3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
4GW1A 2ADGB 3NIFF 4HAGA 4NC1E 1D9KC 3Q6FB 4BFGA 3NOIA 3IDUA 2CJUL 2UYLA 4WHTA 4IS6B 3LB6D 4PJCB 2NW3B 4Z7VF 2DI8A 4JY6A 4LRIC 1WUNT 2XA8H 3Q1SH 4V1DE 5FOBA 2A6KA 4UNUA 3GMRB 3AY4C 4C4KT 3OF6A 5MERB 3OX8B 1F3DJ 4LLDB 5ECJE 3GI9L 5LKNA 3OKOB 1J0YA 1CDBA 2C4FT 1QSFA 3OKEB 4LMQI 4P57B 1D6VH 3U0PB 5EFIB 3DROB 2ICWA 1D9KA 4XBEL 4HV8B 3IXTB 1UYWH 2ZUYA 1D5IH 4M3JA 3A67H 4U6TA 1FVDA 5AUMA 1KB5B 4YHKL 5FM5M 4EI6B 3VXTB 5IOPA 4RDQF 5JIKA 3HE7A 4GW1B 2OTWA 4B7LA 4PJ9C 1R6VA 5BRZD 4M7KL 1C08A 2ZPKL 1G7HA 1UA6L 1WWCA 3MV8B 4P23A 5GISL 4YR6A 2UYLB 4XWOD 4UOJA 2J4WL 1V8HA 2W9EH 2MPAL 1BFOA 4NBYB 5I1KL 5D1XD 3D6GA 4LLMA 4Y16D 1P84J 4BFEA 3MR9A 3KS0H 4KV5E 2W0LA 1IT9L 1GSMA 1MWAA 4UQ3A 5LCVL 3T4YB 3D3VD 4K3DH 1F8TH 5HD8D 1QSFB 1JWMA 2FO4B 4L5FL 4PJ9A 1T1YB 4ZUSA 5A2JH 3CFCL 2E9WA 4XP6L 3CUPB 3FMGL 4LCUA 3X3GL 5IQ9A 5AUMB 1ERNA 4TUOB 2VUYA 4H1LH 1RULL 4JZNB 3QFJE 3MJ7A 4QHKJ 2D7QA 4G43B 5DRZA 2A83B 2BVPB 2QJDA 3N9GH 5LAXA 1C08B 4UNTA 2CIKA 1Q1JH 1CD8A 2VXUL 2RCSL 2C3VA 1RURH 5DYOB 3RAJH 1BFOB 4NZTL 3L3IA 3MRFB 5IJVB 3TFKD 1A7QH 3MR9B 3R1GH 5ETUA 4RDQG 3CLFH 1S7SA 2J6EA 2H2PC 4D9LH 4PTTA 4MAYD 4R8WL 3L3OA 5FM8A 4EN3A 1JWMB 2H9GB 1MPAH 3C6LA 1KJ2L 1LDSA 5KSAC 4KHTL 1F2XK 5JOFB 1N6QH 1KUMA 1W72L 5D2NC 2IPTL 1T3FB 3GSOA 4PP2B 1KB9J 1OVZA 2Y6SD 1MHCB 3NCBB 3U9UA 1EXUA 4NWTH 3MJ7B 1H5BA 2VDOH 4HLJA 2AK4E 2HLFC 5B3JF 4CW1A 2EDDA 2D7OA 5DHVA 4D9QD 4TTDC 1B0GA 4YEFA 3B9KD 1J1PH 3CSYB 4ZXBC 4O2EA 5CJOL 4RISH 4RCAA 4JRYA 5KSAA 2C3VB 1JCKA 2WBJD 1ZT1B 5TDPA 3RI5F 1QACA 3NPSC 5IHBA 5D2NA 2FBJH 1S8DA 4U1SB 4MJIE 5FYKH 2UUDK 2O5ZL 2FL5B 4J4PC 5ETUB 1LEIA 2ZG1A 2Z4QA 3PQYE 1DUYA 4PRPE 1AY1H 5AZEL 2JJTA 4EN3B 3FTGA 1MCIA 1QQDA 3C6LB 4NM8L 3I6GA 4GG8A 1URLA 4BFIA 4JDTH 4ZXBA 3P9MB 2Y72A 2BMKB 1NANH 3TM6A 2P5EB 4Z95L 3RVUC 3KPRD 3JVGA 5BJTA 1IKFH 3HMXL 4P2QE 1MY5A 2E8YA 4WUUA 4MQ7B 4MWFB 3IFLL 3JV6B 3OPZH 4J4PA 1WK0A 3CSGA 3HB3D 4CDHA 2YK1L 3DIFA 3VXME 3CFKB 4ZS7H 1KCGC 4MMZC 5D2LA 1FLTX 2GCYB 3O6KH 1KPUB 4XB8A 5D96C 2J5LC 3DVGB 1ZGLB 4G6KH 4Y5XC 4M61A 1MCWM 4WDIB 5IVXE 2NY2B 5I66B 3MJ9L 1DUYB 4MJ5B 3EJYD 1BJMA 2NMSA 2NX5A 1LO3H 1N0LA 1V3JA 1QSZA 3FQXA 2DQTH 4Y5YC 5GS2D 4LCIL 4O9HH 2BOCA 2X4TA 4GG8B 4BFIB 4HKZA 3F7QA 3EYOB 3TH2T 1AGDB 1HCVA 4PJ8C 5AAMA 3TNMB 4U0RC 4WUUB 3QUKA 2P5WE 2GEEA 1FVEB 1MJUL 4LHQB 4Y5XA 1MQKL 2ZUXA 4OLYH 5LG1A 3QUZC 3ZO0A 1MRFL 1I8LA 2MQ3A 2JB6B 4H1LA 2YRZA 4PJGA 1HK6A 3HZMB 1FZJA 2IAMA 3PWPB 4Y5YA 2AEWA 3D25B 4QTIL 3LKOB 3GSXB 4CVZA 3HR6A 3MQIA 2GQHA 5KOVC 3C60C 3ARFC 4JHAH 1GC1L 4FFZH 4EQ2A 4Y2DC 1TETH 2N7AA 2WQ8A 1HSBA 2MFNA 3NFSH 5EOTA 5ACLA 3MBED 2BK8A 4KKAD 5DEZA 2NX5B 3V6ZB 4DWHA 3MRMB 3QQ9C 2JK5A 3FO0H 1H3PH 2OP4L 5HTSA 4RBPH 1FH5H 4XMLH 3FFDA 3HC0A 5E70A 1IGJB 4UV4H 4XP4H 1BQLL 4C58B 1CLOH 3ZE1E 2FATH 4OD3H 12E8L 3O45A 3E1F1 4IDJL 2XICA 2IH3B 1F90L 3PWNA 3A6BH 4LLYB 5EWIH 1EHLH 4BJLA 3E6FA 1D5BA 1Z9OA 3CCHA 4ZUUA 1H3UA 3F65A 3WXWH 4WTZG 1A21A 4FQ2L 5DR5L 4WEBL 4F15C 4PJGB 4X7FC 3BISA 1YYML 1FZJB 4QRQB 2RAMA 1DVFA 5HHXL 2FBOJ 1FO0B 4PJBE 1T83C 4B5EA 1GJIA 3MRKA 3HI1B 3ECBA 5FGCB 3K1KC 5EZOH 5DHYA 1HSBB 4JO4L 2DQGL 4G6AC 4TN9A 1EGJH 4R4FH 3EBAA 2VSDA 2PR4H 5IVOA 3RUGF 3KPSD 4I5BB 2ZSWA 1LEKB 5F6HJ 5JNYA 2J7LA 4JPKL 4G7YL 3SGDI 4Y4FB 3O45B 3C5ZC 4YPJA 2BHYA 5EU7E 3RWCA 2EYSA 1G9ML 3BP7A 4MDIB 3SCMC 4WCYH 4NC2B 3E6FB 3W0WB 4JAMB 1MY7A 4NQCE 4ZUUB 3ZT7A 4M8QA 5GHWH 3S4SG 1YY9D 5TF1L 2YUZA 3MNZA 3KYNB 1QKZH 1KTLB 1YEIL 4YC2C 5FV2A 1KPRA 3MRKB 3GSUB 5IF0B 4E42A 3C5ZA 3BZEA 3BHBA 3BGAA 3NACH 4M43H 5SWZE 3FT2B 4IOIA 4FABH 3F12A 4LKXB 4D0DB 4BA8A 2QSCL 3VCLA 3BEWB 3DRQA 1T0MB 5CILL 4MA3B 4MAUH 1O0VA 4N0RA 1FNEB 2X4OB 4UT6L 3VG9C 2IPKA 5I8KH 5JPNA 4KGJA 4WFFD 3FRUA 1LO0H 3DUSA 4HGKC 4XVSL 5ADPH 3RNKB 2EDWA 2XG4A 3MXWL 3R8BB 5JHDD 4YAQA 3C2AL 1NFIB 4H20H 4KFZC 3AB0C 1PAMA 5CWSB 3WD5L 4CJ1A 4K3JH 1JF6A 2F9BT 3RWHB 1SEQH 1YEGL 1I8MA 3MRGA 4PJFF 2VZ1A 4S1DD 4EDWH 2VXQH 1GC1C 3DX9A 1IQWL 1BFVH 3BHBB 3U9PL 4DW2L 4PGDA 4PR5A 4I13B 1TJIL 4ZUWA 1HCFX 4OKDA 4X99B 3DRQB 3ULVE 1F6LL 1TPXB 4GQ9H 2DM3A 3IDYC 3OKMA 1RUKH 5DO2C 1FNSL 1J1XL 2F15A 4WI9A 4M5ZL 1EZVX 3SDCC 5CD5D 4JM4L 4OZGE 3K4ZA 3GHBH 4UILH 4JREB 2FYYA 1YECH 3O41A 1UKSA 4KK9C 6CGTA 3SDDD 4YDVA 1CICD 1T03H 2YXFA 3S34H 4YE4H 1NKOA 3TVMC 3BMWA 3LQMA 1MOEA 4WU5A 1FCCA 4BK4A 3MRGB 5IM7A 5IMKA 4NQUA 3OGCA 4ZQKA 3DX9B 1GGBL 5D1QC 5DLMH 5EORL 1DDHA 1IE5A 2XNAA 5MEOA 4JFEE 2APTA 4MA1B 3AM8A 4N8CH 1AXSB 2DI7A 4M7LH 5KS9E 2Y36H 3S3JA 3B83A 3GNML 2OL3L 4HIIA 3QFJB 2VLLB 2O5YL 4POZC 1T6WA 3O2WH 3LB6C 4NNPL 4OZFG 4L8DA 3QG6A 1TZGH 1A6UH 1U8IB 4K71C 3V0WL 4XMPH 1EGJA 4QXWA 5I30H 3SBWA 3IS0X 5MP6H 2ESVD 4XC3L 3LEXA 5D1QA 2VR5A 3BPNB 4QF1A 1M7DA 3TNNA 2EE3A 1OF2A 4J7RA 3MO1A 3QEGH 4G8GD 3VG0H 1BMGA 3QUMH 5FO8B 5E2VL 4F2MB 1MCPH 1Z2KA 3GM8A 3I6KB 3I75A 5JXEA 4QGTA 5EPMB 4MCYA 1NCDH 5JDSA 5E99H 1FJ1A 1X44A 3BZ4B 1TNNA 4PJDF 4XCFL 4NKDB 1DDHB 4I0KA 4WV1C 5MEOB 4G6FD 5JW4M 4U1NA 1LP9F 5CINL 5E95B 3WXVL 3GMNA 3WE6A 4BZ2L 4C4KO 2PYED 1EAJA 1OAQL 4NZUH 4XWOC 1FFOB 1N5AB 2AK4B 4M02A 4LLAA 5FKPA 1I1FB 4Y16C 3LV3B 4JCLA 4HF5H 1M7DB 2HYMA 4O51A 1GGIL 1HKFA 5C2BL 3ZLQC 1GOFA 4X4MA 3G5XA 4MJIB 2AKRB 4XCEA 2BSSA 5E8EA 3PQYB 1J1OH 1N64H 3I75B 4LEOA 3DBXB 4PRPB 4K8RD 1SM3L 1ACZA 4JDZB 3STLB 1U2HA 4XCYB 4YGVB 2VXSH 2Z91B 4UIKL 1UM4L 5ILTH 2BVUA 4FQPA 1NEZA 3ARXA 2ZUTA 1T7ZA 4N5ED 3B3IA 1A2YB 5FECB 2EIBA 4K7PL 4BQBA 3P0YH 1TZIA 5IIEA 1NCUA 3EOAA 3OAZK 3ZKXB 5EO1A 3CXHJ 2ZCHH 3HA0A 4FZEL 4NJ9H 3MGOB 2D7TL 1LD9A 4KI1A 2QV2A 3IRZA 3QDJE 4UUJB 4CVUA 5L2KE 3BPCB 5IB4B 1ZHBB 4LNVA 4LBEA 4FNLH 2BSSB 2FX8L 3MYZA 5IVXB 2VDML 4FQJL 5DK2A 4ZTPL 3RX7A 3SDAB 1JGEA 2Q7YA 4GRWH 4HXAH 4HPOH 3DV4B 4PREB 3M45A 4LAJH 3MLRL 2P45B 1JZ3A 3RWJA 3GK8L 3MA9H 3WIHH 2KUTA 3KYKH 1NEZB 1BEYH 1I8KA 3B3IB 4NCC2 5KVFH 3LN9A 5C0BE 1KCUH 4RFOL 5I18H 2WBJC 3VFUA 2VDRL 4U2YA 4KK8D 3WNKA 1FNFA 3IDGB 5H37H 1ZWIA 5C0AD 4LDLB 3UTPD 1IFHH 5IB1B 2PO6C 5L88L 4I0PC 4KWUA 3ZDYF 3MACH 1DN2A 4LBEB 5AYUH 4PV9B 1MCCA 4QRRA 1BVLB 2AJUL 1A8JH 15C8L 3OR6B 5HPOA 3S8WA 1KLGB 1VACB 1N59B 5DRWA 5F7UA 1TJGH 3L3GB 4DN3L 3MMEA 1UJ3C 3QUMA 4P2RA 1SEBA 3RWJB 1T04A 1A64A 3RU8H 2RFXB 4CUCA 1T80A 2W60A 5JUEH 1D6EB 5TPWL 2ZCLH 1EJOL 2PO6A 4WI8A 5I17A 1I8KB 5I2IB 3PGFH 1HH6A 1QO3A 3TV3L 1B6DA 4U7KA 2A1WH 3O4OC 1A5FH 3VFUB 5LXGH 1QNZL 3ULUH 3QXWA 1VKXA 1QD0A 1U8JA 5E5UB 3BD4A 1RZ8A 5HGDA 1JPSL 3REVA 1NC4D 1QLFB 4HWUA 5E6YA 3MJ8A 5FCUL 2P8MB 4OGXL 3DVNB 3BDYH 1YEHL 1UZ8A 1DN0A 3TT3H 1A9BB 5HYJE 4I4WA 3QJFB 2KKQA 4K94H 3QUMB 1SEBB 1T04B 1VADB 3VWJD 3IDNB 1BP3B 1AO7D 43C9B 2XXMB 2ZNWA 4RMQA 1HH6B 4YUEL 5GGTL 3G6DL 4DKEL 3BMVA 3U0TB 5I1HH 4XP5L 1M7IB 2DJ4A 2ITCA 2AK1H 5J6HA 5ALBL 1NUGA 4NQCB 2Q7NA 1GHFH 4OCRL 1MCBA 3VGHA 3BVNA 3QXDB 3DYMA 3AU1A 4OD2A 4J3OC 5E24E 3H0TA 4WW2F 7FABL 2IH1B 5BXFA 3QEHA 4N68A 5CSGA 4KKAC 3JTSA 4N0UE 2HG5B 1U6AH 1I85C 4ZFOB 1JWUA 1DUZB 2E27L 5I19H 3OKKA 3PV6A 1L9MA 4OLVH 5LVEA 5SWZB 3P3YA 3KG5A 5JHLL 4HC1A 4GW5A 1IEBA 1XGYL 1E6JL 2XZQL 2I26N 4L4VD 4AEHH 1R5IB 4I4WB 2HKFL 4LSUH 5BW7C 2F8VA 1P9MC 4RGND 4UT9H 2HJKA 5HPMA 2APFA 4JGMA 3MV9E 4FTVA 4YX2L 3LIZL 4MDJB 3ROOB 3AS0A 4Y1AA 4YXHL 4OJFH 4J3SA 5KZCB 2PXYC 4PB9L 3WV0A 3O2VH 4Y19A 1P5UA 3WIHA 2J8UE 2L4OA 2R2CA 1KT2B 4KKCC 4QRUB 2MHAA 3ALPA 1GL4B 4PJ7F 4ZPTA 3E2HC 4DK3A 1P6FA 4XPGL 5EULV 2VISB 5KBNC 3BGFB 2VZ3A 4KJWD 2R69H 4QRTB 4RA3A 5TDOA 3UBXB 5ANMA 4BH7B 1OGTB 1K5NA 3QUYB 2G75A 3L1OL 2R0ZL 4WHDA 1LO5A 2OTUB 1UM5L 4K3HA 5CEZH 1TQCC 3KDMB 2Q8AH 4TPRH 4XNQA 3BSZH 2EH8H 3CIQA 5EBWA 1LEGA 4S0UC 3VW3L 3E2HA 4YHIB 2BY3A 4NNXA 4X6FA 5HPMB 3ULUC 4AH2B 2XZAH 5ITBH 2CRMA 3G5ZB 1XFPA 4OZGB 3ETBF 1MCLA 4D3CH 5GGSB 4Y19B 1MAKA 4AYFA 1K4DB 1WC7B 2GSIA 3EW3B 4P9HL 3A6CH 4X7TA 5CMAB 2GITB 5L6YH 3O4LA 5DJYA 2JLLA 2NPLX 3PG2A 3BT2L 1JRHH 4XVJL 5SX5H 8FABA 3AAZA 4LCCB 2YD4A 3JUZA 3ZTNH 1CL7I 4OLWL 2UWEA 4HT1H 1AD9A 4ALAL 5C3LD 3ROLB 4HW6A 5HHOA 2P7TB 3OR7B 5JW4Q 2DKSA 1KJMA 2HTKD 4X6CF 5ALCH 5D7JA 4XNQB 4JFEB 1CG9B 5KS9B 1HN1A 3EYSH 3HMWH 1MIMH 5TH2A 4XPTH 1SJXA 1JK8B 2JCCF 5SX5K 1N0XL 3MRRB 4JG0H 1YYLH 3WUZA 4Z76B 3HCVB 2LE9A 2VWEC 3DGGB 3LRSA 1N8ZA 3C5JB 5FYJE 5HYSA 4JFDD 4PBVC 3SGEH 4ODHH 3H9YA 3NABH 4K8RL 3O4LB 2NY1B 1PBYA 3VGGA 3Q5TA 4HUWA 4ZSOA 3BN9D 4PJEB 1HZHL 1NUFA 2V5YA 2DDQL 1KXTB 3ARQA 4CAGA 4U1GC 3GSNB 1HOCA 3L3DB 1G6RL 3X17A 4KTEH 2UY7A 3D0LB 5LWYH 1MNUH 5CD5C 4N0YH 2YD9A 2O61A 5BQ7A 3SE4C 4KI5C 3GMOA 1I9RH 5IW1A 4JRYE 3RWIA 5DS8A 4Q9RH 3FB7A 3MZTA 2X1QA 5C0RH 5D2NE 3RX8A 4PGEA 1AFVH 5IV2A 1CDIA 5FYJU 4M1DH 1QSEA 4J1UA 3VMPA 1DQMH 3QDGA 1X7QB 5EIIB 1KIRA 1LDPL 5IW6B 5D4QA 4U3HA 4LPWA 3QJHA 1U8LA 4FQ1H 1CTNA 2B5IB 4GBXC 4P2CG 5TQ2H 3UTSE 4QRSB 4DCQB 4AL8H 1Q72L 5H94A 1IGIH 4QTHB 2Z93A 3T65A 3PABA 3V5KB 3WMSA 1K8DA 1J8HE 2BNQD 4L3CB 5E8DL 5I1IH 4FP8L 4OF7A 4YWGL 3OHXA 1NGYB 2VNCA 5FDWB 1AI1H 2DQIH 3P4NB 5F6IC 2MQCA 3U4BH 2APWA 1NQBA 4YHOL 4K2UH 3GBNH 2FIKB 3ZDXE 2VDKL 4LLVA 2R2HA 5D2LE 1S7VA 1A6AA 4U6YA 2VDQL 3T77B 4HH9A 1ZGLM 1JUFB 1QYGH 4LL9A 4QXUH 1EJ6A 4LKCB 4ZUVA 4M3KB 2C7UB 1LE9B 3PGCA 2FCBA 3MC0A 3QDJB 3TZVC 5L2KB 3O6LH 4JM2B 1OTUD 2CR6A 4U6VH 5D5MA 1TJHL 1U8LB 3F7YA 2EDHA 1R3LA 3GKWH 1UVQB 3QDME 1JYNA 5L9DL 3UAJD 2G9HA 2X4PB 5A1AA 1G7MB 1XF1A 1V7NH 4OCYL 4HHAB 3OHXB 4WTWA 4Y89A 1PZUB 2EYTB 2EDYA 3MV7D 3QT2A 3K2UL 5BZDB 5MHSE 4YDIH 2WZPD 1A6AB 1MEXL 1B2WH 5JPMA 1A7NH 4O02L 4Z7OF 4M48L 2G60L 5J11B 1NCAL 2IAND 4JEGB 5SWSE 1KYOK 2BXYA 3L9RA 4WVRA 4UT7H 4NKQB 4ELKB 4NQDA 4NOFA 2W65B 1G9NH 1ZA6B 4JO2H 4YHLL 4YH6A 2RJMA 4PS4L 3HAEG 2GT9A 4WO4D 1U91B 1B4JH 5HVHB 1I3RA 5F3HB 3DSFH 3O3EB 4RNRA 4IRJB 2BC4B 2Y5EA 2G9HB 3O9WA 2DM2A 3DYPA 3QIWC 4TVPH 3ZKND 4HWBH 3T0ED 2ZOLA 1WZ1H 2XV6B 4BKLA 4L8BA 1CU4L 2VABA 3VFNA 4LVOC 3P73A 3G9VA 3SQOL 3TBVB 2DLIA 4U31A 3RVVD 4JY4B 2C3WA 4PJXF 2M2DA 4YFLI 3X3FL 3C8HA 5F9WB 1N6VA 2VLKB 3VRJA 5FHAL 1U36A 1MFAH 3UTZB 1DL7L 2NY5C 4IIQB 5F72S 3CFJB 3QIWA 1S9VA 3LHPH 5EU6A 1OAZL 2Z31D 3N0PB 2YD3A 5DJDA 5CUSL 3GMQA 1P4BL 1RZKL 4P46A 5GJSL 4X98A 5E6IC 3RWFB 4PJHB 1IC4L 5GRWA 2BRRL 4L4TD 4LCWD 5EU3A 5DUMH 1K3ZA 2GFBA 1OQXA 3HZYB 5F7DA 3ARED 4LHUA 2UZIL 4KDWA 3O9WB 3KR3L 3W2DH 2GJ6D 2FO1A 4OFYD 1AGBA 4NQVA 5DGQA 1GGCL 1JGLH 1MFBH 3QHFL 3P73B 4MX7B 3WFHB 3B2UD 1LK3H 4QHMB 1FYTE 3P11H 3X12B 2CJUH 4HGWA 3CC5B 3O6MH 4XT1C 1UT9A 5T3XH 3SJVE 5KVGL 4G8FA 3BXNA 1J05B 1RJZB 1WZKA 1DBJH 2VTFA 2JIXA 5DJDB 1UB5A 3VXSD 2AXGB 4X98B 4R97B 5EU3B 5FAAA 4KZEH 2OK0L 1BREA 5CZVL 2K3TA 3S37L 3ARWA 2GUOA 2GY7B 3STBA 5KTEH 1DSFL 4Z0BH 4GJTB 1HHHB 1PZ5B 1CXHA 4YHKH 1OL0A 4NQVB 3MV9B 5C9JB 5C0FA 2F19H 3TO4A 1WFOA 4IRSB 5ITFB 3Q2CA 3MRHB 4M7KH 2ZPKH 4FG6D 2J8UB 1UA6H 4GKNB 4FQIL 4P4RB 1OWRM 3V4VH 3FCTB 3UYRL 1G9NC 5KSBA 3C6SA 5I0ZA 3U30B 3D39D 1I1YA 1S9XB 5HHMA 1MHEB 4P9ML 4QOKD 5D7IA 1NBZB 2JIXB 1UB5B 4XZUB 1CGSL 3W39B 1EO7A 5C07D 2Q3ZA 4F7TA 4XNXL 4ORGB 2J12B 4FFWD 4L5FH 3D2UA 3LEVH 2A77H 1NEUA 5ICYA 3OG4B 1WIOA 3CFCH 1CS6A 2Z92A 5EUOF 3TIDA 2GUOB 1QBBA 1UADC 1HSAA 3FMGH 3EOTL 1X6NA 5DGRA 3LCYA 4XAWH 3RQ3A 3GO1H 5C0FB 4WFGE 1JYXA 5SX4H 2F8XC 4XCCH 1IM3B 2Z8RA 4HWBA 5E0QA 1G0YR 3QIUA 4KU1A 3MRIA 3MLWH 2OR8A 3D18A 4FQCL 2W0FB 2VE6A 4GRLB 2HMID 4JLRB 5HY9B 4HIEA 2V7HB 4NZTH 2WQRA 1P7HL 4PD4J 4D0CB 5D7IB 4TUKL 1CE6A 1RZKC 2DIJA 3W9DB 1CFTB 4KDVA 2XN9B 4MHHI 2WUBL 4HQQL 2I9TA 1ADQH 4N8VB 3X14A 1KJ2H 1F11B 4LQFL 5IB3A 3DTXB 4XNZB 3IB4A 4NO5A 5ICYB 3KHQA 32C2A 3TP4A 4F57H 1W72H 4IM8A 2VLRE 5D9SA 3V0VB 4K7FB 1T5WB 3LN5B 5JW3L 5GS0H 4NHCL 2R39A 3IAGC 2IGFH 3G5YA 4N0FB 3WFBL 1UKQA 4NRZB 1U9KA 1FZOA 2CH8A 3QIUB 5CJOH 3MRIB 1KTRL 3D18B 2FZ3B 3UTQA 4S1QH 4OAWA 5DQJA 4C55A 3L3JA 5AZ2L 4HIEB 1MVFA 5DC4B 2A73B 4RMSA 3TN0C 2O5ZH 4HG4J 3OKNB 3VWKA 4XPAL 4X5LA 5CSZA 3VXRA 1MJ8L 5AZEH 4PJAA 1NBVH 3HS0A 3VD5A 1U3HD 3WFDL 4PLOB 4OLXL 2HKHL 5A40E 3F6IA 1EEZB 3RDTB 4RQQA 1JMXA 4Z95H 2AV7B 5J57B 1WSST 3HMXH 4AG4L 3ARYA 5TFSL 3MUY1 4P5KA 4TYUA 2J3SA 3R06B 1SJVA 5ADOL 4ODSH 1FHGA 4KC3B 2V2WB 3UC0L 1INDH 1NH6A 3WL9B 3ULSB 4UDTB 3PHSA 1KB9K 1E0OB 1HHGB 3UTQB 3TH3T 5BV7L 3H9SA 5DQJB 5GJTH 1UWGL 4Z7VA 1JGVH 4EI5A 2D4DA 2P5ED 1RZJL 5I6XB 3OMZA 3IFNH 3UTSB 5FB8A 1MH5A 1A4JA 2CKBL 3T2PA 5GIRA 3MREB 3VXRB 1J8HB 4OCNC 2HT2D 3NPSB 3RI5K 3V2AR 1XGPB 4G9DA 4LCIH 4IDLA 1AHWA 3B5TA 5E8PA 2I5YL 5KN5A 4Y8DC 2GTWA 4X6EA 3IXAA 2G5BB 4ETQA 5IEHB 2CSPA 1RUQL 4ODWA 4N9OB 1EFXA 1JFQL 5IMOA 2VDNL 1WT5A 1GPOL 2Q3AA 5F7EL 1I7ZA 1MRFH 3QWOA 5I1EL 4P2OC 1CL7L 4YFDB 9CGTA 5J0BA 4ONFL 1EO8L 4ZD3L 4A6YL 3H9SB 1FDLL 1RMFL 3GMLA 4OIIL 4R4NC 5D93B 1MVUA 1N3NB 3QDMB 1YN7B 3N06B 3FN0L 3U36B 1BBDH 1MJJB 2YPKB 5DD3H 1CLCA 1P4LB 2YPLD 2WMPA 3UP1A 1X4ZA 1INEL 3GSRA 3LEYL 3O3AA 5DFVC 4G59A 5D96B 1ZGLP 2J5LB 3N85H 1ZLWH 4JJHA 3IFOA 2I60L 4G9DB 5B8CC 3PP3H 1BQLH 3QAZC 4BH8A 1FE8H 1PGRB 3VXUA 12E8H 2CUHA 4IDJH 4PY7B 3HZKA 1ADQA 1KJ2A 2BVYA 1HEZA 1YPZB 3O8XA 5T5FH 4DZ8B 1W72A 5J6GA 2XY1A 5EUKA 1Q9KA 1XGTB 1ZLWK 4WEBH 1OGAD 1QRND 1YYMH 5SWSB 4UIMB 5HHXH 1OARL 1FG9C 5EOCL 3PP3K 2KH2B 3EDKA 2R56L 3BPLC 2R2EA 4AIOA 3QUZB 4NKOB 2BSRB 2RIKA 4LK4A 4R2GC 4P2RE 5JZ7D 2MWCA 5HJ3B 2XPGA 3IJSA 3UX9B 1YUHA 2J8OA 1RJYB 2QEJA 4PJCF 1ZEAH 3GSRB 2VDPL 5FOJA 1TZHA 3C60B 3IFOB 2VYRE 3ARFB 1S3KL 1ORQA 4YHYC 4Y2DB 5F8QC 3MUGA 4JPKH 4G7YH 5FA3B 4JN1L 1KLFA 1OSZA 3EO9L 4DGYL 1KJ2B 1FG2A 1G9MH 1HEZB 2FR4A 3RIAK 2UY6A 5HGAA 4YXLH 5GS1A 4TOYL 3QXVA 3HMXA 4V2CB 3IFPB 3GRWL 4NYLB 4Q2ZA 4EVNA 4LLWA 4JO3L 4Y7MA 3MLUL 5BV7C 3L5JA 2ORBL 5E1HB 4XWGL 5DJ6A 1QP1A 3VGDA 4ELME 4NQSB 2FH8A 2B7DT 4Q6IC 3FOLB 3IJSB 4JFHE 4WJ5B 4NQEE 1FL5B 5KG9A 1X5FA 2QSCH 4PRID 5TGBA 2P8LA 2JJSA 1RVFH 3K80A 2GSGA 2DQFB 1LO2L 3VI4E 3IS1X 4E5XA 3MUGB 1C16A 4XTRC 3IETB 4Z77B 4Y4KB 3FL7A 1JJUA 1FYTB 3CXDL 1KB5L 2FR4B 3QCVH 2HFTA 1CI5A 4Y4HC 5M95B 1GIGL 1H0DA 3MJGX 3IF1A 5GS1B 2X4RB 1DQJA 4JKLA 3B5HA 3SJVB 1KLUB 2DWEA 2HWZL 1FNLA 3WD5H 1JGDB 4EVNB 3SCMB 2F74A 4LLWB 1YEGH 2C3GA 3LKQA 5EZLB 3KPTA 3T0EC 2R0LL 3CGTA 1R3IH 4ZS6D 4EXPX 4DW2H 4FTVE 5C0CA 2DIAA 5ESVA 4F7EA 4YNYA 4Y4HA 1TJIH 1N5YL 3LKSA 4Y1AE 4WTZA 4WGVB 5ABDE 4AEFA 3GSWA 3MX0A 3QUXD 5F1SA 4I2XE 5DDHA 4AIZA 4V1DD 1S7QB 4UNVA 4X4YA 1C16B 1OM3H 4NUJA 1FIGL 1P2CA 3IKKA 2HVKA 3SGJA 5GRJL 5KVEH 2Z31C 5IW3A 5KSVB 5L7XL 1IGFH 3BP5A 3NFPA 3V7AE 3V5DA 1ZOXA 1DEEA 2EIDA 3DOSA 3EO1B 1K2DB 1DQJB 3FB6B 1JWSA 1T1XB 5C09A 2VXTH 4BSVB 2NLJA 3MGAA 5DVNA 4NSKB 1CDCA 3UPRA 4JRXE 2X4QA 5DI8A 4N0CD 3OXSA 2AJSL 3AB0B 3D85D 3TPKA 4FXKA 5DMYA 1GGBH 1U8QA 5FUOL 1PEZA 1EUUA 1CGVA 1C12A 4XPBL 5C0CB 4OCWH 2B0SH 4R7NA 5F8RC 4F8TA 3PUCA 4F7CA 1KIPA 3BPOC 3GSWB 3V5HA 3S4SA 3PHOB 5DDHB 1BLNB 4MXQD 1ZVSA 2OL3H 3KPSE 2EEBA 5FGSA 5BZWA 4F7PB 4X4YB 4J3TA 4L9LC 3LMJH 1P2CB 5I9QB 3V0WH 5F9JB 4HS3B 2I25N 4PG2C 2CIIA 3OQ3B 2VQ1A 3U46B 1K9TA 2W9DL 3RVWD 4I1NB 3ULUE 4AT6A 1DEEB 3ZE2E 5LQBL 3SDCB 5T1LA 1I3UA 2XYCA 4K23L 2NLJB 4PRAA 3NBNA 2YR3A 2G2RB 1I7RA 3QFJD 1NDGB 3HRPA 5DI8B 4L9LA 3ZHLA 1UXWB 5E7BA 4XCFH 5A2LH 3GHEH 1SYVA 4HX1A 1D5ZA 3L7FB 5FO9A 1C12B 1MF2H 4PG2A 1VENA 3TVMB 2VLRB 4R7NB 4ZNCD 1Q9LB 4HFUL 2YRPA 5EZJA 5J1AB 4PRDA 4QO1A 4UBDD 2ZG3A 3S4SB 3VU2A 3B9DA 5IHLB 4JANB 3RUGA 2E7MA 1CR9L 3PDDA 2VAAA 4LHJB 1IM9B 1BZ9A 1UXSB 4WFFE 4MNGB 1E4XL 4S2SB 4XHJD 3QO1A 2BNUA 2QKIB 5IQ7H 5E00A 2ENYA 3VGEA 2NXYC 3RWEB 2VQ1B 1FFPA 5C2BH 4AT6B 3DX7B 1JF1B 3MA7B 4K71B 5D1XA 3BKJL 2VWEE 5A3IC 2W59A 3PJSA 4PRAB 4NUGH 1I7RB 2DMBA 4NHUA 4LP5A 3DUUB 1NDMA 5HI4D 4RAUA 3KWWB 2XTJD 3X13A 4CVXB 4HX1B 5D8JL 3KXFA 1RFDH 1MFEH 1PD6A 2W91A 5EU4A 2BY2A 3KLAA 1KC5L 3H3KA 4HKJA 2AJVH 3IDJB 4K7PH 2F58L 4MJID 5CJXA 2X6MA 1CK0L 4X7SL 1JL8A 1ZSDA 5ESQB 3P40A 1DP0A 3PQYD 1T7VA 3JSSA 4UU9A 5BRZB 4L3EA 5JORB 1FZKA 5MENA 1BJ8A 2BNUB 2VL5A 1JF5A 4KI5E 2EDLA 4M6NL 1PY4A 3MRPA 3D69B 1FFPB 1T20A 4XCNB 2L7JA 2A9NH 4Y16B 3RL1A 4HJ0D 3TFKA 2D31B 4LSVL 3H7BA 2NXZC 4P2QD 5DUPH 2HJFA 2VDMH 1CWVA 4ZTPH 5E9DD 3KLHD 2AV1B 3D3VB 4PJFA 1B88A 1RUML 4RAUB 5AAWA 3L5WA 1EK3A 3EHBD 3MLRH 1FIEA 4PJGF 3KPLA 5CEZE 3GK8H 4MA7L 3LSOB 3G04B 2X41A 2AJXL 3VXMD 4NO0D 3G6AB 2SEBA 3IU3A 4C56E 1HHIA 3QHZL 1MCNA 1IEHA 1DBAL 4ORZC 1MIEL 1N4XH 2DJUA 3MUZ1 2AEPL 3JZ7A 4RFOH 3WIFA 2XKSA 4X9GA 5C08A 2VDRH 4RGOL 4WEUD 5D5ME 1CGUA 3JTCA 1J86A 1UFUA 1XIWD 2QBWA 3LVEA 3MRJB 4NBZB 2OL3A 1AKJD 1JHKH 3BUYB 5IMMB 4FZ8L 4TNVK 1ZS8A 5L88H 4XGZA 5IT2L 3IDIA 1L7TH 1ZKAA 2VUOA 3CXHK 4G8GE 2A38A 3RL1B 3GUTA 2X4NB 2CDGB 3GI8L 5C7XL 1AP2A 3H7BB 4FMFA 2XWBA 2P5WD 4XNMA 3FO9A 1NBYA 3QDAA 5F7WC 4OZFB 1FO0L 2R4SL 4JHBA 4MAYB 5GSRA 4HEME 1L4IA 2HLAA 4DGVH 5INDA 1V7ML 3KPLB 3U4AA 3D5OF 3QRGL 4OGZA 5TPWH 3IU3B 2FB4L 3VGFA 1NPUA 1A3LL 1ZHLB 1AQDB 2R29L 3FQWA 4WU7A 2OR9L 3MOBH 2PYEE 3IJYA 5DEGB 4NT6A 1HE7A 3SE9L 1MREL 3B9KB 2C3XA 1RZGA 4HZAA 4TSAL 5EO0A 4WWKC 3QCUH 4DQOL 1JPSH 2WBJB 4PP8C 2I07B 1QR1B 4I18B 4NZRL 1XCTA 4OGXH 1XR9B 4HEPG 1I9JL 1KACB 3FT3B 5C8JB 2D0HA 3FO9B 5E08L 4JPIA 4DK6A 1B90A 1ZHKA 2X70A 4ZAKD 5GSRB 1GVIA 3LH2L 2HLAB 4PJDA 1QEWA 2PF6A 4X8JB 1IAOA 3PWJA 4MNHA 1OD7A 5JQHC 5DTFA 1D5XA 3OAYH 2OQJA 4ZUTA 2CK2A 2CRZA 3KPRB 4Q7DA 4YUEH 1UJ3B 3T3PF 2WIIA 4QYOA 2EDTA 1JPTL 3IJYB 4GKOA 4IMLB 4XVTH 3TLRA 5ALBH 3F7VA 1D5MB 3ARSA 3MOAH 1FGVH 3EDDA 5BMFH 2QHRH 5EBLB 3JWOH 3ARDD 4G9FD 3U7AA 4M6ML 2NY7L 3R8QA 3UO1L 2CPCA 2OJZL 3OAYK 4QHLA 1DQQA 4PRNB 4KK5D 4K9EL 4ELMB 1NSNH 3Q6GL 3U83A 3ARBC 3WN5A 5I1CL 1HHKA 1RJLA 4NQEB 5JHLH 3UDWC 5FM5O 1E6JH 1ZHKB 3MBEA 2HN7B 2NZIA 1CFVH 2HKFH 5IVZB 5K59E 2EKSA 1IAOB 2DLGA 1RHHA 3P9WB 4KV5F 2VB5A 5F3BA 1JZ4A 1NGWA 5C0EB 4JG1L 1BIHA 3LKRA 4YXHH 2EDRA 2FD6L 4ONGH 4WW1A 4LSSH 3ARBA 2WIIB 5E5MA 1HXYB 5SWZD 5I1LB 5IHUL 4NZDA 4AEEA 1WBZB 5JZ7C 3PGDA 3I84A 2RQ8A 1SJHA 4FQXD 1VGKA 2OXHA 5F7NC 1DQQB 3KJ4C 3O11B 4KUZH 2R0ZH 3BP4A 1A47A 2PTTA 4B0MM 1RK0B 1UM5H 3VMNA 3FQUB 3OSKA 3AGVA 1UKTA 4H88H 3BUTA 3MBEB 2DBLL 4NN6C 4LIQE 1RK1B 1K8IA 3VW3H 4LGRB 4KQ4L 3UTTE 4EDXB 3RTQC 3DARA 2PTUA 3PL6D 5E8OA 1OW0A 3H2WA 5HHME 2M26A 1XF3B 1YMME 5E5MB 3SY0A 4YBHA 5F1IA 5B38G 4P9HH 5DQDL 5HI3C 4JFYA 2EC9U 2YBRB 1ZLSL 1LVEA 2WAHA 3RGVA 3ULVD 2PXYB 3BT2H 5C0IA 1VGKB 2EICA 1A7RL 5I16B 2DYPB 3QIBD 1IAKB 2YEZA 3NN8A 2HH0H 3PWLA 1YN6B 2VKXA 2PTTB 5F93C 1NAMB 2WWMD 2X1PA 4ONHB 4EUPH 2QQKL 1IC1A 1S9YA 2APVA 3KVQA 1E4JA 4G3YH 1U8NB 3HC4L 5FYLD 5A2KH 3LS4L 1P7QD 3O3BA 3U2SA 4DUWA 2YUWA 3KPSB 2YA2A 3BIKB 3VXOB 1N0XH 3L3KA 1ITCA 4JR9L 1F4XL 1TQCB 1QFHA 4KY1H 4W6XB 4XXDB 4K7PX 4HZLA 3JWOC 1X3DA 3T2NH 2R1XB 5DUBB 5F1IB 3GMPA 5D1ZA 5F1NA 1NGPH 5IB5B 2CO7B 3DSNA 4JFYB 4K8RH 4CDGC 1X4YA 4HUXB 4ZS6C 3HPJA 4YXKH 2BFVL 2DQJL 3FRPG 4TULL 5FUZH 1KENL 4F37K 1OHQA 1XZ0A 4P48A 5AG8A 2YEZB 3BJLA 2JJUA 3CFDB 3PWLB 4WEMB 5DJZA 1G6RH 4KJYA 4KKBD 5FIEA 4L8CB 5C0GB 3MXVL 3MROA 2P43B 4YO0A 3O3DB 1KIQB 4ZFZA 5TE4H 2HFEB 3EDEA 2FGWH 3WO3B 1ORSA 4WW2C 5IVXF 1TVHA 5CP7A 5CHNA 5IK3A 3HNTH 4Q97A 4PP1D 4WNQA 4NRXB 1HWHB 5JHDB 3NCCB 1I1AC 5F1NB 3T4AA 4HKXB 4OV5B 5T3XE 5E2WL 2X1OA 2A6DB 1PDKA 3P4OA 5GGVY 2DLTA 3SDDA 2NTFA 1CICA 3UZVB 1P4IL 2XY2A 3S36L 5K9QI 4TQEL 5B21A 1UB6B 5ID0A 1J5OL 1Q72H 2E8ZA 4MVBC 2Q76B 3MGTA 5JW5A 2WY3A 1MCJA 3OB0K 1GGYA 4YK4C 5EBMB 3U4EB 4NN7C 5E8DH 4ODUA 4KJYB 3CX2A 1MI5A 2EDXA 2FJFB 3MROB 4XMKH 4OM0L 4YBQD 4YO0B 3U6RB 4UQ2A 4U1GB 1WTLA 3VRIA 1YY8B 3NIFE 4YHOH 4P4KD 3RVWC 1RU9L 5DHXB 1TVHB 2FJGA 3L3HA 4X0KB 4UB0L 3OAUL 3SDXA 5GGUA 1M6OB 4RFNC 5FV1L 2EE6A 1PX3A 2IC2A 3ZKMC 3ZE1F 1LMKA 4QRPD 4DN4H 1PKOA 1FL3A 5HGHB 5DWUH 3SDDB 1R3HB 2BJML 1CICB 4RMUA 4D94A 4XPFL 5ID0B 4HS6B 4R90L 5EB9A 3MGTB 4PRHA 1VFOA 1H9VA 3U0WL 2MTPA 4GBXB 4OCYH 4U1KA 4TTGA 2C1OB 4C56B 4ONOA 1U8MB 2GIYA 4QHUB 3QDJD 5JO5B 3BKMH 5TE7L 1AJ7L 2UV3A 4P3CL 2ICWI 4JM2D 4RSVA 1CFNA 3Q48A 1OD9A 4XI5D 5T1KD 1G7JB 1A1NB 3MV01 1T21A 4EUPA 3CK0H 1OAYH 4OLUH 2GHWB 3S88L 3T3ME 1EO5A 5F44A 5I1JH 4EOWL 3MCG1 5F6IB 4U2ZA 4HBQA 5JR1H 5CEXB 1INQB 3PNWA 2IADB 2ZUQC 3SDXB 1FP5A 2FECI 1FAIL 3K8KA 1DQLH 4X4ZA 2G60H 3U7WL 4JFDE 2ESVB 3WKMH 1O7VA 3QEQA 5IFJA 4HUUB 1NCWH 4IRZH 2CDEB 4DVRL 3V4PH 5IKCB 2R1YA 2XTJC 4G8GB 1ES0A 4YHLH 2XFXA 4GW4B 5C0BD 3THML 3ZYJA 3INUL 3TZVB 5CLWA 5EA0H 3VXUE 2CDFB 1NL0L 2X89A 3VFSB 4NO2A 3WKNA 5DJ8B 3QXTA 4M62L 1UCBL 4IJ3B 1C5CL 4OLZH 4LSQL 2DQHL 1CU4H 3GSVB 3ARGD 1LGVA 4G6FB 4N5EA 1SYSA 3QNZB 4GMSL 2B4CL 4LGPB 5FHBL 3SQOH 1CFNB 3IDMB 3CZFB 2H8PA 4MSWB 1G6RA 1BD2A 4OCMC 5B4MD 2PYEB 2JCCA 1IAIL 3GBML 4XNYL 1QBLH 5IBUG 3X3FH 5DJ2A 5DJ0A 4FFYH 5J9PA 5KAQF 2H41A 2HFGL 2WK2A 3AMKA 1MFCL 3WNLA 4PIRF 4AEIL 1XGRA 1H8SA 3C9NB 3FOMA 5K9KA 4IHOA 1Z3GL 1IC4H 5TQ0H 3RKPA 3HI6L 1B4RA 1FNGA 3TYFA 1PLGH 2UZIH 2BNQE 1W0VB 3KR3H 1F2QA 3RHWF 3BFOA 3BZDA 2H32B 4TUJB 1GGCH 3MRNB 3QHFH 1XIWC 5D72L 1SYSB 3VFGL 5FM4A 5IB2A 1XR8A 4YHPB 2F53E 3KLDA 3MCLL 4H25A 4G80B 4KTYA 5DJXB 3DXAE 2FJHB 5ERWB 3OKLA 2A6JB 5GZNC 2XQBL 3REWA 2X40A 3BO8B 1J0KA 1M71A 4E0RA 4M93C 5HYJD 4U1LA 4XBPB 3P4MA 2IFFL 2P24A 5C9KA 2E9JA 3WDHA 3W11D 3UYPA 4DFIA 3WLBB 3P0VL 4OZGF 2JJVA 2K7QA 2AVGA 4MA8H 4NRYB 4M00A 2XRAL 1HHJB 1G0XA 2OK0H 3CDYA 3S37H 5KW9H 1PSKH 2YA1A 2ZKHL 1DSFH 5KAQG 1SJEA 1P7KA 1CLYL 5E6IB 1NLDL 4X80H 5TF0A 4IMKC 1IGYA 2Y5TA 1TDQA 2CK0L 1ZLVK 4LSTL 5BVPL 5IG7A 1Z9MA 2VLJA 5D70L 5IB2B 1XR8B 3MV7E 1OSPL 3O6FD 3ULVL 5J13C 5DEFB 4FQIH 3OKLB 4Q9QL 1DLHB 2H1PL 3RWGB 4YDKH 4P5TA 4DGIH 2DF3A 5KS9F 4HUNB 4G42B 2AABL 4PG9A 5C0AB 4ISVB 2IANE 4IMKA 3VFPB 1WFNA 1J8KA 3FB8B 4ZAKC 1CGSH 4I77L 5FYLL 3FAWA 3RY6A 1KCKA 3E8UL 2XZZA 3QG7L 4MD4B 1MUJB 3RP1A 3OF6D 4M6OL 4NN5C 4MCZB 1CFQA 3LQAH 1S7WA 3DWTA 3LKNB 1SJEB 4NIKB 3T0EE 1UWEL 1BZ7A 2E9BA 3UTTB 1BF2A 3VWJA 1D9KD 3H9HB 4PJEF 1AO7A 3SEPA 1B0RB 1DR9A 4ZFGL 3OKDA 3KPQA 4U1MB 3NVQA 3JTTA 1NC2A 4CJ0A 1DBKH 5AG9A 4LNRB 3HAEB 4GRMA 1X5HA 3CX5J 4FQCH 3V6FA 3HE7D 3OJMB 5D7SL 1L7IL 4ESKA 3GSQA 1R0AL 4UOW1 2ATPB 4RGMC 5D6DA 4P23D 1RIHL 5DJCB 4E41E 1NC4B 1S5HA 1IQDA 4OQTL 4DJMA 1QLRB 2ZUWA 3EYFA 4JZOB 1TTUA 2WUBH 1VFAB 4HQQH 4NOBA 1G7QA 2OS7A 4Y5VA 1V3MA 4LQFH 3BWAB 3C8KA 3BI9X 4YHNB 2EO9A 2DQEL 4L4VA 5IGXL 3V0AC 1OCWL 5JW3H 1MFNA 4PJ9D 1WCBA 1CGYA 3BE1L 3VWJB 2EYRA 1F45A 1AO7B 1OY3B 3OKDB 1BFTA 1A02N 1RPQA 1IVLA 2DQDL 3JTTB 4XRCB 5K93A 3QEUA 4HBCL 4KUCF 4J6RL 4FQXC 5C71A 4OZ4B 3WFZA 4HXBL 1Q9OA 2EEAA 4ERSH 3QULB 1BVKB 3U82B 1EPFA 5AZ2H 5E8NA 5KJRL 4JVWA 5FFLA 4RAHA 3L95B 3VE0A 4PY8I 4R7DA 4XPAH 3ABZA 3TA3A 1E4KC 4R0LC 3VXSE 3QA3A 5LGHH 3CH1A 4LFHD 5IFAL 2ITDB 3RUGE 1ETZB 5FYJD 1S7XA 3A6OA 4PD4K 4FS0A 4OLXH 4HCRH 2HKHH 4JM2F 3PL6C 2OI9A 2XIDA 2ADFH 1KSRA 2ZZUT 4AG4H 5TFSH 5MEQA 1HDMB 4MS8C 3EGSB 5EG6C 5J12C 3TCLB 4J8RB 4HK0B 3S35H 4MD0A 3SKJL 1NCCH 3NTCH 5GGVL 5C0DB 4D8PA 1H3TA 3GDBA 4DZBA 3AS2A 5IESH 4NHUE 3NAAL 1MCSA 4WY7H 3HFMH 2X1WL 4JO1L 5EN2A 5EC2A 1DQDL 2H2PD 4QHNB 1RZJH 1MLBB 1B3JA 4PBWD 2IALA 5C3TA 4QOKE 5CCKL 4JRYD 5KSAD 4MS8A 1EAPA 3U79A 3UROR 3T8XA 3CH1B 4HGMA 4QT5B 1QSVA 3PDOB 1I7TB 4LDOB 3HE6A 4HG4K 2I5YH 5CIPH 2WUCL 3BP6B 3Q3GA 2XWJB 1L9NA 2HLFD 5MENE 3UJJH 1HQRA 1JHTB 3QQ3A 4MZ2A 5IFHL 1AE6L 5GGRA 4ZXBD 1CQYA 5CBAA 1S7TA 4ZTOH 1GPOH 4BYHA 2NW2B 1HIML 5I1DA 2LVCA 1MFDL 1YEFL 3QFDA 4DZBB 2AJZB 4ONFH 3EFDH 1EO8H 4PJIA 2MCPL 4D0BB 4QY8A 4ZD3H 4CMMB 4J4PD 4A6YH 2R0KL 4LEXL 4PJFE 4Z18A 1RMFH 4RMRA 4FQLH 3NZHH 4KKBC 5H8DA 3VXNB 3I6LE 4XP9L 3QZWG 2EDFA 3SKMA 1EAPB 1Q0YH 3V8OA 3LEYH 1INEH 2R0WL 1H3VA 5I1AB 3T8XB 3C5SB 5ICXB 4N8PA 3RVUD 4GG6A 5FO7B 1NAKL 2ZOKB 5ICZA 5EUOA 1KELL 2AGJH 2VIRB 4UDUA 1YEJH 2VO5A 1QFUL 2W07A 4PJHF 3QQ3B 3TF7A 5GGRB 4RFEB 2HVJB 1QFWL 1VGEL 5CBAB 1NFDB 5DRNA 2QR0A 4H8WH 2P47B 3GFUA 4ZDHA 4JFDB 1OAKH 2NY0D 4G8IA 4PJIB 2PW2A 4QY8B 2FWOB 3LDBC 1CXIA 1X5KA 4JKPH 4OIBA 4Z7UE 5MHSD 5F1KC 3SKMB 2AEQH 1U8PA 4WI5A 1A6TA 2PW1A 1YNKH 2VDPH 1OPGH 1N7ML 3FONA 4GAJL 3G6JB 4PJ8D 4GG6B 3S37X 3GIVB 4R6UA 1BAFH 2WINB 3VFMA 1FVCB 1CT8B 4NDMB 5DZNA 1YEDB 4I48A 4UDUB 3RZCC 2CD0A 5I74B 1NMAL 2CMRL 2NNAB 3CDCA 5B8CB 1YDPB 4X83A 2PKDA 4HCRA 5HHVL 5I73C 3B4NA 1G0DA 1SBSL 3SO3C 4TOYH 4ZYKA 4LPTA 4FQQB 4YBLC 3SPVB 4MNQA 4W68A 4Y2DD 5JDJA 1QHOA 4JO3H 3QI9A 4LRNL 3ALWA 4Z78B 4PJDE 4LLQA 3QQ9D 1U8KA 3I3DA 3WHE1 5IEKA 1WIPA 2LFGA 3ZTJG 3RZCA 1DVFD 2J8UF 1A1OB 3HNSL 1CD1B 4Z8FH 1U8PB 3JWNC 3BQUC 3B2VL 3BPLB 5GSVB 1IBGL 2BNQB 2PW1B 3GBLA 4CADA 1LP9E 4U6HA 2K9UA 3NFNB 4DVBA 2ICWJ 2Q6WA 2BP3A 3HG1E 1S7RB 1UG9A 1YMHA 4DAGL 3HZVB 4U6XB 5K9QG 3LAFA 3RY4A 4QXTA 4W6YB 1C5DA 4PJ5E 4XC1H 1EA9C 1KB5H 5C6TH 3DXAB 4UV7L 4YHYB 5DVMA 4JY5L 1GIGH 4DOHE 5CIPA 4YDJA 3HUJA 5I0DA 3C08L 2A74A 4CNIB 1I4FA 2DM7A 4HFWB 3L7EA 5DF0A 3FO1A 1XF4A 4WFHE 2XQYG 3RL2B 1XH3A 2I9LA 4WO4A 2R0LH 2GJZB 4LLQB 5TE6L 1U8KB 1KYOJ 4LQ1A 3FFCA 1FYTD 3J8F7 5CEYA 3NA9H 3ARGC 5CBEA 2YPLE 3AS3A 4A6YA 5BV7B 4G5ZH 1N5YH 3WIIL 2C9AA 1FAKT 5BS0A 1OTSD 3C5ZD 43CAB 1VPOH 1K6QL 2CKBB 5D7IF 2FECL 2FLBT 4H8WC 2LAGB 3MFFB 3HN3A 3MV7B 1U95B 4X5WA 3PP4H 3KPNA 4JFFA 2FHCA 3HUJB 1GZPB 4BSWB 2A74B 3U7YL 4UINH 5EO9A 1FFNA 4O2CA 4WHYG 5EU5B 3FB5B 1QRNE 2IANB 4MB4A 1KBGL 5I8CB 3DMMC 4FXGB 4OBSA 5F96L 5I8OL 2AJSH 3DV6B 1T5XB 2I9LB 4WO4B 5GGQH 4L4TA 1GZQB 4Z7NF 4HH8A 4A6YB 5D7LE 1QFOA 2VAJA 4YDLC 3DECA 1IL1A 4U1HB 3T0EB 2GJ6A 1QR4A 5J1SC 1F02I 4M5YL 2MCG1 2DMKA 2ZCKL 3WHXB 2FH6A 5CD3A 4HKBB 4QLRA 4QKXB 1NMCB 3N1GC 5DZOA 4KKNA 1IEAA 4X5WB 4LF3A 1IC5L 3NGBB 3PXHA 4KTDH 5SV3A 1F58L 2V5SA 2CKNA 4NJAL 3W11C 2EZ0D 2O5XH 3V6OC 3CVIL 1P5VA 5EO9B 1FFNB 3LKPA 5LQBH 3EYUH 3L6FB 2EH7L 5FYJL 2Z31B 4PYHA 2PYFA 1HNFA 2N56A 1MCFA 2J6EL 4MMXC 4APQA 4HLZH 4KK6C 1VEMA 2F54E 3UPAA 2ADGA 4LCWB 1A7PL 2NY4D 3Q6FA 2B20A 3AREB 4IS6A 4M9PA 3MLSH 3V6OA 4HFUH 2NW3A 4PRIE 3VJ6B 1IL1B 3O6FC 4P5MB 1A7OH 1R5VA 4I3SH 4LARL 1CR9H 3GMRA 5MERA 4TNWK 3OX8A 4LLDA 4LFHG 3LS5L 4OTXH 5SWQA 3BPOB 4KK9D 1IEAB 4UMGA 4LF3B 4P57A 2AEIT 3FO2B 1FPTL 2CR3A 5EFIA 3DROA 2ICEB 3JBG7 4HV8A 3MLZL 1CDGA 5M94B 2CXGA 3KPPB 2VLRD 3D39A 4HK3J 1VFBB 1KB5A 4N1EA 3TBYB 4EI6A 1WV7T 5D1QD 5C0JA 1EEYA 3UTOA 3VXSB 3BDXA 3E6HB 5C07A 3Q1SL 2BSED 4C54A 1EBAA 3WJLC 4XBGB 3MV8A 3RKDC 4POZD 2NY3C 5DZLA 2WSKA 1NGXB 3KS0J 4RZCB 3WNMA 1D6VL 5I1GL 1R5VB 2YRLA 1I1CA 1SBBA 2AAVA 1CK0H 2JB5L 3TT1L 1D5IL 5HDOA 3HPLB 3HE7C 1KTDB 3T4YA 2LU4A 4BUGA 5SWQB 2ZNXA 3GIZL 2FO4A 1TCRB 1T1YA 3MRLB 1CCZA 4P23C 3WJLA 1D3CA 2OZ4L 1A7BA 3ZL4L 1AIFA 3CUPA 1JBJA 3D39B 3RVXC 2DB8A 4TUOA 4QOKB 1FFRA 4JZNA 1YPZF 5C0JB 1EEYB 1DQTA 4G43A 2W9EL 5E56A 5C07B 1J11A 1RUMH 2A83A 2BVPA 4NO3B 1IRAY 5H35B 4MA7H 2AJXH 4X6DA 1U41A 1UH3A 3QPXL 2IBZX 5DYOA 1L0QA 4K3DL 1B9ZA 3QHZH 1DBAH 1F8TL 4FA8A 1KCVH 3JV4B 3MRFA 3ELAT 5IJVA 2V17H 4LVEA 1ZLUK 2QLVB 3K1DA 3FQRB 4G7VH 4RGOH 1S9KC 4PJ7E 2ERJC 4Q58C 4F33B 4AENB 5HHNA 2DLFL 2H9GA 2IQAB 2YZ1A 2OX5A 2BSTA 4PY8J 5JOFA 1AIFB 5IT2H 1T3FA 3DGCR 3JWDC 4PP2A 5C7XH 2FSEB 2VH5L 1Q1JL 3SOBH 1MHCA 4YHZH 3WS6A 1HI6B 3TPUE 1RURL 4OI9A 1FO0H 2R4SH 3RAJL 2DTML 1BX2B 3H3PH 4LCYB 4EN3C 3DRTA 4X7DC 3C6LC 1U3HA 3CSYA 5L8LB 4X6DB 3QRGH 1MCDA 1KXVC 4M7ZC 3QQNA 4U3XA 2AW2A 1A3LH 1ZT1A 4G8EB 4H1LG 1LK2B 4R96B 1T89C 4GQPH 1MPAL 4U1SA 2OR9H 4OD1H 2BOBB 3T0AA 1H5BC 4M7JL 1XT5A 2FL5A 5DJAA 1N6QL 4S11A 1QPPA 3TBSA 3ARTA 4NFDA 3RNQB 4I3RL 3N1MC 4WTXA 5E6ZA 1MREH 5DD0H 4TSAH 5HHNB 3C2SA 1KG0A 4NWTL 5EBGA 2VDOL 1T6VN 2BSTB 3NCEB 1P6AB 4GKSA 4ZMAT 2YOCA 1WAAE 3P9MA 4WI2A 2BMKA 1R3JB 2P5EA 4NZRH 1J1PL 1XCQB 2HTLD 1T89A 2YSSB 4RISL 4Z7UB 2UUDH 2NY2C 3NCFB 4X6CE 4MQ7A 4MWFA 3JV6A 5A2IH 1G7PB 2FBJL 2XTJE 3LH2H 2JJTC 3NCJL 3DRTB 4QRRD 2AS5M 1BD2E 1U3HB 1ZAGA 2JCCE 5E94B 1I8IA 3CFKA 1FGNL 4LASL 4MJ6A 2GCYA 3T08A 3DURB 1KPUA 3JVGC 4AK1A 3DVGA 3HR5B 4KDTC 4P2RD 1ZGLA 1OOAA 2YC1B 1JPTH 4OZHE 4WDIA 5DJAB 3R0NA 2XOTA 4JFQB 3TBSB 4KAQH 5I66A 2PO6D 4I0PD 2ZUSA 3BYTA 4MJ5A 4JKKA 5L0QB 1IKFL 1HKLL 1JPFA 1NBQA 1KG0B 4M6MH 5C70A 4GKSB 1QLEH 5HDBE 3UO1H 3EYOA 2DTSA 4MD5B 1AGDA 4G6JH 3DVIA 2W0PA 3QSKB 3TNMA 1BQHG 1X5IA 5I1CH 3FZUD 4WWKB 3X11A 4KDTA 25C8L 4M8VA 4ZS7L 1FVEA 2Q8BH 5E9DE 3FN3A 1H3WM 3RGHA 2J88L 1WBXA 2JB6A 3HG1B 4G6KL 2FIRT 1I8IB 3HZMA 3PWPA 2C1PB 3D25A 4MJ6B 3LKOA 3GSXA 4JKWA 3VFWB 4EXKA 4PJ5B 1LO3L 1OP3K 4JG1H 3IVKB 4M1GL 2NY0C 2IQ9L 4O9HL 5J06A 4DOHB 3S96B 4JFHD 4JQVA 1Y0LA 1ND0B 4NQED 1JE6A 3PHQB 5E2UL 2F8OA 1I8LC 5L2JA 1L0YA 3V6ZA 3MRMA 1JPFB 5IMLA 2IAMC 1XF5B 5GGSY 1BIIB 1IGJA 1OAXH 4JFXA 1R5WB 5IHZB 1HH9B 1M05B 3VMOA 2VITB 3CSBA 4MJ2A 2IH3A 4LLYA 3X11B 4GAYB 4KJQD 2YPLB 1LWRA 4ZG1A 2GW5A 2F5AL 2DBLH 3VA2C 4MLSA 3KPOB 3TGXA 1WBXB 4JHAL 1W0WB 4JFPB 1TETL 4QRQA 3ARVA 4KJPC 2X9YA 3NFSL 1FO0A 4Y4FC 2MJWA 4V3DB 3MNVB 1H3PL 1FH5L 4XMLL 3HI1A 3N1FC 4Z7WB 4UV4L 4XP4L 4ZNEA 2D7MA 1RZIB 4OUOA 3LZFH 1CLOL 1Y0LB 4FTVD 4PLKC 5DQDH 2L7UA 5L2JB 1OGAB 4Y1AD 5EWIL 3A6BL 4U1IB 5IMLB 1QRNB 1LQVA 5EIVA 1EHLL 1DVFC 1FQ9C 3MRBB 3RIAF 5JOPE 4I5BA 4JFXB 1LEKA 4GAGH 2A0LC 4DTGH 4Y4FA 3NH7L 3AC0A 5DD6A 3OJVC 1F97A 3K0WA 4MDIA 4UTBL 3W0WA 5I15L 5HGGS 5JA8B 4JAMA 4EZMA 3BZFB 3KJ6L 3KJ4B 4XPHL 1JN6B 3BJ91 5LBSH 2PXYD 3KYNA 3VD3A 1KTLA 4KKCD 3W9EB 2CLRA 2FLRT 2DYPD 4PV8A 4Z7OE 1JV5B 4JRXD 1OWWA 3GSUA 4R4FL 3SKNB 5IF0A 2PR4L 1A6ZB 2IMMA 4PGBB 1ULVA 3FT2A 4KHXH 3RTQB 3CFBA 5GRUH 2H6PB 1O7SA 1YA5A 4LKXA 4D0DA 1JPGA 2X10A 3LOWA 1UM6L 3BEWA 3S6CA 1T0MA 4G9FE 2ZJSH 4MA3A 2BFVH 2DQJH 5DD1H 1VCAA 2BNRE 4TULH 1FNEA 2X4OA 2D2OA 1KPVB 3EOYG 2F54B 4GS7C 5A43C 5DD6B 5GHWL 1OTSC 2ADJB 3LY6A 1KN2H 2YMXH 1IGCH 2YHGA 2HT3C 1QKZL 3RNKA 3MXVH 4PLJC 2EIZA 3RFZC 1IKNA 3TYGH 3ULUD 4PRIB 1NFIA 1SHMA 3NA4A 1G84A 5MEPA 2VZVA 1TPXC 4GXVH 3NACL 5CWSA 2BVEA 3QHTC 2R4RH 4PJXE 3RWHA 1MRCH 5DURD 5F89A 3VFVB 2CLRB 4PV8B 5HI5D 1ODAA 2ZSVB 1U3ZA 4JREC 4MAUL 4BZ1H 5JQ6H 3BAEL 2E9IA 4PTUA 5I8KL 3CFBB 5F7HA 1LO0L 4WWID 5E2WH 2YXMA 4X99A 1JPGB 3S36H 2IEPA 1BOYA 1TITA 1T22B 3CFEA 3MODH 1J5OH 3AMLA 4N0CA 3EYVB 4WENB 3Q5OA 2DLHA 1G7LA 4K3JL 2ILLA 2FEEI 1SEQL 1IGTA 3PDGA 4MA1C 1F6FB 2EIZB 2Y07H 4EDWL 5MEPB 2VXQL 3QUXB 2FNBA 4MXQA 1BFVL 4V1DB 4QCIB 2Q86B 1BWMA 3ES6A 2EZ0C 1RU9H 4EQ3A 1HNGA 5F89B 2E7LC 1NLBL 2IG2H 3OAUH 2DS4A 5EZIL 2A6IB 4HAFA 1T7YA 2D9QB 1E4WH 3RWDB 1RUKL 3GJEB 4PTUB 3L5IA 3O2DH 4PUBH 1I3GH 1A4KA 1AXSA 4L4JA 4TRPH 1JZ6A 3WFEH 4UILL 2BJMH 2NY4C 4L8SA 3WDJA 1QSED 2X42A 3QDGD 2VLLA 3QFJA 3CFEB 4WHCA 1FZMB 1ZVYA 3BGMB 1U8IA 4HUKB 2EDOA 3D85B 1OLZA 2E7LA 1G7LB 3U0WH 1T03L 3S34L 4KI5D 4YE4L 1IGTB 5B38B 3AM8C 1KNOA 5FYLE 4NN7B 5DLML 3ES6B 3MZGB 4QXGL 5FO8A 1EVTC 1U2CA 2YWYA 5MI0B 4F2MA 1WBYB 3S88H 3I6KA 4N8CL 4EOWH 4M7LL 5EPMA 2Y36L 3SBWC 1FAIH 3BZ4A 3U7WH 4NKDA 5CEZD 3ZE0E 3O2WL 4GBXD 1TZGL 1A6UL 3MBXL 1BPVA 2QL1A 4C56D 4XMPL 1A4KB 3UJTL 4JZJA 5I30L 3MCKB 3EOBB 5MP6L 4L8SB 1T1WB 4RFNB 3THMH 2R2BB 1EX0A 5JXEC 3KHOA 1FFOA 1N5AA 2AK4A 1JVKA 2ATKB 4V3EB 3QEGL 3ZYIA 1I1FA 1G9EA 3LPGA 4KMTH 1C5CH 2APBA 3LV3A 2OJEB 3BEVB 4YEEA 5T3ZE 5DC9B 3CVHB 1KNOB 5KSUA 5E99L 4ELMF 5FHBH 4MJIA 2AKRA 4OQ1A 3ZKXC 2LU3A 3GBMH 3PQYA 1U42A 2EDQA 2M1KA 4HWEL 3TZVD 1ZT7B 2DWDA 3DBXA 4PRPA 1FYHB 4JDZA 3STLA 1EMTH 4LOUC 4FQHB 1NCBH 1CN4A 4XCYA 1CDHA 1HINH 3MLTA 4NZUL 2DJSA 2Z91A 4YGVA 4OZIE 4AEIH 4POYA 4AJ0A 3SDYH 4X8XA 4B41A 2R23A 5CGYC 1AH1A 1FV1B 3D87B 4JZJB 3IKCB 2ZUQB 1A2YA 5FECA 1Z3GH 3OGOE 3SDAC 2HP4A 2OCFD 5IROA 2XTJB 4NQDD 3O0RH 3MGOA 3RX5A 5AWNL 3VXMA 4NO0A 1WF5A 3SKOA 4UUJA 1ONQA 2Z35B 3RIFF 3BPCA 5IB4A 5KSUB 1ZHBA 3VFGH 1AC6A 4O5LL 3P0GB 2VXSL 2JJWA 1BM3H 2DL9A 4P3DB 4OZHB 5IVXA 3OAZH 2XQBH 3SDAA 1DBBH 4JFZL 2DWDB 1U3JA 4HD9A 1AKJA 3DV4A 4PREA 2IFFH 3MLTB 1HQ4B 2ZCHL 3I02B 2R23B 1JTTA 4QRPE 1UZ6E 4JPWH 4ODBD 1PKQE 3P0VH 5D7KE 1YNLH 3QIWD 4P2QB 5EU6D 5E9DB 4TNVF 3O2DA 4TVSa 3GMMB 4Z7QF 4WRLA 3D0VA 3BRGC 4P46D 2ZKHH 3ARUA 1CLYH 3IDGA 5FKAB 3OL2A 3VXMB 1BHGA 4NO0B 3SKOB 3ERYA 5IB1A 3B8SA 4HC1H 2CK0H 2QSTA 4ODXA 1ONQB 4LHUD 4HXAL 1AQKH 4HPOL 2LV4A 4PV9A 1OAUL 1BVLA 4HPYH 3KYKL 3OR6A 4Q9QH 1GAFH 3IGAB 1BEYL 2H1PH 3RHWK 3T2OA 5CGMA 1KLGA 1XIWB 3PWUB 1VACA 1N59A 3L3GA 1RZFL 1AKJB 2HTLC 2AABH 5E6ID 1KCUL 5DFWH 5I18L 2RFXA 1CXEA 5LGKA 1D6EA 4ZO8A 3WS3A 4F80A 4I77H 1GCFA 3E8UH 4M93B 5I2IA 3IJHB 3QG7H 4J12A 1G7IA 4CMHB 2P5WB 3HLAB 3AROA 3SQBA 4M6OH 1CLZL 3MACL 3BH8B 5AYUL 3D0VB 5ISZE 1UQSB 1UWEH 1DCLA 3I9GH 1XGUB 2MNUA 3QH3B 1NAML 5D6CB 4ZFGH 4YPGB 4ODXB 4KXZI 1QLFA 3DO7B 2P8MA 4L29B 2X7LB 3DVNA 1JNLH 3GM0A 3V7AG 2ZCLL 4MQXC 3TO4D 1A9BA 2ZP0T 3PGFL 2HFFA 2V7NB 3QJFA 3FZUC 1NJ9A 1L7IH 2QTEA 2CGRH 1WEJH 1S5IH 5J13B 4EBQH 1R0AH 3UTTD 5DMJB 1VADA 1RIHH 3C8DA 5LXGL 3WS3B 3IDNA 4BM7A 3ULUL 43C9A 4OQTH 2QHLA 1DJSA 3S36X 2MQ0A 2Y25A 1V05A 4PFEA 5KANI 3MLXH 5HHMD 1G7IB 5SX4I 3U0TA 1OTTC 1M7IA 1YMMD 3VDBA 2B8OT 5IBUB 5F7KC 4ZAKB 4NQCA 2YKLH 4S1SH 5IGXH 3VFRA 1OCWH 3BDYL 3QXDA 4AQ1B 1RD6A 3GSNH 3D2UD 3DVFA 4PJBB 1XGQA 2IH1A 4W4OA 4NN5B 4N90E 2HG5A 2B2XL 4ZFOA 1DUZA 4J6RH 5SWZA 1C5BH 4HXBH 4EJ1C 3BKCL 2HFFB 4TSBH 1R5IA 4RRPA 3ARDB 1NJ9B 2HRPL 4G9FB 5I1HL 4KJQC 2AK1L 4C83A 2YZ8A 3BGFC 2BNRB 1WWWX 4GOSA 1A0QL 3IU4H 4PJCE 3ZT6A 3V6OE 3CX5K 3QUYC 4KQ3H 4MDJA 3ROOA 5IFAH 3VA6A 1KT2A 1RI8A 4QRUA 4XXCA 4POUB 1BGXH 3HRZB 1U6AL 3VGAC 3FQTB 3GZKA 5HYQB 1MJ7L 3VFRB 5I19L 2VISA 1HILB 1F6AB 1J0ZA 4QRTA 4BH7A 1L6XA 1XGQB 2D03H 3UBXA 5IWLA 3SKJH 1AGCB 1OGTA 3TWCH 1DEDA 3QUYA 2HJLB 4UT9L 2OTUA 5F88B 3ZDZF 3NAAH 4WUKH 2VR4A 5GS3A 3DUHA 3QB7C 4Y2OA 3KDMA 1DQDH 4PB0H 3HNVH 4OJFL 4ZPVB 4NNYB 4YHIA 4C83B 4FQXB 3KPMB 3E3QC 4LCCC 3MV8E 5CCKH 5T33H 3IRPX 3QIBA 4Q0XH 3OJDA 4AH2A 3VH8G 2V5MA 5FDYA 3G5ZA 3SDXF 3TBTB 4OZGA 5J3HD 1BJ1J 4MB3A 4RWHA 1Y6KR 5GGSA 4YIQB 2R69L 1K4DA 1WC7A 2LTQC 4TSCH 2DD8H 3UJIH 3CDGB 3ME0A 5CMAA 2GITA 1P7QA 5T3XD 1VA9A 1QSFE 4GMTH 1ACYL 3ZHKA 5CEZL 3WSQH 2IMNA 2Q8AL 3E3QA 4LCCA 3BSZL 1EIBA 2EH8L 4NKIL 3PL6B 3EJZC 1IC7H 5I8EB 2BCKB 3ROLA 1MFDH 3OR7A 2P7TA 3DX6A 3HC3H 5T1DH 3TN0D 5IR1B 5EC1A 4RX4A 2O93L 2XZAL 4S0SD 1Z5LB 3P77B 4LEXH 2NY1C 4JFEA 1CG9A 3MLYL 5KS9A 4D3CL 4BQ9A 1JK8A 3MRRA 1MLCB 4XP9H 4Z76A 3A6CL 3QIBB 1ZT4B 3HCVA 5L6YL 3OJDB 4ZOEA 3DGGA 4EI5D 3C5JA 1FNHA 2PTVA 1U8HB 1NAKH 5D7JC 3ZTNL 4R4BB 4F37F 4OKVB 4OQTA 5HI5C 1KELH 5AYQA 1P7QB 3RJDA 2DN7A 5A16B 3BYYA 5ALCL 1J12A 4JPVL 1VGEH 4PJEA 3EYSL 1CGWA 4K94C 4XPTL 4XH2A 1F4WH 2JELH 3B6SB 3DX6B 3GSNA 3L3DA 5EC1B 1EFXD 3D0LA 5F7LB 2VDLH 4KROD 3VFOB 1CDJA 2XG5A 2X4UB 3NCYS 4ZO6A 3OZ9H 4ODHL 5IBLD 3OWEA 3NABL 4HIJB 5CZXD 1CDUA 4RWYH 4XP1H 5FGBA 3KYMB 1S7UB 3K8MA 1R3KB 2NTSP 1XF2B 3ZTJH 1WGOA 5INCA 1X7QA 1CF8L 5EIIA 5IW6A 4JRWA 1X5JA 3WYRA 4JHWL 1NMAH 4P2OD 3PIQB 1GH7A 1JMZA 4QRSA 3VI3E 4DCQA 5LWYL 1KJVA 4F9LA 3VXUD 4QTHA 3V5KA 4MGXA 4N0YL 4HWZB 5KVMC 2H26B 4HIHB 5DK0A 1KGCE 4XH2B 5ACZA 5K59F 2AJYH 1YJDH 4L3CA 2OTPA 4OZIB 4R4ND 3RA7H 2YD7A 3ZSTA 4ZO9A 4Q9RL 3FHAA 4OFPA 1KN4H 1NGYA 2FEEL 5HYIA 5FDWA 3P4NA 1AFVL 4F9PA 1T7XA 5DFVD 4M1DL 5GS0D 1BQSA 1DQML 2VQTA 2FIKA 1ROWA 4UOW0 1FORL 1OLLA 5FUCC 5HDLA 3T77A 3LDBB 5TDNB 1JGUL 1CZ8H 1Y18B 1JUFA 4FQ1L 4LKCA 1HXMB 2NY5L 4D2NA 2C7UA 2DAVA 3BIAX 1LE9A 2ICCA 1IGIL 5INCB 3QDJA 1YEEL 5L2KA 1DE4B 4OB5H 3HHRB 4JM2A 1E6OH 3MRQB 2YD8A 3CMOH 4P4KB 5I1IL 2CXKA 4UV7H 2OR7A 4P59L 1UVQA 1JYVA 2RHEA 3QZWA 1AI1L 2DQIL 1KJVB 3C08H 2ID5A 4EKXA 1YQVH 1CFBA 5DK0B 2XQYK 2X4PA 3TC9A 5J11C 3GBNL 5ACZB 1G7MA 4R2GD 4WUUE 2D0GA 4HHAA 4LHUG 1TVBB 4QRPB 4RMVA 1QYGL 2BDNH 4WHYH 5GZOC 5C0BA 2EYTA 5TE6H 3VFTB 4UAOC 2F53D 5BZDA 3PWPE 1AGFA 3DXAD 4IRJC 5F9OH 1JHLL 3O6LL 3ILQC 2UVFA 4U6VL 3WIIH 5IJKA 1BOGB 4OGYH 3P30H 2R15A 5HSFA 1QVOB 1A6WH 1K6QH 3CAFA 3QQ4A 4X7CC 2V9QA 3BQUB 2DQCH 4ELKA 2NX5E 1MAJA 4OFIA 2W65A 4LIQL 1ZA6A 5T1KB 1V7NL 2X4SB 2VQUA 4OUUB 1CXKA 1U91A 5F9WC 3QZWB 2UVEA 5F3HA 3O3EA 1JYWA 4IRJA 2BC4A 4JFOA 4DEPB 5IP4A 4ODVL 1A22B 4YDIL 3UZEA 1B2WL 3CSPA 5F96H 1A7NL 4CN1A 1YZZA 5C0BB 4PJGE 3TBVA 5JA9A 4JY4A 1AGFB 2XA3A 1J9CT 3GB7B 3O9WC 1G9NL 2VLKA 4HDIA 4XTRD 5FGCE 1CGTA 4IIQA 3UTZA 1MHPH 3CFJA 1A1MB 4ZNEE 3I3BA 5FF6B 1B4JL 5IVNA 3AS1A 3DSFL 3ARGB 3QQ4B 1E27A 4Y4HD 2Q87A 4AMKL 1YJDC 2YD2A 1PX4A 1X5XA 3RWFA 4PJHA 1IC5H 2WIMA 1WZ1L 3MNWB 5I71C 3TJHA 2CLVB 1H15A 3HZYA 4JFOB 5HYJA 4IOSD 2B1AL 3SGKA 3W0WE 2YUXA 2FX7L 4X4XB 2C3HA 4NFCA 2GTZB 1Q0XH 4P46C 5C1MB 4LAQL 1MFAL 4MX7A 3GKZA 2P1YA 3WFHA 4M03A 5C09D 4R97C 1MAML 4QHMA 3X12A 1FN4B 1OB1B 5F21B 3CC5A 3AXLA 4LVHB 4QWWD 4O4YH 4HDIB 5DUML 1J05A 1RJZA 1REIA 3C09C 1E27B 4E41D 5HVGB 4CRPA 4IRSC 3I2CH 3LS5H 5FK9A 2AXGA 5ENWB 3QPQC 2GYSA 3W2DL 5FYKE 4R26L 2LAAA 4HUVB 1FPTH 3MYJB 5T5NG 2KPNA 3TBWB 5T1MB 1JGLL 1H15B 5DD5H 5HYJB 1LK3L 1J0IA 5FGRA 2CLZB 1A14H 3QR2A 3P11L 5HGBB 1HHHA 1PZ5A 4JB9H 1ED3B 4LVNB 1DFBH 4LPVA 3MV9A 3WEXA 5C9JA 3O6ML 4MXVE 5H2BB 4GKZA 5T3XL 4IRSA 5ITFA 5T1LD 1U58A 3MRHA 3IYLW 1DBJL 2J8UA 5JLZB 4GKNA 4P4RA 5DMKA 2A2QT 3LN4B 3KYOA 2W92A 3FCTA 3AXLB 1AR1C 1NCTA 3RPKA 3L5XL 3EIFA 3T3PE 5I1GH 1S9XA 2COQA 1MHEA 4KZEL 4X5XB 2JB5H 3TO4C 1E4XI 3TT1H 1NBZA 3QWQB 4XZUA 5KTEL 4N0UB 5FK9B 3W39A 3GI9H 4Z0BL 1EV2E 3O6FB 5FYKU 1WICA 4NM4L 3GIZH 4LRIA 4ORGA 4OIAA 1DLFL 2F19L 4GRLC 4XBEH 3AY4A 2OZ4H 3ZL4H 4U1JB 3BDBA 2WBKA 5KVDL 4WHTB 3V4VL 3WEXB 3T3MF 3H7LA 3OB8A 4GKZB 1NFDF 4JY6B 3VDAA 3LD8B 1IM3A 3F5WA 1U58B 2ZG2A 5FOBB 2A6KB 4XNZC 3WHE0 3K74B 3LRHA 2KZWA 4PJIF 1KEML 5GISH 5DMKB 3QPXH 3KYOB 2W0FA 2Y1VA 4GRLA 4JLRA 2J4WH 5HY9A 4YFEA 1UWXH 2MPAH 5I1KH 1EUTA 2V7HA 1F3DH 2ICWB 3LEVL 4XX1E 1D9KB 5B3NA 2A77L 4AIXA 3KXFD 4D0CA 2NYYC 2NXYD 2NY3B 2ZUUA 1IT9H 2H2SC 3W9DA 1CFTA 5LCVH 2XN9A 1FVDB 3G6JF 4ZODA 2AI0L 4GG6F 3QIUC 2DLFH 4XAWL 5A3ID 4N8VA 2HT4C 3GO1L 5IOPB 4YGAB 1F11A 3DTXA 1GGTA 1X9QA 4XP6H 3HE7B 4HMEA 4XCCL 2OTWB 4K7FA 3V0VA 1UWXK 2E7LE 4L3ED 1T5WA 5MEND 3X3GH 3LN5A 1G7HB 2VH5H 3OXRA 1RULH 3MLWL 1OQOA 4P23B 4YR6B 3CD4A 4N0FA 2DTMH 4LLMB 4NRZA 3F5WB 3UZQA 1X5ZA 5HBBA 5HHQA 2VXUH 2RCSH 2FZ3A 1MWAB 4UQ3B 3RDTC 2JE8A 1Z6JT 1ADQL 2G5RA 4PJ9B 4ZUSB 3MTRA 1Z9SA 2A73A 3W5MA 5KANG 1AXIB 4M7JH 3OKNA 3I6LD 1T0NA 3S98A 1FC2D 4F57L 3BRDA 4LCUB 4I3RH 5IQ9B 2IPUG 1NFKA 4R8WH 5GS0L 3N50A 2IGFL 4FFVC 4KHTH 2NXZD 5C08D 5DRZB 3HKFA 4OF5A 4DKDC 2IPTH 1EEZA 2MKLC 3RDTA 2R8SL 2ERJB 5LAXB 5J3HC 5I6XC 2AV7A 4W70A 3OXRB 2CIKB 3VWKC 5F7FA 4S1QL 4AQOA 2WWKO 3R06A 3L5HA 1X5LA 3EO0A 3L3IB 2V2WA 3NCJH 1KCRL 3WL9A 1NGQL 3ULSA 4GXUN 4UDTA 2BY1A 1S7SB 5HHQB 1HHGA 1FGNH 4LASH 4PTTB 3IAQA 1NBVL 3L3OB 1EHXA 5C6PB 2W1NA 3UTSA 2IWGA 1T0NB 5GRYA 4M7ZB 1CQKA 3MREA 4XVUC 1J8HA 3GSOB 4BZYA 1CIUA 1HKLH 1M1SA 3U9UB 3W5NA 1EXUB 1BF8A 1XGPA 4WI3A 5BVJA 1H5BB 4M4RA 4NM8H 4V2BA 4ODSL 4CW1B 1AGEA 5DHVB 4EI5C 1INDL 1B0GB 5D93C 4K7PY 2G5BA 1JZ5A 4O2EB 5IEHA 2EDBA 4JRYB 25C8H 5KSAB 3T1FA 4I8DA 3SE8L 3IFLH 2OZ4A 2C5DC 5GJTL 5TDPB 1JPST 3HUJF 1JGVL 3EO0B 4CU7A 5D2NB 5DQ9A 4X4ME 1S8DB 1MELA 2J88H 2UZXB 4YZFF 1ZTXL 3IFNL 2YK1H 1LEIB 1AHWC 2Z4QB 3FTGB 4RMTA 1QQDB 4M1GH 3RJQB 3LQZA 2IQ9H 3I6GB 1N3NA 4PPTA 3QDMA 4WWKD 4ZXBB 1YN7A 3U36A 5AEAA 3M1BA 1MJJA 2YPKA 1WT5C 1AR2A 3D48R 1P4LA 4KROC 4U4BA 5E2UH 3MJ9H 1IZJA 5BJTB 4J23A 2BZDA 2FDBP 3HG1D 4HS8L 5IBLC 5BVJB 5CZXC 1AGEB 1ZVHA 4PJ5D 3T2QA 2BHZA 3DIFB 4PY7A 3B9AA 4HULB 2BX5A 3T1FB 5D2LB 1MJUH 1YPZA 1ZMYA 1MQKH 2F5AH 4DZ8A 3P4LA 1U93A 5DQ9B 4PJ8A 2VLME 1XGTA 2B39A 5EOQL 4M61B 5SWSA 1BBDL 4UIMA 5DD3L 1ITBB 4QTIH 1TTGA 3TO2A 3QUZA 3N85L 2DMCA 4WFHD 4NKOA 2BSRA 3FQXB 3LQZB 5EOCJ 3DETD 2BOCB 1F00I 1GC1H 2X4TB 3O8XC 4HKZB 5HJ3A 4GAFB 4U33A 3M1BB 1RJYA 1FE8L 3NIGF 3CFIC 2X05A 1A6PA 3T0XA 5GS0C 2NY0B 2OP4H 3C60A 3QUKB 3ARFA 3ARBD 3T04D 4Y5XB 4Y2DA 5T5FL 5FA3A 3BRFA 3NH7H 4H1LB 4JVUA 4RBPK 1AC0A 1OP5H 1F90H 2IAMB 4JQXC 4Y5YB 3I85A 4UTBH 1B0WA 4CVZB 5I15H 3MPCA 3KJ6H 1U93B 5DFTA 4PJ8B 1JI1A 4QRRE 1FNAA 4XPHH 4FQ2H 1SY6L 5DR5H 4U0RB 4KVCL 3IFPA 5L8JB 4NYLA 4MLIA 1M7XA 1ZEAL 5EOTB 3TO2B 1WZLA 2JK5B 4Y4KC 2Y9RT 1OP5K 3FFDB 3HC0B 4L1HA 1BQHA 4LPUA 4NQSA 4UZGA 5F9DC 1CBVL 3FOLA 4Q9BA 4JQXA 4WJ5A 5GS1C 4JKMA 1T83A 4JO4H 2DQGH 1FL5A 5D7LD 2NR6C 3VDCA 2CRYA 3PWNB 1UM6H 1JI2A 1KFAL 1D5BB 2DQFA 4YXLL 3CCHB 4NP4L 3IETA 4Z77A 1IGML 4Y4KA 3RGVD 1FYTA 2DRUA 1DVFB 4R3SA 4WFEE 4LGSB 5CGTA 3RTQD 3ECBB 2X4RA 3SJVA 1KLUA 2RGSA 2JJSC 2AJ3A 1JGDA 5DHYB 5TF1H 3SCMA 3QWRA 3F62A 3BIBX 1YEIH 5HI3D 3HI5L 2F54D 5EZLA 1BQHB 4F15B 1RVFL 1IAIM 2DM4A 2ZSWB 1HYRC 5JNYB 3BAEH 4ZOCA 4G6ML 5F70A 3V95A 3QXAA 1RV6X 3RWCB 2EYSB 3BP7B 5CILH 1FBIL 3QCVL 2Y06L 1EEQA 3U1SL 4PGZA 4UT6H 1S7QA 5D1ZD 5J8OA 3MJ9A 3GGWA 1J18A 2C4FU 4M8QB 4D9RE 1NUNB 4XVSH 4R3SB 3MNZB 5KSVA 1DANT 3MXWH 1KPRB 2AQ3A 3C2AH 4GS7B 3ZKSD 3EO1A 1K2DA 4E42B 3C5ZB 1R3IL 3FB6A 3BZEB 1T1XA 2AJ3B 4BSVA 1I9IL 3DHMA 4IOIB 1KV3A 3F12B 4NSKA 2WP3T 4L9DA 5I9QC 1NLBH 5EZIH 3SGJC 3VCLB