3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
2OL3L 1G7IB 4JQIL 4D0CB 2AJXH 5ADPH 3FO0H 3ULUD 2I07A 3LY6A 4QHUB 1RIUL 4NNPH 2XYCA 4KMTL 5BW7C 2OYPA 1NGQH 4TRPL 3MV8B 1ADQL 3BJ91 3TP4A 5FYJU 3F5WB 5F7NC 1U3HD 3EYUH 5EBLB 3VGBA 5L0QB 1XIWB 3P0GB 3VE0B 3NZHL 1OTSD 1I9JL 4X83A 4XBEL 5H37G 5JXAH 2ARWA 1WCBA 2X4PB 4HEPG 3DX6A 3L3KB 1ZANL 4WIQA 4C57C 2GEEA 2ZCLL 3LCYA 4R7NA 4WUUA 3ROOB 1MCWM 25C8H 1KIPA 4FTVE 4X7TB 4UDUB 4Z76B 2KKQA 3TEUA 4HGMA 1CFTB 5DRNA 5DGQA 4UTBL 4Y4HC 5HVGB 1BOYA 1TCRB 4L8DA 3BP7B 3N1GC 4I48B 3OG6B 4JGJA 4IRZL 4Y1AD 2DQCL 2ARJB 4U1LB 1TJHL 2AJZB 4MHHG 3NZ8A 1QSFD 5IOPB 3EJJX 3GSXB 1QSED 4Q2ZA 5CINL 3MOBH 4FXGB 5CGYC 5KJRH 4P9ML 2C5DC 4U33A 5HHQA 1JGUH 4HWBH 4K71C 3P4MB 5DFVD 1R5IB 4X98A 4PGDA 3PL6B 1H8NA 5DA4A 4LFHD 4PJ5B 1QRNE 1QLFA 5KTEH 1ZLWK 3ARFA 4L9DA 5K9OA 3HC4H 3BDBA 4JRYE 4QLRA 4PRIE 2YD9A 4ZS6D 4EUPB 4ELMF 3QZWG 3IETA 3T3ME 3UTQA 3D5OF 2PW2A 4QHLB 5BMFH 2A9NL 4PJGA 3QWOA 5CEXA 4HAGA 4L9LA 4KJWC 3BHBA 3OBAA 4NBZB 4ZUTB 4LVNB 4JDTL 3L3DA 2FJHA 4XNQB 1G0YR 5A3IC 1H5BB 2OJZH 4OGYL 2CH8A 1F2QA 3O2DL 1RIHH 1ZVYA 5DD6B 2D7MA 5C7XH 1NCDH 1HINH 1X3DA 1KTLB 3WNMA 3HR6A 2FX9L 1FO0B 5IHZB 3UTTA 3GJFB 4RISL 3LV3A 3ZDZF 4NRYA 1ULVA 1DN2A 3L7EB 3RGVA 1MOEA 3QUYB 1OAQH 3UTSB 3RIFF 1A7BA 3WIFB 5IWLC 4PJEF 1NGWA 3HLAB 3MLZL 2DLGA 3K0WA 4HIHA 1TPXC 1MRCL 1RURH 3B2VH 3T2OA 5AD0B 4Q9RL 3ARBC 3QUZD 5IMLA 4EI5B 3OSKA 5DQ9B 3W0WE 4RWYH 3W2DL 4A6YB 3ARDD 5IKCA 1HQRB 3GSWA 4Y4KA 2BC4B 1MQKL 4HGKC 4P5TD 4PJHF 4NNXB 4ZNEE 3KYMB 4G8GB 5BZDB 3TGXA 2OI9C 2DS4A 2PO6C 1AH1A 1I7ZA 4ZNCD 2IANA 4Y5XA 1GGCL 2WP3T 5EORL 5JO5A 1CFQB 1C8PA 2G2RB 3MO1A 4HHAA 5BV7L 5IV2A 4QRQB 5KW9H 1PY4A 5I8KL 1YEEL 5TF1L 5TQ2H 5IEHB 1Q0YH 1OTUC 4HS3A 1FZKA 3HS0A 3U9PL 2GAZB 5D2LB 1FL6A 1U92A 1VFBB 3A6BH 1X44A 1MFDH 1I8MA 4CU7A 1UH3A 1DLFL 1NC4B 4WW2C 2ENYA 3HPLA 3MLWH 4L3EA 5IMMA 3CVIL 3QHFL 2J12B 4PGZA 3SGJC 4JCLA 4UAOB 1NMCB 1U8KB 3QIBB 5T5NG 4KKAD 1DL7H 5DJ0B 5C0DB 5I0ZA 5DRWA 3EDJA 3QA3A 5C08B 1D9KC 3VI4E 3DX9A 4XP9L 4LLAA 3R0NA 4KJYB 2BVPA 3WJLA 4LHUA 2VR4A 3EOTH 1WZLA 4KJPC 4KI1A 4AT6A 3O11A 1ZT7B 1WF5A 5EU3A 4LSQH 2DRUA 3VXSA 3B9VA 4FQIL 2FATH 3TYGH 3LKRB 2C3GA 5C3LD 1RZ7L 5FYLH 5D1XA 4R8WL 1WBZA 2O5ZL 1U3HB 3C60B 3MRKB 4PGCA 3FQTA 1T4KB 4KQ4H 4KKNA 1LO4H 4XCFH 1N3NB 5DMKB 2B4CC 1XR9A 2XKNA 1ZA6A 4LLQB 4PJIA 5HGDA 1I1AC 1J86A 4PV9B 5I1AB 2XZCH 1HHHA 5JHDE 3F58L 3MBEA 4NNYA 3FO1B 3DRTB 4G9FD 2OXGA 3EHBD 1FZMB 2DQEH 3KAAA 4TUJA 2LU4A 3WE6B 4HJJL 4QRUB 4WU5B 2YSSA 2JJTC 1G9EA 1FE8L 1W72L 3O3UN 2D03H 1QG3A 2NYYC 4JFFE 3I02A 4H26A 2R0KL 2BNRA 3L6FA 5JHLL 2WIIA 1QP1A 1NANI 1U2HA 4YWGH 4TUKH 2R2EB 3GSNH 5E4IA 1G7QB 3M1BA 1QSFB 2I5YL 3P0YH 4QTIH 1JF5A 5I6XB 1QSEB 4XC1L 1X5KA 4UZGA 2JCCA 1BWMA 2X4TB 3VI3F 4P99A 4ORGB 2D7OA 1K4DA 1ZWIA 1XH3B 2CKBA 5EA0L 5IHBA 4GO6B 2FJGB 2DLHA 4DUWA 2E7LA 4GXVH 5K33A 1BVZA 3DGGA 4RFOH 4RDQF 4PR5B 3ARGD 2IPKB 5EPMA 2X5PA 1AGDB 3MNWB 3D3VA 1EUUA 3SCMD 4C58B 1ACZA 2EDRA 3MFFB 2R9HD 4Z18A 3RDTA 5JUEL 1C08B 2NY6C 3WXWH 2B0SH 5F1KC 4KVNH 1FL5B 2Q20A 4PG2A 5CEZH 1DUYA 4PBVC 4GRLB 3STZA 3UMTA 1GXEA 1FFPB 1CGYA 3PP4L 2DKSA 5C2BH 2VITB 2XQYK 5GPRA 4JKPL 1OGTB 5IW1B 5GGSB 4OUUB 3IS1X 1JGDB 4G3YH 3C6LA 2BCKB 4CVZB 3FN0H 4F9PC 1CK0H 2DYPB 2IALB 5KANI 3QUZB 3KGRA 4G5ZL 3V4PH 4U6XA 3QIWA 1UWXH 1YEKH 3H9SA 4P5TB 3OF6D 3D2UA 2GSIB 6CGTA 3JTCA 5DO2C 4LCCB 4Q0XL 5JR1L 4F15C 5ESQB 3IDGA 2Y07L 3PHOB 4AIOA 4X6CB 4N0UE 3CFEB 3IAQA 4JZOA 4R7DA 3MUGB 3LVEA 3IJSA 3ULSB 4HCRH 2NX5E 1Q1JH 4TVSa 4P4RA 3VXPA 1EHLH 4OCYL 1KFAL 4MD0B 3JZ7A 3I3BA 3SDXA 4YFLF 2J88L 2CO7B 5KS9F 1Y0LB 2VB5A 3VG9B 5JOPD 1YJDH 1XZ0B 2C3VB 4RMRA 3ZYZA 1UADC 2C26A 2MCPL 3AS1A 5K59E 4ZO9A 1UT9A 4JFYA 3D0VA 4YO0B 4FQ1H 5F1NB 4C56A 1J12A 5I8CB 1T7VA 4ZUWB 4KHTH 3QI9C 4Y4HA 3DBXA 2J8UB 5IMKA 2VERN 2UVFA 3IFLH 4HBQA 2CGRH 4WDIB 5ID1B 1S9VB 1J10A 1EAPB 3QQ3A 5FO8B 4I5BB 4JY4B 4RMVA 4Z0BL 3GK8H 1I9RL 1XGPB 4HPYH 3TZVD 5CWSB 3DPBA 3HC3L 4B50A 5IVXB 2BVQB 1S5HA 2NY3C 4FXKA 3DURB 2BXYA 3PQYD 2V2TB 4XP6H 4NQVA 3MGTA 2I26N 1OL0A 1RJYA 1WBYB 4MXQD 3SGKC 1RU9L 1TJIH 4I4WA 5ENWA 3RU8H 4DGVL 2AEPH 3DTXA 2R4RL 3QQ9C 2AW2A 3P77B 3B5HA 2FBJH 3GGWA 4LHQB 3VXUD 4PP2A 5ELIA 1EBAA 3VFVB 4BQ9A 1FZOB 4G9FB 3OMZA 5E0QA 5IB5B 3RUGE 3JV4B 4RMWA 3WKML 3L5XL 2PTTB 1VGEL 1BFOB 1OQXA 1SVZA 5GRUL 5E6YA 1Z9OA 4S2SA 3AS2A 4PRPE 4JB9H 2MHAA 2QKIA 1LP9F 2ESVB 5INCA 3E0GA 2JIXB 3WS3A 5CSGA 3BGMB 3D39E 1TFHA 2MQ0A 3M8OL 2DQJH 3ERYA 5FYLD 3NA9H 4MAUH 3D85D 2LU7A 2W60A 3BP6B 3IGAA 3TCXA 4D2NA 1VFUA 5ICYB 1KV3A 2XZQL 4WW1A 3NFSL 4OFYA 5F9OL 5H37H 2VQ1A 4NDMA 3SCMB 3TH2T 1MAMH 2HVKB 4KUCD 4WI5A 5DQDL 4GRMB 4BJLA 2OI9A 2PO6A 2H6PA 4YEFA 4F57H 1D5XA 5CLWA 5DVLA 3WSQH 4E41D 2J6EL 1BQHA 2B2XL 3LZFH 4PRHD 3SQOL 2BSRA 4AEHL 1AIFB 1A7QH 1O7SA 1FIGH 3BKML 4KRPC 3VGGA 5IJVA 2WQRA 1KYOJ 2YPLD 4M9OA 3DUSB 4XVUD 4QCIB 3SE4C 1G6RL 3GB7B 4NQEB 3ZT6A 1SEBA 3ARYA 4LLWA 3RTQC 5BRZE 4S1SL 3REWA 4XI5C 4RMUA 2NXYC 4XPTH 4XPGH 3JV0A 1KN4L 3GMMB 4XCEB 4NCDA 1EGJL 3OKLA 1AGCB 3LN4B 5D96B 3V9FA 5D5MF 4WW2A 2VXVH 4NWTL 3F6IA 2WWKT 4X6DE 4UU9A 4JGMA 3WJJC 5J06A 4R26L 3L5WA 2Z8SA 2V17L 2GIYA 3ARPA 3H8NA 3SDYL 5LQBH 1XAUA 4L5FH 1HCVA 1BVKA 3PWLA 4HS8H 1ZXQA 2APVA 3BN9C 5DSCB 1KPVA 3TBSA 2X9XA 5BS0A 1MAKA 2GT9A 3RNQB 4Z7UA 2ZG2A 2VZ1A 4BA8A 1MFAL 1KCSL 4XAWL 5CEZD 1K3ZA 2QQKL 4X5WA 3N85H 4WO4C 1F45A 4K94L 3WL9B 3EAKA 4IEFB 1X5LA 3LKSB 5DD3L 3JTSA 4QNPE 1UEMA 1BM3L 4JPWH 2F58L 3NACH 4CW1A 1T1ZA 3B9KB 4WFHD 1FVEA 4PRNA 3BZ4A 2CPCA 3PP3H 3SQBA 1I1AA 1BECA 2E9WA 2DMBA 3PWPD 1X6NA 5JMOC 5J3HD 4PJDA 3BP5B 1G9NH 4DQOH 2OTUB 2AI0L 5F1OB 4M5ZL 1QA9B 4JANB 5IGXH 1A8JH 5TF0A 2W9EH 2APXA 2JJTA 3H3PH 4JO3L 5FHBH 5E5MA 2XACC 4LEOA 3ARWA 2VLJA 4U1HB 4HWUA 4DKDC 5I17A 3ZYIA 5HHVL 3KYAA 3HA0A 4RFNC 4JN1H 2BDNH 4QO1A 2P8PA 2DWDA 3H6JA 2R69L 5FV1L 1J8HE 1LO0L 3EYSL 5DD5H 2QTEA 2YWZA 5AUMB 4L4VE 2R0LL 1V7NL 3QG7L 3I9GH 4ZUVB 1FNFA 4UV7H 1UXWB 3BPOC 5L7XL 3GNMH 3PQYB 1ZEAH 1DP0A 4NC2B 3C2AH 4LAQH 1KTDA 3KPLB 1LVEA 2NZ9D 2OR9H 5LKNA 3ARRA 3WD5H 4ELMB 4AG4L 1IAII 1CG9B 3OAYK 4WV1C 3UPAA 2X4OB 2E7CA 3VXUB 3X3GL 4GRWH 4KVCH 2YRZA 4JO1L 2WLYA 4KAQH 1F4AA 3OKEA 4YX2L 3OAZH 3TH3T 5C0EB 4ERSL 1NBVH 4N5EA 5AEAA 3REVA 5DUBB 3I50L 3L9RB 4YIQA 5IFAH 5FOBB 4KUZL 3FT4A 4CN6A 2VSCA 3HMWL 3MRGA 2R8SH 3C8KB 3RX5A 1V3KA 1QFUH 4JFXA 4LGRB 2YEZA 5F3HA 3BH9A 5FGCE 3TVMA 1KC5H 2NLJB 3ARXA 4HKZA 3GFUA 4BZ2H 3D85B 1CD1B 5E5RB 4DK3A 2VDPH 4F9PA 1B4JL 2DQUL 4NQDD 4FZ8H 2ICWA 4LSTH 4K3DL 4ODSH 1AGEA 4N90D 4EKXA 3JVGC 3KXFD 2YMXH 2PTVA 4FQPA 4MJIE 1GPOH 2YRPA 5DS8A 4PJFA 5KOVC 5I1DB 2JK5A 1P9MC 3VXMD 5B8CC 2YUWA 4E41B 3MRMA 5LJYH 4JZJB 4JFHE 4PRHB 3MRNB 4OLYH 4AENB 3EJYD 4ZS7H 5L8JB 4KK9D 4QRRE 5IW3A 2ZG3A 2FWOA 4K7PH 4PV8B 3V6OE 1I3UA 2IADB 2YPLB 1OF2A 3RRQA 4MS8C 2NXZD 1B9ZA 1ZA3B 2H45A 3GSNB 2DBJA 1CLCA 1JWMA 3VXQA 5CZVL 3HMXH 3QPXH 2Q1EA 5CFHA 1TTGA 1ED3A 4PRAA 4HT1H 4OM1H 3PIQA 4N0FA 1UC6A 4OZHB 4PLKC 3MV7B 1GL4B 5GIRB 2DWEA 1BX2B 2X10A 1EPFA 2X44D 2I24N 1BBDH 4YHKL 1BQHG 1QHPA 1B2WL 3QI9A 2YBRB 3F65A 1Q0XH 5C86A 2A6JA 4HG4J 1TMCB 4HGWB 2AAVA 4D9RD 3ZYJA 1A3LL 1KXVC 4JR9L 2XA3A 2Y36L 5CHNA 4CVXA 4WEBL 4S1DC 4XNMB 5HYSB 4LKCB 4NCC1 1JNNL 2GY7B 3C5ZD 4K3HA 2Y23A 2XA8H 5JPNB 1NC2A 4RMSA 5FECA 4V3EB 1N7ML 1J0YA 3QDGA 4LBEA 4YDJA 5IHLB 3MRBA 4LASL 1YY8A 1KXTB 4CU6A 4KI5E 4AEFA 2DLFH 3BKCH 5BV7C 3KWWB 3ZKND 3PWPB 1IM3B 2A1WH 4HIEA 4IRJC 4TPRH 1PW3A 1E6OL 5ID0A 3W5NA 3ULVF 4U1KB 4R9HA 4X6BB 5KSAD 2XG5A 4FN0A 1A7OL 3I6LE 1MELA 5CJ5A 4X5XB 2A83A 1NGXA 2XTLA 5MP6L 4ZOBA 3DMMD 4RIRA 3E3QE 4DGYL 1CDJA 1W8OA 4R3SA 3THML 3BKJL 5DJCB 3R06B 2XNAB 3IFPB 3RBSA 4I3SH 4R96B 5ICXA 3VJ6A 4G9DB 5C3TA 4UNTA 2EZ0D 4H0IA 2X89A 4U0RC 4KTDH 3TBTB 4LCIL 3KPMB 2OZ4L 3VXRA 2W65A 3CDGB 3IS0X 2AXJA 2DOCA 4TYUA 3HNVH 5CEYB 5FDWA 1AQDB 3MJ9L 3MGAA 4NN5B 2ZJSL 5BQ7A 3MBXH 4L4TB 4JG0H 3DLQR 3DRQA 4U1GB 1QQDA 4XBPB 5EU6A 4WU7B 1O0VA 4OI9A 4HV8B 3HI6H 4NYLA 4M7JH 5DHXB 5D2NB 3PNWB 3OKDB 1D5MB 1SHMA 2B39A 2CQVA 2V6HA 5BZWA 4NJ9L 4KXZH 3T04D 1AR2A 2P8LA 3CSBA 5I73C 3NABH 4KDWA 5ESAB 3E2HC 3QQ4B 1T2XA 4KMLB 2DLEA 1EHXA 1FC2D 2FIRT 5I19L 1HZHL 1FNGB 4OAWA 3VFPB 5E03A 2X1WL 1NQBA 3VGEA 1KLGA 3P11H 2Z92A 5F6IC 2WINA 2BMKA 3TBWA 4WUKL 3MJ8A 4M62L 3K7UA 2XFXA 5C0FA 1QHOA 3SE4A 2F54B 2JTDA 4JVWA 3V6ZB 1YUHA 1OM3L 1HKLH 3RTQA 5C9KA 4KDVA 4FMFA 3QWRD 2HLFC 5ANMB 2HKFH 4M6AA 4MA3A 2BXZA 3O45B 1KCUL 4PS4H 3LHPL 4EDWL 1NCBL 3VFWA 1KEMH 5IFJA 2P5WE 3O4OC 4XCCH 4UQ2A 2YHGA 1L7IH 3BI9X 4PJXE 3MROA 5HD8D 4CMMB 4F7MB 4NO2A 2YC1A 3BGAA 2J1KA 4NM8H 3U2SA 5BVPL 1NBYA 1JF1A 4KRNA 2NY2C 1OQOA 3KXFB 3GMOB 1JPGB 3O4LB 4HULB 4KK6D 4AM0A 1OAZL 1T0NA 5DRXA 3HE6D 1IGJA 4YXLL 4Y8DC 3ILQD 2ARJQ 2R23A 2CIIA 1M71B 5I2IA 3HNTL 5ITBL 2DKMA 4WO4A 2VDKH 3OJDB 5DI8A 3BH8A 5DJ8A 3FAXA 3D87B 4JO4L 1UCBH 4X9IA 1MUJB 5C0RH 5DRZB 1IC7L 4HJ0C 5KG9A 4YDLC 1JGLL 4L8CA 2NXZB 2B1AL 3IDXL 5D93B 3VGAB 2FEEL 3MLTA 5DJ2A 3ZKMD 5HHXH 4NGHH 1MAJA 1E4XI 1OB1B 3WNPA 3FTGB 3GI8L 5HHPA 5GRJL 4IIQA 4HK0A 1S7TB 1GHFL 4PP8C 1T5WA 1YMMB 3B8SA 1RIVH 5HHNB 1IEBA 3BIBX 3UPRB 5TGBB 6FABL 1OTTC 3HZYB 1MNUL 1DJSA 1BD2A 3ES6A 4GSDL 4OFPA 2PYFA 3BAEL 5FYJE 3UBXG 3KLAB 1H3WM 3MUHL 4KHXL 1MI5E 3D9AH 3C5ZB 4LPWA 3INUL 1OLZA 2CKBH 4FQXB 2R0ZH 3RY6C 3IDUA 4MNQA 4YK4B 4I3RH 1TVDA 1S9YB 4MAYB 3C8DA 3BZFB 3EYOB 2CUMA 4I9WE 4YHLH 4N8PA 3GI9L 5GRYA 4WUUD 4EXPX 1HH6A 4KGLA 1T21B 1WFTA 2H2PC 4WV1A 4FQQA 3CSGA 5FO9A 5KSAB 1CR9H 2BSTA 2P7TA 4XC3H 4MD4B 1SYVA 1T22B 1KN2H 5FYJL 1KT2A 3QDJB 2IMMA 2HG5A 1EO5A 3MRLA 3DMMB 3O6LH 1G9MH 4XVTL 4J3VA 2HTKD 1DBMH 4XXCC 1FG9C 1TITA 2A38A 3MNVA 1KJ2A 3IF1B 4UIKL 4GAFB 5JDJA 1FZJB 5E8EB 4OF6A 1B0WA 4O4YH 3LD8C 3X11A 2DQTL 3MRDA 5EOCL 4F8QA 1NDGB 2AV7A 4ELKB 1LO2L 3BXNB 3P0VL 3ARFD 2GI7A 3VRJA 1WBXB 4AEIL 5LAXB 2DM4A 1KB5A 2XWTA 2WUBL 1BWWA 2LU3A 4U1MB 1U8OB 2XN9A 1BZ9B 2R2CA 2CXGA 4HMDA 4J1UA 4GJTB 4FTVA 4MQXD 4BUGA 5JNYB 3HZVB 1OOAA 2V2XB 4EI6A 1RI8A 4N9GA 1T1YA 3ISWA 1P9MA 1SM3H 1K8IA 3OR7A 3JV6B 1FGNL 2X9WA 3G6JB 5B8CA 4UQ3A 1JGEB 3D25B 5I1KH 4NC0B 3VDAA 4XHJD 3TIEA 4PTTA 4Z78A 2EO1A 5C6WH 5D7IE 2H32A 4P46C 3VA6A 1TTUA 3CZFA 3QO1A 5C07A 4PJCF 3ESUF 3UTTD 3T0EC 2XQYG 4YBLC 2FIKB 4HF5L 3RGVD 1MCIA 4WHDA 5DEFB 4WCYL 3HAEH 4F58H 2A6DA 4E5XA 1NFIB 3CX5K 1MCKA 2D3VA 5TH2A 3DX7B 1JPTL 1KJVB 3RA7H 1JUFB 2X4UB 3U36B 3QJHB 1QNZH 4IM8A 3PUCA 4XPHL 4Y4KD 4JRYA 1MHHA 4NQCA 5DJAB 4HD9A 4RA0C 3BP4B 1NUNB 1YPZA 4HAFA 3JWOL 5E6ID 4PTUB 4GMSL 3BZEA 2WMPA 3TNNB 4PD4K 5HGAB 1I1YB 5ITFA 4J3OC 4GRWB 2IAND 3HE6B 2E27L 4K3EL 1EK3A 2UY7A 3BDYL 2LTQB 3BD3A 1ES0A 2V5MA 1TQCC 1AO7E 4KK8D 4D0DB 4OJFH 1BJ1H 4YHYB 4D9LH 2EEDA 1RJCA 3U7YH 1KGCE 2QHRH 4ZPTB 4Z9KB 1TIUA 4XNUH 1RUAH 4Z7OF 5KSUA 2R56L 2VRAA 3MLUL 2FO4A 2OP4H 3MA7B 2ADFL 3RNKA 5DQJB 4IRJA 3VMNA 4X0KA 2YPKB 4L3ED 3FO9A 2W9DH 3CAFA 5J9PB 3BISA 4Q9BA 5FUOL 5D72H 3W0WA 2WSKA 4BK4A 1N5YL 5DJ6A 5HYEA 2B8OT 4ZNEA 2ATKA 1UACH 2BNQE 5C0GB 5DUMH 3SO3C 1K3IA 1T1XA 2ZSWB 2VLKA 4M02A 5ESVA 3RVVD 4XP1H 1GOHA 3BPCB 4LHUD 5EB9A 3WUZA 5JPMA 5EWIH 2I07B 3MRCA 2X4SB 4KROD 2GTWA 4YBQC 2D7TH 4HIIA 4W6YB 5D6CA 3VXSD 2JELH 4ZSOB 4LVEA 5D1XD 2A77H 2VTFA 5A2LH 5FYKH 3TJEH 4HWEH 5IQ7L 1JNHA 5LVEA 3L3HB 3RQ3A 1F5WA 1U36A 3N0PB 1QFHA 4M48H 4JJ5A 4XZUA 1WCBB 4YGVB 4I0PC 4K94C 3MBED 1T03L 2GJ6A 5MHSE 4KZDH 4F7TB 3O2WH 4R7NB 2X2YA 4M93B 4WUUB 4OV6F 2VXTL 4MNGE 3IFNH 3EUUA 4OCWH 4Q74A 1KIPB 3E2HA 5E8NA 2E9IA 2O61A 5DRNB 2W0PA 3GMRA 2OR8A 2QQNH 2DDQL 1FLRH 1RAMA 4L8DB 3HE7C 4X7SL 3STLA 5H8DA 4UT6L 3HNSH 2BNRD 3L95A 2AS5M 5E9DB 1MCOH 1OAKL 3FB5B 1IGML 3NZ8B 5H2BA 1V8HA 5JORA 1OAUL 4Q2ZB 4LCUA 2AV1A 3MR9B 5DTFA 5HHQB 3WO3B 1HKFA 4X98B 3LIZL 4PGDB 3MA9L 4JKMA 5T1LA 1BVLA 3H42H 3BGFB 3NCFB 3KPTA 1QLFB 5LGHL 3ARFB 4V1DE 3D3VD 2ZCHH 1HH9A 2B1HH 4PJ9D 2Z8WC 1ZOXA 3RDTD 3IETB 1YYLH 5GJTH 3UTQB 4DW2H 2OJEA 1RJLA 4PJGB 5HDQL 5IB3B 3QWOB 1J5OL 5HHOB 4L9LB 3BHBB 4A2MA 2J7LA 3FOMA 3L3DB 2FJHB 3SDCC 4RQQA 2GCYA 4PJHE 1H3PL 5BOPA 3WBDA 1EO8H 1U0QA 5T5FL 4W4NA 1R3LA 2B4CH 3UTTB 4CADA 4LVOB 2HFGL 3LV3B 2EIDA 3OJ2C 4NRYB 3RGVB 3D6GA 2CDFA 4O2EA 1N5AA 1II4E 1Y6KR 3BT2H 3MV9A 4YHOH 1NGWB 1AJ7H 3C6LD 3JSSA 2PYEE 1U42A 3GSUA 4HIHB 3PWVA 4EOWL 5L9DL 2ZUUA 4O5LL 3UP1A 1LO5A 1XEDA 4JLRA 3QIWD 1ZLWH 5IKCB 3H9SD 3LB6C 1FAIL 3GSWB 4YNYA 4Y4KB 3CDYA 4OCMC 1A6UH 2HMIC 4RZCA 1MRDL 2PETA 2QL1A 3D2UD 5T3ZH 4NFCA 5CGMA 4XCYA 2AQ1A 4PP1C 4YPGA 1I7ZB 4OM0L 1R5VB 1Z9SA 4F2MA 1QBAA 2Y7QA 3RX8A 2QR0A 5JO5B 5KSBA 2QSQA 1GZPA 4MSWA 4K7FA 3MO1B 4HHAB 5E08L 4M1GH 3RY6A 4OZGE 2WWMD 4DN4L 5CJQL 5A40E 4HS3B 1GZQA 1F90H 4Y19E 1FZKB 5A2IH 3HS0B 3I75A 5GHWL 4CUCA 1U92B 5GGSY 5I1CH 4OZIF 2H3NA 2ICEA 1I8MB 4F7EA 3VWJA 3U0TA 3W39B 3DUUA 4ODXA 2CLRA 2YK1L 1TENA 2YPVL 4C56D 4NPYA 2BZDA 5TFSL 3TPUA 4L3EB 5IMMB 4W70A 2IQ9L 1T2QL 4Y4HD 4U6VL 2IH3A 3KPSA 3HPJA 3JV5A 4XNZB 3R1GL 1P7QD 5B22A 4ONOA 1MJ8L 5DRWB 2DD8H 3QA3B 1IGTA 4GMTH 1Q72H 3ZTJG 4HFWA 4MA1C 2BVPB 1P4BL 2VE6A 4XXCA 3X3FH 4GG8A 2PR4L 4OLVH 3O11B 2BVTA 1ZKAA 5EU3B 5DMGC 5CGYD 1OVZA 2R29H 1I3GL 1D5IH 1HHGA 4RFEB 3X14B 3V6OC 2AK4E 5IJKC 1WBZB 4PGCB 4D0BA 3BRGC 1OGAE 1XR9B 2XKNB 4PJIB 5HGDB 5JW4R 4OB5L 1YMHB 4AIXA 3RL1A 4GAGL 1MCLA 4HDIB 1S8DA 2FX8L 1ZLSL 3MBEB 4NNYB 4NWUH 1HI6A 3VI3E 4Q6IC 5EZIL 5TJWK 4TUJB 4Q9QL 4BH7A 3TIDB 1VESA 3HUJE 3OB8A 2YSSB 1CXKA 5IP4A 2HKHL 5HTSA 2VH5H 4DKEH 5I1IL 2VDML 1WAAF 2YUZA 3T2NL 3I02B 3MREB 4H26B 3L6FB 4Y5YC 3LN9A 2WIIB 4LKXA 2DJUA 4X7EC 4LU5H 3T0EA 3V7MA 4MA8H 3WXVL 1JHLH 3RAJH 1DBBL 3CMOL 3RFZC 5ALCL 3LEXA 4GAJH 1CE1H 4IBLT 4K55A 1FORH 3QUML 1K4DB 1ZWIB 1S3KH 2CKBB 2EC9U 2BNUA 4WHYG 4XNXH 3NOIA 3RVXC 3ZL4H 2FSEB 4KI5C 4OFYD 5FHAH 1YEFL 5EPMB 3RWCA 4RNRA 3JBG7 4PG9B 3D3VB 3HN3A 4GG6F 1AR1C 1WWCA 2PO6D 4NQXA 1P53A 4NKQB 3LQAL 4U31A 4PB9H 3C08L 3NH7L 3MOAL 3PWNA 5C0BE 5SWZE 2N7AA 4HLZG 3CH1A 1UA6H 3E3QC 3NFNA 4I0CC 1DUYB 1V7ML 1CT8B 3STZB 1VKXA 4UV4L 4R90L 4G6ML 4MQTB 1CLZH 5KAQF 2Y6SC 3QT2A 3RGHA 2XTJD 1DZBA 3GJEA 2R4SH 1J9CT 1OD9A 3BQUC 1QR1A 3D39A 4BKLA 4QXGH 3W5MA 4JPKL 1EBPA 4YHMH 2ZUVA 3GHEH 4LCWA 4K9EC 3V4UL 3C6LB 1F6AA 4ENEC 2KL6A 5J89A 1FCGA 1MHCA 4GLRH 1D6VH 3QIWB 3BWAA 4NN7C 3H9SB 2VUYA 4ZAKB 4M00A 3MZTA 4FRWA 3UTPD 3HG1A 3ZSSA 3D2UB 1MCEA 2XWJA 1NGZA 5BS0D 4FABL 2APFA 3KYKL 5TPWH 4KJPD 3ILPA 3IDGB 1OSPH 5EO1A 4Y0GA 4JZOB 3ARVA 4R7DB 1MCCA 3G5YA 3IJSB 2CK0H 1UH2A 4P4RB 3VXPB 1L0YA 5GGVY 4I2XE 5FA4A 1GGIL 1I1AD 3QCUH 4NKDB 1BFVH 2QV2A 4I0PA 1YEGH 5F9DC 3VWKC 4DWHA 2Y06L 4OLWH 1FGVL 4D94A 5DD1L 3HAEB 4JFYB 3D0VB 3M07A 1UM5H 3JUYA 2FO1A 3MZGB 1CIDA 3EW3B 1WK0A 3UAJC 1EHAA 3CH8A 4Y4HB 2AJYH 3DBXB 2VLJD 3HE7A 5F7EH 2D9CA 2XPGA 3O3AA 5IMKB 2BSSA 2I60L 2NYYD 1UWGL 5IB1A 5T3ZD 1CD0A 2R0WL 1IAOA 3FB7A 1P7HL 4L8BA 1HIML 1P4LB 1S5HB 4FXKB 4WY7H 5C0AA 2HRPL 4S0TD 1E28A 2ICWI 2A0LC 5I8EA 4RAHA 2HTLC 4NQVB 4K8RC 4K71B 1QPXA 1NAML 4OFVA 5C1MB 1OPGH 1RJYB 4YXKH 2YA1A 1AHWC 1NCNA 1NEZB 4I4WB 1LP9E 1S7UA 5ENWB 1MIMH 3DX8B 2HLAA 3DTXB 4UTAL 3I3DA 2DQIL 3GGWB 3MV8A 4DOHE 3EZ8A 1T66C 4PP2B 4N9OB 1A6AB 1F4XL 4DTGH 4G8FB 3F7QA 1XGTA 3AXLA 1MHPL 3CUPA 3QDMA 4MD5A 3SDCA 1O5DT 4N5ED 4S2SB 4U6YB 1ZT1B 4N8CL 2MHAB 1J8HA 3NPZB 5INCB 4X7TA 5GSVA 3CLFH 3CK0L 4BQBA 3MSPA 3FFCE 5D8JH 4OF5A 3BP7A 3KJ4C 4U0QB 3TVMD 3G5ZA 2NY4C 2W60B 4P23C 3IGAB 1TPXB 3ARBB 2EDYA 1NLDH 3FFDB 4WW1B 1TZGL 5CILL 4ZFOL 3CX2A 4F9LC 5IOPA 2VQ1B 4NDMB 1ZS8B 4KDTA 2O5YH 3OKMA 2B5IC 2I9LA 1I8LC 2OI9B 4U6TA 2PO6B 5DO2D 4JDZA 1D5XB 1R5IA 3AB0C 1S7QA 4PRDA 4KY1H 3ABZA 1BQHB 4PJ5A 2BSRB 4XXDA 2OL3H 4JQIH 3DXAE 3QR2A 4H0GA 4M7KH 5EIQA 5IJVB 4IJ3C 3O9WD 1RIUH 4HBCH 5JIHA 1SEBB 4LLWB 4QHLA 4UI2A 3U1SL 1ADQH 1CDCA 2XTJB 3REWB 4QWWC 4OQTA 1UYWL 3DO7B 5FM5O 3OKLB 1FFNA 1EXUA 5EC1B 4I3GA 4LEXL 2OSLA 2P48B 5E24E 1IC1A 3NZHH 2P47B 5T3XE 5ALBL 1JE6A 5DD6A 4WW2B 1PD6A 4U2ZA 1YEHL 3O2VL 1ITCA 1KTLA 4UU9B 3VMPA 3QI9D 5DVNA 3L5WB 2FECI 2ZCLH 1M7IB 5ILTL 1MEXL 3NCJH 5D7JC 2VJXA 1EEQA 5T1MA 4M9PA 1BVKB 2BVOA 3PWLB 3QUYA 3UTSA 1D9KB 3T3MF 4JRXA 1KJ2H 1N4XH 1WQVT 4UTBH 3TBSB 4W81A 5BS0B 5DD0L 3RP1A 4X7DC 1JFQL 2GT9B 2OMNA 3LS4L 5AD0A 4KTEL 2W0KA 4Z7UB 2JB5L 2Z8RA 4JPIA 3JWOC 2NY7H 3U0WL 4X5WB 2DQCH 1HQRA 2IBZY 5EU5A 1NC2D 3NIGE 12E8H 1IARB 1VHPA 3V6OA 5IT2H 1WEJH 4B7LA 3QDGD 5T3XL 5IJKA 1F11B 5EFIA 4EVNA 5GGTL 1FDLL 3KPPA 5CINH 3UTOA 4CW1B 1T1ZB 4MZ2A 1FVEB 1EJOL 1KB5H 3BZ4B 4PRNB 5F96L 4CU8A 1I1AB 3QQ9D 3SE8L 1AFVL 3UYOD 4HW6A 3MRIA 4PJDB 3HZMA 4TSBH 4P0DA 3S97C 3MUZ1 1J8KA 2Y72A 4Q6IA 5F88A 4YJZL 5IEHA 1CGVA 5F44A 1M6OA 5GRVL 1ROWA 1YEDA 5E5MB 4LEOB 5D2LA 1GOFA 2VLJB 4QHKI 2LABA 4CBPA 3E8UL 4Y5YA 1WIOA 4OLUL 2P8PB 1DR9A 1NC4A 2DWDB 2X89D 1IT9L 3MRQA 1TNNA 4BSWA 1CLOL 3ALWA 3DVNA 3Q5OA 1CYGA 2XQBH 3O2DH 2NPLX 1RUKH 2ATPA 1K5NB 3L3GB 2UZIL 1LD9A 5DJ0A 5C0DA 2FX9H 4HPOL 4NZRL 5EU6D 3EO0A 5JIIA 4XCNA 1MFCL 4POUB 2ZUSA 5IBTL 1A1NA 1B4RA 3KPOA 1C7SA 5I1HL 1WUNT 1A6TA 2EYSA 4G8GE 5DJYA 4FG6C 2NY6B 1ZGLA 3OX8A 2D7QA 3C60A 3MRKA 1MQKH 3OKEB 1FJ1A 2OX5A 1FO0L 3E3QA 2DTMH 3Q6FB 4OF7A 1HYRC 1KIQA 4KRPD 4PV9A 2WUCL 1RFDL 3RWGB 1KEGH 3REVB 4NZDA 4XWGL 4YIQB 1T80A 1FPTH 1GH7A 3FO1A 3DRTA 5EU7C 3RTQD 5EORH 2IGFL 4XI5D 3MRGB 1DANU 3BQUA 1TETL 2NXYD 5BV7H 4GKNA 5I8KH 5TF1H 3O8XC 4PY8I 4MCYB 2YEZB 5EZOL 5F3HB 3BH9B 1I1CA 3U9PH 4G6KH 1NKOA 4XP4H 5HBBA 3LH2H 1UWEL 4LARH 1DUZB 3F7RA 1DQDL 3TH4T 2R2EA 4DGIH 4JRWA 1DLFH 2VAJA 5A2JH 4ZXBC 3OAYH 3UEZA 3ZDXE 1F4YL 3CVIH 5JOEA 1T0MB 5DS8B 4PJFB 3BN9D 5C08E 5CSZA 3EYFA 2X4TA 3VFSA 2G9HA 1QLRA 2FJGA 2JK5B 1J1PH 4F15B 3MRMB 2FGWH 4WO4D 5F71A 4PJ8C 2HT2C 3P30H 1AGDA 1NGYB 2FWOB 4X4ZA 1OF2B 2BHYA 5I1GH 4JM2F 2V7NA 1KUMA 2ERJC 1V3MA 1QEWB 1JWMB 2DAVA 3VXQB 3UBXB 4OSUH 2Y9RT 1T3FA 1FL5A 3CLEH 3GRWL 4NFDA 4G8EB 4KQ3L 5JW5A 4PRAB 1ED3B 2ZCKH 3VWKA 3PIQB 1MCRA 4GRLA 2FBOJ 4KPHL 2DWEB 1UCTA 3U9UB 3WHE0 3GKWH 1FFPA 4LLUB 3QI9B 4J3TA 5F97E 1J0HA 2A6JB 1UVQB 5IK3A 1X5GA 4MQSB 5GGSA 4OUUA 4FZEL 3TPKA 3J7HA 4RX4A 5CHNB 4CVXB 3OR6B 4GH7B 2YZ8A 1BD2D 1FE8H 1NJ9A 4Y1AE 5EO9A 1DTUA 5SWQA 3FOLA 2DYPA 2IALA 2NY3B 3QEGL 2Q87A 1CI5A 4JFZH 5JHLH 4V2BA 1QSEE 3ZYOA 1L0QA 1MY5A 1NC2B 3WDHA 4MNQD 3ZT5A 5FECB 3K2MC 3V79C 2EDEA 3CD4A 1CZ8L 4GQ9H 3QDGB 4LBEB 4YDJB 2GFBB 4JO2L 4Z7VA 2I5YH 3MRBB 3BESR 1YY8B 4XMLL 1NDMA 2X1QA 3W9EA 4XC1H 1JV5A 3CDFA 4LCCA 1BHGA 5DUPH 3CFEA 4HIEB 5ID0B 5F7LB 1OAYH 4QXUL 2Q7NA 3EBAA 1N0XH 1X7QA 1GC1C 4ZYKB 1S5IL 2KZ1B 1KJMA 2A83B 2UWEA 1Y0LA 3JXAA 4QF1A 5CCKH 4RIRB 3S4SA 1HDMB 2C3VA 4RAUA 1BLNA 4LPCA 4R3SB 1BGXL 1A7RL 2EDBA 3B5TA 3SDDD 5ICXB 5GISH 1RUML 4YO0A 3VJ6B 2MWCA 3HZKA 5J11C 1CFBA 5I8CA 7FABL 1MI5A 1JGVH 3VXRB 2W65B 4ZUWA 4NP4H 4DAGH 3T8XB 2OCFD 1U93A 4WDIA 5ID1A 5BQ7B 3DRQB 4KKCD 1EAPA 1QQDB 4P23A 5FO8A 1C1EH 4N0YL 1XGPA 4NYLB 1YEJL 1TJGL 5CWSA 3DVFA 1MJ7H 5IBLC 2XN9D 1O7VA 2BVQA 4F9LA 4LNVA 1EV2E 4XMPL 4FTVD 3V6FA 5K59F 5BZWB 2P8LB 1S7VA 5T1KA 1I8LA 3RBGA 4XWOC 3B2UD 4Z7WA 2DF3A 4OAWB 5HHMA 1UB5A 1L6XA 4X6CE 2Z92B 4EBQL 3HHRB 2DTSA 3P77A 1U6AL 2WINB 2BMKB 4KRPB 5FB8A 2K1MA 3DV4A 3TBWB 5DFWH 4Q0XH 4OCSL 5JR1H 5C07D 2RJMA 5DWUH 2P5EA 3MJ8B 5C0FB 2XFXB 2Y07H 4JHZA 4ZO6A 5JZ7C 1YUHB 3RTQB 3U7AA 1FZOA 1R24A 3FO2A 1B88A 2NXYB 4OCYH 1KFAH 5TE4L 4G59A 5E4EC 2PTTA 2M8XA 4PLKD 1XGRA 2J88H 1SBBA 3VFWB 4X4ME 1V3LA 3LMJH 5IFJB 3QUXC 4N0CC 4YDKL 4UQ2B 3MODL 5DR5L 4JRYD 1BZ7A 2ESVA 4PJAE 4OZ4A 4NQCD 2JIXA 4GT7A 4RMQA 3FZUD 3U2SB 1C5BH 1NBYB 2IAMA 1JF1B 2ZKHL 5C0CA 5D7JA 2J8UE 1FNSL 4R4BA 3E6HA 1KYOK 3FJTA 1QO3A 5E99L 4AM0B 3N1PC 4S1DD 3UJIL 1T0NB 3RUGF 4I0KA 4HK3N 1IGJB 2EDWA 3BP6A 5IVXE 2R23B 2CIIB 4QHMA 5I16B 5I2IB 1C5CL 4Z0BH 5F9JA 1AY1H 1I9RH 4WO4B 5D7IA 3BH8B 5DJ8B 3LQAC 2ZUQC 4I13B 1H8SA 2HVKA 4YHZL 5KG9B 4LPVA 4L8CB 4EJ1C 1U91B 1MJUH 2YD3A 4IRJD 3MLTB 1ORQA 5ISZB 5HI4C 2HFEB 1RU9H 1AIFA 1QVOA 4G9FE 3I6GB 4IOFC 1JRHL 4NQEA 2J8OA 1VEMA 1JL8A 2JKXA 1CN4A 4NJAL 1XGUA 2VLKD 1T5WB 4ONFL 3DHMA 4XTRD 4XCEA 5TDNA 1IEBB 3BE1L 1QBMH 3VFOB 1AGCA 4RFNB 3V52H 3WKMH 3CFIC 1VGEH 1BD2B 3ES6B 1VA9A 2PYFB 1KNOB 3E1F1 3KPQB 1AO7A 2C1OB 5IB2B 3FCTA 3I6KB 2OL3B 3BPOB 2IBZX 3QRFM 3G9AB 1LDPL 4MNQB 4N1EA 2QBWA 1TZHA 5TE6H 3LOWA 4U1SA 1U3ZA 2Q8AL 2GJ6D 1BIIA 3WFEL 2XWBB 1HH6B 4PJBF 3VCLB 2XZQH 4WV1B 1CDGA 3NFSH 4FQQB 3WL9A 2MJWA 3IKCB 2BSTB 3RWFB 3BX7C 4X6DF 1KT2B 5ADPL 2BNQA 1PSKH 3B9KA 2HG5B 2AK1H 1VSCA 4WFGD 3C5SA 3F7PC 1AI1H 3D69A 4PJ7E 3MNVB 1KJ2B 3EYUL 2J6EH 2B2XH 3SQOH 4XVJH 5CZXD 4AEHH 1J11A 1LK3H 2F8VA 5E8OA 35C8L 5FGRA 2PXYC 2AABH 3O8XA 3X11B 3C09C 4K7PY 4FQHB 4S1SH 2AV7B 5DK2A 5T1LD 1INDL 3TF7A 1A0QH 3ELAT 3QULA 5F70A 4QNPF 5JA9A 3RL2A 1EGJH 3VRJB 1NUFA 1KB5B 2XWTB 3F7YA 3S4SG 2XN9B 4ZXBA 4B53A 4G43B 3GMQA 5DMJB 4J1UB 1G7HA 1UXWA 4FTVB 4Y8AA 4R26H 5GRVK 3I3EA 3SDYH 3S34L 1KULA 4N9GB 1T1YB 1M1SA 1K8IB 1VEOA 3OR7B 3KVQA 5B8CB 2NCMA 1MJJA 3FN9A 3IAPA 4JN2A 4PLNC 4ELMA 3TIEB 4PJ8A 4PTTB 4Z78B 3AC0A 1IGYB 3CZFB 3QO1B 4NKMA 5C07B 1JGUL 4HWBL 3OGCA 2YD6A 1MFAH 1X4ZA 3NGBC 3QBTB 4K94H 2L4OA 3PABA 5JOPE 4HC1A 3MV9D 5DD3H 3U83A 4NRZA 1VENA 3IJHA 3HC4L 4E5XB 2J4WL 2BFVL 3U4EA 3NN8B 1QRNB 3L9RA 5FOBA 4OD3L 4GAYA 4V1DA 3TA3C 4JRYB 1JWSA 1KELL 3BN3B 4FQCH 5E94A 4NQCB 3UYPA 5HI5C 5GS2H 1YPZB 5T1DH 3BZEB 4PJEA 1W0VA 1E4KC 3EZJB 5C7XL 2AEWA 1NCDL 1HINL 1WFUA 3GJFK 4MDJB 4KH2A 1CF8L 3SHSA 2F74A 3ZHLA 4PJHA 4ZOEA 3ARED 2EXYC 4OIBA 3PQYE 2R69H 3QQNA 1OAQL 4PGJA 1FP5A 1YNKL 4MX7A 4R2GC 1U8LB 5KSUB 3B2VL 5L7XH 1IKNC 4LP4A 2FO4B 2ZZUT 5BV7B 3VWJD 4J7RA 2D4FA 4IRJB 4X0KB 2H2PD 5JQ6H 1HSAA 4AENA 1HEZA 3FO9B 5ETUB 5F7FA 3QAZC 2Z8VC 3KHOA 3TT1H 3VXUE 1DVFC 4PV8A 2DN7A 3W0WB 4NQTA 3KPSD 3BPLC 3QHZH 4G42A 5DJ6B 5E7FA 2ATKB 3L5JA 1VFOA 1T1XB 3X3GH 1KG0A 2RHEA 2W07A 4ZOCA 5GGUB 2NY5L 3PWJA 1P6AB 3MV7A 4HUXA 3QFJE 5L2KA 5KW9L 3CFCH 1Q9LA 3T4YA 1E0OB 1Q0YL 1MREH 4U0RB 5HY9A 2GITA 4ERSH 1N8ZA 4HIIB 3MMEA 5F6HI 5D6CB 4ZQKA 4X4YB 1BOGA 5AZ2L 2YBRA 3I50H 4KUZH 1CLYL 1BFTA 1MFDL 5EOQH 1JNHB 3AY4C 2AP2A 3HMWH 5FYLE 1G84A 1JFMA 4KRMB 1R3HA 5D1QC 3SKNA 3MLWL 2DLIA 1UEYA 4XZUB 3SE9H 3VRLE 2OS7A 2YD5A 4RWHA 4Y4FA 1B4JH 3WUWA 5I73B 2DQUH 4G80B 4LAJH 4K3DH 3E2HB 5E8NB 5F7WC 1HYSC 4LMQI 2O61B 3GZKA 5AWNH 1I9EA 3EOTL 4E41E 4NQSB 3STLB 4WTXA 5F6IB 4PRHE 4LSQL 2EH7L 1T7ZA 3L95B 4HKJA 5CUSH 1JI1A 3T0ED 5FYLL 4U1KA 5DMIL 2YPLE 1WLHA 3BKYL 1CD9B 5H2BB 1PZ5A 4OQTH 4KQ4L 4U1JA 1KLFA 5LXGH 4XCFL 4LCUB 5DTFB 2AK4A 3WKNA 2XZCL 4OZHE 2VXSH 1ZGLP 3QUXA 5T1LB 4N0CA 5CZVH 3O4OB 4NC1E 1M4KA 2XNAA 4R96A 2O93L 3B8YA 4PYGA 4G9DA 4KI5F 4ODHH 5DVKA 1HH9B 1OP5K 2NY2B 1UZ8B 3CDGA 5M94B 4NKOA 4P2RE 1FH5L 3KS0H 4Y88A 1JPSL 5CEYA 4DZ8A 4YHKH 4RGMC 2D03L 2OJEB 4HCRA 1B2WH 1RJLB 4L4TA 3S36L 2MKLC 4K23L 4WU7A 4YWGL 1JNLL 3FOMB 4HV8A 4TUKL 4UUJA 2AQ2A 5CJBA 1H5BC 1KPRB 3GSNL 2YD8A 4JR9H 4JFFB 1FCCA 4RQQB 1ACYH 3RVWC 2GCYB 5CEZE 4WEBH 1RZ8A 3MLSH 2R1WA 1PG7W 1R3LB 2Q7YA 1GYAA 1JNNH 4YDLB 2KH2B 3D39D 5ESAA 3IXAA 4GXVL 4TUOB 4WFHE 2CDFB 4O2EB 1N7MH 5B3JE 4WWID 2UYLA 1IZJA 3PWPE 4LCWD 3MV9B 3QRGL 2W1NA 4X6FA 5DZNA 3GSUB 3PWVB 3PJSA 3RY5A 2MPAL 2OK0L 4EI5C 1CVRA 4JLRB 3UDWA 2ICWJ 2B0SL 4R0LC 4YNYB 1E6OH 2P46B 3N1FC 4DCQA 4KVNL 4MXVE 3HG1D 1A7OH 5CEZL 1KB9K 3KYNB 4XCYB 4Z7NE 4LF3A 2OTWA 5MP6H 4YPGB 5DJDA 4MCZA 4M7LL 4YBQD 3S8WA 4DGYH 2Y7QB 3THMH 3BKJH 3Q2CA 4K7FB 4P59H 2C4XA 1JTTA 4LCIH 1JPGA 1QKZL 3O4LA 3VU2A 1JJUA 1ZVSA 4G3YL 3I75B 5C09A 3FN0L 1CK0L 1X4YA 4I0PD 2H3NB 2ICEB 5GSRB 4E42A 3BWUC 3V4PL 2ZJSH 4F7EB 3JWNC 2NY1D 3T1WA 2QQQA 3DUUB 1YEKL 4ODXB 2F5AL 2CLRB 4OCRH 1I4FA 3WFZA 3TPUB 1NCUA 4ZO8A 4CDGC 3GMNA 5KS9A 2V7HA 4OD2B 1GSMA 4PJXF 3DYMA 4N8VA 4DK6A 3I84A 3KPSB 3HE7D 2IH3B 3QIBC 2UVEA 2Y25A 4NJ9H 3PV7A 4ZFGH 5B3NA 4ODTH 5GS2D 1EA9C 1IGTB 3VH8A 1AXTH 2VE6B 1YEIL 1FYHB 4AL8L 4GG8B 5C0AD 4NOBA 1J0IA 2AEIT 3WS6C 4N1CA 5ANME 4WUKH 2NX5B 2PXYA 3RY4A 3LD8B 1HHGB 5DHVA 1OM3H 3OKKA 1WAAE 5TDPA 2HP4A 1YMMA 2BERA 3UYRH 2CK2A 3UPRA 4GW5B 4IS6B 4D0BB 1OTSC 3HZYA 4WEUD 5CIPA 3BFOA 5IROC 3RL1B 4NQDE 3LHPH 3KLAA 3EJZC 3BD4A 3MV8D 4KHTL 4N90E 5CP7A 3KXFE 3WIHL 5MEQA 5BJTB 3IFLL 2UZXB 3PGFL 5E70A 1U3YA 2CGRL 4BH7B 4P2QE 5BVPH 2FHBA 4MJ6A 5AZEL 4HPYL 3U30C 4MAYA 3QDMD 3VXME 1FL3B 4XRCA 3SDCD 3VXNA 5EUOF 3BZFA 3EYOA 2GHWB 1DQTA 1FLTX 3ULVC 4LRIC 3K80A 4P46B 1Q8MA 5E2WH 3HNTH 5MENA 4ZTOH 3T0EB 5ITBH 4YBLB 3DO3A 3TJHC 4X5LA 4JO4H 5I6XC 3LRSA 1KCRL 3LEXB 3LQZA 3RU8L 3QDJA 2AEPL 3WUWG 1ZHKA 2MKWA 1ZLVK 1J0JA 3PHSA 1BIHA 4K7PX 2LAGB 2AXGB 1LP9A 4IMKC 4L3AA 5FIEA 1IGIL 3IF1A 3TA3A 2BY1A 2NW2A 4RNRB 1FZJA 2HMID 4H20H 1IAIL 4ZS6C 3Q0HA 4LSRL 3V0WH 2RBLA 1H3GA 1XGQA 3RIAF 3RUGB 1JZ5A 1E4KA 4MLIA 1MFEH 4PP1D 1IC5L 1P2CA 1X5IA 3EGSA 3O3EB 4R6UA 4ELKA 1GHFH 3PWNB 3TLRA 3CH1B 4PJ5D 3NFNB 4TNVK 2VO5A 1TQCB 4YDIL 5F3BB 6FABH 1CE6A 4PRPB 4K8RH 5GS1C 4GW4A 1BZ9A 1FRGH 4GSDH 2GW5A 4ZMAT 3BAEH 1CGTA 4JREC 3NA9L 3TT3H 2KQNA 5JNYA 3GJEB 2V2XA 1QR1B 4YE4L 3D39B 3BPNC 5SX5K 4BKLB 5MERA 4FFWC 3FFCA 5IM7A 2WP3O 1HQ4A 1UKQA 1F6AB 1MAML 4RDQG 1OT1A 1DVFA 4M6NL 1MHCB 1OWRM 4F57L 3ARDC 2FIKA 3I2CH 3ZZ1A 3BWAB 1DQLL 3WSQL 4QRTA 5CD3A 4P4KC 1DN0A 3SO3B 3QUYD 1OW0C 3UTSD 5BO1H 3LZFL 3HG1B 5DEFA 4JRXD 5D5MA 3T1FA 2XWJB 1NGZB 1NFIA 4Z5RA 2F9BT 3WLWC 1N6UA 4FHBD 1E6JL 2J8HA 3ILPB 4XVTH 3U36A 3QJHA 1DFBL 1HCFX 4Y2OA 3CJJA 5EO1B 3MACH 1KF9B 3G5YB 1QBLH 3CXDL 3WN5C 4XPTL 4XPGL 1MCFA 3KLSA 1CDYA 4UIKH 3IDYC 2MNUA 3AY4A 1RZJL 2F5BH 3H9ZA 5FA4B 3R4DA 5HGAA 1I1YA 4PBWD 2R39A 2VXVL 5I1EL 2X4NA 4I0PB 1MY7A 2VN7A 1U95A 3U82B 1B3JA 2KDGA 4NZTL 1TTFA 5GGTA 4D0DA 5AYUL 1JN6A 3H0TB 4X6DB 5J13C 2WUBH 2CDGA 4TQEH 4S1RL 5E95B 4NO3A 3HE7B 2XPGB 2E5EA 4KKAC 3O3AB 4YQXH 1R0AH 3RVTC 5IB1B 5IVNA 3N85L 3SPVB 1FGNH 1NC4D 1IAOB 3KHQA 1IKFL 4NRXB 4L8BB 2V5RA 4URTB 5J9PA 3QCTL 5C0AB 4JPWL 4WTZG 3NCMA 3VD3A 3EYVA 5I8EB 4RGOH 2X70A 2AJSH 3MRRB 3PV6B 4X80L 3E6FA 1CFSB 2ZSWA 3RVXD 1N6QH 4HF5H 4N8VG 3BPCA 4DQOL 2MOVA 1S7UB 3F62A 2I9TA 2HLAB 3QDAA 3DIFA 2X4SA 1BF8A 2JLLA 2W9EL 4XB7A 2VDQL 3H3PL 3VH8G 3BUYA 1AR1D 2VWEE 4U1IA 4UNUA 4ZSOA 4GQPH 4U3HA 3RKDD 2HN7A 3EHBC 2LE9A 3C60D 2BDNL 4GRWE 3L3HA 1NGPL 3JWOH 5J4MA 3F7VA 1XGTB 3AXLB 4GMSH 3CUPB 3QDMB 4MD5B 3SDCB 4YZFF 3VGDA 4YGVA 1SY6L 3HMXA 1I7UA 5C6TL 1SJVA 4UV7L 4K3EH 2E27H 5I18H 3TESA 4P57A 4F7TA 1WZMA 1J8HB 1S7XB 1OSZB 1F8TL 1ZEAL 2V9RA 3BQUD 1IEHA 3S37L 5GSVB 4L4VB 3D48R 2J5LC 3BW9A 3SGEH 3H9YA 1ETZA 3G5ZB 3QNZA 1AD0A 2R56H 3MLUH 4B0MM 1JI2A 2NTFA 5GGVH 3T0BA 3EFDH 1B90A 1LE9A 5E9DA 3ARGC 2VLMD 3FB5A 5DJXA 3VFTA 3AMKA 2H9GA 4KAQL 2WK2A 1A9EA 4YHPB 3OKMB 2Q3ZA 3RVUC 3TNMA 3MR9A 2ZNWA 2YN5A 2I9LB 2P24B 1F02I 1NBVL 4JDZB 1T7WA 1S7QB 4PRDB 1JHKH 3T2PA 5J12C 2HT3C 3MRHA 3P2TA 4XXDB 4TVPD 4K2UH 4OTXH 2F8XC 3VG0L 4QT5A 2CUHA 4BZ2L 5IB3A 5HHOA 2VDPL 5IQ7H 1BQLL 3VWKD 1LEKA 1FFNB 1EXUB 4GRLD 5FGCB 2L7JA 2OSLB 2VABB 1KLUA 4OLZL 4MVBA 2NMSA 2YMXL 3TCLA 1GPOL 1VGKA 4LK4A 2FYYA 3EKCA 3H9HB 2N56A 3EFFA 3UAJD 1T03H 1WVZA 4M8QA 1LEGB 2PUQT 2VXTH 4MJIB 1G7JA 5IW6B 4ZO7A 5T1MB 3Q1SH 2BVOB 4RX4D 4JRXB 2EKJA 4MA1B 3RWJA 4F7PB 2DYPD 4UT6H 4JPIB 4DEPC 1A3RH 1JRHI 2DMKA 3WS6A 2ZOLA 1KCGC 2HTLD 1WT5C 3N1MC 4LPXA 3U4BH 4OBRA 4QRRB 5EU5B 4XX1G 4K8RD 3C9NA 2EDHA 1OAKH 2PTUA 3OGOE 1IGMH 5CKAA 4HT1L 5EFIB 4EVNB 1MQ8A 1K2DB 2FD6H 2A2QT 3KPPB 1D6EA 4NN6C 1TVHA 1RPQA 5IROA 1R5VA 3U7WL 3LIZH 3MRIB 2KBGA 1V5JA 2GQHA 1E4XL 3HZMB 1T66D 1N64L 3DHJA 4Q6IB 1CXFA 5F88B 4PJGE 4U7KA 3MFGB 4CKVX 1M6OB 1YEDB 4BUHA 1W0WA 4FOMA 1Z3GH 1CL7I 1E4WL 3PF2A 3W82A 4GUPB 1J5OH 1MCNA 2BOBA 2YA2A 4LRIA 3WIIH 4Y5YB 3W39A 4G7YH 1UH4A 3TZVC 2Q86A 3MRQB 2XRAH 4M1DL 4BSWB 1MI5D 3DVNB 3TJHA 1ZTXH 3UTTE 1FAKT 3ALXA 2ATPB 3T0XA 1ITBB 1H3PH 4JDVB 4HC1H 4LLMB 3SE3C 4S0SD 1LD9B 5T5FH 4N1HB 2DLFL 4HXAH 3SGDH 4P23D 1IGCH 4OZGF 3EO0B 5GS0C 1LE5A 2X4QA 4XCNB 1QBBA 4IMKA 1A1NB 5BVJA 1RQ5A 1R3JA 3KPOB 4FP8H 1RZKC 1PG7X 4WTWA 5DDHA 4EOWH 2WBWB 5FCUH 3WCYA 3CVHL 1A6TB 5T1KD 2EYSB 5DJYB 2W38A 1YN6A 4RFEA 3X14A 5FGBA 1ZGLB 3OX8B 1CTOA 3V7AG 1FAIH 3P4NA 1FJ1B 1EEYB 5HHMD 2IANE 2EO9A 1YMHA 3HFML 5E2JA 2IG2H 4ZFFB 1KIQB 4FQJH 5EUKA 4HDIA 4OM0H 5GS1A 2P5ED 3HNVL 4HIXL 4MJ5A 5CZKA 4FNLH 2W91A 2LVEA 4DVBA 4QWWD 2RIKA 3MBXL 3BQUB 3MV01 3TIDA 3JWDC 1BAFH 4ZUSB 3HI6L 4GKNB 3S5LA 5J6GB 1UQSA 4M7JL 1HXMA 2CMRH 2VLRA 2GJJA 4PGEA 5GHWH 4YHNA 3MREA 1L9NA 1GC1H 1FFOB 3NABL 2ESVD 4Z95H 2JIXD 2X1XR 1D5ZA 4ETYA 4N68A 2IAMD 5C0CD 5D7JD 4NN7B 4HQQH 3NCEB 4P4KA 1QLEL 3MOQA 5EN2A 1OW0A 2IQ9H 3L1OL 5J1SC 3VFUA 5CSZB 3EYFB 4U6VH 3VFSB 5A2KH 1INEH 2G9HB 1QLRB 3SKJH 4PREA 3QPQC 5IR1A 1ZHBB 4ONGH 2FGZA 1KXQE 3HUJF 3IFOA 1MJ8H 4UINL 3L3IB 1RUQH 2FSEA 5GZOC 2WWKO 2P1YA 5ACMA 2HKFL 3VXSE 3WN5A 4PG9A 2PR4H 3QEQE 4XVUC 4PS4L 1FBIL 2V7NB 1KEML 4WI9A 1J7VR 1I3GH 4PJIE 1N6VA 1RULL 1T3FB 5JW5B 5F7YC 3T4AA 3VWKB 3D0LB 3FB6A 4X4MA 1Q38A 4ODWA 1CT8A 3NAAH 4NC1C 4OB5H 4PJXB 1NCAL 3Q5YA 3IYLW 4NQED 4PJAA 3S96B 4LHJB 3GHBL 2R1XA 1ZLSH 4ZOAA 4IHOA 1IC4L 3NIFE 4AH2A 5IK3B 3B6SA 4KRLB 3ZE0E 2BNRE 2VDKL 3T08A 5SX4H 1IMHC 2ADJB 1NJ9B 2HKHH 1I1FA 5C0RL 1U8IA 5EO9B 3C6SA 3P73A 5SWQB 1QTYT 2YUXA 5I1IH 2VDMH 3FOLB 1A6WL 3T2NH 4O02H 4AJ0A 5EIIA 2CJUL 3OG4B 4ZAKA 2JCCE 1CVSC 3WXVH 4NGHL 4Z7VB 4QXWA 5ALCH 2E7LE 2YXMA 1AHWB 4RMTA 1NDMB 3W9EB 1IM9B 2R1YA 1JV5B 3KYOB 1KCLA 4CNIA 5L88L 3EO9H 4EN3C 5BW7A 3ZHKA 3D3VE 3AM8C 3BMWA 1YEFH 2DQGL 4LRNL 1X7QB 3LEVH 2EDJA 1GVIA 1KJMB 1S7SA 5TQ0L 2UWEB 3B9KD 1WICA 4QF1B 3ZO0A 1EIBA 4NKDA 3S4SB 1GGTA 3OAUL 4RAUB 3LQAH 1BLNB 3QNXB 4C4KT 2APWA 3DNKA 3C08H 3NH7H 3MOAH 4L1DA 5ERWA 3HAEA 2CKBL 2D2OA 3K46A 3N9GL 3HZKB 1FYTA 2KUTA 4I3RL 2H8PA 2XICA 1MLBA 4UV4H 1MI5B 3H7BA 1UM6L 2ZUWA 4IOSD 3O8XD 4G6MH 1QD0A 3U46A 3A6OA 3KJ4B 4AMKL 3NTCL 1HXYA 4LDLB 2NY4B 1U93B 4ISVA 2BRRH 2BY0A 4P23B 1IGFL 4C83A 4PLJC 4LCYA 2NZ9C 4WEMB 5J1AA 1P4LA 5HYJE 4OCXL 4ONHA 4ZXBD 5J7CC 4P3DA 1JTOA 3H9SE 1KN2L 3ARUA 1KENL 3V6FB 1M7DA 1S7VB 2HJLA 1HHKA 5T1KB 3O6LL 5JIKA 4XBGA 4RRPA 1DBML 3AB0B 1VEPA 1WSST 1KBGL 3A67L 1EAJA 4WNQB 4Z7WB 3KPRA 1NEZA 5HHMB 1A4KB 3Q5TA 1UB5B 3DX8A 4HX1B 4PJ8D 2EEBA 4FABH 5FB8B 3DV4B 3CXHJ 4PJ7A 4O4YL 2DM2A 2EDQA 2P5EB 4IJ3B 5E2UH 3MLVL 3SDXE 1DBJH 1R24B 1A6AA 3FQUB 2DB8A 3FO2B 4G8FA 4UOW0 1MWAA 2ADGB 2Y5TB 3LEYH 2VZUA 1XGRB 3MJ7A 4U6YA 1ZT1A 4PJCA 4C56E 3CIQA 1BEYL 3LSOA 4V1DD 5F6HJ 4OIIH 1BZ7B 5GJSH 5JLZA 4OZ4B 4FFZL 1FGVH 5DD1H 1YYML 3HB3C 2IAMB 5C0CB 5D7JB 4R4BB 2A9MH 1A6VL 3E6HB 1QO3B 1KCVH 2IPUK 3RWEA 1L0XA 3WYRA 4GFTB 5IWLA 1CXHA 4IRSC 2J2ZA 2I60H 3S5LG 3ARBA 3V5DA 1UWGH 3FFDA 4QHMB 3L3JA 4DKFH 1A6ZA 5F9JB 5C8JA 1WT5A 2R0WH 5DHVH 5C0IA 1U8MA 5D7IB 2W0LA 1ZS8A 5JA8B 4JG1H 3IRPX 1HIMH 4M1CD 4F58L 1R3IH 2HRPH 1MIEH 3RZCC 5AAWA 5CIPH 1A22B 4PGBB 3CU7A 3BSZH 4NHUE 1QNZL 2BHZA 4V2CB 1NAMH 1KIRA 2C4FU 2FNBA 3PGCA 4QTHA 4Y16C 1ORQB 2JB6A 1NMBL 1JVKA 1X5YA 3S35X 1Z0NA 8CGTA 1QVOB 1ZLUK 5I1LA 1VFAA 2DQIH 1Y18B 2RFXA 3GSVA 1CICC 4OCNC 1JPFA 1ZHNA 4WI4A 1XGUB 4MQ7A 3DO7A 3SY0A 5TDNB 5EC1A 3MV7D 4POZC 5C71A 4PJBE 1T89C 5L2KD 4D9LL 2LAAA 1MHPH 3SEPA 2SEBA 1CS6A 3P4OA 2QHRL 2FRGP 2H1PH 4KV5E 3SGJA 2B20A 3O3DA 1AO7B 3SE3A 4N8CH 1RUAL 3GMPA 2W59A 1M7IA 5CAYB 3FCTB 3BEVB 2ZG1A 2OP4L 2YRLA 4G6FD 3DYPA 3RJQB 2ZUYA 2V5SA 1MCPH 1D9KA 1YECL 2CRYA 1TZHB 4Y5VC 4E9LA 4U1SB 4ZUUA 4H8WL 3VRIA 3V0VA 1BIIB 2H41A 1IJ9A 2X9YA 4Y4FD 1RZJC 2NNAA 3IDIA 1RZGA 5CILH 1TZGH 5IF0A 4D9QE 3N50A 1R6VA 5A16B 1F11A 2Q76A 5IMOA 4JY6A 4JFOA 2BNQB 1C16A 4OGZA 4QRPA 1R3KB 2AKRA 1FV1B 1RD6A 3C5SB 1MF2H 2D7TL 3LDBC 2E3VA 2EE9A 2AJ3A 3G04A 1OAXL 5I66A 4JEGB 2JELL 1P5VA 2VAAB 1CGUA 3QFJA 3D69B 3IDJA 3KLHC 3RZWA 4XB8A 4X9HA 5I30H 4LSVL 5DMYA 5CGTA 2XTJE 3WEXA 5E8OB 4UB0H 5GGQL 2AK4D 4M48L 3IU4L 3O8XB 1QFWH 1RMFH 5DT1H 4Q9CA 3NIGF 3U1SH 5DK2B 3QUXD 4N0CD 1CU4L 3O2WL 4M8VA 3QULB 4OCWL 5D7SH 3RL2B 3SKOA 5I71C 3GBNL 1F4HA 4BM7A 1S78D 1NUGA 3F7YB 3AMLA 2F15A 5ALBH 1A7PL 2BVEA 2QQNL 1EVUA 5CJOL 4ZXBB 1FLRL 1K5NA 3L3GA 1CFVH 3FHQA 3GMQB 4MNGB 1YEHH 5DK0A 1G7HB 3HAEG 3VFMA 3UTPE 3OXSA 4FFYH 3HNSL 3TBVA 5ILTH 4L4TD 2JE8A 1FNAA 4OI8A 5BS0E 2DM3A 1MJJB 4Z7UE 1PGRB 4JN2B 4PJ8B 5IVZB 2DQFA 4RCAA 4NKMB 5E8DH 2AJVH 5KVFL 1P6FA 3OGCB 3EDFA 2ERJB 4OF0A 4YFLI 5HSFA 4Y2DC 2F53A 3B9AA 3PABB 1CBVH 2HRLA 2WANA 5LG1A 4NRZB 5GGTH 3IJHB 5HI4D 4IOIA 3Q6FA 4RRPG 1FDLH 2B1HL 3RWGA 1EJOH 3DETC 5C9JA 4IOFD 2VZOA 3U4EB 1JZ3A 2F54D 3K4ZA 1NEZG 1A2YA 4GAYB 4V1DB 2EIEA 1JWSB 5E94B 2YKLH 2VWEC 3MTRA 4TOYL 4P2RA 3MXVH 4JY5L 5D9SA 2CLVB 2VLJE 1H15A 4PJEB 4MCYA 1W0VB 5IFHL 5F7HA 2MTPA 1Z5LA 5T3ZE 3K8LA 4OCLC 5CMAA 4MDIA 3WHXB 2B4CL 2ICES 1FN4A 2F74B 1DUZA 4PJHB 4OLUH 2W9LA 1REIA 2UY6A 3O4LD 4P3CH 4CRPA 1T0MA 3BT2L 4MX7B 4F33A 3SJVA 5ABDE 5C09D 4I77L 2HFFB 4OBSA 4YPJA 2NY0C 3P9MA 4EUPH 4HPOH 4NZRH 4EN3A 2EYTA 5HJ3A 3X13B 4MHHI 2PYEB 1P4IL 4XT1C 1ORSB 5ADOL 1A6UL 2EE3A 1NLBL 1HSAB 1DQJA 1HEZB 1NGYA 2R2HA 5T3ZL 5I1HH 4NOFA 4JPVH 4G42B 4OZIA 1I8IA 3QIUC 3HKFA 1QEWA 2N4IA 3K2UH 1PFCA 3UBXA 1VPOH 1P5UA 1KG0B 3ZDXF 2YS4A 4G8EA 2N1KA 3T3PE 3PWJB 1NAKH 4TTGA 4HUXB 5L2KB 4BELD 1Q9LB 3T4YB 3U9UA 5J11B 5HY9B 2GITB 3QEUA 4JFDA 4NHCL 2ZUTA 3RPIA 1RFDH 1N8ZB 3ULUF 3IU3A 2RCSL 3MMEB 2PXYD 4LLUA 4ZQKB 1BOGB 1YMMD 4WFFE 5CJ8A 1UVQA 1INQA 3GMLA 3LKQA 2IGFH 4G6FB 5GRWA 3FAWA 3HRPA 4GS7C 1UG9A 3Q6GL 1R3HB 3JUZA 3SKNB 3OR6A 3Q48A 4KZEL 4HXBH 5EZOH 4LDEB 5IHUH 4FFVC 5IIEB 1X5JA 4Y4FB 4FQXD 4X8XA 3WUWB 1UWEH 4PJFE 1JYWA 5DZLA 3GO1L 5E2TH 1Q72L 2MFNA 2GFBA 3SGKA 4MAYD 1F4YH 2V5TA 1TVBA 4QKXB 2JJUA 4M5YL 1G0DA 3W11C 2HTKC 1EMTL 1A3QA 4HKJB 1D5IL 1QFWM 2DJSA 5MEND 1PYWB 3FMGH 1PZ5B 1PAMA 4U1JB 3OQ3B 4ZYKA 3QDJD 4DN3H 5TDOA 5KVEH 5E4EB 4PUBL 2AK4B 1WAAA 2OLDA 3HI5H 4LSSH 1MPAL 1HDMA 5LGJA 4XNYL 3QUXB 4JFEA 3WNNA 4I18C 4NWUL 1VB9A 5HI5D 4R4FH 3CMGA 1CQKA 4LNRA 4S10A 4KPHH 3STBA 4S1QH 2XZAL 4NKOB 5JIPA 3T8XA 3QNYA 3FL7A 4DZ8B 5HI3C 4P2QA 5AYQA 1LNUB 1JMZA 2ORBH 1QYGL 4H25A 4M6OH 3S9DB 5FKPA 4IRSA 4EIZC 4KJQD 1IEAA 4YUEL 2EE2A 4LU5L 4UUJB 3TWCL 1P69B 2X7LA 1JHLL 4FZEH 3RAJL 2EXYD 2G60L 4H88L 4GG6A 1RZ8B 2R1WB 4GAJL 3O3BA 2ZUQB 2YD2A 2Q7YB 1J0ZA 1FORL 4DKAA 3QDGE 3QEGH 3RZCA 2PNDA 4LVOC 4XNXL 3FFCD 1U8QB 3IXAB 4H1LA 4JAMA 3ZL4L 3KPNA 3UZVB 4Z0XA 3WDIA 1WIPA 5FHAL 4GKZA 3FQXA 1MCDA 5K9KA 2UYLB 4LGPB 2FB4H 4Y16A 3EOAB 3NFPA 4X6FB 2X05A 2AXFA 3PJSB 1DVFD 4EZMA 4W68A 4IDJH 3VD5A 3KNBB 4XPFH 4UT7L 4DCQB 2GK0A 1CICA 1SEQL 4O2FB 1OP5H 2DJ4A 4QXUH 1Q94A 3ULVH 2DQHH 5E6IC 3MLYL 1JHTA 2FX7H 3MC0A 1S5IH 4JHAL 4RBPK 1URLA 4LF3B 2OTWB 5DJDB 4MCZB 4Y5XC 1HNGA 4HUKB 1CLZL 4BQCA 3WJJA 1OD7A 1AKJA 4X6CF 3EDKA 3OB0K 2YUVA 2XY2A 3GHEL 1ZVSB 5EU6E 3QJFA 5C09B 4LSDA 4YR6A 1I7RA 4E42B 2X4RA 4HWZB 5I16A 1UB6B 1I4FB 4N0YH 2AGJL 2IBGA 1AXSB 1XCTA 1G0XA 3W9DA 4JM2C 1HYSD 3GMNB 5KS9B 2V7HB 4N8VB 2FECL 4PJAF 4HIJA 1F00I 2BY3A 5D4QA 5EBMA 5TPWL 5TE7L 1OSPL 4Z6AT 4JHWL 2J8UF 1U91A 4U05A 2EKSA 3VH8B 4J6RL 5ISZA 4RGNE 1U2CA 2CK0L 4J3XA 1U9KA 2HFEA 3WJLC 4Y89A 3I6GA 4KROC 4EBQH 1A9BA 5IVXF 1U6AH 1T2JA 4OCSH 2PXYB 4KKLC 5F89A 5EBGA 3LAFA 5D1XC 5EUOE 1WZKA 2BVUA 5DHVB 2C3XA 3OKKB 3WFCL 5TDPB 1HILA 1YEGL 3C09B 3VFOA 4PB0L 3AROA 4LQ1A 2AQ3A 3BMVA 5TE4H 5CIPB 4XH2A 5FDYA 3OXRA 1KNOA 2D9QB 3MCKB 3KPQA 3MBEC 2AJYL 3G6DL 4YDKH 2C1OA 5CP7B 5IB2A 5F7EL 2F8OA 5MEQB 3I6KA 2OL3A 2ZKHH 4MJ6B 1JK8A 5I74C 3MCLH 4XRCB 3EYQD 3VXNB 1ADQA 1F3DH 3K81A 1N2RB 5E99H 3RVWD 4M7ZB 1TZIB 4C59B 3UJIH 5F8RC 3ZDYF 2C1PA 2XWBA 4PDCE 5FM4A 3VCLA 4ZODA 4YGAB 5MENB 4KKBC 1DDHB 5GGRY 3LKOA 3IKCA 3QWRA 3RI5F 3VXTA 3RWFA 4YXKL 3LRSB 3NGBB 4Y2DA 3FHAA 4QRSB 3LQZB 4XGZA 1J18A 4YHZH 1ZHKB 4TNVF 3R0MA 2QADC 3UJTL 2E7LC 4YC2C 1P7KB 1LP9B 5E9DD 3TA3B 2Z91A 2NW2B 3LRGA 4DTGL 43CAB 1I7TA 4PJ9C 4UT9H 1PLGL 3SDAC 3MRFA 1T20B 3RDTC 1XGQB 4F8TA 2VXUH 1P2CB 1OLLA 3T09A 4FQHA 3EGSB 2Q8BH 4P3WA 4ZFOB 1GAFH 1BD2E 4ONFH 4KXZI 2VQUA 4PG2C 4WFED 1M05A 4WGVB 4LLYB 1CE6B 3JTTB 4BZYA 4GW4B 3JVGA 4YFEA 4G43A 5D8JL 4LQFH 1XCQA 2YR3A 4PJ7F 1LEIB 4MNQE 2DKUA 2JF1A 5HHOD 5MERB 3FFCB 5IM7B 1NLDL 1OT2A 3QXAA 2BJML 1LDPH 1QPPA 5CP3A 1ZLVH 1HQ4B 4MVBD 2O5YL 1NL0L 3Q3GA 3QAZB 4Q7DA 1IGYA 2CXKA 1DVFB 1G1YA 2W0FB 3BPLB 5KVDL 2FEDC 4MS8A 1I3RA 3QIUA 3QH3A 4KY1L 4QRTB 3UXFA 5CD3B 3NCCB 1DN0B 1PG7H 3O2DA 4NBXB 5D5MB 3T1FB 4TNWK 1MRFH 1FVDB 4Z5RB 3MV11 4M7KL 4H1LG 4U1NB 4HBCL 3NN8A 2CRIA 1QRNA 2BOCB 1K8DB 5EG6C 1UJTA 3DXAB 4PRIA 1XF3B 3EIFA 3O6FC 4ORZC 5KAQG 1P84K 2WWMC 4Q97A 1H0DA 35C8H 2VYRE 5D1QB 5SX5H 2JJVA 1J05A 3NIDE 3QYCA 5IG7A 2X4NB 2IPTL 3EJZD 2HH0L 4MDJA 3FRUA 1INDH 1HWHB 2XN9E 1U95B 5HVHB 3G08A 3NCJL 1EO7A 3ZHDA 1LQVA 2GKIA 1GGBL 1JN6B 2CDGB 5D7LE 4NO3B 1KJ2L 1N4XL 3BRFA 2E7BA 2VZVA 3S88L 1U8LA 5EO0A 3U0PA 3ULVD 2NY7L 4CMHC 3S34H 4ESKA 4XPAL 3UZEA 2R15A 5CBAA 1A7NL 12E8L 3H3BC 5DHYA 5C07E 1WEJL 2VLLB 5IT2L 1HK6A 1A5FL 5ETUA 4PLOB 3TJHD 1NEUA 3ET9F 1MWAH 2ZP0T 5I75C 1KB5L 3EYVB 3LPFA 1L7TH 1NANH 2YWYA 2X70B 2WAHA 4YZFE 1CGSH 3E6FB 3OZ9L 4BSJA 4M3KB 4HUWA 5GGUA 4F37F 4TSBL 4YXHH 1RZIA 2JJWA 4I18A 3TN0C 5E2VL 5HYFA 4BZ1H 2I9TB 4JKLA 3DIFB 4MGXA 5DEZA 4OFDA 4NQCE 2J4WH 1EZVY 3CGTA 2BFVH 2PCPB 3BUYB 4U1IB 5I1JH 1YPZE 5DJZA 4X4YA 2GJZA 3DOSA 4OD3H 4YBHA 2HN7B 3CFKA 4RGMB 4WHTA 1J88A 3QG6A 1KELH 4X99A 5T33H 3PDGA 3V5HA 2CR6A 4H8WC 2VSDA 2Z93A 3F7VB 2WY3A 4NCC2 3CVHA 5SWSE 2XQBL 1RUKL 5FKAA 1I7UB 4P48A 2BVYA 4P57B 3BJLA 4N0RA 1CF8H 4G80A 3WV0A 4XPBH 4FFWD 32C2A 3BW9B 2ZPKH 4UOW1 2VLRD 4IMLA 1ETZB 5DYOA 1YNKH 4NQSA 3QNZB 3QXUA 4JQVC 2K7PA 1NCWH 1TCMA 1AD0B 3C87A 2NTFB 1ZT4A 4XMKL 1LE9B 3AS0A 3PHQB 5DJXB 3U6RA 3VFTB 4R0LB 2H9GB 1Q9OA 4P4KD 1A9EB 3VFGL 1W72A 3VRLF 2FLBT 3G5XA 4U7MA 3TNMB 2DTML 5E6IA 2VC2L 1RHHA 2IPUG 2VLKE 4NUGL 2VR5A 4K3JL 4RSVA 3WLWD 1KEGL 4KUCF 1FPTL 1ZHLA 5BOZG 1A4JB 5D71L 2VL4A 3MRHB 5KN5A 2NY5H 2DBLL 4GKSA 1JIBA 3O41A 5JHDA 1HNFA 1UZ8A 5GS0H 1UJ3C 1BZQK 2XTJC 4MA7H 4QT5B 1JZ2A 4G6KL 5AZ2H 5J1TC 1RZKH 1TQBC 1CLYH 4XP4L 4QOKE 4FXLA 1WJ3A 2G75A 3LH2L 5KZCD 4Z7QE 1YNLL 1LEKB 2YD7A 4LARL 4DGIL 1KPRA 1A47A 2GJ6E 1KLUB 5LWYH 4JFFA 4OZHF 3T0AA 3TCLB 1VGKB 1C12A 1IAKA 2FYYB 1I8KA 4JM2A 3EFFB 8FABA 1YC8A 3A6CH 4M8QB 4M6ML 1PDKA 1J1PL 1G7JB 2WIMA 4TUOA 5E00A 3RVTD 1XF5A 1GOGA 1MLCA 2FGWL 4WFGE 3CCHB 3HCVA 1HOCA 2CDEA 3P30L 3RWJB 3UZQA 2H26A 3WFDH 4V3DB 1K9TA 3MNZA 2QQLH 2XI9A 3JWDH 4OIAA 4L8SC 5I1GL 2ZOLB 2EH7H 3VFNA 3LKPB 3C9NB 4ZAKD 1MFNA 3QEQA 1CWVA 1KIUA 4OSUL 3CLEL 4QHNA 5DMIH 3BKYH 4NM4L 4NQUA 5C0ND 2ZCKL 2MQCA 2CSPA 3K3QA 2EE6A 3U48A 1AQKL 3KYNA 1D6EB 4X8JB 1ODAA 1TVHB 4O58L 3VXOA 1BBJA 3GKWL 3WO4C 4OLXL 1PKQE 5E8PA 5B3JF 1RJZB 1T6VN 1RK0B 3OPZH 3LQMA 2FR4A 3BIKA 1BMGA 3U30B 1FH5H 1JPSH 1W0WB 1FIEA 1QOKA 4MXVF 5GSRA 2BOBB 4JFZL 3C2SA 5BXFA 3S36H 3GUTA 1Z2KA 4K23H 4Y1AB 2E8YA 3DARA 4Z7NF 1JNLH 1IBGL 2Q86B 1FYTD 2VDOH 4UDTB 1KCKA 4GQ9L 3O0RL 2O5XL 4DVRL 5DURD 1IZKA 4OD2A 1FFQA 3GSOB 3ZE1E 2VXQL 2PKDA 5DUPL 3MV9E 1GGYA 5I9QC 1LE5B 2X4QB 1OAYL 5BVJB 1EEZA 1R3JB 3U4AA 1WIUA 2OQJB 1N0XL 3QRGH 3BZDA 4N0UA 5FA3A 5DDHB 1T7XA 1TDQA 1YN7B 3RVUD 2WW8A 1H3TA 2IFFH 1GGUA 1MVUA 4PJ9A 2MPAH 2NX5A 2G5BA 3SDAA 2HT4C 2OK0H 5CCKL 1UKTA 2V9QA 1YN6B 4X4XA 3NCYS 3S35H 5A43C 4NO0A 4OGXL 3VD9A 2HT3D 1RVFL 3P4NB 3KPRD 4GW5A 1XMWA 4IS6A 5GISL 5I76A 7CGTA 4TULH 2EC8A 2Z0BA 1WTGT 5KSBE 1DBKH 1JGVL 1JMXA 4N5EC 5EUKB 3DECA 5GS1B 1NSNH 4M7LH 4NP4L 4MJ5B 4A2LA 4DAGL 4JREB 5K9QG 5BJTA 1RUPL 4DVBB 1U8NA 4KJWD 3BPNB 4LLDA 1C1EL 3S5LB 4GBXC 1RZFL 5HVFB 2EXWC 4BYHA 1UQSB 4NO5A 1HXMB 3QUKA 1FL3A 1YY9C 5A3ID 1MJ7L 1QKZH 2VLRB 3TVMC 5I8OL 3NBNA 1YQVH 5B4MC 4PGEB 4YHNB 5FXCH 3UC0L 4WI6A 3CDCA 4D8PB 3TPUE 1BJMA 4P46A 2OM5A 3KDMB 3ZLQC 1FNEB 5HYJA 1D5ZB 3ARDB 3KPSE 2F5AH 1MFBL 3FKUS 2FL5A 4P4KB 1JZ6A 1DCLA 1DQMH 5EN2B 1T83C 4HH8A 3TO4C 3VFUB 4H5SA 5FYKD 4PREB 5IR1B 1IQWH 4MXWL 5DWUL 2AXGA 3ARBD 3IFOB 3LKNA 4APQC 5IUSA 3PWUA 4TSAL 1YDPA 3AGVA 1WZ1L 1YEIH 3WN5B 4AL8H 3O6FA 3IDYB 5E1HB 3R8BB 3O9WC 3H7LA 4WI3A 3RUGA 4W6WB 2EDNA 1OARL 3LMJL 2N7BA 3O3EA 3MQIA 1T1WA 3RHWF 4TTDC 5KZCB 3T4AB 3FB6B 3OTTA 4X9FA 1JZ7A 5F3BA 1C5BL 4ODWB 1UXSB 1J1XH 3EOBA 4PRPA 3VGFA 1CGWA 5J13B 4PJAB 1OTUD 3F12A 3L5HA 4RAVB 2R1XB 4P49A 2OXHA 4IHOB 2J6EA 2YD1A 4OD1L 3WIHH 1P7QA 3PGFH 4AH2B 4DUVA 3B6SB 3RIAK 1SMOA 4QYOB 1GRWA 3DUHA 4LVHC 1SVCP 1AY1L 2XG4A 2JJSC 4MB3A 5AZEH 1G6RA 5DC4B 1I1FB 2VKXA 1U8IB 3C6SB 3P73B 4BSVA 3T0EE 2ZUXA 1WC7A 1Z0MA 1EGJA 5EIIB 3WFBL 2QHLA 1JBJA 3GBMH 1U58A 1MJUL 1DE4B 5INDA 5GS0D 3DROA 1D9KD 1J87A 1MCQA 1FFRA 4XVSL 5DVMA 2R2BA 1SMAA 5FUZL 1KCRH 4NHUA 2R1YB 3TN0A 4FQ2L 3MRJA 3BIAX 4CNIB 1WWWX 1WGOA 2GTZB 2BX5A 5FK9A 3NCBB 3UPCA 2AJUH 4O51A 4HFUL 2ED7A 1IGIH 4LHUG 1CFNA <