3TVMA

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
274
structure length
268
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
molecule keywords Antigen-presenting glycoprotein CD1d1
source organism Mus musculus
molecule tags Immune system
total genus 71
structure length 268
sequence length 274
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tvmA01
4M3KB 1U3HA 2FD6H 3PWUB 1XZ0A 1DLHB 1H5BB 3D3VB 1YECL 2JTDA 3CDCA 3PGFH 5HGHB 2RQ8A 4ZOEA 3WS3A 4EIZC 1NEUA 4UOJA 2SEBB 4MJID 3SY0A 4NUJB 4G7YH 4YX2H 1ZTXL 5H94A 2OLDA 4QCIB 1H0DB 4UIMA 4S0UC 2NX5B 1UZ6F 5GSVB 4D3CL 3BOVA 3LQAH 1SEQH 1OAQL 4C56B 2MQ3A 4MSWB 4XCYB 3L5XH 5SWZE 1BIIB 1ZLWK 3HZKA 4WO4D 4L4TA 5JOPD 4YXHH 2C9AA 2P24B 4KVNH 3OXRB 3SGJC 2R39A 4MJ4A 2VKXA 4IHOB 4Y8AA 5I71C 5TQ0L 4KFZC 3VD3A 4J4PA 1EO8L 3I6LD 3IKCA 1BJ1H 1QO3A 3TN0C 3QUXC 2BCKB 4P9HL 2F58H 2FX8L 3VFSA 1XCTA 2FGZA 1RULH 4FQXA 4JN1H 3MRKA 1FO0H 1CD1A 4XVSL 8CGTA 2N4IA 5IB3A 5JLZA 2AQ3A 4Y4KB 1F4YL 3KS0J 5A2FA 3JWOL 3LEYH 4RAVA 5A16B 1PQZB 3BPCA 5C6WH 5EU6A 3OKYA 5LWYH 3P30H 3QNZA 5ADPH 3SCMB 2BSSB 3CSPA 4P59H 4BUHA 4A2MA 5EIQA 4WCYL 1DUYA 2H1PL 3GSUB 1CFTB 5C0FA 2ZCLL 1HI6A 2WBJC 4FFVD 3R1GH 1JE6A 1KCUL 5F88A 5AWNL 4N8VA 5I6XC 5KVMC 4Z7QE 4LK4A 3ZE2F 3TESA 5T3ZL 1AQKH 1W0YT 4AIXA 5GGRY 1KGCE 4XNZC 5CMAB 3ROOB 1NEZG 3DVGA 4JFZL 5GGRA 3DPBA 4BH8A 1UWXK 4H1LH 5DJCA 5C08D 3MRDA 4PJ7B 2FEDD 3EDKA 4JN2B 3B9AA 4HGKC 3BGAA 3LQAC 4OZGA 3KXFA 3CFCL 3FB8B 2VZTA 2X2YA 4JPWH 2O5XH 4GRWB 4ZS7L 5IBLD 1FG9C 3V4PH 1JHTB 1I1AB 3O3DA 4U1GB 5ESVB 3N1GC 3SBWA 1QVOA 2ZUQC 3GB7A 4IRSB 1BAFH 3WN5A 2GY5A 5C0AE 3EJZC 5F3HB 4ZFFB 1QUNA 2UZYB 4JZOA 4PJGB 2OMNA 1QRND 1XF5B 4LCUA 1A7PH 1HXMB 4KHTH 4M1CC 4IIQB 3ZYIA 1U0QA 43CAA 1HYSD 1OT1A 2K7PA 4RAHA 3KR3H 3B8SA 3KPOB 4FTVE 4JKKA 1OCWL 2BNRA 1KENH 3F12A 4LP4A 4U05A 3U6RB 3CLEH 4R7DA 2NY7L 3IFLH 3ZKXC 1G6VK 1NCAL 5GZND 5MEPA 1CGXA 1UXWA 4P46D 5D5MB 1W72A 3O3UN 4PYGA 2YUWA 35C8H 3P4OB 4JFED 4HZLA 1G84A 4LMQI 4G7VL 4YDLB 4PGDB 3RVVD 1KEMH 2EH8L 3QQ3A 1I7RA 2QKIA 3QJHA 5ADOL 2IBGA 2PO6A 1J05A 5E9DA 2IFGA 1G7LA 1A6VH 4NQVB 2Q6WB 2ESVA 4DEPB 1NC2B 2R23B 5C09D 1Q9LA 1CDBA 4M5ZH 3ARZA 2J1KA 4U1NB 1DBAL 3NFNB 5IMKA 4G8EA 3BPOB 4FFVC 5DYOA 4H5SB 4P23B 4YR6A 1RZIA 3RUGE 3EJJX 3LKPA 1FQ9C 3RGVB 3SOBH 2JELL 3VWKD 1GOGA 4OFPA 1AIFA 1AO7E 1MRDH 3EFFA 3BYYA 1NSNL 1K6QL 1PKQB 1C5CL 1TXKA 2VMFA 2BY2A 1GJIA 4M6ML 1I3GH 2C7UA 3CX5K 2R1XA 3IYLW 3WS6A 4QF1B 4AENB 2F74A 5C0JA 5L9DH 1T7ZA 4LCWB 3NABL 2YD9A 1MY7A 4YH6A 4YHIA 2FRGP 2QL1A 1PG7H 1WT5A 4HWUA 2VWEC 5T5NG 1IC1A 3NCBB 3WHE0 1MIML 3G5ZB 2OQJB 3VXRD 4PJ9C 2HA1A 5EPMA 3MRNB 5FM5M 2J88L 1V7ML 1QYGH 3V4VH 1Z2KA 3C60D 3MUGA 4LVOC 3WIHL 4PLNC 5HBBA 5BVJA 4J3OC 4LSVH 3W9DB 4H25A 1UFUA 5LJYH 3BP6A 1BFVL 2YPKB 3DNKA 4MQXD 4X6CA 3HE7B 5EZIH 1GC1C 2F15A 4IMKC 5FYKL 3VG9C 1HXYB 1CBVH 3C5ZA 2P43B 1XGUB 2NNAA 2XA3A 3E3QE 4X5LA 5CGYC 3WHE1 5DS8A 5C9JB 3SGEH 3WJLC 1TVBB 2FBJL 3QUKB 5DR5L 1Q9WB 5GZNC 1YN7B 1FH5L 3BI9X 1KJ2A 4HK3N 3QH3B 5IIEA 4P46C 1CGTA 1JF1A 3IDXH 5I1KH 4WFFE 4HUXB 5FM5O 3B2UC 4LFHD 1GZQA 4N90E 5A2LH 5HGAA 5F1NB 4W4OA 1LEIA 4J6RL 4OBRA 1AI1L 5HI5D 4NN5B 4TSBL 1CXHA 1H3VA 4K9EH 1SMOA 1S7TB 4WHYH 3DROA 3O2DH 1QSVA 5LBSL 5D7LD 2ILLA 1KJVA 1H3PL 2A6IB 2BVOB 3UBXB 1QKZL 2P47B 2JB5H 3F7QA 4P5TD 4U3HA 2C26A 4RMWA 4ENED 1GGCH 1U8PB 4JZJA 5IJKA 4L8DA 1BZQK 3TYGL 4I18A 4Y19D 2O5ZL 4DOHE 4GG6A 5JPMA 5KW9L 4LSSH 3TIDB 1RY7B 3K74B 4QEGA 3VD4A 5DT1L 1R3KA 2AEPH 2JJTC 3OG4B 3PGDB 2VXUH 4K55A 4LBEA 1LHZA 5I74C 5J9PB 1CD0A 1FBIL 2OTUB 4KJQC 4I9WE 2CRZA 2Q8BH 3BGFC 3CVHL 3HC3H 2IPKA 4QRUA 2V9QA 4JO3L 1EXUA 5FO8B 3K46A 5HYJD 2X4QB 4G6KH 3HB3D 1JBJA 1URLA 3MLYL 5A40E 3ILQD 2H32H 3I50L 3F62A 2BHYA 2E6JA 4KDTC 5I9QC 2IPUG 4GW5B 4PRPD 3ARWA 4RGMC 1B0RB 4M7ZB 3KPSB 4G9FE 3GMLB 4XBGB 1Q8MA 3LAFA 5F70A 5IMOA 1MJJA 1TNNA 1NUFA 1KB9J 3HI6H 2AXJA 5KN5B 5ESQB 2Q8AL 5GGUA 2WSKA 4TNVK 3ZTJH 4NKDB 1P7KB 1T20B 4XGZB 3MBEC 4PJBE 3R06A 1Z3GL 4U4BA 3EOTH 1F5WA 1GGUA 5EBMA 1HQRB 1SMAA 3L3DB 4HC1A 5EORH 1T1WB 4Z9KB 5EIVA 1J0KA 5TF0A 2YEZB 4K9EC 1HHJA 1A4KB 1ES0B 5IVNA 12E8H 1CIDA 3WNOA 4JHBA 4P2RB 1P4IL 1LO4H 1J8KA 1H3WM 2CDFA 3N1QC 1ONQB 4EDXA 4I0CC 5FIEA 3GSVB 4HKJB 4O51B 4HT1L 1OWWA 3BDBA 3NIDF 5E00A 4MS8C 1MFBH 1FFQA 2NPLX 2CK0H 5HI5C 2BXYA 1FN4A 3CGTA 5DJAB 5J0BA 1W0VB 4PRNB 1X6NA 2GT9A 2H8PB 5HHMB 3FRPA 2E7LC 1AY1L 1X9QA 2VITA 3RWFB 4F33B 1HH6B 5F7FA 3HAEA 4NCDA 5EFIA 4PJDE 4B50A 4B53A 5SX4I 2C4XA 1ZVSB 4LLWA 5CINH 3PNWB 2AJZB 3VFPB 3MMEB 3HNTL 3QG7H 3C09C 3MYJA 3S3SA 4MX7B 2A0LD 2FB4H 1LEGA 4JFOA 1TCMA 3OAUL 3QIUD 5JIIA 5GS3A 4JREC 1F6FB 4K7PH 2NY0D 3JV4A 2X05A 2XNAA 3I02A 2DD8H 3GM0A 3LEXA 4H1LG 4PJ5D 3TH4T 4M1GL 1TNMA 1DLFH 3QZWG 3S4SB 3TBVA 1F97A 3DX6B 4Q6IB 1KCVL 1NAKH 2F54B 2R4RH 3DV6A 1FZKB 3ILQC 3GI9L 4Y5YB 2YC1A 4NRZB 4XPFH 5ACLA 4JDTH 2BDNH 3S35L 1CZ8H 3O81A 4R8WL 5F96L 1I8MA 5HI4D 4YDKL 4OGYL 5DF0A 5ANMA 5KSBB 3BPNC 4JKPH 2AP2A 3IJSB 4GRLA 1EHNA 4BSJA 1QFUL 4GKNB 1S3KH 5E8PA 5IB5B 4CN6A 5GRJL 2W38A 5D2NC 4PV8A 1HZHH 5ITFA 2EIZB 3T77A 4KK6D 4Z7OF 3SDYL 5GJTH 4KY1H 1A47A 5HD8C 3QUMA 1MCEA 3C6LD 4PB9L 4QKXB 2EDYA 3B9KB 1T0NA 1DQJA 5HDQH 4YWGL 3O4OC 1FZOA 4NUGH 1EHAA 4K8RH 4OLVL 4WI5A 5D1ZA 1KLUB 4PJCF 3Q1SH 4QT5B 3DVNB 2NXZD 1M6OA 1A6WL 2RBLA 3OAZH 3WO4B 4ZFZB 5EC2B 5BXFB 1BQLH 4KUCF 2VWEE 2ENYA 3WLBB 1BD2B 4UT7L 5D1XD 1S5HB 4UOW0 4KAQL 1I4FA 2CDEB 1V7NL 4XAWL 1JRHI 3E2HC 4W81A 1IAOB 1BBJB 4K7FB 1I8LC 3EGSB 4LVNC 1IM9B 3MNVA 4HQQL 1OB1B 1UWXH 2X1QA 1T04A 1YPZE 1E4KC 2UWEA 1H5BC 4OF0A 3SQOL 3CH1B 2IAND 1I1RA 2A9MH 3BHBB 3FT2B 2DBJA 3OKOB 3AXLA 4N8CL 2NY6D 2R29H 5FYLH 4PLKD 1WVZA 4UOW1 5D71H 2F19L 3KPPB 1KFAH 4PRHE 5E2TL 3VXSD 2ITDA 3SE4C 2WBWB 1S7RA 1A9EB 1Q0XH 3CXHJ 4FXLA 3CH8A 4GRWH 3MRFB 3T1WA 1ITBB 3OZ9H 3D9AH 1HIML 3W9EA 4JRXB 3QQ9D 4PJEB 4U1HB 5ESVA 5T33L 3P73A 4HV8A 3ESUF 5KVGH 2A6DA 4JQIL 2RFXB 3T8XA 2EO1A 3VGGA 4P57A 1U8JA 3TNNA 4K8RC 3TNMA 3PV7A 4RFNB 1JNHB 4TULL 4QHLA 3Q6GL 3NH7L 4Y4KC 1R3IL 1BBDL 2BNUB 3WE6B 3HUJF 5C07E 1UWEL 4O2CB 4Y16A 2ZG3A 3KPOA 4Q2ZA 3HCVB 4KK6C 4UQ2B 1VPOH 5MEQB 4ZSOA 2IG2H 5HGBB 4EXPX 1OARL 5F9AC 3WXWL 3SCMC 1EFXD 3B6SA 1S7QA 3J7HA 5FM8A 1IGJA 3U36A 1KBGH 4BFIA 5I1IH 1CIUA 1KEGL 1N64L 4M3JA 3VMNA 1PY9A 1B3JA 1NLDL 4G80B 4Z78A 3RGVD 5IBUB 2C1PB 2WM0A 3ILPA 2D4DA 5E56A 1IC4L 1JP5A 4NZJA 3KYNB 5I8OL 1OAXH 2ICWB 4D9QE 5J6GA 2P5WA 2BFVL 4PP2A 3ARBA 3B3IB 4PJAE 1RAMA 1RJYB 1LDPH 3RVWD 1VA9A 3IU3A 5CD3B 4TUKH 4ZUVA 2V2TB 1B4RA 4U1IB 3ZZ1A 3IU4H 1WISA 4D9RD 4CMHB 3OR7B 1CT8B 3G6DL 3M8OL 4NQCB 4OIBA 4X9FA 3HZMB 2CIKB 3GSNB 4IMLB 2DM3A 3EOAB 1I1AC 4OB5H 4LL9A 4BZ2L 4XXDA 1FIGH 3TZVB 4U1GC 2OR9H 1SYVB 4OGZA 4FNLL 4IRSC 5EZOH 3RHWF 1TZHA 3VXUA 4FQ2H 3PDOA 4MGXA 5E8EB 3IFNH 4KTEH 4LCWA 1I8IA 4LSRH 1L9MA 3P2TA 1FGVH 4NZDA 2NW2B 4DK3A 4NRYB 3PABA 5FAAA 2AK4A 4U1KB 3BRFA 1YEIL 2XA8L 4EN3B 5F7MC 3SHSA 3ZO0A 3K81A 1YJDH 1S78C 1AJ7H 2Z8SA 4XTRD 5D72L 1LGVA 5FYJH 3G6JF 2PTVA 4KUZL 4F9PA 1YEJH 4MNQA 5CBAB 2E7LE 5AZEL 2GSGB 3LEVH 4QRTA 3ARYA 4WTWA 5AUMA 1FLTX 4NWUH 4YDLC 4ODHH 4LDEB 1DN0A 4JM2F 2WIMA 3ZTJG 4D9LL 2VXTH 4OUUA 3CUPA 3QWOB 4ZNCD 5DI8B 3ZDYF 4L4VD 1WWWX 5DDHB 1MWAB 1DQQB 1A3LH 1BPVA 3DXAB 3NZHH 2R0KL 4DEPC 4MNGA 4O2EA 4Z8FL 2CGRH 2W65A 2YMXL 4AIOA 4JR9H 4U7SA 4XCCL 4OIIL 4E41B 1MCRA 3V6ZB 3BPOC 4J12A 3WLWC 5HY9B 1KPRA 3EYOA 3QIBB 2PW2A 2WP3T 4LPXA 1IARB 3WFDL 3PWJA 4PJHB 3RGVC 3REVB 3N1FC 3RTQA 3TJHA 1MFDL 4B5EA 4WRLA 1FAIL 5HYJE 1QSFB 1EZVX 3FFDA 1I75A 4OCXH 4M62L 3CDGB 1CFSB 1FNEB 1ZEAL 3BRGC 2DQCL 1AR2A 3O2WH 3UX9B 1I8KB 3GK8L 4F7PB 3TO2A 1CGSL 1SJHA 2W9DL 2HVKA 1I7ZA 3FO9B 5I15L 1U6AL 5TGBA 1CFNB 3BKML 4GSDH 2OK0L 5D2NE 1OTUC 3MRRB 3PQYD 1XF2B 3MLRL 3JWDL 1L8JA 5I1EH 4QRSB 5EN2A 4PJXB 3BDYH 5AYQA 1P7QD 3FB5B 4YGAB 5KANG 2X4SB 5C3TA 1P6AB 1XGQB 1YJDC 2AV7B 5DMIL 4GT7A 5MENB 2J6EA 3L5WB 3TLRA 5J57B 4LSUL 4JHWH 2APTA 3ULVF 1S9KC 1ERNA 4OAWB 1ZGLB 4GOSA 5D1QA 3MRJB 1FC2D 3DSFH 3E6FA 4GAGH 3PXJA 3VFNB 3U0PA 4QWWD 2FIKB 2CLRB 4MJ5A 1AQDA 1OAYL 2Z4QA 3HE7C 3TJEL 3QR2A 4BELD 3C08H 4J3WA 2XIDA 1HILA 2YS4A 2H26A 1HSAA 4LSQH 2DQUL 4FQJH 4RWYL 5CWSB 4PUBH 3MLXL 4S1QH 3H3PL 1NC4A 1IAMA 1TVDA 4MD4A 4XH2A 4XNYH 5CP7B 4YPGA 5GHWL 2CMRL 5AZ2L 1HKFA 1UB5A 4OZHB 5M94B 1FZMA 1BJ1J 2UVFA 5DFWH 4ZPTB 4ZQKA 5A2IH 5LGKA 4HIJB 3MV8D 5LCVL 2GSIA 4NKDA 3D3VE 5E08L 1I1YA 5IEKA 2GTWA 5C0AA 4LHUA 4NN5C 3SE8H 1ZMYA 1U8IB 1T22A 4ODVL 4U1LB 2ICEA 5GGSB 3WNNA 1Z5LB 1M71B 1MFCL 4G42B 1S7VB 2EH7L 1ES0A 2DQEH 3C2AH 4DKFH 1YMMB 3P4LA 3HZVB 1W72L 1T1YB 2X09A 4LQFH 2IQAA 5TQ2L 2NX5E 2HYMA 1OD7A 1U8QB 2IPTL 3JVGC 2V6HA 4M02A 1XT5A 3LQZA 3ULSA 5D4QA 3ZL4L 2WUCH 5IVXB 5DQJA 4IOIB 4RBPK 4NRXA 3KPNA 1YDPB 3V0VA 3UROR 1NCNA 2BOCB 1JNLL 5E2VL 2O5YL 5FUCC 2Q76A 4YDIH 4LEXH 1CQYA 1LP9F 3BGMB 4P2QD 4OFVA 2M8XA 5H35B 3P77B 1EEZA 1D9KB 2WANA 5CP3A 3U0TA 3C87A 4OLUH 3BWAA 4KGJA 4ORZC 3RRQA 5EC1B 5E8DL 4JKLA 5IK3B 5T3XL 1RJCA 4LARL 3EUUA 5FB8B 4PY7B 3BEWA 3GSXA 4HUUB 4CW1A 3UYPA 4FMKA 3PV6B 4M7ZC 4X6DF 3PHOA 4XRCA 4OFYD 2A6JB 3HG1B 3AS1A 4UNTA 1MNUL 1NFDE 4JKMA 4AH2A 3OGOE 1R0AH 1TVHB 1T5XA 2VAAB 2VE6A 2XWTB 4G8FB 4JKWA 3DX6A 1C5BH 2W07A 2DLFL 5EOCH 4GKOA 4KI5F 2VLKD 4KJWD 4R4FL 4X5XB 1RK0A 1FYTD 2P5EA 2X10A 3OF6D 4PRAB 4E5XA 5F7EL 2B0SL 5K9QI 5IROC 4GXUM 5CLWA 5FYLE 1W0WB 1L7TH 1WTLA 1CE6A 4PJ7E 1XF4A 4CN1A 3AAZA 5B4MD 5I8CA 2G2RB 1NBVL 3WV0A 2UY7A 4LP5A 4GRWE 2DQJL 3RNKA 3MNZB 4Q9QH 1NCWH 1LD9B 2CLVA 5HJ3B 3VI4E 1WC7B 1P9MA 4CRPA 4OZIB 4KQ4L 1KJ2L 2YOCA 3QUYB 3GRWA 4NZUL 4Y1AA 4PJGE 3U9UA 1BP3B 4AYFA 5FF6A 4XMPL 4KJPC 4KQ3L 1NGXA 1XCQA 3BE1H 3FZUC 3PWPD 4DVRH 1UH4A 3HI5H 2FX7H 3GEWB 4L8SB 4LSDA 3RBSA 4GW1B 3LKSA 4UTAL 3LKRB 1KCLA 1G7JB 3W2DH 5DC4B 4BQ8A 2GJJA 2AXFA 3QDGB 2FATL 1N26A 1A7NL 4V2BA 5D5ME 2FJFB 5LG1A 3FAXA 1MJ7L 4YUEH 2ZSWA 1XGYL 1NAML 1FZJA 4O2FA 3O4LD 4NZTL 3HRPA 5BRZA 5HVFB 1ZHNB 4QRRD 4KRMB 4ZFOB 2LTQB 3W11D 2B5IB 4Q6IC 4NDMB 3G08B 2Q3ZA 1CDIA 3S96A 3BKCL 3TF7C 5JW4M 2Z31B 4JRXD 4Y5YC 4P5KB 3RDTB 2A83A 4S2SB 4K3HA 1UKSA 1GH7A 4HUKB 3G5XA 4C57C 3QDJA 4PJIB 2BY0A 3MV7D 3SKJH 3BQUA 3V8CA 1NDGA 3TH2T 2A74B 4NN6B 1PJ9A 4ELKA 2D7QA 1D5IH 1ZGLP 3B9KC 3V5KB 2V5MA 1PG7X 1RIVL 5KAQG 4MLIA 1AD0B 3CFBA 5IM7B 1ZLUK 1EBPA 4HBCL 2F5BL 4RFOH 1PKQE 3L5IA 4RMSA 5FGBC 3UJTH 4CVXA 1AD9B 4WU7A 5GRUH 4F7TA 3LD8B 1JNHA 3BWUC 4JM4H 4NBZB 4LDLB 3WO4C 3GUTB 1X7QA 5EBGA 4M43L 5EUOF 1KYOK 2ITCA 3UO1H 4ZXBB 2PXYD 1KB5A 1ADQL 1KT2B 4N0FB 3HPJB 3ZHDA 3CXDL 1SBSL 1VENA 3WHXA 1OOAA 5TE7L 1UG9A 4HC1L 1MQKH 1DN2A 3L7EB 3DRQB 2APWA 1FRGL 5EU4B 1ED3B 3V6FA 3TYFA 4JPKL 4GMTL 3TCLB 2DM7A 4J7RA 1S7XB 1OTSC 3HFML 2VR5A 2VLJB 1NGWA 2GJZB 5FYJE 3B5GA 3QP3A 2Q7YB 1JGUH 2VR4A 2WBKA 3NIGE 4MXVE 5FYJU 1VFAB 3IDIB 3VD9A 3AREB 1IGTB 2LAGB 5DJXB 5T1KD 1N8ZA 1ZHKB 4GRMA 1FVCA 2H2SD 3KYNA 4TSCH 5KSAB 4XVUC 3MCLH 2Z9TA 4Y5XB 2Z35A 3OB8A 3LKNB 1ZE3C 3JV6B 4HLZG 4NYLA 4ZD3L 3RY6A 4FQIL 3OHXA 1QP1A 4EBQH 2C3VB 4KH2A 5H8DA 2ADFL 2ID5A 4U1JB 4EOWL 4Z7UA 1FNSH 3HMWL 2NXYD 4GUPB 2QEJA 3GSNH 5IOPB 5CSZA 4MJIA 4HK0B 4LIQL 2NLJA 5FXCH 4KRPB 4QHNB 1AP2B 3FCTB 1MREL 3H0TB 4PRDB 3AM8C 4FXKA 4Z7VF 3UTZA 2VDNH 4ELMF 3LRGA 5I1HL 4XX1E 3QISA 4L4VE 4TOYH 4G3YL 2XKNB 1P1ZA 1R24A 1BOGA 1FO0A 2XN9B 4FQLH 5CAYB 4RFNC 4M7JL 3P0YL 3PHQB 3RPIA 4GMSL 1BX2A 1QSED 3S37H 4WO4A 2EO9A 2NQCA 5JHLL 3BN9D 4OV6F 4EI6A 4CGTA 1NBZA 4JQVC 3VCLA 1J0HA 3F6IA 1F3DH 5D7IA 3UPRB 4FFZH 4XC3L 3EAKA 2ICCA 2VZ1A 5M7QA 3TBWB 2BVYA 5FUCE 5DTFA 4HD9A 3KJ6H 1RZKL 3ALXA 4HWBL 4IJ3B 5GGTH 5DJZA 3SGDI 3UYRH 1PZ5B 1CFQB 4NO3A 1JZ8A 1KNOA 4PP1C 1BIHA 2X1OA 3M17A 2YHGA 4XCFL 3RFZC 1FGNH 4LGPB 5CJQH 1GZPB 4BFGA 4XC1H 1R5IA 1WGOA 1MWAH 3N1MC 5I1CH 3QUML 3PQYE 5JOEA 3E1F1 1U3YA 1NGPL 4POZD 2NR6D 2Y06L 4PP8C 1FE8H 3KPSE 4UB0L 2W92A 3T0VA 3KPMB 2GY7B 5JNYA 1JNNL 4BH7B 4XPAH 1QSZA 2RCSH 3FO2B 4WI8A 3U0WH 3D39B 3GMRB 1QFWH 1MIEH 1TJIH 3L6FA 3KLDA 1A4JA 1HHHB 1KXTB 4NP4L 3FB7B 1G1CA 1N3NB 5BJTA 4ZTOL 2CLZA 2Z91B 1OAKL 3DGGB 3O2VL 3HLAB 4DGYH 2IGFL 1A6TA 4FZ8L 5C08A 3DX9A 4DAGL 5DD1H 5CFHA 3WJJA 2XKUA 4YAQA 3H3BC 1YEGH 3V5HA 1A8JH 1P5VA 3DUSB 1G9MH 2DYPD 2E9IA 4BKLB 4X6FA 1YEFL 2NXYC 4MQ7A 5I1LA 2X70B 3FQTA 4PREB 4XNMB 2AQ2A 4EN3C 3U7WL 4I0PA 3IETA 4PJXA 3TV3H 2OI9A 4B7LA 4ZUWB 4WJ5A 1P7HL 4ODSL 2AK1H 5BOZG 4GQ9H 1NMBH 5HHME 4F57L 5HHQB 1QRNA 3OV6A 3GGWA 5A43C 1I85C 3CFEA 2DIAA 3K2UH 4I3SL 4K7PX 1JYVA 3QUZD 4FQ1L 2A1WH 3IXTB 4OD3L 3X14A 4MXWL 1RQ5A 4Y4HB 4G43A 5CJOH 4KJYA 1YUHA 4R4BA 1BVLB 2VH5L 3BX7C 4CU7A 4X98B 5IB1B 1JPSL 5CP7A 2B20A 1AGEA 5EBWA 3FO0L 4F7EB 5E95B 4L29B 5FO7B 4JFEA 1RHHB 3OKLA 1LK3H 1CE1H 2R2BA 1DBBH 5MEOB 2HMIC 3UJJH 3QIBC 2W0KA 4IM8A 4YBLC 1VEPA 5IGXL 1L9NA 1C7TA 5EUKB 4N1CA 1WUNT 4MD0A 1BZ9B 4JJ5B 4TYUA 1U8IA 3KPRB 1JPGB 2E9JA 4X7TA 1T5WA 3HS0A 5C09A 2VTFA 5DJDB 4POZC 1MUJB 4G42A 3FT3B 4ODUB 1DSFL 3IAPA 3FQNA 4ZTPL 2E9WA 5KSBE 3L3JB 3V0WH 2VDOH 3ZT6A 4LCYB 4F58H 2L0DA 5T1LB 1FORH 4ODTH 1G9MC 2DJ4A 3VWKA 5IVXA 5L2KD 3DX8A 4NNXA 1E6OL 3QB7C 2QSTA 5JIPA 2XZAH 3KYKL 1KXVC 3HG1D 1Z9OA 4V1DD 2W60A 4FQQA 3T0BA 1FYTE 3VWJB 4ZAKD 1LO5A 1B0GB 4OFDA 1YYMH 1H3UA 3JTSB 1JVKA 4GLRH 3WNLA 3VXRA 3NCEB 3IDNA 1EERB 4NJ9L 4HS8H 4QOKD 4NQSA 4XBEH 3EFDH 3EO1A 1BD2E 4HUUA 4HIHA 4PRBB 2H6PB 5HPOA 1FFNB 2MHAA 3C60A 3IFOA 4Y7MA 4JB9H 5I8EB 3RVXC 3WFCL 4S1DD 3LOWA 2EDNA 5DFTA 5GRZA 4GS7B 5C0RL 5DHYB 2Q20A 2I27N 5SWSB 5TDOA 5DD5H 4YO0B 3BVNA 3T4AA 3UAJC 2OL3A 2DB8A 3I6KB 3X3FL 2CKBL 5ALCH 1G7MB 5KJRL 3A6CL 3GFUA 3V2AR 1CXKA 5F3BB 3RKDD 1RUPL 4JRYB 5CCKH 2H9GA 4XWOD 4CAGA 1CR9L 3ARFD 4LCCC 4C4KO 3O2DA 2A38A 2ZOKB 4AQOA 3ARUA 5C0IA 4DN4H 4X4XB 1BEYL 2YZ1A 4OF6A 2ZWLT 3X11A 1EEYA 3VXTA 4C54A 1MCDA 1BVKB 4ALAL 2QQLL 1JNJA 2FHFA 3KNBA 2G75B 3S5LA 5DD6A 3CNKA 2MCPH 4OLXL 4JRXE 5LQBH 4PJEE 5D7LA 5DD0H 4ZO9A 1WAAA 1XGRA 4QGYA 5T5NF 4ZFGH 4JFHE 3HZYA 1Y0LA 3UTTB 5CIPA 4K23L 1ORSB 4P5TA 5FA4B 3TVMB 3CAFA 5C2UB 4MDIA 4HKZB 3S36L 1E6JH 2ZPKL 5IWLC 2VISA 3O9WD 1YNTB 3CX5J 3W39A 2EXYD 4Y19A 1UQSB 3CU7A 3TM6A 1U92B 5BW7A 4PJFB 2R0LL 4WIQA 3VGHA 5IESH 4XXCC 1U58B 5EWIL 2VABB 3DTXB 4NBYB 1CGUA 3EYSL 4Y2DD 1J0JA 1JGLH 3VFVB 1FFRA 4NQDD 4NQEA 1G7JA 3H9SD 3MODL 1DVFB 3QDGA 3T0ED 3IGAA 3RX5A 5SWQB 2FJFA 5DXWA 4ETQB 1A1MB 2NYYC 3A67H 5DURD 5HYJA 1KTRL 2BNQB 5DJ2B 3MV9B 3DYMA 3ARXA 4NDMA 4LVEA 2PUQT 1WITA 2ARJQ 2FR4B 1A1NB 2EKJA 4F2MB 3O0RH 1CXEA 2CIIA 4PRPA 4NKMA 4KHXL 1YYLH 3FFCD 3BP7B 1LE9B 1XGPB 2J6EL 1F00I 1IC5H 4UILL 1JPFB 5LGHL 3VFMB 3TWCH 1CDUA 5EIIB 1DQLL 2BX5A 3DHJA 1B6UA 3SJVB 4XP1H 4MA7L 3TBTA 2A74A 3VH8A 2F5AH 4DUWA 1U8NB 2YA2A 4WW2A 3UC0H 3L3IB 1TJHL 3FN0L 3P11H 4BUGA 2HT3D 3RKDC 3C6SA 4Y89A 1INDH 1F3JA 5F97E 3X12B 1CICD 1QEWB 3S88H 3F5WB 3QHTC 1JZ4A 2AI0H 1XGTB 3UJIL 3HPLA 3QUYC 4MYWB 4OT1L 2X4OA 4YE4L 1TCRA 5DHVB 3U9PH 4XWGH 4HX1A 2EDFA 1MHEB 5D8JH 4K7PY 1XAUA 5EZLB 2NZ9D 4JVUA 3B43A 1I8LA 3P9LB 1J8HB 1ED3A 2JCCA 1E28A 2BMKB 3X3GL 1MELA 1N6QL 1DFBH 1UZ8A 4UTBL 1FJ1B 4O02H 3VXNA 1F11B 5DFVD 5DJ8A 2NTFB 1IEBA 3DGCR 2Q86A 3SDAD 2R2EB 4MQTB 3N0PB 2LTQC 3O9WC 3JTTB 1A7RL 2B5IC 3MRIB 5FHAL 2ARJA 3S9DB 1QSEE 1YEEH 3QIUA 5DGRA 1IGYB 1A7OH 4N8PA 4DKEH 3IFPA 1KF9B 4GXVH 4N0CD 3RDTC 1F4XL 3SKMB 5KSAA 4Z0BL 1UA6L 3DXAE 5KVDL 1S9VA 3MACH 5HVHB 3JV6A 5L8JB 3R0MA 4PJ5A 4JFXB 3JUZA 2RB8A 1FFOB 4NWTH 3T0EC 3SQBA 4E41E 2NW3B 4MLSA 4UMGA 3WXVL 1Y18A 5FK9A 2X7LA 4A6YH 1SM3L 4NN6C 1Q9OA 3BN3B 2YD5A 4U3CA 3WFEL 1RUAL 5BS0B 1QLFB 4PJHE 1ZA6B 3D6GA 5B8CA 4PJDF 3FOMA 4WFGD 1PBYA 4RA3A 4JJHA 5JW3L 1EIBA 2IQ9L 1QSFE 4ZNEE 4HGWB 3QQ4A 2PCPB 5C0EB 5DUPH 2XN9A 1ZLSL 2A73B 1D6VL 4XAKE 3KLAA 3RWJA 2AKRA 3F7YB 4NM8L 3RZCB 1UJ3C 3PHQA 1GPOH 1ACZA 1TMCA 1A14H 2EDDA 4RCAA 4ZXBC 3MYZA 1JUFB 4ZUSB 3DBXA 2OR8A 3EZJB 2X4PA 3C6LA 1JHKL 5MP6L 4JDVB 1NFDA 2YUZA 4EUPA 4RZCB 1RZGA 3MLWH 1ZWIA 1INQA 1MI5D 4P99A 5HGDA 3WKML 4ODWA 4RAUB 5MENE 1A6UL 4IOFD 3Q3GB 1C12A 2JIXA 2A9NL 3AREC 3STZA 1CFQA 5BCAA 1LP9B 3ZTNH 3MRGA 2NY1B 3CK0H 2D31A 5D1XA 3RU8L 1JWSA 2X4RA 4Y4FB 3BYTA 5GGQL 5ERWA 2BVPB 3NMEA 1N0LA 2NZ9C 1T80A 4OZGF 4UIKH 4Y5XC 3SDCB 1WCQA 3R4DA 1WIPA 5IUSA 3INUH 1YY8A 4JG0H 5D7JB 4PBWD 4ONHB 3O6MH 1AHWC 5C0ND 5B3JF 2MJWA 4OCWH 2CUHA 4OZHE 3I9GL 3GRWL 4X6DB 5I17B 2X1XR 3LZFL 3GNMH 1K4CB 2IANA 2PN5A 1LK2A 3D18B 3GMOA 4DGVH 4RNRB 5LVEA 2YXFA 3PWVA 4KRPC 3FOLB 5I1JH 3FB7A 2RGSA 4DGIH 3KDMB 3MOAL 1UKQA 3SGEI 3OKMB 4N0CC 1MSPA 5DRXA 5FHBL 3QFJB 3VXSA 3RWHB 4LSTL 4RMUA 3ZE2E 1YMME 3V4UH 1IGIL 4OCRH 4UQ3A 4U33A 4S1SL 5J11C 2J4WL 5HDLA 1D5XA 1A7QL 1I7UA 1NDMB 3C8KA 3VXMB 4TSAL 3TBSA 2HKFH 3BD5A 1YPZF 1K2DB 1PLGL 3BKYH 4XCEA 5EOCJ 3NFSL 3TBYA 1UH3A 1ZT7B 3B5HA 3LMJH 2HLAA 5EZJB 3TGXA 4IJ3C 2J8UA 3MLVH 2XI9A 4QTHA 3RPKA 1VADA 2N7AA 4L8BA 1MLCA 2OP4H 3J8F7 4J8RA 3UPAA 3CLFL 3IXTA 4RX4D 1S5IL 3C8DA 5DQDL 4KKCC 2EKSB 32C2A 2X89D 3KPTA 4FHBD 4Y4HA 4MWFA 5HPMA 3BEVA 2YBRA 3BPLB 5DRNB 3RI5K 4L9LA 5F7LB 2C5DC 3MCKA 3ZKMD 2DQTL 1EFXA 5CEXA 4D8PB 4MDJB 1KIRB 3BXNB 3TA3B 5DO2D 3C5JA 5FDWA 3ECBA 3BT2H 2VLMD 1J1PL 2HFTA 4AEHL 2BRQA 1JHLL 3TT1L 5GS2H 3HG1E 1JK8B 4TQEH 4IOFC 1GAFL 2YZ8A 1OAZL 5DRWB 1XIWD 5EO1B 1ZV5A 2R0WH 3QSKB 1JWMA 43C9A 4GFTB 1EO5A 3QO0A 2P48B 1KB5L 3DECA 4EI5B 3CFJA 4Q9BA 2FGWL 4O00A 4X9GA 3S5LG 3QXDA 5JXEA 4HWEL 1S9YA 2ADIB 3TO4D 5BQ7A 4Y0GA 3VWJD 1EEUA 3WFZA 4YNYB 1ZT1A 5IB4B 1JGEB 5IHZB 5AD0B 1NGYB 2V9RA 5B39B 3G5VB 4HWZA 1BLNB 1BZ7B 5IB2B 5C0NC 1PAMA 3O8XD 3OPZH 3UTSD 3H9YA 4QHMA 4GAFB 2HFGH 1QFOA 5ICXA 4GAYB 1FL5A 3SO3B 1NCCH 1NGQL 1Q9KA 4YX2L 1NFIB 4W6YB 3UZEA 3QWRD 3H2WA 4JVWA 1V8HA 4PGEA 3C9NB 4OZIE 2YD4A 3EYFA 1SEQL 2ATPB 4XNUL 2ZUVA 3DI3B 4YEFA 5KS9B 1CD8A 1J87A 3KYAA 4YXHL 4YIQB 5E6IB 1PDKA 2KBGA 2EYRB 3CPLB 2B2XH 5F7DA 5ID0A 1HQ4B 2DQFB 2BSTA 3VRJB 3D0VB 1VFBA 1EAJA 3RBGA 4JHZA 2Y7QB 5DEFA 8FABA 4XT1C 3LPGA 2HG5A 1YEKH 1DBML 3LIZL 5F9JA 5IV2A 1OWRM 3BO8B 2YKLL 3TPUA 1BFTA 2F58L 2JJSA 4ZPVA 2CR6A 1V3KA 3WD5H 1N7MH 4JN1L 5LAXA 1FO0L 2H3NB 2VDQL 1CYGA 1QHPA 4P3DB 4UINH 2AJ3B 2ZJSL 2FL5A 3VH8G 1AFVL 1ZSDB 5DEGB 2A2QT 1IL1A 2V5YA 4M6OH 2BSRB 3TIEA 4L4VA 1O7VA 5LWYL 4X6EA 1NFKA 3P30L 4I13B 4PD4K 5BO1H 1IEAB 3SDXA 3UTTD 5F1IB 3UDWC 4GG8B 5L88L 4Z76A 3IAGC 4XHJD 5I2IA 2YPLD 4WUKL 5L2JA 1ORQA 3QDMB 4JHAL 1R5VB 2B1AH 3H9SE 4PJIE 1BM3L 3CDYA 1OSZA 3T0EE 3N85L 3P9MA 5EU3B 2VO5A 3CFKA 3QULA 1OPGL 1WZMA 3QEHB 2F53A 1FVEA 4PG9A 4OSUL 1AQKL 1K8IA 2FO1A 4G8GB 2NY4B 2DQHH 3VGDA 3AY4C 4GKSA 1AGBB 4TN9A 5TPWH 4QHUB 3MREA 2ICWJ 2XZCH 3VWJC 1T1ZA 4GBXD 5FV2A 2NY2D 4Z7VB 5C92A 5GS1B 4ELMB 4U31A 3OX8B 1D7FA 3O6FD 3IXAB 4HIEB 3MV9D 3O8XC 3PQYA 5CHNA 1UEMA 1U92A 3LN4A 4P48A 1TTUA 1P7QA 2AJXL 5IVZA 4I0KA 4JM2D 3OJDA 4JCLA 1G7HA 2X41A 4JDZA 3FMGH 5DA4A 5L8LB 5M95B 5L6YH 3GI8H 1AE6H 4GS7C 4M61A 7CGTA 2R2HA 4JGMA 1MJ8L 4KHTL 2CJUL 2VLJE 3IVKB 1KTDB 1NBYB 3NCCB 4JY6B 4TTDD 3RVTD 1XF1A 4X7EC 2VDPL 3G9AB 4JANA 4JFFD 4K3JH 4CJ0A 1JIBA 3MJ9A 2L4OA 3QIWB 4QRPB 5HDBE 4F2MA 4UUJB 4LNRB 3F6LA 4Z7WB 4IRJA 2R8SL 1QPXA 3HC4H 1RI8A 1AXIB 1F3DJ 1U93B 3L5HA 4X8JA 5F6IB 5BVPH 4Z77A 4LRNH 4HFWA 5KVFH 2EDHA 3EKCA 4N0YL 4N5EC 4AG4L 3FRUA 3BUYA 3GMNA 3K80A 4LLQA 3CVHB 1A5FL 1GC1L 2GAZB 2LVEA 3MV8A 4KMQA 1T7XA 3T0XA 3GSWB 5JHDB 1TENA 2D7TH 2D0GA 5DJYA 1BQSA 4PGCA 4WUUB 5J89A 4OQ1A 1O5DT 1A6VL 3FO1B 4KVCL 4EUPG 3S37X 3DETD 2CDGB 4ONOA 4CVZB 3F5WA 4EQ3A 1U8MB 2V17H 1J1OH 3TVMC 4KRNA 4XHJC 3CVIL 2D7NA 3ULVD 5DHVH 1MFEH 3ME0A 1FNFA 3IF1B 2ZOLB 5K59E 1QBAA 1KLFA 4ORGA 4LF3B 1CU4L 2C4FT 5IT2L 3MGTB 5E5MB 4WTZG 3M1BA 4AIZB 4FXGA 2NY5L 2R9HD 3GIVA 1T03H 3RWCB 2KL6A 4N9GA 4P2QA 3T65B 1T21A 3MFFB 4HJGB 1DVFC 3SDDD 3U30B 1FJ1A 2NY2C 4Z0XA 2OS7A 4OD2B 2ZUWA 2XPGB 2A6KA 2BHUA 3W5MA 1RVFL 4PRIB 5HYFA 1ACYH 4TPRH 4B7IA 1MRCL 5IF0B 1A2YB 4OCYL 1R3LA 3NTCL 4G9DA 1J11A 3W81A 4LLYA 4OFYA 3NN8A 1TETH 4WI2A 4ZS6D 4BZYA 3HNVH 4LSVL 4QO1A 3KPQA 4XP4H 3GSOB 1T2QH 4MNHA 5CEYA 4KROD 1T7VA 2C3GA 4OKVB 3RVTC 4TTDC 4ZG1A 5IMLB 4LKCA 1IE5A 1BFOA 2EDTA 4R7NB 3D39E 5IR1B 2KQNA 3STLB 5IEHB 2VLKA 5JORA 4OQTH 3QG6A 3DO7A 5JXAL 3MXVL 5GSRB 5EOQL 1JTOA 1IQWL 1FYTA 4XP6H 4BJLA 1CS6A 3QWQB 2DF3A 1K3IA 3OKEB 2MMXA 4MQSB 4XVJH 1UB6A 4HXBH 5C0BD 1VACB 4CU8A 4DZBA 4P3WA 5DUML 5ACZA 3QEQB 2C4FU 1CG9B 1YECH 2KPNA 3MV11 2DLIA 2GK0A 4FFYL 5C0GB 5CZKA 2OL3L 4JFQA 1OQXA 1R5WB 5FGCB 5E4IA 1JZ6A 4WEUD 1GHFL 1G7PA 1T1XA 4K9EL 1X5ZA 1ZTXH 3FQUA 2OJEA 4MA8L 5CZXD 1KSRA 3O2DL 4IRZL 4L1DA 1S8DA 2UWEF 5DJ6A 4D3CH 4JO2H 1OAQH 1B9ZA 4RWHA 1QRKA 1KLGB 4K94L 2FBOJ 9CGTA 1GGCL 3DMMB 1MAML 3D2UB 4WU5A 4PGBB 1R3JB 1HEZB 3TFKC 4P4RB 3RWGB 1MCPL 4U1MA 4HMCA 5TQ0H 4M1DL 3PWPA 1IFHL 4LSSL 4PJ7F 4HKXB 4OLYL 4EKXA 4FFEX 2AEPL 1ZGLM 3MRHB 2X9YA 2FX8H 2CR3A 4KI5D 4LLUA 1JWUB 2XRAL 3OG6B 5HVHC 3DRTA 1RJZB 2VL5B 4UDUB 3Q5OA 3O4LA 5E1AA 3O3BA 1Z9SA 3JWOH 3VI4F 4QRRA 1K4CA 5IKCB 3PIQB 5AG8A 3GJEA 1I9JL 4RIRB 4UDTB 3UEZA 2QSCL 3FOLA 1LO3L 3MO1B 2KZ1B 4AMKL 2EC9T 3KPRE 4G5ZL 4WCYH 2H1PH 5GIRB 2XFXB 2ZCLH 2Q7NA 1JN6B 3PWLB 3MLUL 1DEEA 5IFJA 3MV7A 1A6PA 5IFAL 5GRVL 2C3WA 3RZCC 4A2LA 1KCUH 4PR5A 1YQ2A 4HUWA 5AWNH 4JQVA 2C3XA 3MRLB 4UU9B 3LKOB 3BDXA 2FYYB 4PJ8B 3LVEA 3EOTL 1HSBA 3TA3D 1XR9A 1S7WB 3WSQL 1FL6B 4JFZH 3BIKB 1IKNA 2P7TB 3UBXI 3BAEL 2WIIA 3H7BB 2ORBL 1QLEL 3L9RA 4NFDA 1LMKA 1K3ZA 4ZS7H 5IHBA 2PXYA 5F7WC 4WFED 1I3UA 2NY1C 3L3HA 1D5BB 3B8YA 1AKJD 2CK0L 4XB8A 5D70L 3VG0L 4F7CB 2E7CA 1KIQA 4WNQB 5EOTA 1QPPA 1RFDL 2OSLA 1N2RB 3VI3F 5DSCA 1T83C 3ZKQD 2AV1B 4JFPB 1QR1B 4MAYD 4YHNB 5GJSL 1C5DA 5HHXL 2YK1L 1K8DB 3JWOC 1S7UB 1OCWH 2EC9U 5SWSE 5D2LA 3VDAA 5T1KA 4BQBA 1FDLL 1F2XK 1HDMA 2D4FA 3IDJB 4OGXL 2EE3A 1RJLA 2NY7H 2VLRB 1AGDB 2P8MB 1JTPA 1MHCB 4EI5A 1NCAH 3CC5A 1Z9LA 3Q6FA 5DVNA 1QLRB 3I6GB 3T2NL 1YQVL 4RFEA 2O61B 1NGZA 2VIRB 3MRPA 4FQHB 4JRYE 2MQ0A 2HTKC 1I9IL 3MRBB 2X9XA 3O6LL 5HHOB 2GJ6D 2IAMB 2VXQL 5FDYA 4X6BA 4AEIL 1WZLA 2HWZL 5F7NC 4HKBA 4MCZA 4ETYA 3OKNB 4G7VH 3ROLB 4O9HL 1HE7A 1NUNB 1DBKL 2EH8H 3QJFA 3HC0B 2Z92A 4LLVB 4HUVA 1EJOH 3G6AB 4X4MA 3V9FA 4X99B 4M6NL 5ADOH 1NAKL 5KAQF 3MGOB 3F65A 3VFGL 4FMFA 3H42L 4MXVF 4L3ED 4QY8A 4XPFL 5FECB 4NO2B 2Y6SD 4JDTL 2BDNL 4JLRB 2FO4B 3PDGA 4OLZH 1NFIA 1UVQA 4MXQC 1DBAH 2IH3B 4OFKA 4JKPL 1WFOA 2AABL 3UZQA 3BZEB 3ARPA 3UTTE 1HZHL 4Y5VB 1CFBA 5GRWA 3BZFB 3P4MA 3EOBA 2JELH 3RL1B 2HH0L 3VFRA 4YIQA 3S3JA 3BPLC 3ARDB 1A02N 3U2SA 3OKKB 4PJFE 1DL7L 4I77L 1NSNH 1K6QH 1KYOJ 4OLWH 3TA3C 3U46A 4HJ0D 4UT6H 4M6MH 4CVUA 4OI9A 3W0WD 4X4YB 4DUXA 5GGVH 4C58B 1X5AA 5E94A 5INCB 4GAJL 3NABH 2GCYA 2QR0A 3Q1SL 3O11A 2FLRT 2GFBA 2APBA 1U3HB 1XZ0B 1MIMH 4WW1A 2ZUSA 2IEPA 3WS3B 1PEZA 2BNQE 3MV9E 2J88H 1V7MH 3SY0B 2DI8A 1OW0A 1HINL 2AERT 1IEAA 4RISL 3I3EA 3WIHA 5D6CA 2HLFD 4UIMB 1E4XL 3LRSA 3K1KC 2AJUH 1BFVH 3EO9L 4LPYA 5FYKH 2DTML 1KJ3H 3NA9L 3HZKB 3O3EA 4L4TB 3OAYK 3SJVE 5EU3A 1ND0A 4KKNA 1FNLA 5ECJE 1PG7W 3SO3C 3GHBL 2IPUK 3UTPD 2WQRA 1UWGL 2FBJH 3L95A 2GW5A 2PETA 5DR5H 3KJ4B 3IKCB 4KMLB 1ZOXA 1FH5H 2W9EL 5D71L 1D5ZA 1MCOL 1QO3B 3AMKA 3PL6D 3CZJA 3R8BB 3STBA 3VFSB 1XCTB 2E7HA 4FQXB 4YHLL 3MRKB 4TNVF 1CD1B 1X3DA 5E70A 2DYPA 3V0AC 4J6RH 3BP4A 1IVLA 4RAVB 1AI1H 5HHPA 1CVRA 5E6IC 3BPCB 3OZ9L 4LASL 1MQ8A 3D9AL 3MRMA 4TSBH 5EU6B 2VUOA 1M05A 1MLBA 3AFLA 4QNPF 3QNZB 5LBSH 4Z5RA 1H3PH 4KZEL 5KSVA 1QKZH 1YMHA 5CSBA 5T1MA 1DUYB 1L0QA 5C0FB 1HI6B 2ZCHL 5I73B 4X0KA 3EDDA 1YY9D 4KWUA 1M4KA 3TYGH 3QUZA 4JFYA 1G9NL 2O5ZH 5F88B 1HH9A 5KW9H 4N8VB 4LCCA 3QIWA 1ETZA 5DT1H 4WWKD 1TFHA 5ISZD 4QYOA 1HHIA 3Q5TA 2JE8A 4K3EL 2LV4A 3DVGB 5GGRB 5I1IL 5DC9B 1FBIH 3RAJH 4BH8B 1HK6A 4UZGA 2VN4A 5DJCB 1CLYL 3MRDB 3CVHH 5TE4L 2AQ1A 2V7HA 3KXFB 1IAKA 4I2XA 3IDUA 2W0FA 3MLYH 2PF6A 3GSWA 3I50H 3NFPA 4J1UB 5FA3A 3O3DB 2OJZL 4R2GB 4Y88A 5BS0E 1QVOB 3GB7B 4TVPD 5I1GL 2NY4C 2VDML 4MD5A 2FECI 4AT6A 1H8OA 3W5NA 2YD6A 5DJ0A 5KBNC 2UZIL 4JZOB 4RGNB 1WV7T 4JO1L 4NHUA 4LCUB 1MEXH 1VFMA 3CU1A 3FHAA 43CAB 1Z3GH 3LN5A 5L2KA 2OR7A 4XXCA 2BNRB 3GBMH 3F12B 1FIGL 4R7DB 5HYEA 1KGCD 2OR9L 1Z0MA 5KG9A 2XTJB 4TVPH 4XB7A 5MEPB 4V1DA 1MCFA 4Z6AT 2H45A 1W72B 2Y07L 5E8NA 4ZAKA 3G04A 4HZLB 4P4KD 1IILE 4W4NA 4HT1H 1A9BA 1P4LA 3QQ3B 4DZ8A 1I7RB 4JAMA 4LPTA 4PTTA 1LP9E 2QKIB 3IKKA 3QJHB 2I07A 2PO6B 4QOKA 1J05B 5KSBF 1G1YA 3EYQD 5E9DB 1G7LB 5HYSA 5ENWA 1AY1H 2ESVB 2ZUTA 1GGIL 4WENB 1Q9LB 4DCQA 1V3LA 2ZUXA 5IMKB 2BXZA 4FTVD 3AGVA 4G8EB 4WY7L 1IGCH 5C1MB 4EJ1C 4TUJA 1NBQA 3HNTH 5ESAB 2AJSL 5DYOB 4YR6B 3ARGD 4I48A 1RZIB 2JB6B 4G6FB 4X6DE 2VXTL 3LKPB 3OAUH 2IFFL 3UTQA 3PF2A 4J3VA 2VB5A 2ICWI 1AIFB 1A3LL 3NVQA 5GSRA 3ARFA 3EFFB 1MCJA 4CNIA 2YXMA 4GW4A 3ZMRA 4S1RL 2C7UB 2R1XB 5C0JB 2F74B 3QFJE 1MVUA 5F8RC 4YHIB 1NUGA 3LSOA 2V5RA 1KCVH 1C16B 3BISA 3GSQA 1KG0A 2H41A 3GI9H 4JFDD 5J1AB 1BOYA 5EPMB 3S35H 3NCJH 3WUWA 4R8WH 5AEAA 5F96H 4OZFA 4YDKH 3GSRA 4OGYH 2LFGA 3MUGB 1VFUA 5BVJB 1QFUH 3O2WL 4H25B 5EA0L 5GRJH 2P44B 3SKNA 3BP6B 3O9WA 4I3RH 5E2WL 4X6CB 5JOFB 4KMTL 3SDYH 4PY8J 3C5ZB 2NNAB 1FNHA 4PB9H 2ADJA 5CEZD 2XQYG 5DS8B 1AGCA 3EIFA 4H20L 4YWGH 4Y2DA 3VU2A 4OLVH 1JJUA 4NQDA 1QBBA 4JHWL 3ZHKA 3FJTA 3H9SA 1GGBL 1KJ2B 5IIEB 3T0EA 1A6WH 1JF1B 3QXTA 5B39G 4XP5L 4DQOL 3BW9A 4PJEF 3FHQA 1GZQB 5HGAB 1FPTH 4ZUTA 4FQJL 1LEIB 4LHQB 3DVIA 1V7NH 4XAWH 4Q9RL 3GJFA 4X5WA 1V3JA 2UUDK 5CEZH 4S1QL 1Z9MA 2FX9L 3FFCA 3DROB 4HQQH 4ZYKA 1KJVB 3Q0HA 1U2HA 4YPJA 2P46B 2PYFA 5DHXB 5KOMC 1UJ3A 1JZ2A 4DW2L 3SQOH 1NAMB 4HPOL 4NO5A 4L8DB 3QI9D 2DBLL 2WUBL 4JZNA 5FGSA 4I18B 4U2YA 2FIRT 5DA0B 4GG6B 2HFEA 3MJ9L 1XF3A 4N8CH 3FB6A 5JPMB 3ABZA 1JZ3A 3KPLA 2RR3A 4CDGC 2F19H 5IBTL 1CICA 2PR4H 4LBEB 4R4NC 3VGAB 5E2TH 5C0CD 4WFFD 2WNGA 4N90D 1JTTA 3DMMC 1G0DA 2VUYA 3WCYA 3WDIA 2IPKB 3ZE0F 5KS9E 4QRUB 1EXUB 3F8UB 2IMMA 4WHTB 3QHFL 3CCHA 5T33H 2NTSP 2ZKHL 4JQIH 4F9LC 4U1SA 2KUTA 5KZCD 1AHWA 5IMOB 4TULH 1MJJB 3LHPL 2W0LA 3Q6GH 2AJYL 1QR1A 3NH7H 1BBDH 1IKFL 4HHAB 1UWEH 3SDAA 5GGUB 4AL8H 4A6YA 2LU7A 3U48A 4NGHL 3R06B 3LB6C 1OARH 3WXWH 3GO1H 5EBMB 3HNSL 3TN0D 3QUXD 3BP5B 2DQDL 1BQUA 1HHJB 3MRBA 3T4YA 4I9WD 2DLEA 1KEGH 2DKUA 1N64H 3QCVL 1G6RH 1NLDH 2CDFB 1CDGA 1S9XA 4EDXB 1MCBA 4LLVA 5INDA 3QDME 3HRZA 1J1XL 1OGAD 3V6OA 4ZUUA 3UPCA 2WMPA 2DRUA 5EOCL 1IC4H 4G6ML 4UV4L 5FYKE 5I8OH 4PJ8C 5E00B 1AC0A 1CDCA 5FYKU 4K3GA 2BFVH 1FN4B 2GT9B 3PP3K 4OTXH 4L4JA 4G8GE 2VITB 5E6YA 3I3DA 3IJYB 1Q94A 3WNMA 3HAEB 1UACH 3BZEA 5EFIB 1EGJA 1RU9H 3G6DH 5F7YC 4LLWB 4Z7VE 2FHCA 1R3HA 4ELME 1OSPL 3N9GL 3MYJB 1JMZA 1PX4A 4FABH 2V7NA 1LEGB 3DV4A 4JFOB 4APQB 1NCWL 3OKKA 1S9WA 1SYSA 1IRAY 4U6HA 3N06B 3RIFF 3PXHA 2V5TA 1MI5A 2ZG1A 3JV4B 2XNAB 4M9OA 3I02B 3UTPE 2Z0BA 4KKAC 4JY5H 1DQTA 3LEXB 4PJHF 1RUML 3ZYZA 2NY3B 2EECA 3EJYC 1RK1A 3TBVB 1J5OL 1YEIH 1H3XA 2GYSA 2XA8H 5ICZA 3OAYH 5DMKA 1SBBA 2EE9A 3BE1L 4DKDC 1YN6A 3DV6B 3BRDA 3HI5L 1INEL 2LU3A 4PBXA 5D72H 2YC1B 2M2DA 3THML 4OM1L 4R9HA 3EJZD 4HW6A 1I8MB 2IH1A 4ONFL 2PYED 4Z7WE 2IAMC 5ANMB 5AZEH 2VAJA 4GRLB 3BZ4A 3VXOA 5GXBB 2HJFA 4M1CD 5E8PB 4PV8B 1MHPL 4PJXF 3WFBL 3WKNA 5JR1H 2GHWB 3VE0A 5ITFB 3T77B 5D7SL 5EU6D 1YEHH 4LOUD 3B2VL 5JHDE 2E8YA 2R0KH 3QUMB 4WUUE 4Z8FH 1T0NB 2YMXH 1DQJB 2FECL 1FZOB 4XCCH 4OIIH 3VRIA 5D1ZB 5ISZE 2FH6A 4ESKA 1SJVA 4U6XA 3SGKC 5DC0A 4N0RA 5D6DC 1M6OB 5I1AA 4LRIA 1U9KA 3WFDH 4PJCA 1MFDH 2DICA 3IS1X 1MHHA 1FAIH 1L0XA 3ARDC 1J0YA 5LGJA 1I4FB 4M62H 3MNWA 5HYSG 1YNKL 4OZHF 4LVHC 1J7VR 1ZEAH 1KTKE 2DQCH 3GK8H 1CGSH 3MNVB 4TVPE 1T89A 3OGCA 2F8VA 2W9DH 3NCYP 5I15H 1U6AH 4YGVA 1T04B 3BKMH 3OAZK 4R96A 1U3HC 3RWDA 2UWEB 3QCUL 3L3OA 4O58L 4RX4A 5KSUA 2AXGA 4NIKB 4RA0C 3MLRH 3JWDH 1E27A 4MCYA 2X89A 1VGKA 2B4CL 4PRIE 3MROA 4BM7A 2UYLA 4X7FC 3AXLB 4P9ML 4LSUH 3UDWA 5H2BA 4PTUA 2ADGB 4RGND 1UC6A 5DK0A 1JGUL 5IVXF 3ZHLA 2ITDB 1S7RB 1OAYH 4H88L 4QGTA 3TJEH 1XIWA 4YXLL 1TQBB 1T3FA 1UM5H 4GO6B 1I9RL 2BSED 2E6PA 3RIAF 3SKOA 1D3CA 2DQUH 2R1WA 4RWYH 3L3GA 4OF8A 4J1UA 5CILL 4PJ9D 3MLXH 3H3PH 3W9EB 4OZFG 4J4PC 4TSCL 4GKZA 3KJ4C 3P73B 3TO4A 3L3KA 4HV8B 3BH9A 5AZ2H 4LPUA 2A6DB 4N0UA 3SKUD 3T8XB 2DLGA 4P57B 1U8JB 3TNNB 5I76A 3TNMB 4FQXC 1FAKT 4HULB 4Q9CA 1BF2A 1KACB 3O8XA 4QHLB 3UTSA 1FNSL 3QEQE 5LCVH 4KZDL 4AEEA 5E08H 5J7CC 3D0LA 4Y16B 5FCUL 5CJBA 4Q2ZB 1WFTA 4JO4L 3N1PC 4OF3A 4ODVH 5CGYD 4M7LT 5E9DD 4ZSOB 4ZMAT 3HUJA 5FGCE 4LOUC 3NZ8A 3A6BL 1MFCH 2EH7H 3B6SB 4RRPA 3QWRA 3FT4A 1S7QB 4PRHD 2BVQA 5EG6C 5J1SC 1IGJB 1W72H 3U36B 4HS6A 2ATKA 4BFIB 5TQ2H 4FQLL 4O5LH 1J86A 4BSVA 2IPTH 5I73C 3WEXA 3CMOL 1N5AB 4DFIA 3ZL4H 3MX0A 4G6FD 3B2UD 3QXVA 4Z78B 3D1MC 2BY1A 6CGTA 2FWOA 3ILPB 3NGBB 1U8OA 1LNUA 1JNLH 2DMBA 5E2VH 2YN3A 2O5YH 1QFHA 3KGRA 2OXHA 2R4SL 2G5BA 4NC0B 2P5WB 1OP9A 4JFDE 4PP2B 5J6GB 3ARBB 1QA9A 1JYNA 3GBNH 1D6EA 3IU3B 4ZUVB 3T1FA 3V5DB 1NCBL 5C07D 1SY6A 3UYRL 3REWA 2B1HL 5JPNB 5ESAA 2VZ3A 5E8DH 4WV1A 1OTTC 1A3QA 4LARH 5EH1A 1SJEA 2JB6A 1RSFA 3LKQA 1Y6MR 4YHYC 5MHSE 4OZIF 1RV6X 4XXDB 2DMKA 4YDJA 2Y5EA 3MSPA 3SBWC 1FLRL 2FH8A 4M8QA 3WN5C 2VQ1B 5CEZE 1TZHB 3CFIC 1MNUH 3VXUB 4R0LC 4NM4L 3PDOB 5F8QC 4QXTA 4RGNC 2YPLA 4KJQD 1RZ7L 4IS6A 1UCBL 1R6VA 3HR5A 1I8IB 4LMQE 4XPAL 2XOTA 1XMWA 2DLFH 4C83A 1C16A 3PABB 2CKBB 2AK4B 2BC4A 4NC2B 3QPXL 4D9QD 4R4FH 5I75B 5GPRA 5J1AA 2XTJC 5AYUL 3GMPA 5F7EH 2B0SH 2Z93A 4DGYL 4MNQB 2EIEA 4QXGL 3K4AA 4GBXA 3G6JA 4QRTB 5AUMB 3ISWA 5DVOA 4ZOAA 5C2BL 5E24E 3O6FA 1C08A 1DN0B 1NBVH 5IHUL 4LQ1A 5JOFA 3MBED 2DQJH 4QXWA 4OUUB 3CUPB 1OF2A 4JM2A 5DVLA 3TV3L 2UUDH 2DMCA 4XPGL 1RURH 3MA7A 4HAFA 4PJIF 3VXPA 2BVUA 4MNGB 4O2EB 4GQ9L 1DE4A 1KJ2H 2W65B 3CFDA 1SEBA 2Y72A 1U3ZA 2Z8RA 4NZUH 1WEJL 3K8KA 3D85A 4NO0D 1KPRB 3EYOB 5C0CE 2ZCKH 2PW2B 1YEDA 4LAJH 4JFFA 4XMPH 3KLHC 3FONA 1IJ9A 4KQ3H 1J0ZA 3LN9A 3PWJB 1YZZA 4MS8D 3HE6D 1F4WL 3RTQB 5DWUL 3QDHA 1T6WA 2VLRE 3FFDB 4QXUL 3EHBC 4UTAH 4E0RA 4W6XB 1UM6L 2IADA 4NKIL 3MRQA 3WS6C 3IRZA 1A7NH 5HHOE 1MJ7H 4PD4J 1DBBL 3TO2B 1SJHB 1BWWA 2HVKB 1I7ZB 4NZTH 5C0DA 3GKWL 5TDNA 1NAMA 4G59A 5TGBB 1WT5C 1MCKA 3O3AA 1NPUA 4YC2C 3BKCH 2D9CA 2JCCF 2CSPA 4W6WB 4KK8D 2HKHL 2IWGA 4M9PA 5EN2B 2XT1B 5J8OA 1IQDA 2QADB 3MLZL 1C1EL 5EO0A 4NN7C 2Q3AA 5D1QB 2IC2A 3E6FB 5DLML 5HDBF 4D0BA 1LQSR 4JPVL 4OJFL 1N4XL 3U0PB 4MJ5B 1AQDB 2Z4QB 3QEGL 1FORL 1L7IH 4HUMB 4UBDC 3C5ZC 1NL0L 1HILB 1X5FA 4WHTA 3X13A 2H26B 1HSAB 1OGAE 2XZAL 5DK2A 5ELIA 1RIVH 1NC4B 1RZ8A 4U0RB 4HBCH 4MD4B 2F5BH 4XH2B 4YPGB 2ZSVA 2VZUA 2X6MA 1ZHLA 2EYSA 1UB5B 3SDDA 5FM4A 5GISL 4AM0A 2BHZA 3P4NA 1FZMB 1LEKA 1JGVL 4M43H 4H0HB 4P49A 4HHAA 2R1YB 5C6PB 4ZQKB 5E8OB 4YHPA 1ADQA 2GSIB 4NPYA 4W4OC 1I1YB 5IEKB 1ZT4A 1IM3A 2GTWB 5HD8D 5TE7H 5C0AB 4LHUB 4HC1H 3AUVA 2MFNA 1T22B 1X6LA 2ERJB 2ICEB 3U83A 4JPKH 4GMTH 2IMNA 4X80L 3BP5A 1U8KA 2UY6A 3PP3H 1I7TA 2V2WA 5K59F 4KTDL 1U3JA 3EZ8A 2IQAB 4PB0L 2C3HA 4RQQA 4JZJC 3LQZB 5F1OB 3ULSB 5C6TH 2Y5TA 5IJKC 1IGFL 1CLZH 4L8CA 5FEBA 4I18C 5DQJB 4HBQA 4NRXB 5I8KL 3KPNB 3FQRA 4L4TE 1A7BA 3HE6C 3V0VB 2I5YL 1T0MA 2R0ZL 2C1OB 5EO9A 2R2CA 2Q76B 5C0BA 3VGAC 4ZD3H 2WINA 1B2WL 3V52L 3HAEH 3IJYA 5DRZA 2BJML 2ADFH 4PY8I 4EOWH 2PYEE 4LKXA 1EEZB 3D3VD 3U0TB 1OAUH 1VKXA 3ULUL 3BWAB 3D48R 4NZRH 4LIQH 4D0DA 4N8VG 3IDYB 1H3GA 1MREH 4YFEA 7FABL 4KK8C 3BEWB 4NNPH 4APQA 3GSXB 4X7SL 4CW1B 5EU6E 2MCPL 1D5MA 3PHOB 4PG2A 4XRCB 4ZFGL 2NX5D 2L7JA 4M7JH 4C56D 4AH2B 4GMSH 4KTYA 1E6JL 4HEME 3GMMA 1NUDA 1T5XB 4FZEL 2VE6B 2P4AB 4D94A 4FFWC 4OI7A 4CMMA 3M07A 4XC3H 2H2PD 1KCSL 5L7XH 1RK0B 3KWWA 4NQTA 5JO5A 2P5EB 3VDCA 4YHOL 4E5XB 1RZKH 4U6VL 4K8RD 4PDCE 4HWBA 1P2CA 5JZ7C 1CE6B 4Y4KD 1NMAL 4G8IA 1V5JA 1XF4B 4XCFH 3AAZB 4OZGE 3KXFE 2AGJH 5I8CB 1PW3A 2R56L 4DTGL 1TZGL 3IDGA 3EO0A 4R3SA 2YWYA 3QUMH 3RNKB 5J3HD 3V79C 1MAKA 2CLVB 3SCMD 4XPTL 1CFVH 5B3JE 4RRPG 2GTZA 2N56A 1YYLL 2BERA 2GUOA 4HDIA 4UB0H 4EZMA 3IDMA 1G0YR 3WYRA 1WIOA 5LKNA 1U41A 3T3PE 2E6QA 1JNNH 4XP9H 1KIPA 3K0WA 3RNQA 4RGNE 4Y1AB 2V2XA 3U9UB 4QLRA 5FF6B 4J3UA 2GITA 3DARA 1NGXB 1O7SA 1XCQB 1BVZA 4MA1C 4L1HA 4ZTOH 3X17A 3H9HA 2BNRE 1OAKH 3O2VH 1TQCC 5F9OL 2IGFH 2XTJE 5FYLD 4FZ8H 1RPQA 3LKSB 4YHZL 5CLTA 4DAGH 5FO9A 2YPVL 2AXFB 2NY3C 1DCLA 2ZSWB 1FZJB 4O2FB 2J5LB 1YEFH 2XG4A 5BRZB 3OKDA 1OHQA 1AKJA 3U7WH 1I1AD 1EK3A 3S96B 1VHPA 4ODSH 4IRSD 4MVBD 2E7MA 5E9DE 2A83B 4F57H 5HSFA 2ESVE 2ADGA 1RZKC 4GRLC 4MAYA 3G5XB 3QDJB 3DURA 5D7KE 5IJVA 4I3SH 2HP4A 4DOHB 5JW5A 2P8PA 4OD3H 2YRZA 3BQUB 5F89A 1E4WL 1NDGB 4MXWH 2BOBA 1A6ZA 3QHZL 4V2CB 1G7QA 2YSSA 2Q87A 2VH5H 4ELKB 5BV7L 1PYWB 3G5YA 5I71B 3WNKA 5T3XE 2AJVL 3EDEA 1A7OL 2WQ8A 1S78D 3QNYA 2H2PC 2OZ4H 3FO0H 2DDQL 2CRIA 3CFBB 5BMFL 2GJ6A 1SQ2N 1WCBA 4PV9A 1TTGA 2J7LA 4HIIA 4NJAL 4CVXB 4F7TB 4WU7B 2VDRL 3S35X 3BSZL 3NCFB 5IGXH 1KN2L 4NSKA 1X7QB 2ITCB 4A6YL 1HN1A 1KB5B 5CUSL 2QQKL 3VA6A 4OCNC 5EUOA 4L3EA 6FABL 5GGVY 3WHXB 2IJ0C 5J3HC 1TDQA 4FRWA 1NC2D 4H0IA 3V6FB 3TYFB 1UT9A 1HHGA 1DSFH 3AU1A 4ZTPH 2YWZA 5F6HJ 2WBJB 1NGWB 1DQML 3WLWD 4HXAH 3LQMA 1N5AA 4P23D 5FUZH 2HFFA 5I6XB 1E6OH 4NOFA 4X6CE 1N8ZB 4POUB 1REIA 4GRMB 4OFIA 2E27L 1FVCB 3B9VA 3MA9L 1W2KT 2ED8A 3W0WA 1MRFL 1IAII 3OXSA 5IFHL 2Z35B 2A77L 3BKJL 4NYLB 4LCWD 1N59B 3OHXB 3V5DA 1MJUL 4KKLC 5IQ7H 1XFPA 1EGJL 1TQBC 2PTTA 5JPNA 4Z7UB 1OTUD 4U6YA 1BECA 4NJ9H 5CSZB 4MJIB 1HKLL 1YNLL 3FAWA 4OM0L 2ZUQB 2NLJB 3VMPA 4FXKB 3UTZB 3WFCH 4UIKL 5FYJD 4MVBC 2VQ1A 1G7IA 1M7DA 4POYA 5C0RH 3E0GA 1P1ZB 1R24B 1BOGB 1GSMA 2Z8VC 4K07A 1FO0B 4ISVA 3O6ML 2EYTA 2J3SA 4PJFF 4OCWL 5C71A 3MRCA 3RPIB 3HE7D 4IIQC 1BX2B 3X3FH 4WO4B 4Y16C 2EDWA 4EI6B 5KJRH 3A6CH 1NBZB 2CKBA 2YA0A 4XCNA 1RUPH 1BQHA 3VCLB 1NCDL 5D7IB 1CR9H 15C8L 2B39A 4M7KL 5I16A 2I9TA 3PL6A 1FNGA 5DTFB 1BEYH 5IQ9A 5E5RB 3K4DA 1JPTL 1F4HA 5DJZB 4FA8A 1T0PB 4OLEA 3ZE1E 2XZZA 4JGJA 3TEUA 1IGML 4PYHA 4Y8DC 4NO3B 3ORJA 1KNOB 4ALAH 3M17B 2QQLH 3LPFA 1R5IB 5DD3H 1JV5A 4KKBD 3BKYL 4Q58C 1KC5L 2EICA 3EW3B 3ZKNC 5I0DA 3DIFA 3BJLA 3U4BL 4I5BA 4HUNB 5SV3A 1VDGA 3S36H 5SWZA 4JG1L 5JNYB 4P0DA 2W0PA 2OP4L 3RWEA 1LE5A 5HHVL 4P23C 4K3DL 4TVSa 2R0LH 4OZ4A 3L6FB 4HAGA 1A4JB 2XG5A 2YD2A 5EWIH 1T4KA 4DVBA 3NACL 2QADD 4WWKA 4YJZL 4J2XA 5ISZA 5BJTB 3EYSH 2CLZB 4LCIL 3DUHA 3QXUA 1S7SA 3FRPG 1JF6A 3VGEA 4HLZH 1A6TB 1II4E 3HMXA 3DX9B 5C08B 3RIFK 3SE9L 3HAEG 2YD8A 5FKPA 5JDJA 4YAQB 3V5HB 4YXKH 4YEEA 2R0WL 3HI1B 4X6FB 4MQ7B 5I1LB 2VDLH 3FQTB 5I75C 1CTOA 4I0PB 3IETB 2OI9B 4KHXH 2KDGA 4WJ5B 3KPSD 1MCLA 2J6EH 2DAVA 4YFDB 4UILH 1NQBA 4LEOA 1QRNB 1DQLH 1ZHBA 1KPVA 1DTUA 3GGWB 4C4KT 3VG9B 3CFEB 4MA7H 3VFTA 3PWNA 3X14B 2VC2L 4L5FL 5CJ8A 2HJKA 1GRWA 3FN0H 4G43B 2G60L 4KJYB 1YUHB 4R4BB 3RJQB 1TTFA 1B90A 2ENSA 3VJ6A 4LIQE 2OTPA 4DN3H 1AGEB 5EBWB 4WGWB 4P2RD 5MI0B 3VFOA 1F8TH 4JFEB 3UJIH 3OKLB 3PHSA 5JMRA 4P4KA 2JJWA 2R2BB 4OT1H 4NFBA 2FHBA 3PDDA 2R1YA 1A6AA 4BSWA 5E8OA 1NKRA 2QHRL 2LAAA 1KPUA 2HT4D 1A21A 3GIZL 4MD0B 3RTQC 3TJHC 4XPBL 2I9LA 1CGVA 4KKBC 4X7TB 1NEZA 1T5WB 3HS0B 5HHMD 5C09B 3X3GH 2DLHA 4HJJL 5GZOD 3WD5L 4UTBH 3FQNB 4FTVA 5ANME 5E03A 1H8NA 3ARGA 1A7RH 3B5TA 4C56E 2HT2C 2HVJB 4KJPD 5D96B 3VWKB 2DM4A 1Q1JL 3DX8B 1QACA 4NNXB 3FZUD 4FP8L 5CBEA 1F4XH 2DQIH 4M93B 4Z0BH 2C1OA 2WWKT 1UA6H 5BO1L 3VFUA 2QADC 5KVDH 1ITCA 3CZFA 1X5JA 2W60B 1IT9L 4FQQB 5D1QC 5I1DA 1MCIA 1X5XA 5CP3H 3FQWA 1SY6L 3WXVH 1LO5B 1F6AA 2YA1A 4XNXL 1SM3H 3WFEH 3VXRB 4FG6D 2F54D 2ZUYA 3IDNB 3PJSA 4JFDA 4HCRA 5I9QB 2PNDA 3RIAK 4PJAB 1KCKA 2PW1A 5ILTL 5JW3H 1A0QL 4NQSB 3EO1B 1T66D 1IBGH 2IQ9H 1JRHL 4HIHB 2WW8A 5A3ID 4U0RC 2MHAB 3C60B 4LLMA 3IFOB 3D69A 3SN6N 2MQCA 1ZLSH 1D6VH 4L3CA 4MJ6A 1F13A 4NM8H 3RUGA 5TDOB 1T2XA 2XQBL 3BVNB 4WEBL 3T4AB 2OL3B 2BY3A 1AO7A 4WI6A 2UWEE 1EJ6A 4DKAA 1JHKH 5MP6H 4KV5F 3RA7L 3B9KD 2ERJC 5A2JH 2H9GB 1EFQA 5C0IB 3QEUA 5B38A 2A9NH 3X11B 2HJLA 4MHHI 4AZ8A 25C8L 2VLLA 3MJ8A 2HN7A 3RI5F 1EEYB 3RU8H 3VXTB 1BD2D 3MLSL 5GGQH 2DJSA 2HT4C 3UTOA 5DQ9A 1Q0YL 5CJXC 3KNBB 5FKAA 3RWIA 5GQBA 3S5LB 5DD6B 1WQVT 3K1DA 1F2QA 5D7LB 2OXGA 5K9QG 1XGRB 1IM9D 1OTSD 5IMMA 2FZ3B 3MOQA 3MBXL 2BP3A 2HRPL 1Y0LB 3HZYB 4M48L 5CIPB 5GZOC 4MHHG 3NCYS 4P5TB 3I9GH 3GRWH 4YHKL 3LZFH 1XR8A 4KK5C 4LSPL 4MDIB 1RZJL 3E3QA 2AAVA 2VISB 3QI9A 1U36A 1WBYA 3W39B 4Y19B 4HH9A 3IDYC 1RIUH 5CSGA 3CMGA 2JK5A 1GIGL 1CDJA 4TUOA 4ZSOE 4XVUD 4EVNA 3VXQA 1NH6A 5FHBH 2E9BA 4P2OA 2DWDA 4HPYL 4NQEB 4LSTH 4M4PA 5D2LF 2WLZA 4MB3A 3DO3A 3IGAB 4S1SH 2D03L 5BZDA 1A7QH 4OD1L 3WL9A 4YBQD 5HYJB 4TSAH 5I66A 5A1AA 4FG6C 4YFLI 1PLGH 4PRPB 2CIIB 3NFSH 1T66C 4JFHD 5TH2A 3UMTA 1IAIL 4NKMB 5A3IC 5CKGA 1T03L 1G6RA 2P5WE 3B83A 5GRVK 1EZVY 1JFQL 4ODXA 3ULVL 3CLFH 1S5IH 3E6HA 5CD5C 1BREA 2X4UA 3L7FA 5DQDH 2WZPD 1Q72L 3TBTB 3SGJA 4JVPA 3U4EA 1BQHG 4M5YL 3VH8B 3U1SH 3VI3E 1PYWA 1MCNA 3LS4L 2DQTH 1DQDL 2N1KA 4WW2B 3C6SB 1UCTA 3O4OB 3TN0A 3QUXA 4HF5L 1F3JB 5KS9F 5ICYA 1P9MC 1OLZA 2J2ZA 1J1PH 1BWMA 4AEHH 1JGDA 1JHLH 3TT1H 5JDSA 5D6DA 1GAFH 3VXUE 1PSKL 1OAZH 1XH3A 3BUTA 5EU5A 2QQNL 3HPLB 3QCTL 2CRYA 3ZYJA 2X4OB 4LCWE 1OGAA 5TDPA 4PP1D 1KB5H 3D87B 1TCRB 1ZA3A 4HX1B 3BFOA 4URTB 2CUMA 4NQXA 2FGWH 3K4ZA 1QNZL 4G9FA 1LVEA 2AK4E 3ALWA 4LLDA 4XP6L 2X42A 1CGYA 4F7MA 5BZWA 2JCCB 1E28B 4NT6A 2APVA 5HI3C 3DX7A 5CGMA 2WBJA 1UZ8B 4MNQE 3FTGB 2I60L 2EXWC 3MJGX 3VXNB 1RUKL 1WWBX 4PJBA 5DJ8B 1IEBB 2J5LC 2J8HA 4NQCD 2Q86B 4P2YA 1QBML 2ARJB 3P0VL 1DUZA 1NGQH 3QIUB 3TZVD 4KPHL 1RIHL 3QA3A 3IFPB 2NY0B 1U8HA 1S9VB 4C59B 4JO2L 1BHGA 4MNGE 4PJ5B 4XNUH 1N59A 3JV5A 1EAPA 3BQUC 5K9OB 2XKSA 4Q0XL 1WK0A 1Y18B 5FK9B 4YBQC 2X7LB 4LPWA 1Q9OB 3FQXA 4EN3D 1K5NA 5B8CB 3LIZH 3FOMB 1DBMH 2XZQL 2ARWA 2YKLH 4PGJA 2VXVL 2L7UA 4PJDA 2PYEA 5ITBL 4U49A 3QQ4B 3MV01 3C5SA 2VDQH 3KLAB 3RWJB 2AKRB 4UT9L 5E0QA 2ZJSH 4ONGL 1TMCB 4YFLF 4RGOH 5L0QB 1AFVH 4KI1A 1QOKA 4F3FA 2VQUA 5IW6A 1F45A 3DBXB 2X4PB 2K7QA 3C6LB 5JW4Q 1AXSA 1EBAA 3DXAD 3ZDXE 5JQ6H 2WWMD 4YHML 5HYQA 1NFDB 1GGYA 1FL3A 4EUPB 1A64A 1RZGB 3MFGB 1ZWIB 2EDOA 5L88H 1INQB 5HGDB 1NLBL 4ODWB 4OCSL 4WUKH 2OTWA 4E41D 4DJMA 2HMID 2NXZB 4JHAH 1EPFA 1BM3H 3O41A 1C12B 2JIXB 3QIBD 3LH2L 4OI8A 1MCWM 3N85H 3STZB 2X4TA 2YUXA 5MERA 1OPGH 4NBXB 4Z7WF 2E7BA 3MRGB 2D31B 5D1XB 1EMTL 2FJGA 4LHUG 1IAIM 1JWSB 1WBZA 2X4RB 4LU5H 4OSUH 1CXFA 1WSST 5I0ZA 1QSFD 4XNQA 5ERWB 5KTEH 5TJWK 4PS4L 1WFUA 4H26A 2JKXA 1K4DA 4XAKD 4BZ1L 4H1LA 4R90L 3VFWA 1YY8B 3MXWL 3RY6C 1AGFA 5GRYA 3ES6A 1UYWL 2OCFD 3QZWA 4QRQA 4QNPE 3SPVA 2IANB 3W82A 4CMHC 3WDJA 1LK2B 5GRXG 3GMOB 5DMJB 2AJXH 1GOHA 4I0PD 3ALPA 3SE3C 5KVEL 3PWVB 5DMYA 1QBLL 3QNXA 3TZVC 3IJHA 4XMKL 3MR9A 2NY6B 5D9SA 4R0LA 5MEND 3CSYA 1N0XL 5DRXB 3VXSB 1MJ8H 2CJUH 2JJUA 2VYRE 4P2RE 4UQ3B 2VDPH 4WDIA 4WO4C 1D5XB 3HI1A 4HK3J 1I7UB 3C8KB 4PJ9A 3TBSB 4JY4A 3C8HA 1KXQE 4ZDHA 5F6HI 1OP5K 2R8SH 1CGWA 4XCEB 2NZIA 4D0CA 3T04D 3RVXD 1YPZA 2CPCA 4JPIA 4NKOA 3TBYB 2AEQL 1LO2L 4N0YH 4AG4H 1ZXQA 3H3KA 4IDJH 2HLAB 1A5FH 1GC1H 2J8UB 1HYRC 4QTHB 3H9ZA 1U95A 1VADB 4L8BB 4HG4K 4IMKA 2OBGA 3UAJD 1EJOL 1MLCB 1HOCA 4BQCA 4J8RB 1CL7I 4BFBD 32C2B 5F72S 4MWFB 2DQGH 3BEVB 2YBRB 5HPMB 5I30L 4KVCH 1KJMA 4L9LB 2CXGA 3MCKB 1CLOL 3WJLA 1EFXB 5CEXB 3DI2B 4LAQL 4OLZL 4PRHA 3C5JB 2WWMC 5FDWB 3ECBB 1OM3L 2D2OA 3ULUF 1YMMD 4P46A 4UI2A 3D25A 5B38G 4CKVX 2WY3A 1CF8L 4HSQA 5JUEL 3CVIH 4FQPA 5DUBA 3MUY1 2WK2A 4XZUA 2AVGA 4MAUH 1JWMB 43C9B 2Z8WC 4RMVA 3QO0B 4I1NB 1KN4L 3EDFA 5IT2H 1CU4H 3CFJB 4H8WH 4ERSL 2NY5H 2F54E 3QXDB 4OLWL 3A0OA 4UT6L 1S9YB 5GGVL 5BQ7B 1X5YA 3T09A 1OGTA 3ZSTA 3WIFA 2P5EE 3VW3H 2FEDC 1ZT1B 5C07A 3WJJC 3S7GA 1D9KD 3V7AG 1UXSA 4HWZB 1RVFH 5IBLC 5JIHA 1V3MA 2HVJA 3EYVA 4QHMB 2R15A 1MRCH 5ICXB 5HHNA 4P5MA 1FL5B 5C8JA 4OCYH 4I0PC 4NCC1 3NTCH 5TFSL 2OI9C 3QT2A 1Q9KB 2JJTA 1TZIA 1OT2A 3QRGH 4XVTL 4N5UA 2FSEA 4PGEB 1F58H 3QFDA 4FQCL 2AJUL 1UGNA 2V5SA 3EYFB 1FHGA 1H9VA 1HYSC 1KJ3L 3F7VA 2NYYD 3WFHA 1Q38A 3NIFF 3V7AE 3MJ7A 4Y1AE 3TT3L 5F7DB 5JXAH 3MXVH 4KDTA 5ID0B 5EOQH 1IQWH 2BSTB 3OR6A 1VFBB 4PJAA 4XBPA 1X5IA 5DEFB 8FABB 1DDHA 2HG5B 5F9JB 2W91A 5IV2B 1I9EA 1FG2A 3BH8A 3TPUB 5DUMH 4ZPVB 5MI0C 1PKOA 2BRRL 5LAXB 1TPXB 1AC6A 4FFYH 3RVVC 3U7YH 2OL3H 1QQDA 3MBEA 2FL5B 3RY4A 5BRZE 1GHFH 1IL1B 4HH8A 3TIEB 4L4VB 5I18L 4X6EB 4MA8H 2G9HA 4H8WC 3S8WA 4IRZH 4HGMA 1HHKA 2NY5C 2R69L 4U6TA 1EUTA 3O6KL 3SDXB 1PFCA 4I4WA 1I3RA 2DTSA 4HS3A 4Z76B 4K94H 3IT8D 4NO0A 5I2IB 3QUYD 5L2JB 1MAMH 1ORQB 3QDJE 1ZANL 3MCG1 1OSZB 1MCPH 3P9MB 4PIRF 5D96C 4MS8A 3MUZ1 3VWKC 3HE6A 3CFKB 3QULB 4M1DH 1IFHH 2F53B 1FVEB 4YDVA 1NCTA 4OLYH 1FFPA 4PG9B 4M93C 4WEMB 1K8IB 2E7LA 1FV1B 2QHLA 2XRAH 4NQED 4NOBA 1P4BL 4GKSB 3RAJL 3LS5H 5CIPH 3MREB 2FZ3A 2KZWA 3QDGD 3DUUA 1FVDA 1C7SA 1T1ZB 5HXMA 4HIXH 1MY5A 1F90L 1N6UA 1D9KC 4R26L 3S98A 1I9JH 2FJHA 3ARVA 1B4JL 2HTLD 3PQYB 5CHNB 3LN4B 2Z31D 2H32A 2QSCH 1P7QB 1LO3H 5IVZB 4AMKH 3QO1A 3RDTD 4G5ZH 2DJUA 3OJDB 1G7HB 3C60C 4N1HB 4JDZB 5IW3A 2XWJA 5ID1A 3MLUH 3HMXL 5GS0D 4E9LA 5IFAH 4M61B 3VGBA 2R2HB 3OB0K 3EYUL 1MEXL 5LXGL 1MH5A 4MQXC 1TJGL 1L0YA 2WWKO 4JANB 1B6DA 4XPHL 3GBML 3WSQH 2VZOA 5DEZA 4RMRA 2VSDA 5TF1L 4TVPL 2P8LA 5K33A 3AVEA 4IRJB 3QDAA 3BAEH 1LO0L 3UP1A 1NJ9A 3ZE0E 2ORBH 2D7MA 1QLEH 4X8JB 2AEWA 4Z77B 4HFWB 5GS0H 5D2NA <