA 4YJZL 5IP4A 4HAGA 3Q0HA 4DKDC 3NABH 2Z8WC 4LRNH 3GJFK 5F1OB 2YPLB 1A0QL 3EYFA 1D5MB 3L3KA 4POUB 1UG9A 4D94A 4JHZA 1RSFA 3O8XB 1QBLH 1SEBA 3KS0J 3P4LA 3QA3A 1MNUH 3AMKA 2PO6D 5DFVC 5JW4R 5E8EB 3RPKA 2NY0C 2YS4A 3F58H 4X0KA 1RZKC 3N9GL 1X5GA 2CQVA 4WWKD 5HYSG 4Q0XH 3VWJB 5BZWB 4X6BB 3HZYB 5TDPB 4FG6C 5GS0L 4FQQB 3MRQA 4NQCA 4OD2A 1JN6A 4MAYB 3MLUL 3E6FB 3RIFF 3RNKA 4YIQA 2GT9A 5EBGA 1MCOH 1I1AB 1OTTC 3DMMB 4JE4B 5EUOA 3BDYL 1HEZB 1HHJA 1TETL 5J4MA 5L9DH 4PJXE 4F7MB 1SVCP 3MACH 5IMKA 2YC1B 2HLAA 1U58B 4Q9QL 4HIHB 2HKFL 2LU3A 3QCUL 5DRWA 3U2SA 4KKLC 3NMEA 1RIVH 4Q7DA 5SV4A 3VMPA 3BGMB 2YD7A 1MRDL 2DD8H 1KIPA 2VISB 4MZ3A 2X4NB 3ALWA 5GSVA 1P2CA 4XMLL 1AR1C 1Q1JL 5C3TA 3MJ8B 5EC1A 1Q0YL 1BAFH 2E8YA 5F7DA 1P69B 5C6PB 2LVCA 3MRGA 3QFDA 4IRSD 5I74B 1HWHB 3IU4H 1BZ7A 2BNRE 2XFXA 3C5ZD 3BZFA 1RUPH 3QNYA 2NXYD 1LP9E 3QQ9D 3L5WA 2FH6A 2NZIA 3UTZB 3QG6B 2MJWA 2XKNA 2HT3C 4H8WL 1DLFL 1KJMA 3OR6A 3B5TA 3QQ3A 3ZL4H 3V7MA 5KVDH 1N3NA 3AMLA 1DBKH 4RWYL 5CJXC 5H37H 3WS3B 4JM2D 4JN1L 2QL1A 3V8CA 1MY5A 4L8SC 4I0CC 3OWEA 5F6HJ 1HI6B 1TETH 3VFNB 2FSEB 4RCAA 5T3ZH 1J1OH 5KANG 1DQJA 4NZRL 3QWOA 1LILA 2XQYG 3D85B 3FQTA 1HDMA 2R9HC 5E8EA 4OLWL 2V2WA 1S7TB 1LQVA 2F15A 1TPXB 2ADIA 5GRUL 1J86A 4HIXL 3VXNB 1QSED 4HK0A 5J9PB 1HHIA 2X4UB 5CINL 3G5XB 3AAZA 2XOTA 4R97C 1CD9B 1MNUL 5CWSB 3TT3H 1YMME 5IJKC 2PXYC 1JTTA 4NUGH 1H3XA 4K2UL 4M48H 5E2TL 4G6KL 3WD5H 4JFPA 2EDTA 3SKUD 1FJ1A 4M1GH 1A0QH 4NYLB 1FNEA 1NBVL 1RZGB 5ESQA 1WBXB 1LDPL 5F72S 2D03H 5DUMH 3WFDL 4FFVC 3ARBB 5FA4B 3E6HB 2F9BT 4ORGB 4RRPA 1Q72L 4QHUA 1K4DA 3NZ8A 5T1LD 1IAKA 3AC0A 1MCNA 4P5TD 5T3ZD 1DVFD 1VEMA 4NO0D 1XGUB 3QWRD 2PW1A 5IQ9A 3FQXB 4NT6A 4LLYA 4HKXB 1MRDH 2DD8L 3KR3H 3BXNB 1CXHA 4MNQD 4NNPL 3PQYB 1TJHL 1YMHA 2A6KA 3SGEI 4OCSH 2IADA 1HILB 4LU5H 3TBWA 4HJJL 3WIIH 5F88B 3L5WB 3HS0B 1W72A 3MV9E 1JN6B 4AIZB 1G6RA 1R3JA 1D9KD 4LSRL 4NFDA 4PJHB 1MCPL 3QQ3B 1E6JH 1H3PH 2FB4H 1OAKH 5DQDL 3H9HB 1R5VB 4W4OA 5E94B 3HNSH 5ICXB 4CU7A 5C0EB 2YKLH 2OZ4H 4BSVB 5L0QB 3AVEA 4P3CL 2X10A 5F93C 3QUYD 1L0YA 3RJDA 1MFBL 4BQ8A 3FCTA 1EIBA 2FYYA 4ODWA 1I3RB 3THMH 1ZTXL 4GAGL 1P2CB 3CJJA 4PD4K 2BRRL 5C0CD 1CDCA 2JJSA 1IGYA 4MA8H 4APQD 1X5XA 1KCRH 1XCTA 4N9GA 5ITFA 5BJTB 3JWOH 4NN6B 3GKWL 1E0OB 2YEZB 1JGUL 1YYML 3ARUA 1EDQA 1HSBA 3GMOA 1F3DJ 3RPIA 2HT4C 1MI5E 4P2QA 3SHSA 1P4BL 4NUJB 2JF1A 3GJFB 2H32B 1EEYB 5FGBA 5T3ZL 1J0HA 3QULB 2R1WB 3MXVH 2XY2A 4I77L 5F6HI 2R0LH 4KPHH 1LO4L 1HHKA 1QFPA 3QNZB 4S1QL 4LVHC 1JPTL 3RKPA 4RWYH 4QHKJ 1D5ZB 3DO7A 3OHXA 3CFKA 1JVKA 1U8MA 4XCFL 5E8PA 1VEPA 4FA8A 5HSFA 5KS9A 3NCCB 3ARZA 3SDDC 5JTWA 5BVJB 1TTFA 1OAYL 1MVFA 4EKXA 3TZVD 2GSGA 4D0BB 2ARJB 2JCCA 1WEJH 5L7XL 1MELA 1SMOA 3V8OA 1HINH 2VLJD 5E8NB 4YDLC 1MLBB 3UMTA 4XPBL 2VKWA 4QY8A 3LKOB 3LPGA 1EUUA 4OFIA 4MXQD 5FHAH 4NOFA 3L3JA 1Y6KR 4JHWL 2E7HA 3LQAH 4Y0GA 3DSFL 5C08D 3L3DA 4XRCA 3GSVA 4HG4J 2IH3B 1EHXA 3WUZA 1ZSDB 3EFDH 1MH5A 1HCVA 4IJ3B 4LKXB 1CYGA 3MLPA 3MRCB 4EN3C 1A6WH 3U4EB 1BEYH 1JI2A 2F54B 4L8CB 2CD0A 4XH2B 3AY4C 4N8VG 5TGBB 5AYUH 1X7QB 4OZGE 2DQGL 5HGBB 3H9SB 4Z7VF 2XPGB 1QUNA 2Z31A 5F7NC 4Z7OE 3KPSD 3D0LA 4X6CF 4EQ2A 3HE7D 1UH3A 4I9WE 4N9GB 3OR7B 2ZKHH 4K71C 1KEML 2VDNL 3PWUA 4LDOB 5IGXH 5E6YA 2DWDA 5JZ7D 4QYOA 5E5UB 4XPAH 5C92A 3RPIB 1I75A 5I16A 1EZVY 4PJHA 3DARA 2DBJA 4V2CB 3H0TB 4FNLH 5A16B 4MX7B 5J0BA 5IMMA 3LV3B 4HIEA 5F9AC 2HTKC 3BQUC 2PYFB 1SBSH 2P47B 1VKXA 3MLVL 1WK0A 1OT1A 4U0RB 1T20B 1DQML 3RWHA 3VRJB 2BHUA 1FGVH 4M7ZC 1A1NB 1KELH 1U3YA 1IKNC 2R0LL 4KPHL 3UBXB 4ODTH 4LSQL 4KVNL 4PRAA 2Y5TB 5ABDE 4YGVB 2MOVA 4LLUB 3SGJC 3KXFB 4WGVB 5HYJA 2JCCB 3ZYIA 1CU4H 1R3KA 4KK9D 3LS5H 4MNGE 5E2VH 4NKMB 4NCC2 2C4FT 5EOTA 5HGAA 1EFXA 3EHBD 3PV7A 4Y16B 1JGUH 1YYMH 5CKAA 2PR4H 1XZ0A 2AXFB 2DOCA 2X4SB 1N7MH 4GFTB 1TCMA 3FQUA 4JM4L 3TBTA 1OWWA 1U8KB 4P57B 4URTB 1BX2B 1A22B 2R0WL 1Z9OA 4JFED 4K8RD 1DQTA 3SKOA 5E9DD 2Y06H 4XPHL 3WE6B 2ERJC 1MQ8A 2HVKB 2G9HB 3TJEH 2Q76B 5EZLA 3DSFH 2A9ML 2PTTA 4OLZL 3VXSE 3HUJF 4M5YH 5IOPA 1KSRA 2HFGH 4EBQH 4JG1H 3SO5A 1A1OB 4RX4D 3W0WB 4LCWA 1UB5B 4Z7NE 2Q8BH 5E8OB 1N5YL 2RIKA 1NGWB 3MOBL 4YR6A 4G80A 1CK0L 3B9VA 1CDUA 1FBIL 5D2NA 3R06A 3L95B 1Z0MA 1U8LA 2FIKA 1JV5A 4JM2F 5B39A 3NFSL 1PVHA 4Q9RH 3NGBC 5J56B 2CR6A 1QFOA 2DQFB 1U8JB 3D87B 4BFEA 1T1WB 2DQIL 1OP5H 3EJYC 3N50A 4K7PX 4H5SA 3VGGA 4B53A 1HK6A 4BQCA 1BBDH 1A21A 5D4QA 1U8NA 3C08L 2VIRA 3C8DA 3GSVB 5L8JB 2OJZH 4LHUB 4W6XB 1UM5L 3BGMA 1RZFH 4U6XA 3DV4B 1FZJB 4EDXB 4U6HB 5D5MF 4LSQH 5HHOB 3RTQA 4RMWA 4OCLC 5E6IB 5I6XB 4PY8J 4YHIA 5HHXH 5EUOE 1SHMA 5C0BA 2A77L 4C56B 3PGFH 4FQHA 3O11B 3D85A 2QQNH 4M6OL 2N56A 5EN2A 2APXA 4JPWH 2Z31B 4M62H 2OTWA 1WZLA 3V4VH 3JV5A 5DMKA 5FKPB 5D7KE 1GGIL 2VUYA 1UJ3A 4CBPA 1FVCB 2EC9T 3M17B 2HYMA 5HHOD 4UDUA 3ECBB 5BZDB 1OTSD 1BFOA 1NCDH 4NZUH 3T65A 4MHHI 4NM8L 4Z7VA 3KG5A 4YBLB 4Z77B 4ZFGH 4Y4HC 2B1AL 3FB6A 3WKNA 1HZHH 5CIPB 4RA0C 1XF2A 5JXAL 1ZS8B 4Z7VE 3GI9H 4ZFOA 2FH8A 1WF5A 1S7XB 3BQUA 4PG9B 1A1NA 5GSVB 1DN0B 1KJ2L 4GRMB 5EU6D 5I30H 1A6PA 4Q9CA 2UWEB 2J4WL 1NAMA 1PG7X 4JFYB 3EO9H 5FAAA 3MNWA 3U0WL 4ZFZA 2ZNWA 3TVMA 2BDNL 5DHVB 4P4KD 4FXKA 4RMVA 3MZGB 1TZIA 3BZEB 1CQKA 2GJZA 4NQSB 2BNQD 3TBWB 1G0XA 4X98B 4YXHH 2BC4A 4TNWF 3OAUH 2HJKA 4ZQKB 1WIUA 3PHSA 4DOHB 3ZHLA 4ZNEA 1LHZA 2QBWA 5JPMB 3NACH 3GK8L 3VRIB 3T2NH 1A5FL 2B5IB 1F4WH 1WVZA 2VSDA 4HHAA 3DV4A 4O2CB 4RMTA 1NGYB 4WDIB 2I07A 5ID1B 1XGUA 1ZLVK 2IANB 4JZJB 4NHUB 3O6FA 2HTLC 1RU9L 3MRJA 3FO1A 2XRAL 3H7BA 3OKKB 3FOLB 4JFFD 2FNBA 2OQJB 5SX4H 1LK2B 2CRZA 4PRHB 4NJAL 1U0QA 1WTLA 4N8CL 1N26A 4JRYB 4PS4L 4YXKH 1TTUA 1ADQL 1RIHL 1S8DA 1HZHL 1GZPB 4LCWE 4UTBH 3V79C 5TE7L 2F8VA 3RFZC 4OZIA 3QH3B 1QKZH 4DK6A 5EO9B 1RULL 1J10A 1Q9WB 4XNMB 1YDPA 4PFEA 1CXLA 1FLRH 1M1SA 1A2YA 1DUZB 3C8KA 5F96H 1ACYH 3MLWL 32C2B 5ESAA 3FT2B 4MA3A 1XR8A 1GHFL 3KYOA 4LRIA 2C7UB 1D5ZA 3C5ZC 1DBBL 2DYPB 2NYYC 3TIDB 1GGBL 5KVGH 1T6VN 2DDQH 1I85A 4C59B 4MNQB 4UNUA 4PRIA 3EUUA 3TJHA 3C60B 1BAFL 1W0WA 5DJ8B 1JRHH 1RZ8A 3MLZL 3H9ZA 1IKNA 3BRDA 4UDTA 2OJZL 2AJ3A 3R0NA 1FDLH 3IFOB 4X5XB 1DTUA 3QO0A 4ZQKA 1HSBB 3GMOB 4WI5A 3SGDH 5D2LE 3IRZA 4QLRA 4U1SB 2VO5A 2X89D 4U1JA 3SCMA 5EO0A 4U0QB 3U30B 1PQZA 2L7UA 2BSTA 4CMHC 1RJLA 4WU5A 2Z91B 2VQUA 1MCOL 1JK8B 4ZPVB 1FBIH 4OBSA 1YEFL 1RZKH 4NQDB 3RAJH 2C1OA 1DBML 4L8BB 3GK8H 4KUCD 5F1NA 5JA8B 3F8UB 3MCLH 4JY4A 5SX4I 3VI4E 1RY7B 3S6CA 1ZVSA 1HQ4A 1NAKH 5K33A 5JDSB 2AK4E 3HKFA 2WINB 3MNWB 4Y89A 3GJFH 1AGFB 3V2AR 1OB1A 2BDNH 3CD4A 3HR5B 3ARFA 2VN7A 5HDLA 2Y06L 2VR4A 2R2BA 4F7CB 1RURL 5JW4M 3PWPA 5D1QD 4UV7L 2CRYA 4LLQA 1S9YB 4OLUL 3MRCA 3PDGA 4P5TC 4UTBL 3T0ED 5H2BB 1HHKB 4S1SH 1CD8A 3G5ZA 5JXAH 3L3KB 1A14H 2B2XL 3NBNA 1X5HA 3KJ6H 2EYTA 3LKSA 5DZOA 1PDKA 3MLXL 5KVFL 3O4LE 4OQTH 1YN7A 5B39G 4UZGA 4Q0XL 5DO2D 3O9WD 4KK6C 1BQHB 3AXLB 2X4OB 3F58L 2V5RA 3VWJA 4TRPL 5DJ8A 3HI5H 1FZOB 2IPTH 1WUNT 3GMNA 4JFZL 3QUZD 2OL3B 1A7NL 3CC5A 4PJGE 5CGYD 3MJ7B 3SE4C 5FA3A 3GMQB 1UADC 5JOPE 1I8IB 1C16B 4WCYH 1ROWA 3KPSB 4X5LA 4OZFG 3BD5A 3E0GA 4YIQB 4IRZH 4NFCA 4Z7WB 3DETC 3H0TA 1EEQA 5A16A 2NY6D 1MJ8L 3DGGA 4XPAL 3NIGE 4YX2H 5IGXL 3ARYA 1L9MA 4OQTA 4PJEA 4XBPB 4X4MA 2VLKB 2C3HA 5DRZB 3ULVD 2F54A 4L8CA 2FBJL 3WNPA 4YC2C 1S7WA 4U6YB 1W0YT 4IOFC 1D6VH 1WLHA 4APQC 3AREA 4HIIB 5IROC 5BS0E 1ZHNB 4JO3L 4KY1L 4HWBA 1MAML 5IMLA 3MBEB 1KN2L 5KTEL 5F3HB 1KCKA 4HWZB 1NMBH 2FO4A 3MACL 4AENB 1A6WL 4S1DC 4KKNA 4CNIA 1ORSB 3A6BH 4HBCH 4IHOA 3RX7A 3B2UD 3B8YA 2R4RL 3QSKB 3TBTB 4V1DA 4GKZB 2M26A 4OGAC 1JZ6A 4O2FA 1RUKH 1U3HD 5C0ND 1RZGA 1MJJA 3V7AG 1FYTD 3VGAC 2G5RA 5SWZA 3VDBA 1RHHB 2VXQH 3INUL 2ATKA 5DWUH 4EIGB 3MYJB 1UB5A 1G7PA 2XZQH 5D7JC 2MNUA 2ADGB 1TQBC 4KGLA 3C2SA 5T1KD 3BOVA 1KLUA 3WHE0 3CMGA 4IRSA 1N2RB 2DICA 1KOAA 3O3BB 5DYOA 3L3GB 4C56E 2VLMD 1EFXB 1A8JH 4AM0B 1JPSH 2OTWB 3IAQA 3BD4A 4UAOC 1UM5H 2UY6A 5F7EH 4D8PB 3T4AA 3OKMB 3LRGA 2MQCA 2OBGA 2J6EH 3VWKC 2RFXA 5EU7E 1FJ1B 3S34H 5D93B 3RX8A 4PG2C 3FB5A 3GKWH 2WBJB 4JAMA 3SE8L 3PABB 1KGCE 4PJEB 3PWPB 1WISA 3O45B 5ENWB 4AMKL 2WY3A 4Z18A 2FECI 2YWZA 3BUYA 3RWFB 4XP5L 3CVHL 4CKVX 5EBWB 4ZDHA 1KJ2A 1PZ5A 4YDVB 4ZMAT 5JO5A 4ZSOA 3CDCA 1WZKA 1ZANL 1R24B 1ZTXH 4PJ8C 5EWIH 3GGWB 4Y88A 3B5GA 1DN0A 4GRMA 5E9DA 3CFBB 1YQVL 4P2YA 2AI0L 1AP2B 4P5MB 5BV7L 3GEWB 5L88H 4NKDA 3I9GH 5J12B 2ZKHL 1MQKH 1CICC 5KZCB 3P73A 4DN4H 1X4YA 1VADA 3UJIH 4AIZA 2WNGA 4PJ7E 5HYSA 1P4LB 1MCLA 3ULUH 2VITA 2F5AH 4KQ3H 5EZJB 1T1WA 3BI9X 3HNTH 2XTJB 1BD2A 3E2HB 3K2UL 1OWRM 3WFCL 3AS2A 5I1CL 1MWAB 3MCKB 1BZ9B 4HUMB 4HF5H 5LGHH 2WUBH 1BWWA 1JWMB 1Q38A 3DYOA 5L8LB 1W72L 4ZD3H 5IW3A 2VDQH 1I7ZA 4RGNC 4X9GA 5B38A 4U1NA 4IRSB 3ZDYF 1JBJA 5TPWH 4PRDB 5MHSE 3ZKXB 1IAIL 1NUFA 4JVWA 4HMDA 5E8NA 2BJML 2O5ZL 5BW7A 3HMXA 1EGJL 4Y5YB 2O5XL 2W9DL 2H26B 1JGLL 4GUPA 3JUYA 4UIMA 4HFUH 1E6OH 5TDPA 1BFTA 1R5WB 1KXVC 1CFTA 1OTUC 2OR9L 5FO7B 2DLIA 5AG9A 4J4PC 3TH4T 1NBVH 5DD6B 4WFHD 2XA8H 1QFHA 5JIHA 1L6XA 4QRPD 4X6EA 4Z7VB 1NMCC 1JZ8A 4JAMB 4GLRH 5HD8D 5J1AA 5KVEH 1P9MC 1I1AD 3DMMD 1SVZA 2CK0H 1NCNA 3VH8G 4OZIF 4HSQA 1IMHC 3MRMB 3HC4H 4M03A 5FIEA 3D0VB 3CFIC 4TSBH 2QKIA 2DKSA 3DUUA 1KEGH 2KUTA 1BHGA 5I8OH 3QIBA 3H9SA 5HDBE 4K7PY 1I8MB 3R0MA 4NP4H 1FL3B 1XR8B 2FRGP 3ZHKA 2EYRA 3FB8A 3Q1SL 5C0IB 1V7NH 4HULB 2Y6SD 1ZGLA 1NDGB 5IW1B 3PXHA 4W68A 2GK2A 5KG9A 3VXUE 4QRUB 4QXTA 3M8OL 4HPOH 4BH7A 4P0DA 3DECA 5JDJA 1PKQA 4YHML 4K3JH 2CMRH 3UTTA 3HAEB 3CLEL 4MJID 4WY7H 5HHNA 1F58L 5IWLC 3SGJA 4LAQL 2MFNA 3Q5YA 4X6CB 3ARBA 2BSTB 3MNZB 3J8F7 3F5WA 1A6VL 3C5JA 2AK1H 3BN9D 3IU4L 1YUHB 4YBLC 4P3DB 1GIGL 3QHFL 2W65B 2WANA 5K9JL 3MRJB 4Z7WF 3MBXH 4DEPC 2OP4L 3MV7A 2HWZL 2MMXA 4QOKB 1OGAE 4MJ5A 4N0UE 2FD6H 4JG0H 2PO6C 3QIWB 5DFVD 3F7YB 2AJUL 2D9CA 3TIEA 3FO9B 1JGEA 4E0RB 2VR9A 4GG6A 1EPFA 3PWUB 1QRND 1AQDB 2N7BA 4OD3H 4O9HH 5L9DL 4JO1H 4NZTL 1I7RB 3UTOA 4Z7UA 1U95A 2PYEE 4XNXH 3PGCB 1OQXA 1OTTD 3OF6D 2R2EA 3UYPA 5D2NC 4QKXB 2PCPA 3MQIA 1LE9A 4I18A 3WS6A 3VA2C 4LNRB 4KKCC 4UV4H 4JN2A 3WIFB 2A2QT 1VEOA 2EZ0C 4JY4B 1MCWW 3TV3H 3DO3A 3OB0K 1I4FA 4U31A 3O2WL 3D9AL 4XHQA 2IMNA 4J3TA 3NIDE 3IDMB 3BHBB 4LPVA 3TO4A 2FATL 3KPPA 2CK2A 1MJUH 4L4VA 3QEHB 2J5LB 5FYKU 4MNHB 2VLJA 4IRSC 4G8IA 5DUPH 2NR6C 4P2RE 3W9EB 1EFQA 5FYKE 3FZUC 1UXSB 4ZPTB 4U1SA 1UWGH 4PJIF 4X9HA 3HG1E 1NH6A 1MEXH 4HCRH 4HFWA 1QSEA 4XNUL 4CVUA 2P8LB 4PRID 1E6JL 1H3PL 1MCPH 2BMKB 2FB4L 3DVNA 3P9LB 4QOKE 1WBZA 4N0CD 5IB1B 2BNQE 4O58L 4MYWB 1A7OL 2HTLD 1YC8A 1PSKL 3MX0A 4K7PH 4EQ3A 5IUSA 2SEBA 2R29H 4GW1B 1GXEA 1VGEH 1XEDA 2FL5B 1AQKH 1XGTB 2DL2A 3V6OA 5I1JH 4QOKA 3VFMB 5EZIH 2HFEA 2VXVH 3U7WL 1MLCB 3ZYJA 5C0CA 5FKAB 5MEPB 4NO2B 5CEZE 2ZUQB 2A38A 2O61B 1C12A 3U48A 1OB1B 3OKDB 1FZKA 5KN5A 2AW2A 4FN0A 1BGXH 4DN3H 3EGSB 4JANA 5KSUB 2P44B 3RVVC 2NPLX 4P2QD 5HHMD 5CIPA 1NCWL 5ACZB 3RIAF 4MS8C 5GJTH 4TPRL 4RX4A 4YDKL 2VWEC 2FYYB 2MPAH 4ODWB 1UENA 3O2DH 3ZDXF 3SDCD 5I0ZA 1OARL 5FO8B 4LSVL 2E7LE 5L2KD 1BECA 1NGPH 5CEZL 4G6ML 4PRBB 3D0LB 5FYJU 3BYTA 3TBSB 1NCBH 3KDMB 2A73B 5HGHB 4YFLI 5CJOL 5FGSA 2GJZB 3GB7A 5INCA 4GS7B 4L9DA 1KT2B 4AM0A 1U3ZA 4N5EA 5HYQA 1N8ZA 4M6NH 3DPBA 5D1XD 4EOWH 3N9GH 4F2MB 2VQTA 4K94C 4Y4FD 4U1KA 5C0DA 1FNLA 3QFJB 3QIUD 3RHWK 4PJFB 1MHEA 1ZOXA 4RFOL 5ETUA 3T2OA 5A2LH 5T3XD 1LVEA 2B0SL 1D9KC 1IEBA 5BRZA 1WZMA 4A6YB 5D5MB 5K9KA 1U95B 4MX7A 1FCGA 2H9GA 4RZCB 4QGTA 3RTQD 1JZ2A 2COQA 1NMCB 3UCRA 4ELMA 5MEQB 1II4E 3NH7H 5FM4A 3RVUD 2HMIC 5C0BD 2YR3A 5CEYA 4FHBD 5TE6L 5C2BL 1UEMA 1BOGB 4XXDB 3U4EA 5GJSH 4MAUH 1YPZF 2R29L 4G9FA 4XPTH 4K9EL 4LASH 1A7OH 4ZUSA 1I1YB 3DOSA 4KDWA 3LOWA 4HS8H 1XIWA 4WO4A 1IKFH 3LZFL 3LKPA 1PFCA 2YWYA 5E6ID 5IB4B 2W92A 1AD0A 4S2SB 3IS0X 3VH8A 4F7MA 1U8KA 5D1QC 4UI2A 3V4UH 1CLZL 4RQQA 1EGJA 4WUUA 3TWCH 3TYFA 4GBXB 4TVPH 2I9LB 3RWIA 3WDJA 1G9ML 4TYUA 1VESA 4KVCL 4OFVA 4QHNB 2PO6A 3GNML 3X14B 4QNPE 2V5YA 3PXJA 1E4XL 5DVNA 3ROLB 7CGTA 4O5LH 5MENE 3CU1A 3VFNA 1XF5A 3MOAH 3MJ9A 1KN4L 3IS1X 2DM7A 4LEXL 5ITBL 5EA0H 3UBXA 4NC0B 1LK3H 4PJ5D 3QUZC 1FYTA 4ZTOH 1PGRB 3HMXL 4X7CC 4BQBA 4JKMA 1AFVL 5DS8B 3VFGL 1FHGA 3CFJB 3WO4B 2KZ1B 3BPLC 1T83C 3P73B 3TPUA 1CFSA 1TLKA 4NC1C 4XNXL 3STBA 2HRLA 1H5BB 3AAZB 1R0AH 1C5DA 1AJ7L 3BKYL 3LS4L 1HEZA 2OTPA 3SN6N 4YQXL 1JNNH 1A7RH 2LAGB 5E03A 1IC5L 4U49A 3SDDB 1F6FB 2NY1C 1UZ8B 1FZJA 3NIGF 2WQ8A 4G8EB 1ZHLA 4J12A 4K3DH 2JLLA 3QDJD 1NUNB 1YEDA 1Z9LA 4U7SA 1BF8A 1S78C 3D3VB 4HPYH 3DRTA 3HG1A 3REWA 4F7EB 1FVEB 3N85H 3IKKA 3B2UC 1I8MA 4QWWD 4NRZA 2PW2A 3PQYA 2AEPH 2C1PB 1F3JA 4PRNA 5DUBA 3EJJX 4GW5A 1L8JA 5KJRH 3UZEA 1JV5B 5IB4A 3EFFB 5DD6A 1FN4B 3HS0A 4ZFOL 4NHCL 4BUHA 4HW6A 2DM2A 4Q6IA 2Y23A 4MNQE 1WBYB 5GISL 5J1AB 2VXSH 1EAPA 1CE1L 3BDXA 5DHVH 3K74B 5FO9B 1KCUL 4OFPA 3BPOB 4Z5RA 4AY0A 1K5NA 1TQCC 3G6JF 3G5ZB 4IDLA 5LCVL 2V2XA 2DMKA 1YEJL 5CEXA 3RGVD 2JJTA 2IAMD 3OPZL 4XI5D 4JPKH 4H0HB 43C9A 1N5AB 1INDL 1WZ1L 4OFKA 4UBDC 4KHTL 2HTKD 4B0MM 5KSVB 3MRHB 4OZHA 3D39E 5L2JA 2MQ3A 4N8PA 4TOYH 4KDVA 3CSYB 35C8H 3UPAA 4X9BA 3BGAA 3L3OA 1EHLH 5IV2A 2UZYB 4ZAKA 5KVEL 1QP1A 4KZDL 3GSNH 4ZNCD 1VPOL 5HYFA 3GI8H 1FVCA 3VWKD 4HCRA 1VB9A 4G3YL 1G7LA 3TFKD 1R3IH 1R5VA 2BOCA 4PJGB 4GG6B 5IFJA 3T1FB 3VCLB 4R2GD 4YHKL 2EDLA 3VXMB 1S7UB 4NKOA 3AU1B 1KC5L 3MNZA 1CGTA 2DWEB 1ZLVH 2BJMH 5GGRY 4K8RC 3SJVB 1FFPB 1BP3B 2GY7B 3N1GC 3N1MC 3O81A 4PJ8D 3KLHC 4JZJA 4LSPL 5IQ9B 2X41A 3P9MA 4HUXB 5CHNB 4JCLA 5EU5A 3C6LD 5ILTH 1DUYA 2VLLA 4UILH 5JHLL 1T22A 2HAZA 4FP8L 1T4KA 2G5BA 4MQTB 5FHBL 1JPFA 4OT1H 5I8CA 1R3HA 1CGYA 1DL7L 4P59L 1JFMA 5I8KH 2OL3A 1N59A 5E24E 2F5BH 1AKJB 3HN3A 3TZVB 3S35H 5C6TH 4R7DA 3R8QA 1H5BA 1KCVL 1AIFA 1NEZA 4OLEA 3PE9A 3TCLB 1YNLH 1WBYA 4Z7UB 2KPNA 3UC0L 1DLHB 3EAKA 3UTTB 4H88H 2PF6A 2F8XC 2YA2A 3U1SL 5LGJB 5EA0L 1DR9A 4ODHL 2PCPB 4XC3H 3MNVB 1T2QH 3QDME 3MPCA 5A2JH 1MH5B 4WHTB 1KLUB 1LDSA 5IROA 3GNMH 1FL6B 4OZHB 1PY4A 2FJHB 2IANA 1YEDB 3GIZH 3BESR 3O3BA 3LQZB 1TXKA 3CVHH 4Y2DA 1E28A 3N85L 3QFDB 1FLTX 2XPGA 1BVZA 5D70L 4FFWC 3PHOB 4PLNC 2J6EL 2YUZA 4V1DB 4I0PC 4FXGB 2AKRB 4LLMB 3L3DB 1HXMB 5C6TL 5F7EL 4HMEA 2DLFL 3OKNA 1QQDB 2Z92B 4DZBA 1S9WB 3FB7A 3G6JA 1FORL 1A6AB 4KC3B 3LSOB 5D72H 2AJVH 3B9KB 4HWEH 1YMMD 4JFEE 4YFDB 2DQHL 5D1QA 5GS1C 4JRXA 1OP3K 5GRJL 2EH8H 5D6CB 1ITBB 1NDMA 2DQTH 2PYFA 3DX8A 3H7BB 1XGQB 3HE6C 5BRZD 2YPKA 5EU5B 4TSCL 5D8JH 1N0LA 1U8HB 3G08B 4I2XE 4TUOB 1OP5K 5D9SA 4FQLL 5DEGB 3SDCB 2RR3A 4MQ7A 1I8KA 1RIUH 3D2UB 1NEUA 1ZHBA 1CLOL 3U9PL 3ZE0E 4MD5A 4K3HA 2DRUA 3DTXB 5B22A 2RBLA 1U8IA 1YEHH 4XMKL 1C1EL 1NCBL 1RMFL 1QPPA 4PG2A 2X4SA 1QBBA 4PJGF 1G7JB 5J6GA 3T1FA 2AQ1A 1UM4L 4U1LA 3B3IA 3BN9C 5C86A 2NY0B 3E1F1 4R9HA 4TQEH 4DUVA 5C0JA 4MDIA 4H88L 4PTTA 2XACC 4M1DH 4LLDA 2ZSVB 1DVFA 4JO3H 4E41A 4K3EL 2Y5TA 5EBWA 3ULUL 4D9LL 1A1OA 1YEJH 4MNQA 4MJ2A 4GXVH 4PV8A 3ZSSA 5GRWA 5I8KL 1Q0XH 4A2LA 1Z9SA 4DN3L 1T22B 2NY0D 4RRPG 3JSSA 1KG0B 1QVOB 5GISH 3MV8B 4ZUSB 1H8OA 1GPOL 3G5XA 4ACPA 3Q6FB 4FG6D 1OSPL 2XNAB 1G7HB 3QAZC 3AUVA 3BKCL 3V5KB 1LD9A 3QJHA 1D7FA 1CDGA 4HQQL 4JFQA 4WU5B 5JLZA 1J05A 5I1JL 5C0EA 1SJEA 3ZKQD 2CKBL 2W91A 2OJEB 5J8OA 3GSQB 3OX8A 2R39A 4KKCD 1I1FA 4PUBL 5DRNA 4XHJD 5CILL 3NZHL 5DT1H 3CZFA 1PSKH 2W07A 4MB4A 3QRGH 4AT6A 4IMKA 2R0ZL 3IDYC 3MCG1 3MC0A 4LFHD 3OJMB 3QEUA 2NX5D 4NRYA 1P6AB 4YHIB 5JDSA 1VPOH 4D9LH 3BN3B 1QOKA 4GOSA 5ACLA 4XVJH 3D2UA 4I4WB 4K3EH 4LOUC 3B9DA 3BZDA 2H32H 2MCG1 3QI9B 2Y07L 5I1DB 1Q9LA 4OCYL 1OARH 4PJAB 1R5WA 4WI8A 4L3EA 1G7QA 4JPIA 4OFYA 4YUEL 1FO0H 2AKRA 4LLMA 4G8GB 4NO3A 4G7VL 4MSWA 3G6AB 3HI1B 3WV0A 3HMXH 3LN4A 5FV2A 2AXJA 1IGTA 4PB0L 5HDQL 4PTTB 1FNGB 5EBMB 3P0YH 2I9TB 3BP6A