3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
2OS7A 5GZND 1FNFA 1YN6A 1AJ7L 3G04A 3FTGA 3OJ2C 5IEHB 1XGQA 4XMLH 3WXWH 2CIIA 5GS0H 4KK5C 5I30L 1OSPH 1OAZH 2F8OA 4GRLA 3RVTC 3P2TA 1DQMH 3LEVL 4MXQD 4NKOB 4U2YA 4OZIF 4AIZA 4IEFB 4R3SA 2X44D 2YRPA 1HDMA 1I1YA 4TUKL 4AZ8A 1KB5B 3O2DH 3VRJA 3FRPA 2EC9T 3MFFA 4PJGB 3VXMA 1NH6A 1AGEA 3MRQB 4HS6B 3PQYE 1BFVH 4MXVE 1F4WL 2MHAB 1I7UB 3TIEB 4NGHL 5ITFB 2LAGB 2IGFH 2V5RA 3EO0A 3Q2CA 4FFWC 4I0PA 4U6YB 2DKUA 5K9QI 3DXAD 3ARXA 1AO7D 3OF6D 4E42B 3BE1L 5JIPA 5E6ZA 4GAYB 2ZG3A 1TNMA 5FGCB 4NHUB 5EBMB 3WIFB 2IQ9H 4GFTB 4JRYA 4W6YB 1WFNA 1MCRA 2NNAA 4X7EC 5D7SH 4KKCD 3BKYL 3UDWA 4JR9H 1QFWH 2PTUA 5I18H 4GH7B 4LCWD 4WU7A 5JIKA 1R3HB 3HLAA 1YN7B 4XBPB 4MJIB 1UZ6E 3HE6C 4JCMA 4MAUH 2HG5B 1OTTD 1X5XA 1XH3B 3DO7B 2D4DA 4PRDA 2C3WA 4ONOA 2P5EA 1S7VA 1NDGA 4Y5VA 3O6FB 3O6LL 2AEPL 5D2NE 4DW2L 3WJJA 1WWWX 1HKLL 3T1FB 1Z0NA 4FNLL 4UDUA 1XMWA 4U6VL 4UTBH 2DIAA 1U8JB 2F5BL 5I1GL 3IYLW 4XCYA 4YDJA 4YGVB 4FRWA 5EZOL 1UM4H 2IPTH 2JJSA 5JUEL 5JHLL 3P4NA 1MAMH 4I3RL 3D87B 3QUMA 3D3VB 3LKSA 4KRPC 4YXKL 1IGMH 3CDGB 1T1XA 5D2LE 2XA8H 5KVGL 3RWEB 3TC9A 3IAQA 4I0PD 3BEVA 1IGTA 3HE7C 3HMXA 3SQBA 4QKXB 3EJZC 3P0VH 1BF2A 5KAQG 4IRJA 1N0LA 5C0CE 3DRTA 4YHIB 4F9LA 3L1OL 5J6GB 5JW4Q 1L9MA 2MTPA 1KOAA 4HGWB 1NFDF 3IJYA 4EIZC 1ZLSH 2AV7B 1TVHA 3MOBH 4GS7B 5FUOL 1OP3H 4JFXA 5FGSA 4PRAA 3H8NA 1G0DA 3FCTA 1FL5B 1I9IL 4MHHG 4QOKE 5LAXA 4ODWA 1G6RL 2A1WL 1IGFH 3QUKA 4JFFD 3S88L 2X10A 1EHLL 4NJAH 3MNZB 1TZGH 3BIAX 4JJ5B 5ESAA 1P9MC 5HY9B 4DZBB 3UJIH 4X4XA 4X80H 1UB5A 5FYKH 1JK8A 2BNUB 3DX6B 2ZUQC 4OZHE 2VE6B 4XP5H 4M03A 1UM5H 3MGOA 1QRNB 3QT2A 3EOYG 3DUSA 1H8NA 2A6DA 4JFQA 5GS1B 4PY7A 1EFXB 1F4HA 3QO1A 3RWHA 5ALBL 2NYYC 4GMSH 5C07D 3W9DA 1H9VA 4NNPH 3MLTA 2APWA 1A1OA 4RAUB 4G8FB 2R56L 1NMBL 1F11B 1U8MA 5F3HB 3GB7B 3O0RL 5DVLA 5D6DA 1A6UL 5D7KE 1T1ZB 4M00A 5T33H 1MCHA 3CGTA 3NVQA 5FB8B 4NUGH 1MCQA 2V2XA 3GSXB 3H7BB 3RWCA 5CMAB 1U3HB 4LLYA 3UO1L 3QUZC 3S7GA 4DUVA 4NC1E 4IOFC 4H20H 5DD0H 2VLRE 4MNGA 5EUOB 3OG6B 3RWDB 4LP4A 4V2BA 2FX8L 3BKCH 3U30B 1K6QH 4XCNB 4HKBB 4AENB 5DJ2A 4HKJB 4GW5A 3WFZA 3QJFB 1ITCA 2HMIC 3HI6L 3MRFA 4DZ8B 3SPVA 5HYQB 35C8H 2HAZA 5DD3H 3CK0H 5F7MC 4RAVA 3KPOB 4PFEA 4LGRB 4JKPH 4Z9KB 1B2WH 4LASH 2EE6A 4XMPH 3MV7E 2VLMD 3DROB 4D9RD 4U0RB 1Y0LA 3OJDB 4LNRA 2P4AB 4W6WB 3WN5C 1NAMB 1F3DJ 4MS8D 1OLLA 2X4NA 3U7AA 4F7TB 5IW1B 5CKGA 1ND0B 5DLMH 1NJ9B 2PYEA 5IR1A 2VL5B 3KXFB 5C7XH 3VMPA 4H8WH 3DVIA 5DVOA 1MCLA 1F2XK 2OTUB 4X6CB 4ZG1A 2GIYA 3CLEH 4CN6A 4PJDF 5DSCB 4MJ6A 1F4YH 1Q1JH 2EYRB 3MBEB 2HRLA 3UJTH 4LDOB 4P4RB 2C26A 5FM5M 43C9A 2VDNH 1XR9B 4ONGL 2R69L 4XXDA 4MWFB 5E8OB 2ZKHL 1GZPA 4OFIA 4GQPH 2H26A 4QHMA 5F7LB 3Q5YA 4MA8L 3U0WL 3EHBD 1CFSA 1FZJA 2FL5A 1SHMA 3RUGB 1MIEH 4OSUL 4KJWD 3W9EA 1II4E 2XFXA 4JQXA 5JR1L 2COQA 4NHCH 2PO6A 1YN6B 2APTA 2EE9A 3G04B 4WO4D 3FTGB 2AQ2A 4ZFZB 1XGQB 3BSZH 2CIIB 4DKFH 5IQ7L 4GRLB 4LRIC 4Y4HC 3A6CH 4AIZB 5HI4D 4R3SB 1HDMB 1I1YB 3VRJB 1J18A 5ELIA 2FLRT 4ODXA 3MFFB 3VXMB 4YDIH 5HHMA 1AGEB 4YBHA 1J0YA 4ZFOL 1I3GL 3L3OA 5ESVA 2OJEA 4CAGA 2X89A 3VGHA 5C1MB 5AG9A 1Q9OA 3EO0B 3P0YH 4I0PB 2EDYA 5CGYD 2XY1A 1U95A 2Z31A 1VPOH 5TF1L 3S35X 4D2NA 1G6RA 1OAXH 5L2KD 4JRYB 5CD5D 2NNAB 2DQGH 3VWKC 1DBKH 1X5ZA 4OZ4A 2E7LE 3I6LE 4WU7B 1IEHA 9CGTA 5I17A 1UWEH 3HLAB 5TDNA 2WBJC 2PXYA 4XNUL 1KCUH 4FQQA 5CP3A 1KG0A 1PG7X 4ZUUA 1TQCC 4RCAA 1RQ5A 4PRDB 5E2TH 2JE8A 5ICYA 4P9MH 5CINH 5CJXC 2P5EB 3ORJA 1NDGB 3QHZL 4Y5VB 3QRGH 2BCKA 3ISWA 5EIVA 4NZUH 4PJXF 2B4CC 5CEYA 4MQXD 3HNTL 1TCMA 4UDUB 1YPZE 4PJBF 4BSJA 4L4JA 5C09A 2UYLA 4TOYH 4P5TC 1K4DA 4YGAB 3KPNA 4XXCC 4XCYB 2J12B 1MCWM 4YDJB 4Q97A 3RTQC 4NUJA 4OFVA 5LGKA 5DD5H 4IJ3C 5EOCJ 3P4NB 1M71A 4GRWF 3X3FH 3RIFK 4EI5C 3QUMB 3B9DA 3O2WL 1TLKA 3LKSB 2AW2A 4R4NC 1FFQA 1N64H 2H2PD 3HG1D 1T1XB 1P6FA 3GMOA 5F97E 3VH8G 4B7LA 5CGTA 4PS4H 3BEVB 1IGTB 3FQTA 3NA4A 1ZGLA 1LO4L 2X42A 1CE1H 2EDLA 5HPOA 1BAFL 4IRJB 3LMJL 2CXKA 3DRTB 1MHEA 1MCSA 1IQDA 4HS8L 1TVHB 4X4YA 4C4KT 5C86A 4JFXB 4PRAB 3FCTB 5L8JB 4M93B 5LAXB 1QTYT 4ODWB 4D94A 2DLHA 4BZ1H 3QUKB 4S1RL 4K9EH 4AEHL 4YHOH 1NCWH 1A6WH 5BO1L 3H9YA 5ESAB 4S0SD 4FQIL 4Y5YC 3PWPD 1DQDH 1IC4H 1AH1A 4X99A 4X4XB 1UB5B 4PJ7E 1JK8B 1GZQA 4J6RH 2OCFD 5D7JC 5J0BA 3KWWA 3WHXA 1REIA 5D2NC 1DBJL 1NCBH 1JRHI 4FTVE 4WIQA 5GRUH 3QI9C 1TVDA 5K9JL 1FC2D 1M7DA 2I60H 3HE6A 3DUSB 1PJ9A 3MR9A 2A6DB 4JFQB 1OD7A 4X0KA 1L6XA 5ADOL 2UY7A 4PY7B 3T3MF 5J06A 5C09D 3QO1B 3RWHB 1MFEH 2IQAA 1OGAA 1OTSC 1Z5LA 3PP3H 1IM3A 3W9DB 1ITBB 3KPPA 2ZCKH 1JV5A 3BDYH 4HK3J 1S7RA 3MLTB 2JK5A 1A1OB 4KFZC 5DC4B 1JNLL 5EUOF 3T0BA 1E28A 3W11D 4UBDC 1CL7L 1G1CA 1U8MB 4PJ8C 5B21A 5I1JH 4U1IA 3KLAA 3LIZL 1DL7L 4WW2C 2H1PH 4P9HC 4RBPH 3RVXC 5CLWA 3QPQD 3NTCH 4JB9H 1O7SA 2FJHA 2V2XB 2DD8H 1P4BH 5I8OL 3LD8B 2VH5L 4G6AD 3RWCB 1WWBX 4LLYB 4TVPD 4PLKC 5IMOA 5ICZA 4X7FC 3GK8L 3QP3A 1I1RA 2AJSH 4YDKL 4MNGB 1AKJD 4JHWL 4G59A 2K9UA 1S7UA 1P53A 4QTHA 3VXSE 4XP1L 5AG8A 5DR5L 2NY6D 3NN8A 1IM9A 2ATKA 3EIFA 4GW5B 4P59L 3NFPA 4ZFOA 3MRFB 3VD7A 2OYPA 5GS2H 3SPVB 4JVWA 3MCKA 3U4EB 4X6CF 1TTUA 4O2CA 4RAVB 1FBIL 2BNRA 5LXGH 2HT2C 2DYPD 2ZJSL 2VLKD 4M3JA 1Y0LB 4MD5A 1SM3H 1FVCA 3B2UC 1VB9A 2X4NB 2PYEB 3TJEH 2NY1D 5IR1B 5JXEC 4LNVA 3RL1A 1JFQH 2E3VA 3RUGF 4OZFH 4TSAH 4KQ3H 2YMXH 3JV5A 3DARA 4MJ6B 5E08L 5EOCL 1S9YA 5DMGC 1XF2A 43C9B 1NC4A 4PJ5A 5IB4B 4N8CH 2UY6A 3NGBB 4NQDE 4OTXL 2GY7B 4XXDB 1T7YA 3GJFH 1GZPB 2B4CL 3UYOD 2H26B 3QIBC 1U92A 4QHMB 4XP6H 4AMKL 4KKBC 2ERJB 2W1NA 1ERNA 2V7NA 1MVUA 5BMFL 4G6KH 1CFSB 1FZJB 1L6ZA 2FL5B 3ULUD 3VXUA 2APFA 2ED9A 3W9EB 5E8DL 2XFXB 1LE9A 1MF2H 2YD9A 1W0VA 5EBLA 1RIUH 4XWOD 2PO6B 1YYLL 1UZ8A 5INCA 4KUZL 3IDXL 4Q58C 2E7BA 4J8RA 2XN9E 3ET9F 3HMWL 4UMGA 1XF4A 2KDGA 3QUZA 3W5MA 4OLXL 3GZKA 4RA3A 5IG7A 2OK0H 2Y5TA 4U1JA 4J3SA 2EYSA 4NBYB 2Y6SD 5ENWA 3U83A 2WLZA 4ODXB 4YHMH 4YWGH 1LK2A 1LEGA 5HHMB 4X6DE 1CDGA 3NBNA 3BGFC 1DQQA 4H0GA 2BNRD 3QB7C 4HUNB 4EUPH 3L3OB 5ESVB 2OJEB 1FZKA 5I1LA 4Y1AE 1JL8A 1JPST 1Q9OB 3WFEL 3OWEA 5EU6E 4JKWA 3ZYJA 1SQ2N 4QGTA 1CR9H 1MCKA 5FUZL 1U95B 2BVOA 2Z31B 2ZUSA 3OKKA 1EUUA 1TJHH 5I15L 4WJ5A 4POZD 4LARH 1G6RB 4UT9H 2LTQB 3FKUS 4GKNA 3WN5A 3HB3D 4YFDB 4JKLA 1YJDH 2EH8H 3MUJA 4OZ4B 2DI8A 4OZGA 1MLBA 2BP3A 5I17B 2X4OA 2N7AA 5TDNB 3V4PH 3UBXI 1YEEH 2PXYB 3WIHL 5CJOL 4FQQB 3LHPH 1KG0B 4AYFA 4ZUUB 5SX4H 5GJSH 1JZ8A 3E6FA 4N90E 5AUMA 1LO5A 3RY4A 3JUZA 3DBXA 4HIHA 5ICYB 2HA1A 1QLFA 1KJMA 5B22A 1VEOA 4L9LC 5DQ9B 2BCKB 1JHKL 1V3LA 1WEJL 1ZLUK 1TVBA 5FCSH 2FSEA 2GSIA 1SJHA 3C60D 5C0AE 5CEYB 2RAMA 4NM8H 3T3PF 2A74A 2VZUA 5T1DL 1F58L 5C09B 1I7ZA 2UYLB 1K4DB 3QIUC 3KPNB 4HFUL 5JOFA 4NUJB 1PG7L 3WKML 2GT9A 3LEXA 3RVUC 2P8PA 3DVNA 2J4WL 1JZ6A 1M71B 1ZMYA 3KYNA 3QXTA 3WLWC 3BKMH 2AEQL 4XHQA 3GJEA 3Q6GH 4Y4HA 3GMOB 1UENA 5CEXB 1HHJA 1JYWA 3FQTB 4WY7H 1ZGLB 5GGTL 3MRBA 2N1KA 2YKLH 1U2CA 3L9RA 3BN3B 1BM3L 4GO6B 3MRLA 4LPUA 1MHEB 2JCCF 4YDLC 3DOSA 2NQCA 5AD0A 1IQDB 5FKAB 2XZCL 1MJUH 4QXTA 2BFVL 4X4YB 2E7LC 2CK0L 2XQBH 3O6MH 2FD6H 5J56B 2E9WA 3FO0H 2GEEA 3VH8A 5KS9E 3VFRA 2NY0C 1JPGA 1RVFH 4JFED 3QQ3A 5I19H 2OTWA 4MXWL 1TMCA 5GQBA 4NN6C 2JF1A 3LH2H 3L5XH 1GZQB 5F70A 5FO9A 1J1PL 3LN9A 4EDXA 4HD9A 1T7ZA 3KWWB 3WHXB 3LKPA 2WBJA 2VNCA 4KPHL 4KK8C 5FGBC 4GUPA 1A9EA 1M7DB 3HE6B 3M8OH 3MR9B 5ECJE 2NY1B 4L8SC 4X0KB 4NFCA 4DQOH 4QGYA 5I9QB 3I9GL 5DRNA 2IQAB 4FXKA 3B9KC 4DN3L 1OGAB 1Z5LB 4JZOA 2MKWA 3WIIL 1T5XA 4F7MA 5HI5C 4ZODA 3KPPB 2VXQH 3Q6FA 1JV5B 3CH1A 1TDQA 1S7RB 3NIDE 1I1AA 2JK5B 3T0EA 4TRPL 1TNNA 1E28B 2IMMA 4O58L 4JPIA 2R2EA 4U1IB 3KLAB 1MWAH 1T80A 3BO8A 4XXCA 1MI5D 4PJIF 4XPTH 1RI8A 3G5YA 3LS4L 4LIQE 4EI5A 1OM3H 3VG9B 2QSTA 5IMOB 5HYJD 5ICZB 3M45A 4KRPB 3SDAD 4KRMB 1F5WA 3N1QC 1S7UB 3ARBA 2EE2A 2N56A 4QTHB 1A4JA 3FMGH 3NN8B 4DAGH 2ATKB 4AIXA 1A7RH 2GHWB 1S7SA 3NFPB 4JM2C 4Y88A 3J7HA 1JI2A 4ZFOB 3VI4E 4P46A 1A6VH 3MCKB 1JWMA 3CFDA 1X5AA 1KLUA 1S7WA 2XICA 4O2CB 4KKAC 2BNRB 2OQJA 2ZPKH 1FH5L 3UTSE 2CIKA 3WFCL 1H3GA 3TWCH 1T2QH 5D1ZD 2NLJA 4MD5B 1FVCB 2CKBH 5E5MA 5HHOE 4Y5YA 3RL2B 1RSFA 1VENA 4U1GB 2ZUWA 1T66C 4N0RA 2Z8RA 5I71C 2ZUQB 1TENA 4ODSH 1AQKH 1L7IL 2BSED 2W60A 1QOKA 5D2NA 5E2VL 4S1QH 1ED3A 1QFWI 3EDFA 2WWMD 4YX2L 3UZEA 1BF8A 4U4BA 1I1AD 3T0ED 2A77H 2CUHA 3WIHA 1XF2B 1NC4B 4PJ5B 1OWWA 1RUAH 5F8QC 1SYSA 3MXWL 4ODHH 4OCSL 5EC2A 4JKKA 1U92B 1Q0YH 1R3IH 3GHBH 2V7NB 1MVUB 2Z8WC 1F2QA 2IFFH 5TPWH 4ZFGH 3VXUB 4GAJH 1J12A 1D5MA 4RBPK 4G6JL 1KEGL 4PJ8A 5D2LA 1CFTA 1FGNH 1PAMA 1LE9B 1W0VB 1WV7T 5EBLB 3INUH 3CMGA 3KPTA 2R1YA 4GMTL 1UZ8B 2BHZA 1UCBL 5INCB 5F7EH 2P7TA 1X44A 5D8JL 3PGDA 2B0SL 4FP8L 4J8RB 1JVKA 1XF4B 4RGOL 4RQQA 3QUZB 5C0CA 4M1DL 1MQKL 4JO2H 3SO3C 5EO9A 5IG7B 3GM8A 2DQTH 2Y5TB 2M8XA 4U1JB 2EYSB 5ENWB 1T7VA 2F74A 1UKSA 4KDVA 1LK2B 1LEGB 1ZLVK 3HNSL 1KFAL 1DQQB 1I8IA 4NQVA 1PLGH 4QOKA 1ZGLM 5EORH 4LMQI 5GGTA 1UYWH 3K81A 3MLZH 2GYSA 1UCTA 4HUMB 1ZAGA 1EBPA 1FZKB 1F6AA 5I1LB 4DTGL 1KTRL 3LKQA 3PWLA 5D70H 5EULV 2BVTA 4R26L 3RWIA 1NGPH 4Z7UE 1G9NH 4BFEA 2BVOB 3OKKB 1JPSH 2VAJA 4LMQE 4WJ5B 1K2DA 4OZHA 4YXHH 4NO0D 1IKNA 2DLIA 4L5FH 3QEQE 4F9PC 5JDSA 2E6JA 4GKNB 4FG6D 4N8VA 4U1SB 3MOQA 3ARGC 2ZUTA 3WN5B 3G6JB 4WI9A 3MMEA 3C8DA 5JXEA 4OZGB 3NFSH 3RPIA 1MLBB 4X5XA 2X4OB 3GSNH 4PJCA 3UPAA 2V5MA 1J11A 1IZJA 4S0UC 5CJ8A 1KCVH 2VN4A 5E7BA 3WFHA 3E6FB 5AUMB 1BVKA 1DEDA 1LO5B 3JXAA 3DBXB 4HIHB 2L7UA 1QLFB 5FUCC 3DSFL 1KJMB 1N3NA 5FYKE 2DKMA 5HDBE 1TVBB 2FSEB 2GSIB 1SJHB 3LB6C 4DN4L 3CSPA 3SO5A 1WZKA 4IS6A 2A74B 2Q20A 5IHBA 5IB5A 1I7ZB 3QQ9D 3WD5L 5JOFB 2VLRA 3QDGD 2W9DH 4JPWL 4F3FB 3WS3A 2GT9B 3LEXB 2P8PB 1PBYA 1XGTA 3DVNB 1RFDL 4QRTA 4OGYH 4CKVX 4EBQL 3KYNB 4QOKD 4PBXA 4OFYD 3EOTH 4WEMB 5CEZD 1F02I 4WUUE 3GJEB 4Y4HB 1N59A 5A2FA 5C92A 1NEUA 4N1CA 5F7FA 1HHJB 3GRWH 1F8TH 3EJJX 1IGCH 3MRBB 4WHYH 4NQSA 1T89C 1A7OH 3L9RB 3MV7A 5KAQF 2HFGL 4GRWH 3MRLB 1D5XA 1JTPA 1HILA 3QULA 4J7RA 5AD0B 1Y6KR 1K9TA 2DM4A 4QXTB 2QADC 4NT6A 2EDBA 5EU7E 2HFEA 4PP1C 4R9HA 3VH8B 3V4VL 4OLUH 4A6YH 4KMQA 3VFRB 2HVJA 1JPGB 5CLTA 1J0KA 1UGNA 5IT2L 4BZ2H 3QQ3B 5E7FA 2OTWB 1TMCB 1RHFA 2H2SD 4KK9C 4G8IA 4DGIL 1JRHL 4GJTB 5C0RH 1HHKB 5FO9B 1VFMA 1W0YT 4EDXB 3GNML 2WMPA 3LKPB 4HBQA 1AD0A 3QZWA 2WBJB 3U7YH 4FFVD 3FO9A 2OR8A 1TQCB 1A9EB 4GUPB 1W72L 4YC2C 1TTFA 1UJTA 2EICA 4EKXA 5KTEH 4GLRI 3IF1B 5DRNB 1KELL 1QBMH 4FXKB 3HTLX 5C0DA 4RWYL 4JZOB 3ULUF 4U31A 3TT3H 2VLRD 1T5XB 4F7MB 4L9LA 1NSNH 3Q6FB 3CH1B 4KV5E 1CLOH 1I1AB 3T0EB 2JB5L 2BSSA 3AM8C 1CXIA 4H1LH 4HJ0C 3IDYC 4JPIB 3G6DL 2R2EB 5L2JA 3BO8B 3ZLQC 1RK0A 3QIUA 3RPKA 2DLFH 2VO5A 5C0EA 2YD2A 5DO2C 3TO4C 2H32A 2MCPL 3G5YB 5GRJL 4EI5B 1N4XH 3GI9L 4M48L 1IGYA 2XZQL 4K7PL 4V3DB 1FLRH 3ARBB 4X6BB 4M1CC 1A4JB 3SCMD 4LCCA 3T2OA 4RFOH 3BEWA 2B1HL 4HWEL 4ZTOH 5DUMH 1S7SB 3B9VA 4P46B 2QJDA 1PYWA 3CFDB 3IFNL 1KLUB 3D25A 1QBBA 2E7LA 3MV8E 2VR4A 4XHJC 2OQJB 2CIKB 1RUKL 2NLJB 5F96H 2IJ0C 3C5JA 2UV3A 4P23D 3VRLE 4E41D 5E5MB 1EVUA 1WZMA 3RGVA 1ZVHA 1NLBL 5SWSD 4Y5YB 4NOBA 4KK6C 3PUCA 4JFHD 4MCZA 4OF3A 4NO0B 2P42B 2W60B 2XTJD 5D2NB 2VC2L 1ED3B 1IEBA 4H88L 3P4LA 4BQCA 5IBUG 5C3TA 4LEOA 4LSUH 5TDPA 3QUYA 1KJ3H 1YPZA 4KGLA 1GAFH 4L8SA 4XPGH 1NFKA 1LDSA 4DKEL 5C0BA 1SYSB 2WUBH 3B9KA 5EC2B 5AZEL 5F1OB 4G9DA 2R0KL 1EHXA 2OSLB 1D5MB 2HFFA 1CXEA 1VFAB 4PJ8B 5D2LB 1CFTB 1BJ1H 3WKNA 2EE3A 4MD4A 3DVFA 4PRHD 2R1YB 4P2OA 4XNZC 4E5XA 4LVNC 2ZZUT 2P7TB 1OP5K 3PGDB 2QV2A 3IDIA 1MJ7L 3BPLC 4RQQB 1JGEA 3EOBA 5C0CB 1IAII 1PZ5A 3NZ8A 1CXKA 3RZWA 1C1EH 4G8GD 1A2YA 2XG4A 2ZSWA 2Y1VA 2F74B 1PQZA 1IKFH 3L5WA 2GFBA 4NQVB 1I8IB 3IXAA 4MNQD 4QOKB 3G6JF 3JVGC 4M6OL 1GL4B 5SWZD 1F6AB 1G7IA 3BPCA 4P48A 4JM2A 3OB8A 1NL0H 5C71A 3JTCA 3LKQB 3PWLB 4IRSD 3ZDYF 3RWFA 6FABH 5DVNA 3RGVD 3RWIB 1L0XA 3BP6A 3BMWA 5TE7H 4NPYA 4OLVL 3I50H 4PJ7A 5IB1A 2EXWD 4MAYC 2V7HA 1K2DB 4OZHB 2QQKH 4K71C 1BQSA 4FTVA 5JDSB 4N8VB 3PGFL 1YZZA 3T4YA 4W81A 1A7NH 2YS4A 2KQMA 1CD0A 1JYVA 3MMEB 3VA2C 4QHUA 3RPIB 2YUVA 5C0BD 2YPVL 4X5XB 5GRVK 4E9LA 3I75A 4PJCB 4WU5A 1RMFH 2Y07H 3C08L 4ZSOE 2B5IB 3WFHB 1BVKB 1PKQE 3AS3A 1NMAL 1W72A 3OKLA 4U1KA 1DBBL 3FOLA 4KY1H 1N3NB 1X5JA 1P4IH 4P2OD 5KVEH 4U1NA 1DBML 2Y36H 3BZDA 1IVLA 2P24A 4IS6B 4XPBL 4HXAH 4Z7OF 5IB5B 4KHTL 4DGVH 4RGNE 2VLRB 1M4KA 2YOCA 5EPMA 3UP1A 2C4XA 5B38A 3WMSA 3WS3B 5CSGA 1XGTB 2VZ3A 3VXSA 4QRTB 4LVHC 5ILTL 1QP1A 3QCVH 5E99L 1X5YA 4TVSa 1BP3B 1N59B 3KPSA 1NUFA 4XTRD 4JQIH 1R3JA 3GIZH 2EEBA 1G0XA 4NQSB 2A38A 5GGQH 3HFMH 5DHVA 2ESVD 4KHXL 3MV7B 1J1XH 4P3CH 1D5XB 3CVIL 4I9WD 1HILB 4M6ML 3QULB 4S2SA 3IT8D 2Z0BA 2X1QA 3T0AA 2ADJA 1IARB 1RUML 2FB4H 3CX5J 3QWQB 1Q72L 4NT6B 4NRZA 2HFEB 4UILH 4XBGA 1FHGA 1RZJC 3KJ6H 3SDCC 1WICA 4UIKH 2HVJB 5C08D 5I0DA 2XXCB 3EYQC 4F9PA 3MXVH 4YIQA 1ZT4A 3MRGA 4JO4H 2DBLL 4B0MM 3VFGL 4G8IB 3AAZA 1MCDA 4NQDA 3MLWL 1Q9KA 5MEND 1AD0B 4KQ4H 3QZWB 4YHKH 3FO9B 5EIQA 1KCSH 5IM7A 3K4ZA 4GRMA 1XAUA 5FXCH 3E3QE 2DMCA 3N1FC 5CSZA 5C0DB 3ARDD 2BJML 4L9LB 2EIBA 5DUPH 4LIQL 2D9QB 5F9AC 2PTTA 3PP4H 5L9DH 5E2WH 3VXSD 3BIBX 2XN9A 5D1QA 4PB0L 3OAZK 4LHJB 3W81A 3K4AA 5L2JB 4LSPH 1RK0B 5F3BA 3QIUB 4O9HL 1R5IA 3KPSD 4JRXE 1JGUL 2C4FT 4FFZL 3STBA 5C0EB 2H3NA 3LN4A 1JWUA 2H32B 4X6DA 2FRGP 4LK4A 4XMLL 3WXWL 1EO7A 2IPKA 4XGZA 1KTDA 1OSPL 3OPZL 1OAZL 3BDBA 3BVNA 1IGYB 4Y1AA 1OD9A 4LVOB 1GOGA 2YPKA 5EU6A 1IZKA 3O2DL 5EU7C 5IWLC 5I73C 2ENSA 5B39G 4LCCB 1UZ6F 5T5FH 3BJLA 1RZKH 1XGYH 4HJJL 4YDLB 3MUHL 2IGFL 1PYWB 1X4ZA 2NZ9C 2I5YH 3T65A 4IOSD 3D25B 1AHWA 3VFPA 2AK4D 5D96C 2DOCA 4K23L 1HZHH 1IEAA 4KROD 3C5JB 3EUUA 5ID1A 3GSUA 5INDA 5TFSL 2KL6A 3RGVB 3U7WH 2YK1H 1KBGH 3MZTA 5EOTA 4NN6B 5D7SL 3DI3B 1A8JH 4H25A 4JR9L 3QG6A 1QFWL 1A3QA 4MCZB 4OB5H 4OZIE 2VB5A 4N5EC 3TFKC 1FRGL 4MVBC 1HQRA 3UBXA 1BGXH 1CWVA 3L7FA 1IEBB 3ZZ1A 4IDJH 4LPCA 2YR3A 5F6IC 4LEOB 3D0LA 3U9UA 5TDPB 3QUYB 1YPZB 5D1QD 4OF5A 4MAUL 1DFBL 4L8SB 1FZMA 2ICEA 5HD8D 5C0BB 4NC2B 3C2AH 3B9KB 2RGSA 5FHBH 3S3JA 5SX4I 1GJIA 2WY3A 2QQQA 2EDHA 4G9DB 4OGAC 3GBLA 4KJPD 1T4KA 3QO0A 3TYGH 2E27H 2HFFB 2EO1A 4LLVA 3P4OA 1MHPH 3BMVA 4MD4B 1HXMA 1A7QH 4P2OB 4E5XB 5KVFH 1UM4L 3IDIB 2IPTL 3F12A 1ZKAA 3DHJA 3ARQA 1D5IH 1I1CA 1TCRA 1JGEB 3EOBB 3GMNA 4OCNC 3FQNA 1PZ5B 2VXSH 3NZ8B 4BFBD 3OKMA 1EA9C 1A2YB 2XA8L 2ZSWB 1PQZB 2CO6B 3RY6C 3L5WB 3BQUA 4L1DA 2GFBB 3IXAB 3HC3H 3P0VL 1OAQH 3VGBA 3K80A 1G7IB 2ILLA 4DKDC 1EH9A 4JM2B 3ARTA 3RWFB 2OMNA 2WIIA 1FYHB 3BP6B 3ZE0F 4YBLB 1RZJL 4NPYB 4PJCF 3IRPX 4C4KO 3LZFL 4PJ7B 5IB1B 3MACH 2V7HB 3ZTNH 2NX5D 1KYOK 4FTVB 4NJAL 5MI0C 1TZGL 4P2QD 5L6YH 1A6ZA 4M1GH 4RIRA 1BQLL 4U7SA 3NPZB 4FFYH 4QHUB 2MOVA 4WWKD 4F37K 1HWHB 2A9ML 4ZS7L 5FYKL 4NRXA 5KVDL 1EJOH 1OAKH 3NABH 3I75B 4WU5B 3ZKQD 4XNXH 2X1OA 4XP5L 2BSTA 1UM5L 3HRZA 4EOWH 1U0QA 5J1SC 1D7FA 3U6RA 4MQSB 5E00A 4X5LA 3QRFM 4BSVA 5JMOC 1W72B 3OKLB 4U1KB 5ADPH 1NFDE 2CKNA 2ZCLL 3FOLB 4LBEA 5E56A 1RZGA 4U1NB 5KW9H 1YEHH 3SE3C 1KC5H 4YE4H 2P24B 5JOEA 4IBLT 2FDBP 3QQ4A 4NSKA 4I48A 5CZVL 5IV2B 3CX5K 1FG2A 3X3GH 3MODH 3RVTD 4M6NH 4FABH 4Y16A 5EPMB 1GGBH 5B38B 1S5IL 1NC2A 4ZS6D 1LNUA 1KPUA 3ARFC 5DC0A 4P3WA 3VXSB 1A1MA 3QFDA 2VXVL 1YDPA 3BW9A 1CGVA 5KZCB 3KPSB 4WI3A 4H20L 3N50A 1R3JB 4TVPH 3ZYOA 1EBAA 1TJIL 5DHVB 3O2DA 3NH7L 3UTSA 3O9WC 3JVGA 2KPNA 1CN4A 2V9RA 1EXUA 5FCUH 4S2SB 2ADJB 5J1AA 1NGQH 5HHOA 1DVFC 2VDOL 4K3JH 5EO0A 3EJYC 1SBSH 35C8L 4NRZB 3CK0L 4XBGB 2NR6D 5J13C 4G9FE 1B2WL 4LASL 1EEZA 4XMPL 3BPNB 5C2BH 2FLBT 5IB3A 4JY6A 2MQCA 4YIQB 3X13A 1V7NH 1ZT4B 4NQUA 4XZUA 5HI3C 4HIEA 2F9BT 4P99A 3MRGB 3RWGA 1VFUA 5D7LE 2J88H 4JRWA 4NQDB 5SV4A 5GJTH 1FG9C 2BXYA 1Q9KB 3F58H 1EZVX 5HPMA 4JFZH 4OLZL 5T3XD 2V9QA 5IM7B 4GRMB 4NBXB 3V6OC 2W9EH 1Q1JL 3UJTL 1D9KD 3MNWA 3B3IA 2VDNL 4G7VL 4RGNC 5CSZB 4YH6A 4OJFH 1IGIL 1KGCE 1XR8A 4Y16D 5ISZD 1NC2D 3SN6N 2PTTB 3SKJL 1E4JA 3KAAA 3KPRD 4R4BA 2MPAH 2DL2A 2XN9B 4MGXA 5D1QB 5DK3A 2DRUA 2XRAH 3O4LA 3IXTA 3L3KA 4DK6A 3IDMA 1MIEL 5F3BB 5KANI 5GS0D 1R5IB 4NHCL 3ULUH 2H3NB 3LN4B 1JWUB 4X6DB 3WFBH 5IMMA 1G84A 3QDJE 4QHKJ 2D7TH 3FJTA 2IPKB 2Z4QA 2WZPD 4XGZB 1KTDB 3AFLA 1T2JA 4Y1AB 2XG5A 2JJVA 3C8KA 4PJDE 3A6CL 3T08A 4QRSA 2YPKB 5HHOD 5EU6B 4Z7UA 1MCFA 4YDIL 3WO4B 4BK4A 2LV4A 1JYNA 4ZOAA 3DYMA 2KUTA 5IFHH 4RISH 3TN0A 3M1BA 4HSQA 4HPOL 2QLVB 3QEQA 4NQTA 5E8PA 2XV6B 3TNNA 1KACB 3T65B 3C09C 1AHWB 3VFPB 5A3ID 2HP4A 1X5IA 4K94C 1IEAB 1BFOA 3SDCA 2OP4H 1YPZF 4LP5A 4HIIB 3H42H 4WGWB 5IVXE 5ID1B 3GSUB 5INDB 2X4TA 4WFGD 4OT1H 1OAXL 4QXUL 2ZNXA 4JFPA 5ESQA 4C56E 2C4FU 5EOTB 1MCCA 3E3QC 1OTUC 3W0WE 2DQGL 1MRDL 1DBKL 4H25B 3QG6B 1R0AH 4WFFE 1HQRB 4FA8A 3UBXB 1UWEL 3L7FB 3LDBC 3HA0A 5DYOA 3VXQA 1CXLA 4XWGH 4KTDH 1KCUL 3D0LB 3U9UB 1NCDH 1A14H 4YC2B 3O4LD 2ICEB 1TXKA 4YXLH 3TF7C 2A0LC 5F9OL 1MPAH 5IMKA 5IESL 2HT4D 3NIGF 2FCBA 3O45A 4P9ML 4NYLA 3L3JA 2BMKA 1M6OA 4NNXA 2CH8A 1E4XH 2XKSA 2A9NH 3NIFF 4NZUL 3U2SA 1T4KB 3QO0B 3BRGC 1E4KC 5C6TH 4FQ2L 1R3KA 2HT3C 4LLVB 2VAAA 3IDYB 3FFCA 3GKWH 3P4OB 4WUUA 1HXYA 1SVCP 5HGAA 5B4MD 3GMMA 5ERWA 4LAQL 4M5YH 1HXMB 4EEEA 3G08A 1ZVSA 1XGRA 1IAIL 5DD5L 4LSQH 3F12B 2DTMH 2D31B 1TCRB 3GMNB 3X3FL 3FQNB 1VEPA 5D5MB 5JZ7D 1BIHA 2ZP0T 3OKMB 4EN3D 2Z35A 4HBCH 5T5NG 2K7PA 5HHNA 2JJTC 4KI5C 3BQUB 4I4WA 4PS4L 5IWLA 1FDLL 2YN5A 5JIHA 5DA4A 1CE1L 4JPKH 3D3VE 1KV3A 3TBYA 1I3VA 1HOCA 3DETC 4PJXE 4K7FA 3VGFA 2WIIB 1I75A 5D1XC 4PJBE 1E6OH 1T1YA 1EERB 1GGTA 1LMKA 3IFPA 3TBVA 5CKAA 4BZ1L 3B8YA 3NPSC 1B0WA 1AXTL 4RMWA 1NCWL 4A2LA 1A6WL 4GRWE 5HYSA 5C6WH 1A6ZB 1XCTA 4RIRB 1DQDL 1IC4L 1VKXA 4GKOA 1ZXQA 1BBDH 4NRXB 5JW4R 4J6RL 4WFHE 3ARSA 2L7JA 12E8H 1AR1C 2BSTB 3TBTA 3HRZB 4N0UE 1KIQA 5GRUL 3U6RB 3TP4A 5E00B 1TZHA 4M5ZH 3V6FA 4Q6IC 2I60L 1A22B 5DJ0A 4BSVB 5IFJA 4UT6L 2CPCA 2ICWJ 4P3DA 3FFCD 3MTRA 1NGZA 4ZFFA 1IC1A 1WIUA 1CFVH 3NZHH 1DN2A 4LBEB 2VISA 3BPOB 1RZGB 3BDYL 5GS3A 4NSKB 2BERA 3QQ4B 3UXFA 4XI5C 5AYUL 4I48B 1YNKH 1FG2B 1FPTH 5I1JL 3GDBA 1QPPA 4K3DH 1KPRA 4Y16B 3NACH 5EIIA 3RAJH 1NC2B 1LNUB 1KPUB 2H1PL 1OL0A 4XNZB 3VWJC 5J57B 3NTCL 4JB9L 1A1MB 4EUPG 3FOMA 3QWOA 5GISH 1P4BL 2HTLC 3K1KC 3QFDB 3BPLB 1YDPB 4R4FH 3BW9B 1MCOH 1J7VR 2VZTA 2NXZC 1MFDL 4L4VD 4HT1H 2AJSL 4P5MA 3D39D 2QR0A 1AXSA 5ALCL 5FYLD 3MV8A 1CDIA 4KRLB 1FFPA 4ORGA 3P73A 3UTSB 3V8CA 1FNSH 2Z91A 1EXUB 4R8WH 4QHLA 1CIDA 3SDDA 3NCCB 5F7HA 3FAWA 3IJSA 2V9TA 5J1AB 2HWZH 5HHOB 1CDJA 5EO0B 4TNVK 1PFCA 1X5GA 4K94L 4RGMB 2QTEA 1UEMA 3VWKD 1RUPH 4JO1H 2O5XH 4XRCA 1EEZB 4K71B 1F13A 1QO3A 5EG6C 1UWGH 5CGMA 5IB3B 3JTSA 4JY6B 3X13B 4XZUB 2EDFA 4HIEB 4QWWC 2V6HA 4Z7NF 1XCQA 3RWGB 2EDWA 5DJ8A 4LCUA 3GKZA 1JNJA 1LDPH 1EIBA 4LAJH 1MY7A 1UKTA 1QYGL 4K55A 2P43B 3IU3A 5HPMB 2PF6A 1FE8H 1RK1A 1PGRB 3DYPA 4TSAL 2QHRH 1KXVC 2YMXL 3I3DA 3L6FA 4KQ3L 4QY8A 1YY9C 3HC4H 3DXAE 1AO7E 3MNWB 3B3IB 2DS4A 2EDTA 4NQCD 4N8CL 4NWUH 5I1KH 1ORSA 1XR8B 1CDYA 1JGVH 2MKLC 4Q9RL 1FSKC 1UA6H 4P5TD 4XP4H 3QPXH 4R4BB 4XP6L 3WO3B 3E2HC 3QG7H 3O4LB 1YEIH 3IXTB 5HGHA 3L3KB 3IDMB 2R4SL 1UWXK 3DTXA 4LCWE 4R4ND 1TZIA 3RBSA 1RIUL 2AGJH 4NFDA 3SE4A 5IMMB 1WIPA 1I8MA 5DFVC 2Z4QB 1CCZA 3E8UH 2Q6WA 4FMKA 3SDDD 3C8KB 2OK0L 2VDKH 1EGJL 4XP9H 1WZ1H 1G7PA 4QRSB 4Z7UB 4NFBA 2I24N 4YWGL 4YHML 4KAQH 4AEFA 3TN0B 3M1BB 4EN3B 4FQXC 2Q7YA 4PJ9C 2CDFA 3QEQB 4HWZA 3MA7A 5E8PB 3D9AH 2W07A 3RJDA 5GHWL 3TNNB 4YHZH 1FNHA 1NMCC 1MEXH 4IMKC 4B53A 3GSOA 3V4UL 1N2RA 3IETA 5L88H 1C5CL 1TJHL 5EB9A 1BFOB 2HLFC 3SDCB 1EX0A 2FGWL 4LARL 1PY4A 1VFBA 2H8PA 2X4TB 3RRQA 4UT9L 5B3JF 4JFPB 4OM0L 4H0IA 5ESQB 4ZSOA 5M94B 5F1NA 1T03L 2RJMA 2IALA 1K3IA 3ARVA 2E9IA 1K4CA 1PKQA 3ZT5A 4JDTL 1E6JH 4ONFL 3MRNA 1DLFH 1X9QA 5F7YC 3V4PL 3KYOA 2IADA 1YEEL 5DYOB 3VXQB 3QIWC 2I9LA 1VGEH 3SJVD 3M17A 2BHYA 5GJSL 1MAKA 1YC8A 2W59A 5IMKB 4UBDD 5I1EH 3O45B 3UTQB 2FHBA 4NYLB 3L3JB 1PW3A 2BMKB 1M6OB 4JFFE 4LPTA 4NNXB 5FO7A 3S4SG 5D5MF 5D93C 1LP9F 4DEPB 3U2SB 1S9XB 2R0LH 4BELD 1AY1L 3QSKB 1R3KB 2CMRL 3LY6A 4NM8L 2VAAB 5E6ID 3FFCB 4WUUB 1E4WH 1HXYB 5HGAB 2WV3A 3GMMB 4PLKD 5ERWB 1V3JA 3D2UD 5GZOC 4ISVA 3G08B 1ZVSB 1UADC 5IBTH 1XGRB 4URTB 1A7PH 2H41A 3BKML 3B5TA 3JWDH 1MQ8A 2Z35B 1NEZG 2VXUL 1T0PB 5C07E 3TA3C 5HHNB 4JFOA 5CEZH 5EWIH 4I4WB 5I73B 3RKPA 1LO3L 2JIXA 5HVHB 2R39A 3G5ZA 2YKLL 3TBYB 2QSQA 4M7KH 1HOCB 4K7FB 1EHAA 2BC4A 4XCFH 1HHIA 1MJUL 1T1YB 2V5TA 3B2UD 4RMSA 4U3CA 2PR4H 3NIDF 1A6TA 3ILQC 3O6ML 1S9KC 4S1SH 1KJ2L 5DK2A 1MUJA 3TBVB 3IFPB 3MLUH 3FO0L 2AJXH 3UPRB 5E5RB 2X4SA 1AR2A 2QQNH 5FDYA 4TTGA 4HH9A 3MUY1 2NCMA 2D7PA 1XCTB 2J6EH 4OGXL 4OF8A 1WCBA 3E3QA 1ROWA 1VKXB 3KPQA 3EOAA 5A2JH 3TBWA 3L5XL 4BKLA 4FZEL 3DUHA 2YN3A 2LAAA 4E0RA 2CR6A 1JGDA 1QFWM 1B0GA 3ARRA 3TBTB 1KIQB 3IB4A 1CQKA 1N5AA 3OTTA 3QIBD 1TZHB 2EECA 3V6FB 5DJ0B 4OZFA 3M8OL 4PR5A 4CDHA 4YR6A 5IFJB 4LPYA 2JCCE 4P3DB 1NGZB 1OSZB 2VLME 4MLSA 4X8XA 4ZFFB 4JRXA 4D9RE 2A6IA 3KYKH 2VISB 3C5SA 2VXQL 3KS0J 3VI4F 3DMMD 4ZAKC 3GJFA 3MUGA 4ZXBD 4APQD 1UACH 3UJJL 1KPRB 1MWAL 5EIIB 2B20A 4NCC2 2BSRA 2WK2A 4D0CA 1LGVA 4XPTL 1KB9J 1WC7A 4P2RD 2ZUYA 3FOMB 3QWOB 2NY2C 2F5AL 1OM3L 3F6IA 4I3SH 3QXVA 2PUQT 2AABH 1H3UA 5FK9A 4FFEX 4P5MB 4PJFE 3MNVA 4MA1B 3OKDA 2QR0B 1AXSB 1EGJA 3MV8B 2IG2H 1FFPB 4ORGB 4N0CC 3P73B 3FMGL 1NANI 1YQVH 2Z91B 4QHLB 3SDDB 3BRDA 3LKRA 3IJSB 1CG9A 1OF2A 4V1DD 2BVPB 4O02L 1WBYA 2NY5H 4OF6A 4S1DD 5D1XA 4GS7C 3MSPA 5CUSH 5IHUH 1VHPA 1U9KA 4OZIA 1ORQA 4FHBD 4XRCB 1G7JA 1NGXA 1N7MH 3TWCL 1T2QL 4PJIE 1QO3B 1L7TL 4RX4A 2F54D 4XPHL 3MA9H 1EEQA 1NQBA 2FX9H 3JTSB 1TETL 3DRQA 5J3HC 3C5ZD 1XCQB 1MHHA 5DJ8B 4LCUB 3IFOA 1MREH 4PRID 2KBGA 3IU3B 4ODSL 1AQKL 4I0KA 1RK1B 3SKOA 4S1QL 4GSDH 1RAMA 1MJ8H 3L6FB 3F8UB 4QY8B 4UIMA 4CVUA 3OXSB 4X83A 4Y7MA 5A2LH 1WIOA 5GS1C 1RUAL 2X9YA 2YZ1A 1ORSB 4ODHL 2R9HD 5EA0H 1G9MH 5L2KE 5E2JA 4CVWA 2P5WD 4OD1H 1Q0YL 1R3IL 3GHBL 2OBGA 2AP2A 1Q0XH 5HGHB 3ZHKA 3MFGB 1QZ1A 4ODVH 3SBWC 4XVJH 3DTXB 3UTTD 4XAKD 5KSBF 1TZIB 5F6HI 3FQXA 3DLQR 3IU4H 5F7EL 1I8MB 4F33A 1U3HC 4NP4H 3SKNA 3LV3A 3WBDA 2Q6WB 4IHOA 4JCLA 1G7PB 2DQTL 4HV8A 4MDIA 5GZNC 2Z8VC 1ZOXA 2VLLA 2V2TA 1OOAA 1PLGL 5EORL 1UYWL 2PCPA 4MXQC 3G6AA 3MLZL 4NNYA 2Q7YB 2CDFB 4HWZB 3MA7B 2G5BA 3OL2A 4LHUG 3VFMA 2NY0D 3K0WA 2FECI 5D70L 1NGPL 3GSOB 1N2RB 2WSKA 3IETB 4KMTH 2BDNL 2X41A 1FVDA 1JPSL 4JZNA 1OW0C 2DQFA 4M62H 4YXHL 1KJ2A 1VFBB 2H8PB 3HG1E 4ZSOB 4L5FL 5F1NB 4QRRA 1BPVA 4LKXA 3RVVC 2IALB 4R7NA 3UROR 1K4CB 1PKQB 1BOYA 5TF0A 3FQWA 1NFDA 3MRNB 3GSNL 1JPTL 4Z7QF 5M95B 3KYOB 2IADB 2NTFA 1ZLWH 4EIGB 2WUCL 1AP2A 4K8RH 4QEGA 2DQDL 2I9LB 5LQBL 3MBEC 3M17B 4LSRH 4PRPD 3RY5A 5CCKH 4RGNB 5M7QA 1NAKH 1ONQA 4FQCL 15C8H 5FO7B 4ZTPL 2VL4A 5FYJH 7FABH 1AXIB 1F90H 3E6HA 3PWPE 3RGHA 1OTTC 5CJ5A 3SY0A 2BRRH 3WNNA 4HAFA 4JGMA 4JANA 4LU5L 4ISVB 4L3ED 3T2NH 3THMH 3QXAA 2W9DL 1MWAA 1DDHA 3QUMH 2GW5A 3PXHA 5F88A 1D5BA 3BP7A 4OGYL 3S34H 2NW2A 4ZXBB 2CR3A 3VE0B 3SE9H 3A67L 2DJSA 1GGYA 2EDQA 1INEH 4JFOB 4CDGC 4KTEL 2R29L 3QWRA 2Y9RT 2DMKA 3WNMA 2JIXB 3GRWL 1F8TL 5JW4M 4EQ3A 2JJUA 4G9FA 3G5ZB 2OZ4H 4KKAD 4PJ9A 4ZNCD 1C16A 1BJ1J 5I1HH 4R6UA 1QEWA 4JZJA 2BC4B 3H7LA 4QRRD 4I0PC 3VG0L 1HHIB 3C09B 1U3YA 1U8NA 4IMKA 4PUBH 3VD3A 1W8NA 3P11L 3L3DA 5D7LA 1A6TB 3GBNH 3MLRL 4Y2DA 5DK2B 1MUJB 1MCIA 4TVPE 4AK1A 4L4TD 2CJUH 2X4SB 4OLUL 4BQBA 4NM4L 4WTZA 1MFCH 3S5LG 4HH9B 4BZ2L 1E0OB 3UDWC 1WCBB 3KPQB 3EOAB 1B4RA 3TBWB 4BKLB 5C0RL 2UZXB 3LQAH 5GRYA 1KB9K 4O51A 3OKOA 2F54B 3OQ3B 4WGVB 1JGDB 1B0GB 3U7YL 5HVWA 4M9OA 2D03H 1N5AB 1GHFH 4MHHI 4OZFB 4PR5B 4YR6B 1T20A 5KTEL 3T0WA 3L3GA 1I85C 1MH5A 3T1WA 1QBML 4JRXB 2VLKE 2A6IB 4UV4H 3WJJC 3C5SB 3QDJA 4TPRH 1CLOL 1D3CA 2BXZA 3GJFB 3MUGB 4HPYH 4KZDL 2X70A 3NFNA 4PJDA 4CU8A 2L0DA 2FZ3A 2DLFL 2BSRB 4D0CB 3VRLF 2LQRA 1AJ7H 2JJSC 1WC7B 1FCCA 2UWEF 2AJUH 5I30H 3FN3A 3BI9X 5FK9B 2GY5A 3LEVH 3MLXH 3TA3A 3MNVB 3OKDB 4P49A 1FLRL 4I13B 2YD6A 4OFDA 1I8KA 5D7LD 3ULUE 3C87A 4JDVA 2YRLA 4F9LC 5IVXA 3PE9A 3KG5A 5DUML 3LKRB 4NGHH 1CG9B 1OF2B 4C56A 1WBYB 3S98A 1FGVH 3RVWD 5D1XB 2DQJH 2XNAB 3ARGD 3QCTL 3W0WA 1ZANH 1URLA 3BIKA 1CVRA 4P5KA 3ZMRA 4M93C 4OZIB 1ORQB 3BE1H 5DDHA 1NGXB 4RMTA 1QRKA 4C83A 5F96L 3LAFA 3NPSB 2FEDD 3WIFA 2FH6A 3DRQB 4XNYL 1MHHB 1T22A 1VDGA 2IH3A 4OV6F 5E1AA 3PGCA 1C5BH 3IFOB 1RHHA 3W82A 2BNRE 3MV01 4TTDD 2QSCH 3SKOB 1P84K 5L7XH 2IBBA 3GSNA 4UIMB 4JFDE 3KR3H 1KJ3L 3VDBA 4XPGL 4YBQC 1YEJL 3OG4B 3O6LH 3W39A 3WDJA 4DW2H 3TZVA 5HHPA 4ZAKA 5EFIA 3T1FA 3O2VL 4FNLH 4G42A 1E4XI 4U6VH 5F71A 1A5FH 1U8JA 3LCYA 5D6DC 1KCGC 2Y25A 3SGDH 4BQ9A 3NCBB 1CLZH 3FQXB 5C70A 1YC7A 2IEPA 1NCAL 3LD8C 4KUCD 4WI8A 4F33B 3SKNB 1YYMH 2ITDA 1SYVA 3LV3B 1BD2A 4KJWC 2P1YA 2BNQD 4IHOB 4NN7B 4PJXA 3ZKXC 4U49A 4HV8B 4MDIB 4JN1L 4KVCL 2OLDA 2GJZA 2VLLB 4PJBA 4FOMA 4LSVH 2GI7A 2DICA 4LQFL 2V2TB 4N0CA 3GRWA 4PP1D 3BFOA 4NNYB 3G6AB 2G5BB 3QDAA 5FOBB 3VFMB 1NL0L 4HKXA 4WUKH 6FABL 2W0KA 1ODAA 5TE7L 5FUOH 5TJWK 4KK9D 3H9HA 1FVDB 2H6PA 1I9IH 2XT1B 1T0MA 2VDMH 4JZNB 1G6RH 2DQFB 3PV7A 1KJ2B 3TCXA 3S88H 3ZL4L 1EHLH 1LILA 1WFTA 4N0UA 4R7DA 4QRRB 4LKXB 4R7NB 1HNGA 1A7NL 1TIUA 1ACZA 3BT2H 3FQWB 1NFDB 4J12A 4FXLA 3HZVA 4GBXA 3FONA 2NTFB 2MQ0A 1RMFL 2O26U 1AP2B 2Y07L 4XCEB 3TZVD 5I76A 1BQHA 1QSVA 4U1MA 3G6JE 3IFLH 2JB6A 3AB0B 1FAKT 4XC3L 3UYRL 5HYIA 1MLCA 1B6UA 1CQYA 1ONQB 5ALBH 2PKDA 4KY1L 2X09A 3MCLL 1P4IL 4JFEE 5KVEL 2EIEA 2ERJC 3E6HB 5DT1L 3TO4D 3K46A 4OCWH 3ARPA 4G8FA 4YDVA 1HINL 1JHTA 1JZ2A 3SBWA 1BD2D 2CK2A 4HXAL 3SY0B 3GB7A 1AGCA 4JANB 3QISA 1MAJA 4DGVL 4H1LA 3QXAB 5BZDA 1MWAB 1DDHB 4X4ZA 4MQXC 5DJAA 5F88B 1D5BB 3BP7B 2ZUUA 2Q8BL 4CU6A 4TUOA 2NW2B 3QCVL 4QHNA 1P7QA 1DP0A 1MRCL 5T5NF 4N9GA 5CZXD 3MRHA 2W92A 1MCNA 3U4BH 5L0QC 3GIZL 2FX8H 3A0OA 1QNZL 4G9FB 5F6HJ 5DURD 3HFML 4YQXH 4XHJD 2H2PC 5F7UA 1J1XL 5FFLA 4MXQA 4PJ9B 5GRWA 4RRPA 1C16B 1QEWB 2YSSA 4JZJB 4X7CC 1MI5E 5I1IL 3S9DB 1NKRA 1U8NB 4HZAA 4Z7OE 1VA9A 3L3DB 4H0HB 5D7LB 2X5PA 4Y2DB 4WI6A 1FNGA 4HWBL 3KJ6L 4LHUD 3HRPA 4BUHA 5HYJE 1IQWL 3CFEA 1YY8A 3ULVD 2VZSA 1B88A 4UIKL 2LTQC 5JDJA 1B4JH 3O8XD 3MXVL 5H37G 2CLZB 3DXAA 1AO7A 4AEIH 3OF6A 4OD3L 5LG1A 1OGTA 3ZKSD 4Z0XA 4O51B 1S7QA 4NO5A 3OKOB 4KQ4L 4YHKL 3CXDH 5F9JA 4QLRA 4F57H 4R90L 3S36H 2ARJQ 4NDMA 3Q3GA 4HK3N 1GC1C 1PZUB 1T20B 2A6JA 4WV1A 2BY2A 2W65A 3L3GB 4LCWA 1MH5B 4TSBL 4I18A 2EDNA 4LSDA 4ONGH 1J5OL 2R69H 2AJZA 5DZOA 4M7LL 3QDJB 5L9DL 4KRNA 3U0WH 2X70B 3NFNB 1RV6X 3ZHLA 5JXAH 1JWSA 4JM4H 4OSUH 4PJDB 4LSPL 2RCSL 1O7VA 2PETA 1A9BA 2FZ3B 3QNXB 4J3TA 2BOBA 3Q1SH 2DI7A 4ZFZA 3T0EE 4N0YH 3HZYA 4JREB 3D85D 3RP1A 2NY3D 1OLZA 4Z0BH 2ZOLA 4KKLC 3QPQC 3TA3B 4PG9A 3I3EA 4G6AC 1I8KB 1S7XA 3CAFA 5ANME 4JDVB 3UTZA 2H45A 4MAYD 4XPFL 5IVXB 5CBAA 4C56B 1RZKL 1XGYL 1PDKA 3W0WB 3BIKB 3KLSA 4P5KB 5DDHB 5TF1H 1QSED 3BD5A 1U91B 4UDTA 4CJ0A 1JZ4A 4C83B 5ICXA 1HZHL 1AIFA 3SKMA 5H94A 5TE6H 3U7WL 1T22B 1KBGL 2IH3B 5E1AB 1OB1A 3PGCB 3I2CH 1RHHB 2NY4B 3TV3L 1ZSDA 5FM5O 4JFFA 5TE4H 1F00I 1BGXL 3V7AG 3S37X 2XI9A 3ZDZF 5F7NC 3MRPA 4IDJL 3GSNB 1YEGH 2NY1C 3MX0A 3QYCA 5DQDH 5I9QC 1EPFA 1KJVA 5HJ3A 1I85A 3C2AL 4M7JH 2HLAA 2FIKA 3W39B 3P30H 3TZVB 5HHPB 4OLYH 3BKJL 4ZAKB 5EFIB 4G42B 5DVMA 3TYGL 2E27L 2G60H 1KIUA 3PJSA 1NBYA 4NN5B 5C07A 1MHPL 4RWHA 2VSDA 3FRUA 1A7QL 5KVFL 3F7QA 3MV9A 2VKXA 2NY2B 3ULUC 3VG9C 2ITDB 1SYVB 3K8MA 3O2WH 1BD2B 3BN9C 2ZUXA 2VXSL 4PJXB 5H8DA 1WWCA 4XWOC 1F3DH 4CGTA 2GJZB 4PJBB 4ZUSA 2NXYB 1XGUA 2Q76A 3HC3L 2FECL 4OGZA 1OAQL 3QDHA 3BZ4A 1J88A 3ARYA 4HKXB 3QDGE 2V2WA 4GRWB 2NY7H 3RZCA 2AXGA 2X6MA 3IKKA 3ARWA 4NZJA 3TT1H 2YXMA 3QUXD 1J87A 4B41A 3H9HB 2H6PB 1HHHA 1P5VA 3MACL 1T0MB 4XVTH 5CEZE 1IFHL 1N8ZA 2X7LA 4HWBA 4S1RH 2Q8AH 4N0UB 2EYTA 3FB8A 4R7DB 4CMHB 2N7BA 2EIDA 4PIRF 4M1GL 4U1GC 2JCCA 4POZC 3QJHA 1SY6L 1QFHA 4Y2OA 3HZVB 1EJOL 1OAKL 4GBXB 3FONB 1N6QL 3HB3C 3T2PA 5I76B 4MS8A 1BQHB 1GC1L 3UC0H 2VQTA 4PP2A 4U1MB 2J8UB 4EOWL 3C6LA 1F4XL 2JB6B 2P47B 3PHSA 5ADOH 1MLCB 5BCAA 4LCIH 5F7WC 5HBBA 1JTTA 4Q7DA 3ZE0E 2YPLD 3ZHDA 4BQ8A 4PJCE 4HIXL 4G3YH 1FV1A 3DECA 4OLWH 3MV9D 5KW9L 1YEHL 2MJWA 2V5SA 1JNLH 4YE4L 4YDVB 1W2KT 3VCLA 1JHTB 1AGCB 1HSBA 4C58B 1DL7H 3MODL 1B90A 4H1LB 4PJFA 4FABL 1U8IA 5BZDB 3L5JA 5D7IF 1QFPA 3C60C 4BZYA 5DJAB 2R0ZH 2VH5H 4TUOB 3IVKB 6CGTA 5SX5K 1NBZA 4QHNB 1P7QB 5F44A 3WNKA 4N9GB 4F15B 4KVNH 3MRHB 3RZCD 3MYZA 4MMZC 4WO4A 5F8RC 4WI2A 4TVPL 1QHPA 4M9PA 4XP1H 3T04D 2XKNA 3I3BA 4NCDA 5JOPD 4PJIA 2F19L 4J4PD 1M7IA 5FYLH 1IC7H 5FCUL 2YSSB 3DPBA 3VD5A 1NGQL 3U4EA 4K3JL 3IAPA 1SBSL 1Q8MA 5L8KB 1I8LA 1CGTA 1BVZA 2APVA 3HAEG 4M43H 1FNGB 4X7DC 5B8CA 4HFWA 3CXHK 4PJEE 3CFEB 1YY8B 2D7OA 2DLTA 4JLRA 5JHDD 3TFKD 2F15A 5C2BL 3WFDL 1WAAF 5CJBA 1V7NL 3C6LD 3DXAB 2I25N 1AO7B 3B2VH 4HCRH 4X6EA 1V7MH 1OGTB 5I74B 2J88L 1BWMA 3CPLA 4Z0XB 5GJTL 5HHXH 1S7QB 4NO5B 3F58L 5IJVA 2LU7A 5L2KA 4G6FD 4XH2A 5F9JB 3HR6A 4Y4FA 1D5ZA 2C7UA 3WLBA 4NDMB 3Q3GB 2DJUA 2W9EL 3U1SH 4WV1B 2A6JB 4HF5H 5IB4A 2W65B 3BH9A 3HC0A 3BX7C 4LCWB 3GUTA 2CDGA 4I18B 2ZNWA 4OJFL 2AJZB 4E41E 5IHZA 1KLFA 5MEPA 3FT3A 1HSAA 4AMKH 5SWSE 1DQJA 4PDCE 3GSQA 4HAGA 32C2A 4CJ1A 1I3UA 1JWSB 4JFHE 1ZLUH 1IBGL 4WTXA 1CXFA 2OR7A 5E8DH 2XTJE 1QBAA 4U1HA 1A9BB 2BOBB 4TSCH 5EDXA 5IVXF 3ULUL 3IDXH 4M02A 3WFBL 1A6AA 4WCYL 5J12B 3HZYB 5IBLD 2D7TL 2XKUA 4OLXH 5TQ0L 2ZOLB 4HC1H 4UT7L 3O6KH 4BQ6A 4PG9B 5DWUL 4QRPD 1KN2L 1G7HA 1GOHA 4F8TA 3BZFA 2JELL 2QL1A 1PVHA 1S7XB 3UTZB 5TGBA 1FP5A 3SDAC 1D6VL 1FIEA 3HG1A 3V5HA 1DUZA 5CBAB 5ITBH 4PRHE 2HH0H 2QEJA 3OKEA 5IOPA 4Z78A 2IAMA 4KZEH 5I15H 4UDTB 1U8HA 2VWEE 3PDDA 5ICXB 1AIFB 1XGPA 2OP4L 3SKMB 4O5LL 3H42L 4G8GE 4Y4FD 5H94B 4HX1A 4H26A 1OB1B 5EU3A 1QFOA 4MNQE 5D1ZC 1ZSDB 4JFFB 3EO1A 5SWZE 3DV4A 1SY6A 2VDQL 4AJ0A 3MRPB 1JMZA 3NCJH 4X9IA 3PWPA 4KTDL 4XWGL 3VRIA 4ZPTA 3S3PA 5C0JB 1NCDL 4Z95H 1A14L 3REWA 4JJHA 3S35H 3VD9A 5KSAD 3KHOA 1KJVB 5HJ3B 5DRZA 2R4RH 5DQ9A 2HLAB 2FIKB 4NKIL 4KDWA 5L8LB 4QNPF 2WWMC 3SE8H 1E4XL 3M07A 2YBRA 2CRYA 3STZA 2A9NL 1I1AC 3ARFD 3T0EC 4XCCH 5C6TL 3FN0H 2EDOA 2DQEL 3PJSB 4X9HA 1NBYB 1F58H 4J3WA 3GKWL 4P9HH 5C0BE 5DXWA 3S37L 5C07B 5HDOA 4UNUA 4Y4KD 4GXVH 4K3EH 3PWUA 1PG7H 3FRUB 4G6MH 3MV9B 3CFJA 1JN6A 2DTML 3F7RA 5GGSA 5FYJE 3O9WD 5E94A 3ZE1F 4QXGH 5C8JA 3ZKMD 4HBCL 5CEXA 3G5XA 3ARBC 3HZKA 3CFIC 4D9QD 4ZUSB 1XGUB 3EJYD 2Q76B 3NIGE 2IAMD 2Z8SA 4OIAA 4HWUA 3X17A 3MRKA 1RY7B 2XACC 1ZEAH 3BZ4B 5GGVH 2J8OA 5GGVY 4P46C 3NIFE 3TH2T 1JGLH 5FF6A 1AKJA 2V2WB 3RZCB 2AXGB 5FHAH 5FKAA 3ULVF 3B4NA 2BFVH 1JNHA 2CK0H 1E6OL 1QVOA 1WTGT 1HHHB 1RD6A 4F7PA 2J8UF 5BQ7A 5J7CC 4DOHE 1N8ZB 3T09A 2RB8A 4WRLA 4W6XB 2X7LB 1S3KL 1HHGA 2EYTB 3FB8B 4FQ1L 2F8VA 4JG1H 3QXWA 3WJLA 3TO2A 3W2DL 2JCCB 5MEOA 1ULVA 1YQ2A 3QJHB 2ESVE 3BGAA 1BBDL 2DYPA 2W38A 2VLKA 1ZHKA 2HRPH 4JPVH 4NC0B 4I9WE 4FG6C 4KPHH 3VFWA 3ZKND 3V9FA 3MGTA 5F9WB 2W0LA 4PP2B 2AI0L 4X8JA 3C6LB 2EH7H 1ZGLP 4CL7A 1V8HA 5EBGA 3V5KA 2R2CA 3DIFA 1FLTX 2DI9A 1PEZA 4WENB 3A6BH 1DCLA 5BV7C 1CFVL 5C08E 1F3RB 3D48R 3LPWA 1FV1B 1Z3GH 3ZSTA 2A2QT 5IFAL 3S6CA 3VCLB 4U0QB 4O58H 1YNKL 2V17H 1EK3A 1QD0A 2VLJD 3WUWG 3K7UA 5KVMC 1HSBB 3O3AA 5MENE 2IAND 1FPTL 1SJEA 4K3DL 4PJFB 4Q6YA 3V0WH 3NACL 5I6XC 1U8IB 2UZYB 3IDJA 4LGPB 4UTAH 3ROLA 4DUXA 3QFJA 4P57A 5GISL 4R4FL 1NBZB 1MCOL 2ZOKA 4FS0A 2AAVA 1QQDA 1VACA 4Y19D 1RJCA 3ZKXB 4GG8A 4HT1L 2IBZX 1T0NA 3LPGA 4WO4B 1HWGB 5I75B 2AJVH 3OZ9L 1QBLH 2XKNB 5E1HB 1FNSL 3CZJA 4PJIB 1ZLVH 4R8WL 1M7IB 1FIGL 3EYVA 4PB9H 4PV8A 3KPSE 2HJLA 4RDQG 2Z93A 1DZBA 2DM7A 3LS5H 3PHQA 4D9LL 2O5YH 5B8CB 4OCRH 1FH5H 1RUPL 4F37F 4HFWB 1FAIH 3OSKA 5T1LD 4JLRB 1IKNC 1NUNB 5E4IA 4KXZH 2IBZY 2AV1A 2W0FA 2D2OA 4JFDA 3RL2A 4X6EB 4GT7A 3CPLB 2A0LD 1L7IH 5IJVB 5L2KB 1PSKL 5E2VH 4XH2B 5DGRA 1WFUA 3ARUA 4Y4FB 2FEEI 1FE8L 2IFGA 1D5ZB 2C7UB 4L3CA 2B5IC 3WLBB 5KJRH 2QHRL 3BWAA 3UTOA 3MPCA 4M61A 1PX3A 2AK4E 2EIZA 1SMAA 3H3KA 3HC4L 4UNTA 4L3AA 3BH9B 3HC0B 3GUTB 2CDGB 3VFTA 4I77H 4NWUL 4YHLH 3WV0A 5I1KL 4FFVC 5IHZB 1G1YA 1JGVL 2CLVA 2BVUA 1UA6L 2ICES 1AGBA 3FT3B 5MEPB 4XNQA 1HSAB 4XP4L 1DQJB 3GSQB 32C2B 3GMPA 3QFJD 1YEIL 3Q5TA 4JE4B 4NC1C 4G6JH 1CGUA 1CF8L 1KEGH 3I6GA 3VU2A 4XB8A 2R23A 2DQIL 5GIRA 4U1HB 3UPCA 3LVEA 3DSNA 4Z7NE 1UVQA 5DMKA 1IAOA 1MELA 2AGJL 3C60A 4W4OC 1FL3A 5D8JH 4KI5D 1A6AB 2X1PA 2XWJA 5DEFA 5E9DA 4NZTL 4RGOH 5KSVA 1MQKH 3ZTJG 4X7SH 3E8UL 3PNWA 3VXOA 2WW8A 5GGUA 1F6LL 2VDKL 4N0FA 4PGDA 3RDTD 4LLAA 1G7HB 2ADFH 3P3YA 3MJGX 2FBJH 5AWNH 3BZFB 5L0QB 1I7RA 1GGIL 5TGBB 3HG1B 3Q0HA 3V5HB 2IPUK 4EVNA 1DUZB 1BOGA 4S11A 5T1KD 3OKEB 2K3TA 4JFDD 5IOPB 3SCMC 2IAMB 2K1MA 4Z78B 5L88L 1DUYA 4EZMA 1U8HB 4OBSA 3VXPA 3HUJB 3MJ8A 1XGPB 1I4FA 2XWTA 4NOFA 1LO2L 5A1AA 2VZ1A 2YZ8A 2EDJA 4U1SA 3U9PL 1PD6A 2D7NA 4HX1B 2C3VA 2R0WL 3G6JA 4H26B 2YD1A 5EU3B 1MFAL 2WLYA 3MO1A 4PLOB 5DRXA 2J3SA 3EO1B 4P23C 1E6JL 3DV4B 1N5YL 4JFEA 2VQ1A 3PWPB 3VRIB 1I1FB 4ZPTB 1QSFD 1VGEL 1INDH 3REWB 1BJ8A 5JA9A 5BV7L 4XI5D 2NX5E 5DRZB 5I1EL 1H3XA 1ACYH 3NCYS 1YEKH 4PJAE 2YBRB 3STZB 5MHSD 1EEYA 1GGCH 4P2QE 1G7MA 1G9MC 4DN4H 1KPVB 2R0LL 3U79A 2YA0A 5E9DD 1FO0L 2HTLD 3RHWF 5KN5A 5B3JE 5BOPA 4F58H 3QDMD 2NXZD 5JLZA 5GRXG 2ICCA 4J3UA 4O4YH 4F3FA 3PWUB 1A64A 1AFVL 3CFJB 1JN6B 1RFDH 3PL6D 3CZFA 1Q38A 2DM2A 5E2UH 1A7PL 4TN9A 5GGSB 1FORH 2D0HA 4D0DA 5E94B 2YUXA 4JHAH 2IANB 4LVOC 5C8JB 1MI5A 1LHZA 4LKCA 3G5XB 3HZKB 4QRUA 5CEZL 5EWIL 3QNZA 2LVCA 4MQ7A 2I9TA 4KH2A 1KIRA 4LCCC 2VWEC 3MRKB 5HYJA 1XF1A 3SDAA 5D5ME 2WWKT 1LP9E 3VXRD 5FF6B 1AKJB 1NUDA 5CSBA 5E8NA 1F97A 4L8DA 4HUXA 1JNHB 1QVOB 2NY6B 4AG4L 3H9SD 2PR4L 3GBMH 1WJ3A 4F7PB 5BQ7B 1UJ3A 3V4VH 4U3XA 4DWHA 1WCQA 2OJZH 2AJXL 2N4IA 2ZG1A 4BK5A 4IRSC 5DJ6A 1HHGB 2NMSA 2QQNL 4Z7WE 3RGVC 5IT2H 4U1LB 3D1MC 3TO2B 3WCYA 5CIPH 2EXWC 2APXA 2FATL 1RIHH 4XVSH 5MEOB 4NKQB 1HHKA 4HXBL 2DYPB 5D1ZA 3EDEA 3PABA 2VLKB 1ZHKB 4D0BA 4KJQD 4ZOBA 3TVMD 3VFWB 5CILL 3MGTB 4ERSH 1WZLA 1FQ9C 3BD4A 3IDNA 4X8JB 4PJFF 3CJJA 3QUYC 1I9RL 1W72H 3K74B 4LPXA 3V5KB 3DIFB 3IF1A 1KLGB 1JF1A 4CU7A 1KELH 1NCCH 4ENEC 1DE4A 2XA3A 2YWYA 4K7PX 3KYKL 4NZRH 2CRIA 1H15A 2Y06H 5DFVD 3O3AB 2ORBH 3BXNA 1SJEB 1BX2A 3IDJB 4JDZA 4P2OC 5T3XE 4JVUA 2MCPH 1P5UA 5DK0A 3ROLB 5GRJH 3QFJB 4P57B 5ANMA 2ZOKB 3R4DA 3LKOA 4I1NB 4I3SL 3GI9H 1OP5H 3U0TA 2AABL 4M48H 1QQDB 1VACB 2X2YA 2AJYH 1TPXC 4FQXD 4K7PY 1L0QA 4XBEH 4GG8B 3DUUA 1T0NB 2EKSA 5ISZE 2NW3A 5J89A 4K2UH 4X6BA 4Q9QH 1XIWA 3KPRE 2IG2L 1VGKA 1EHNA 2NZIA 3EYVB 1T1WA 1EMTL 3GSVA 2WNGA 4PV8B 4NIKB 2HJLB 2Z93B 1WITA 4XTRC 3PHQB 4YBLC 2NY5L 1MCPL 4IIQA 5CUSL 5IHUL 5SV3A 4PBWD 5HYEA 3SDXF 2AV1B 2W0FB 4XC1H 3BH8A 4JFDB 3QIWD 3ELAT 4YPGA 3DX9A 1FYTA 2JLLA 1UT9A 4NO0A 1T6VN 3Q48A 1F3JA 4H88H 4GSDL 1UEYA 4L3CB 3GSRA 1SBBA 3BWAB 4M61B 2EIZB 1UXSA 1CD9B 1CTOA 4DKEH 1YMMD 3VFTB 1U3ZA 1Z9SA 5AZEH 3H3BC 2D0FA 5IIEA 2CLVB 4WFGE 1FC1A 4UV7H 1G9ML 1AGBB 5EA0L 4XNQB 1EAPA 1NBVL 2VUYA 3O41A 2OSLA 3VD4A 3GMPB 4HUKB 3ZT6A 1Q0XL 4ODVL 1TITA 1VFAA 2EZ0D 1FZOB 3OJMB 3I6GB 1XT5A 4X9BA 1IC5L 2R23B 3CLFH 1FNLA 5GIRB 1FO0A 3KJ4C 1UVQB 5DMKB 5I0ZA 1IAOB 1CU4H 3IU4L 3C60B 5C6PB 1FL3B 1XIWD 43CAA 4N68A 2XWJB 5DEFB 5E9DB 3O4LE 5KSVB 2X9XA 4NP4L 1S7TA 4CADA 2DWEA 2DIJA 3PNWB 3VXOB 4GXUM 5GGUB 1UFUA 3QDGA 4N0FB 3SOBH 1CTNA 3HUJF 4PGDB 5CJQH 5TQ2H 1DJSA 4L9DA 1YEFL 3AUVA 1I7RB 4OFYA 2EDXA 3H0TA 2IWGA 1BEYL 4M6OH 1INQA 1EEUA 3F6LA 4EVNB 1BOGB 1V3MA 1MFBH 1J8KA 3IDUA 4OLVH 1N6VA 5DEZA 5J11B 4JAMA 3ME0A 4P2YA 4KMTL 5KSBE 1DUYB 3G9AB 1JJUA 3VXPB 1FYTD 3MJ8B 5T3ZD 1CDHA 1I4FB 2UZIH 2XWTB 3BPNC 1Z0MA 4M62L 3P9WB 3PGFH 2C3VB 2BX5A 3EW3B 3RIAK 4J23A 4MJID 1WT5A 1CGSH 3MO1B 4N9OB 2J6EA 5DRXB 4KROC 3PG2A 1MRFL 5JTWA 2CXGA 2VERN 3V52H 4XX1G 1KXQE 3TBSA 3O6FD 4JFEB 2VQ1B 1J1OL 2WQRA 3DURA 4CNIA 1NMAH 1CI5A 1DBBH 1EO8L 1NAKL 5IW6A 1BREA 15C8L 2YHGA 4GG6F 3MJ9H 4LEXL 1EEYB 2WBKA 5FYJL 1G7MB 7FABL 1F90L 2W0PA 4OM1L 5D1QC 3UZQA 4XPBH 5HD8C 3TGXA 5KN5B 4CN1A 2BRRL 2EXYD 5JLZB 1UB6A 3QEHA 1MCWW 4R2GD 5FECA 3OAZH 2WQ8A 3PDOA 3T2NL 3THML 4W4OA 3CZFB 3CMOH 1H3PH 3S34L 4D0DB 4Z7QE 1ZA3A 3FFCE 3SE9L 5J4MA 1MI5B 2QQLH 4LKCB 1INEL 4QRUB 3R06A 1CK0L 3QNZB 4MQ7B 2FBOJ 2I9TB 3MLYL 1KIRB 3WO4C 4KHXH 5HYJB 2OZ4L 4PJEA 3SDAB 1J8HA 1LK3L 4ELME 3KYAA 5DMJB 3T2QA 5E8NB 3QNYB 4L8DB 4O2EA 3VGAB 4HUXB 1ADQH 3OKYA 1AHWC 5JW4N 5HTSA 5KSUA 3AXLA 4PUBL 2C3HA 3SCMA 3GBNL 1UJ3B 2Q86A 3T0VA 2X4QA 3MOAL 2CJUL 3WNOA 2R1WB 5DJ6B 4L4VE 1MFCL 1U3JA 3R0NA 2GUOA 1A3LH 3D39E 5FYLE 4MJ4A 4PYGA 2F58H 3DO3A 2ADGA 3PXJA 3ULVH 1BQUA 1FN4A 1RUQH 5D1ZB 3MLWH 3PABB 4D0BB 1EFXD 3LQAL 1GPOL 4P23A 4E41A 4WI4A 1S5HA 5D6CA 4ZD3H 5DHXB 5SWSA 2D03L 3IDNB 1GHFL 4WEBH 3V5DA 4OCMC 5BJTA 4AQOA 4ODBD 1JF1B 4QTIL 2RR3A 2DL9A 1KSRA 5IGXH 3UTPD 3R1GL 4OIBA 3QA3A 1DE4B 4PREA 1TTGA 3EKCA 4UINL 4G7YL 4UV4L 4LIQH 4TPRL 2YD5A 3OB0K 1H15B 1P4LA 1TQBB 1JHLL 1L8JA 4OCYH 2DQUH 4KI5F 1U3HD 2C5DC 4N1HB 3BXNB 4O9HH 1BX2B 4JDZB 1Y18A 2X9WA 3G5VA 2DF3A 5DK0B 3H6JA 4OI8A 2B1AH 3S96A 5ANMB 2AJUL 3LKOB 3U0TB 4NQCE 4MSWA 1J8HD 3OPZH 1C5DA 1WF5A 3MLXL 4PRHA 4ZS6C 3DUUB 3MUZ1 1ZHLA 2EKSB 2NW3B 1V5JA 3BQUC 3B5GA 4RFNC 1XIWB 3FZUD 3WUWB 2HFTA 1VGKB 4JG0L 2RHEA 4HMDA 1OVZA 1T1WB 3GSVB 1ZHNA 4G8GA 5EOQH 1ZS8A 3EYUH 4HJJH 3TJHD 5EBWA 1FGVL 2DQJL 4IIQB 3RVVD 1ZANL 4MNQA 4K23H 2D7QA 5SWZA 3KXFD 4X98A 4GQ9L 4Z18A 3ALPA 4IRSA 3AREA 5TFSH 3RFZC 3BH8B 2UWEE 1Z9OA 3DI2B 4K07A 4YPGB 2NR6C 3DX9B 3MBED 1ZHBA 1C5BL 1FYTB 2FEEL 1LQSR 2HJKA 1FRGH 4TULL 3U36A 4EDWL 1F3JB 2QSCL 3VJ6A 3X11A 4YUEL 3GSRB 5L7XL 5CBEA 1A6PA 4CN4A 1DQLH 3OAYH 3KR3L 1DFBH 1UXSB 5JQHC 3P9LA 3V79C 3NAAH 5BV7B 5BS0D 5IIEB 1R3LA 3BPOC 3L3HA 2XIDA 1EAPB 2MSPA 3O41B 5MEQA 1D9KC 3VFSA 1NGWA 2E7CA 4GRLD 5CWSA 3I84A 3UMTA 1A5FL 4Y16C 4JY4A 1DSFL 1FO0B 3K4DA 4MD0A 5I6XB 2J7LA 1CLZL 2E8YA 1HH9A 1RZFL 2FIRT 3SJVE 3BAEH 4PJHE 3VXMD 43CAB 1W0WA 1Z6JT 4CADB 1S7TB 1YYML 1P2CB 2DWEB 3P4MA 3MJ6A 5GS0C 2ENYA 3QDGB 4R2GB 1J0HA 2RQ8A 5K33A 3RX7A 1I7TA 4LSVL 1CGWA 4OI7A 1DLHB 4ESKA 3H0TB 4W70A 3NMEA 1INQB 2FX7H 2OZ4A 3ARED 4JRYD 4WUKL 5KOMC 3WE6A 5E4EC 5EU5A 1RZJH 4RGMC 3F65A 3LZFH 4JAMB 2ESVA 2VDML 4Y89A 3GGWA 3JWOH 3BYYA 4GAGL 5IVNA 3EDJA 5FOJA 5A3IC 1EV2E 1BQLH 4GW4A 2VIRA 2MQ3A 4K8RD 3BT2L 2A9MH 4ZS7H 5KVDH 3JV0A 5C08A 2Y4SA 5I16A 2I26N 1KCRH 2P5ED 2M2DA 3TBSB 3RU8H 1DN0A 5LGHL 3IFLL 3DURB 4CNIB 5FYJD 5MENA 2ZCLH 2HKFL 5IW6B 1P6AB 3SGJA 4HG4J 5IB2A 2R8SH 4OCWL 2PYFA 1S78D 5IV2A 5CZVH 2HT4C 3ARDA 5K93A 5AZ2H 3CFBA 1GYAA 4NJ9H 1UB6B 3QEHB 4N5UA 5C0ND 4OIIH 1S5IH 5FECB 3PDOB 4WNQB 4HEPG 5K59E 1XZ0A 5FYKU 4TNWK 2VXVH 1IRAY 1ZA3B 3JV6A 5B4MC 4CUCA 4IRJD 4C54A 4UZGA 1A0QH 3BP5A 2ED8A 4JQVA 1U42A 3R06B 5D71L 1G6VK 1GOFA 2HTKC 3U4BL 4DVRL 1TJIH 3DVGA 3NH7H 4PJEB 5JZ7C 3TN0C 4YQXL 1J8HB 4EN3C 4XMKH 4H5SA 1HN1A 4Y5XC 2VRAA 4O2EB 3KVQA 2VDOH 4HWNA 4UB0H 5KSUB 1ZTXH 3AXLB 4P2RE 3SCMB 1A21A 3FHQA 2Q86B 2X4QB 2HJFA 1QR1A 1WQVT 1QSZA 2GUOB 1B4JL 4GKZA 2AK4A 3EFDH 3L7EA 2ADGB 1RURH 4AEIL 2G75A 2YUZA 4KXZI 1FN4B 5IJKA 4I2XE 1LEKA 3KGRA 4P23B 4E41B 4D3CL 1S5HB 4YBQD 5D6CB 1CBVL 4OLZH 4V1DE 3CXDL 1BZ9A 5SWSB 4GLRH 4F57L 3C9NA 1QKZH 5DI8A 1OPGH 4TQEH 3S36L 5C0IB 1RULL 3V5DB 4IRZH 5BJTB 5FKPA 5E24E 5DJCA 5T3XL 3QCUH 1CICA 4G7VH 2XTJB 3T0XA 1IGIH 3QA3B 4PREB 2F54E 3IRZA 2FGZA 4DEPC 1KN4H 3SKJH 4GOSA 2YWZA 1P4LB 1H3VA 2CD0A 5JXAL 4PRIE 4JM4L 3FB7A 4PJGF 5BS0B 4OF7A 1Y18B 3NA9L 3N1MC 3G5VB 3CH8A 3Q1SL 4PYHA 3S96B 2OTPA 3LRSA 3RQ3A 5GS0L 3DV6A 1BZQK 4UU9A 4N0YL 4MSWB 1C5DB 4QO1A 1DQML 5IVOA 5MP6H 3S97C 4PRHB 4Z0BL 1ZHLB 4LOUD 5AAWA 2A73A 3O81A 2P5WE 5DJDA 5HVHC 3RKDD 3IGAA 4DGYH 1BFVL 4X9GA 5AEAA 4BYHA 4FN0A 4C57C 1OP9A 3UTTE 4HPOH 4XAKE 1WBZA 1ZHNB 4G8GB 5T1MA 2HKHH 1ZS8B 2YD4A 1CS6A 4RDQF 5EBWB 2DQHH 4HH8A 3KPLA 5AYQA 1U41A 3ECBA 5DF0A 5JQ6H 4RSVA 3O3BA 4MNQB 5TH2A 4G43A 4OLEA 2PYED 4JEGB 5SWZB 4X98B 4HIIA 1OAUH 3EYSH 4IRSB 2VQUA 5GSRA 3AREB 3IS0X 2IQ9L 3CSYA 4QXUH 3LEYH 5TE6L 8CGTA 5HYFA 4P4KA 1MRDH 1ZHBB 4WW1A 3ES6A 3I2CL 2HJKB 2NX5A 5I18L 1CICD 3U36B 5DA0B 3LSOA 1U8KA 4PJAA 3N1PC 5TE4L 1FNEA 1SVZA 3VJ6B 4P2CG 4H8WC 3X11B 4P2QA 5CBEB 1YEGL 4XPAH 2DKSA 4WWKA 5D72H 3V7MA 2EC9U 5H37H 4ALAH 1VESA 5DQDL 5F9OH 5IESH 4FMFA 3P9LB 1G7QA 3TH3T 3TYFA 2FHFA 3WL9A 1S7VB 1R3LB 4M7JL 3L3HB 2DJ4A 3P30L 4DUWA 2PO6D 4OLYL 3FT4A 5MEQB 3HI5H 1NGWB 3VFSB 4FQ2H 1K5NA 5BW7C 5ETUA 3W5NA 3CIQA 4UTBL 4AL8H 25C8H 2G60L 5CWSB 4JY4B 4LAQH 3LN5A 4MD0B 3MBXH 1HH9B 1IAIH 1HYSD 2D31A 4PRPE 1W0WB 1J10A 5HHMD 1MAML 4X4ME 4CMMA 4OAWA 4YEFA 5D5MA 2VDRH 4JY5H 3ZDZE 3P4MB 5JO5A 1LP9A 2YUWA 4EI6A 1TPXB 1IGML 4YFEA 2IPUG 1A02N 2E9JA 4MA1C 3K2MC 1KNOA 4EJ1C 2X89D 3ZE2F 1I7TB 5IMLA 1FDLH 3N1GC 3FB6A 2G9HA 4DOHB 4M8VA 2Z31D 3GHEH 2W9LA 3SDDC 4JGJA 3EYFA 4Z7WA 4AH2A 4L3EE 2NY7L 3WE6B 3IJYB 1T3FA 5EU5B 1ZLSL 1M1SA 4YHYC 1HE7A 3MOBL 3TT1L 4P4KD 2ESVB 1WWAX