4PGEA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgeA01
1XGUB 2EECA 4CW1A 4XCYB 5IQ7H 5DJXB 5HGHA 5EIVA 3LRGA 5DD5H 4KRMB 1A7QH 3MSPA 5C0AB 4JCLA 4X80H 3NAAH 1IKFH 4PJDF 5BRZD 2WM0A 1OP5H 1MCNA 4MB4A 6FABH 3VGAC 5DFVC 3S97C 5ICXB 1YNKL 3P77B 1RQ5A 4OFVA 4XCFH 3QDGD 2XY1A 4PD4J 5E8OB 4GLRH 1T0NA 1ZWIB 3BRGC 1Z3GH 2VE6A 4U1NA 5F6HJ 3HNVH 4HIHB 3T2NL 3QNZA 2DWDB 4HX1B 1IAOB 4KV5F 4JPKL 3D0VB 1G0XA 2I9LB 3BRFA 2J3SA 1K4CA 1ADQH 4W6YB 3M8OH 1MIEH 1S9YB 1T0PB 3SDAA 1UWGL 3K1DA 3ROLB 5DHYA 1HIMH 5C08A 4BH7A 3CSYA 2JIXB 2XWBA 3T8XA 2V2WA 1QBBA 1BQLH 4PBWD 1FCCA 1JMXA 3MLXL 2NY6D 3OF6A 4KKBC 3Q5YA 2HP4A 5GPRA 1FP5A 1NGQL 2H2SD 4PP2B 2FEDC 2EO9A 2UZXB 3PWPA 4KJYB 1KELL 4K8RL 1VDGA 5FF6A 5IHUH 5EA0L 3O11B 1AGBB 1R3JB 2ADGB 4GKZA 3GJFK 4S1SH 2Q86A 5I15H 3KPTA 1NCDL 2E7LE 1L7TH 4MXWL 4P3WA 2DQFB 4JY4B 4MLIA 4OIIL 2X4PA 3T2OA 4JY5L 1SVCP 1X5FA 4UI2A 5C07A 4X4XA 1K8IA 2ORBL 1LP9A 2JKXA 3O6KH 3RA7H 2R2BA 2X4UB 2X4SA 4NC2B 3GZKA 4KZDH 3CFDB 2A0LD 3T0BA 1MRCL 3QDAA 1KV3A 3IDXH 5I75B 1S3KH 2QR0B 4LIQH 1IJ9A 2V2TA 4QLRA 5D8JL 4P46A 1PDKA 5ETUB 5D7SH 2D7QA 1FIGH 5D6DA 1NC2B 2FJHB 3SKMB 4HXAH 2YBRB 1GRWA 4Z7UE 3RKPA 3BI9X 1T3FB 3MRIB 3QWRA 1QA9B 1UYWH 4P4KA 1A1NB 3L3DB 1BVLA 4QRPA 2H8PB 2D0FA 3OKKA 3C6LB 5ITBH 4P4RB 2VIRA 1RFDL 3C2AH 2YWZA 1LEIB 2ESVD 2XZZA 4I8DA 1LE9B 1DBBH 1PG7L 2A6JB 2NX5E 2EDHA 3GSNH 4YDLB 5A2KH 3P9MB 1DUYB 4IJ3B 2OTPA 2IANA 3QCTH 4GW4A 4TVPL 1SJVA 3HZMA 5BCAA 4PGCB 2V17H 3ULVE 4K71B 4BSWA 1XR9B 5DYOA 2I25N 1U91B 3KYKL 5DMKA 2OI9A 2JJTC 4JJ5A 4OIBA 1M71A 1HCVA 1I3RA 3FTGB 4JG0H 2VZUA 1NDMA 4OCSH 3MRCA 5KSAB 5IT2L 2D0GA 3RDTA 2Y1VA 4S1RL 2V9QA 1FNGA 4JFDA 2O5YH 1LILA 4KXZI 2IMNA 5IW6A 4PIRF 1I7RA 4HBQA 1VFBA 1BAFH 1KJVA 4APQA 1H0DA 5GGVY 4K3GA 3VXPA 1AJ7L 2R9HC 1Z5LA 4JO1L 1T7ZA 1QVOB 2EXYC 1QSEE 2F9BT 2NY7L 2P42B 3MLZL 2ZSWA 4Y16C 2VDOH 4F9LA 2OR7A 2NY2D 3DYPA 1U8LB 4Y19B 3O41A 4YBLB 1RJZA 2EIEA 3CPLA 4HUVB 4QRTB 1JWSB 2G9HA 4KK6C 3F7PC 1JZ3A 4S0SD 5I8CA 2VQTA 2FATL 1MFAL 3DGCR 4NQCE 3FQXB 2XTJE 5JO5A 4JZJC 2DLFL 4P2OD 3C8KA 5FO7A 2NY6B 3FN3A 1HHIA 1U3JA 4F37F 2XA8H 3KGRA 4TVSa 2R0KL 3IF1B 3OGCB 2YMXL 5CIPB 3HB3D 2VXTL 2H9GB 1UFUA 3VXOA 3WIHA 3L3HB 2OK0H 4F8QA 2F5AH 3M45A 4I0PC 5GGTL 4J3OC 1JNLL 2DN7A 2Y7QB 3LRSB 3RWFB 1TQBC 1REIA 3DX9B 4G9DA 3TN0D 3QDJA 3ULVD 1IL1A 1NLDL 2BHZA 3FQWB 4OLVL 3RU8L 5HVWA 3IGAA 2X4OB 1CD1A 1XF5B 2W9DL 5C6TL 4ONFL 4Y5VA 2B8OT 1ZTXH 3TO2A 2X4RB 1IKNC 1A3LH 2L7UA 2GAZB 3OAUL 3W2DH 2C7UB 3GKZA 4PJCE 4Z7WF 3N1FC 4HPYH 1P4IL 4JPIA 4QY8B 4RX4D 4BH8A 5GZNC 1E4WL 5FM8A 3LV3B 3D5OF 4IRZL 5FOBA 2H32B 3HAEH 5CP3H 1Q94A 4XC1H 5J3HD 3VG0L 3NFSH 1AE6H 5C0EB 2ITCB 3AU1A 5F7DA 4ZTOH 3FB8B 1CGYA 3KPSE 1J8HD 3OJDB 1B0RB 4OF6A 3S34L 1QSED 4G42A 3SJVA 1NC4D 3NCJH 2GI7A 3SGJA 3C6SA 4M43L 4PRDA 2XTLA 4OB5L 2X4NB 1SEBA 5ISZE 3KWWB 3H3KA 4WW2F 1XCQA 3TBVA 4AIZB 1Z9MA 2QADD 4UILH 3QXWA 4NJ9L 4OQTA 2XTJD 2P5WE 4QTHA 4G8GD 3LKSB 4L3EA 1KTDA 4PG9A 4HHAA 3TJEH 3LB6D 4LSSL 4O9HL 4RSVA 3NZHH 3RWEB 3H6JA 1B4JH 2BNRD 3V7MA 2HWZL 3CDGB 2AVGA 1KLUB 1P4BL 1QQDB 4HDIB 4KROC 4KTEH 4OLWH 1DBKH 3VMPA 4Z76B 1S5HB 4XPTH 5I1IL 4TUJA 1T0MA 1EV2E 1AR2A 2JJWA 4ZDHB 1CICA 4I4WB 3NA9L 4WFED 5H94A 2AEQL 3MACH 5E6IA 1PFCA 4LRNL 3DNKA 3VDCA 3WKNA 1QFWM 1CDGA 3F5WB 1QNZH 4UBDD 3WFHB 5DJCA 3GKWL 4XVSL 5JORB 1WIOA 2NY2B 5I18L 3EFDH 4KTDH 5HGAA 3ARRA 5IMMA 1T03H 1BX2A 3MV7E 2MHAB 3ZKQD 2A6KB 5K9KA 1V3MA 5LJYH 2Z8RA 1MAML 1BJMA 3BIKB 5BZDB 4R26L 3PP4H 1T5WB 1Y6NR 1KCVL 4KXZH 5T3XL 5D1QC 4PLKD 4HH9A 4J4PA 3S36X 2XKNB 1I85C 4GRWH 3BT2L 5C09D 4GBXA 4HUWA 5HHVL 25C8L 4ISVA 5DSCB 1MCWM 1KIRA 1T89C 4Z7UB 4XX1E 3U79A 3CFEA 3SE3C 3V8CA 5HHQB 1NAMH 2ICEA 1IGYB 1ETZB 4MHHG 5HSFA 1N6VA 4FQJL 1YEFH 3ZDXE 3O6FA 5DFVD 2I9TB 1WBXA 1QFPA 2E9WA 2AKRB 2NX5B 5EU3B 5E00A 4G6ML 3JTCA 3S8WA 4NC1C 4Y4HB 3TN0B 2WINA 2H6PB 4M1GH 4UT9L 3RIAF 5IEHA 3BP5A 1MPAH 3GBNH 5E99L 5ISZD 4KDVA 4Y4FD 5EU4A 2BRRH 3HC0A 4X98B 3C5ZD 4UT6H 3RAJH 1Q0XL 4PJBA 5F3BB 3S35H 3ARBA 3BGMB 1JWUB 3VFWB 3ZKND 4OM0H 4OCWL 4ZFZB 2P5WD 1F3RB 2PO6C 4R8WH 3ECBB 3FB7A 3EO1A 1MCIA 2WK2A 3QEQE 4NP4H 4NCC2 2DTML 3ULVF 1L9MA 4KKBD 4L8CA 1XR8A 2E7CA 4X9HA 3PG2A 4EN3C 3MUGA 2FEDD 1L4IA 5EUKB 5JNYB 2IAMB 1ORSB 3EFFA 2WQ8A 1AFVH 1LDPL 3GI8H 4YPJA 3RZCB 1DANT 1JYXA 2NY5C 4JFXA 5HYSB 1QSEB 3A67L 1T22B 3PGFL 3AB0B 2G5RA 3P0YL 4FFVD 4PB9H 4NFDA 2CDEB 1DEEB 2XZCL 4JRYD 1G7IA 2BY1A 3CFBB 2ADJA 3PUCA 3V0AC 1YEGH 1AY1L 4XBEL 1R24A 5DRNB 1CFQB 4QNPE 3VXME 1GGIL 3DVIA 2VH5H 5CEZH 4Y2DB 1NUDA 1KOAA 2FIRT 2CXGA 4EQ2A 2AJXH 5GS0C 4K2UH 1K85A 1WCBA 2RR3A 4NQCB 2XTJB 1DANU 4D0DB 2R1XB 1VGEH 3QCUH 4KHXH 1RURH 3H8NA 2X9YA 4JG1H 4DFIA 4L8DA 1BEYH 1HHHA 1J5OL 2N7BA 1YMMD 2DOCA 2P5EE 4MA8L 5FUZL 4F7MA 4OF5A 3WDIA 5INCA 3RIFK 3QUXC 4HMCA 4KDWA 2UVFA 1F13A 4X4YA 1FHGA 3GK8L 3PWVB 4OV5A 2WWKO 3NGBC 5E8EA 4IMLB 1YEIL 1FFNB 2LU7A 2ZCKH 4QTIH 1A47A 5AAMA 5C70A 1TJIH 4PJGF 2LAAA 3TBTB 3L9RB 3O2WH 3GI9H 4FQCL 5CSBA 2J6EL 4X7TA 4K7PL 5EORL 4LVEA 3MLYL 1RUPH 1OB1B 4KRLB 3LKOB 3GJFB 2E7MA 1T7YA 2OZ4H 4XPGH 4C83B 3SDDA 1UKTA 1OL0A 3IFPA 1CGSH 2X4TB 4N0UA 4PJCB 3PDOA 1CE1H 3I75B 5IB5A 4OFYD 5HI3C 3LD8B 3PWNA 4WY7L 3TV3H 3WEXA 3CK0L 3OTTA 4MWFB 2XZAH 5E94A 5I30L 3V6ZA 5DQ9B 4ZUWB 2QV2A 1C5BL 2VL4A 2YD2A 1SJHB 5GJTL 3KPSB 4JFFA 4PJDA 4JVWA 2OQJB 5DD3H 1HHGA 3O8XC 4WNQA 2OL3B 1HSAB 1V7NH 4BQ9A 2HJFB 4PJCF 3VGAB 1FNSL 4YXHH 5MERA 5CEXA 3GSNB 2W9EH 3MLVH 4UB0L 3SCMC 2EDQA 2R9HD 3O4LD 3K81A 3ARZA 4H25B 5DJXA 2EXYD 2CKNA 5CD3B 3LKQB 4Y16D 5C0AA 2P4AB 3D39D 4X6FB 1E4KA 5ISZB 3LEYH 2AJYL 3DURB 1FGNL 1QTYT 2ZUUA 4XXCC 5GGSY 4G6KL 4KK6D 5I8KL 5ICXA 1PQZA 2P5WB 3P77A 3ZE2E 1LMKA 4AQOA 4MNQE 3P0VL 3ZT6A 3OKLA 1E6JH 1T1YB 1FNAA 5TQ0H 3O3AB 4HS3B 3GSRB 4YHZH 1OT1A 4HIHA 4HWZB 3UPRB 3ILPB 4HX1A 2DWDA 3O0RL 1BP3B 4KMTH 3D0VA 1WVZA 2MJWA 5J12C 4F3FB 1JUFB 1YA5A 1MCOL 2JB5L 4HKBB 1S9YA 5TFSH 4FQHB 3ROLA 3T0DA 1X4XA 3UTQB 3CLEL 4KVCH 4IRJB 4ODUA 2GFBA 4JLRB 3S3SA 2P8MB 1HILB 4LHUA 2HFGL 1DFBL 1WWBX 3GFUA 5KZCB 4I0PD 4YQXL 3CMOL 1RUAL 3ME0A 5DWUH 5IVXE 2P24A 1K6QH 5TDPB 5CJBA 3DHJA 3MV7B 4PP2A 1CGWA 1OM3H 1WZ1L 4KJYA 3H7LA 1FAIL 1AGBA 3GHBL 4LFHG 1R3JA 4YNYB 2ADGA 2C4FT 2WANA 1EA9C 3G6JE 5C0RH 4L4JA 2DQFA 4JY4A 4ODTL 4WHDA 2NYYC 2NLJA 3VRLF 1HK6A 2AQ2A 5EOTB 3G9AB 5HYJD 1FO0H 4KQ4H 1GPOH 4CMMB 3THML 3K2UH 2MMXA 1G6RH 5GZND 3I9GL 2X4UA 5LG1A 3QEGL 3NFPB 5E5RB 1GIGL 1BFOA 3HZKA 2YRZA 3CFDA 4KKLD 5FYKE 3ZMRA 1I3VA 3AFLA 2YD3A 2VZTA 4JE4B 4FTVD 5J6HB 1IEBA 1BVKA 2DQJL 2QR0A 4QT5B 1BJ8A 2C4FU 3BKML 4YAQB 1CTOA 4KK8D 4MJ6A 1RU9L 4LL9A 5ETUA 3BYYA 3QJFB 5SWQB 3L95B 1MCFA 3QQNA 1WIPA 1UVQA 4YJZL 4AIOA 2DI8A 1NC2A 2FJHA 4D3CH 1NEZG 2NXYD 3MPCA 3HLAB 1ZHNB 5TF1L 1T3FA 4NC1E 3MRIA 5GS2H 2JJVA 5HDOA 1A1NA 3L3DA 4I9WE 3C09C 5D70H 5TDOB 3RGHA 5T1DH 1AXTH 4B53A 1QYGH 3ZDXF 3QZWA 4P4RA 3CZFB 3ARPA 4LQ1A 1LEIA 3HCVB 2I26N 4FQXA 2R56H 5C0IB 1LE9A 1NGXA 2A6JA 1ZANH 4L9LA 5IMKA 3QEQB 2IFFH 3P9MA 1DUYA 5KVFH 4IIQB 3ZHLA 2OXGA 5I6XC 1LQVA 4ODWA 4PGCA 4EI5C 4RMQA 4PRHE 5J8OA 3DUSB 3T3ME 1S8DB 1XR9A 4U4BA 5BV7C 1B2WH 1MFBH 4Q2ZB 2ZOKB 5LGJB 1HXMB 1OARL 4LCIL 3FTGA 5LQBH 5KSAA 5A2JH 2IF7A 1Q72H 3P2TA 4KTYA 2WLZA 3BUTA 4UZGA 4Y16B 4NWUL 4RFOL 5F1OB 2NZ9C 2ATPB 1A9BB 4KJWD 5DDHB 3VXMB 5ADPL 1DN2A 3B9DA 4DEPB 5BRZA 1B9ZA 5GRUH 5GGVH 3IDGA 1HHJB 1OCWH 3MLRL 1RHHB 2BC4B 2FNBA 3FO9B 3V2AR 4LLAA 1RK1B 5I0DA 1SYSB 5D1QD 2B1AL 4B7IA 1WTLA 4JZJB 4NN7C 1T5XB 5E56A 4IRSC 5DJ2A 1U8LA 2WWMC 4Y19A 1KB5B 4QNPF 3S88L 2P5EB 5F7EL 2ZG2A 5FYKD 4HUVA 2VB5A 4QRTA 1JWSA 2BDNL 1YNLL 4Q9CA 2YPKB 4HWEL 1LO2L 3FO0H 4JZNB 3ZSSA 5IROA 3FQXA 3LSOB 1INEH 1Z9SA 3RVTC 1SQ2N 4I0PB 2KPNA 2O5ZH 3X3GH 2NY0B 5DLML 2BZDA 2EH7H 4PRNB 5E4IA 1JN6B 5DK0B 4RMRA 3GMQB 4NCC1 1TQBB 2GT9B 5CJOH 3OKNB 4KAQH 4BJLA 4PG2A 2AV1B 1S7SA 4NZDA 2XRAL 2CLZA 2ICCA 5JQ6L 3LH2H 4N0FB 4NJAL 3IF1A 4W6WB 2ED9A 5CIPA 2R4RL 5JTWA 5F1SA 2H9GA 3B3IB 3Q1SL 3K4DA 4AG4L 4JKPH 1P1ZB 5I1DB 4MXVF 4MB5A 1NDGB 5EH1A 4EDXA 2Y7QA 2PO6D 2YWYA 2V6HA 3RWFA 2ADIB 3S4SB 1MFNA 5JMRA 3DX9A 1OW0C 4Q74A 1Y18A 4PYHA 4KHTL 3FQWA 4UIKH 1UWXK 3O81A 4PRHD 2YRPA 1NAMB 1N4XL 5EIIB 3U30C 1JFQL 4LLWB 4TSBH 4EN3D 2X4OA 2CJUH 2XIDA 2FB4L 3BH8B 3OXRA 5EO1B 4JO4L 2X4RA 1LO3L 2GAZA 5IB3B 4NFCA 5L9DH 4GRLC 2EE9A 4RRPA 1RIVL 5C6PB 1PAMA 4QY8A 5HVHC 2X5PA 3LV3A 4LVHC 1TCRB 3SDXE 2H32A 3UZEA 4JHBA 1DQDL 1GGCH 3UJTH 3OGOE 2IGFH 3UC0L 2LE9A 5EUOE 3B5GA 5B21A 2Y5TB 2ITCA 3EYUH 5F89B 3RPIB 5C0EA 3FB8A 3IKKA 3F58L 4PBXA 1ZVHA 1DLHB 2M26A 3WKML 5I1JL 4K23H 3OJDA 3I3DA 4MNQB 4PBVC 2ESVA 5KVEH 1YQVL 2LVEA 4E41E 4LCYB 4XNYL 3LVEA 1U95B 4NDMB 5FYLD 4W81A 3MRDB 4NZUH 4U6HA 5JA8B 2X4NA 4P57B 5F7NC 3QNXA 3TP4A 4KROB 1MIML 4X6DF 4XXDB 4LSUH 2Q3AA 5T1LD 4JKMA 3TF7A 1X6LA 4FFWC 3QUXD 3MJ9A 2OJEA 4X7EC 4N90E 3TIDB 1I1RA 3GHEL 3JV6B 1PW3A 5FCUH 3LKSA 5IHZB 1KPUB 2VC2H 2ZUQC 4Z95H 3QUYC 3WSQL 5A16A 4OKVB 2WSKA 5IVXB 3RWEA 1DQML 1DQTA 3CDGA 4RA3A 3UPAA 2ZJSL 1KLUA 1QQDA 3R4DA 4HDIA 2Q6WB 3UROR 4UV7L 4Z76A 4FFZL 4WEBH 1AR1D 3MXVL 2IQ9L 4XI5C 2VDML 3SN6N 2GTZA 3IAGC 2BSSB 3G6JB 2E7LA 5SV3A 1CT8B 3GGWB 1BWMA 3UPCA 5CUSL 3PL6D 5K9JH 3F5WA 3S36L 2Z35B 5ALCL 5D1QB 5IVXF 1G9NC 5JORA 5IESL 2DM2A 4DAGL 5TE6H 4N68A 5D1XD 1MFDH 2M1KA 1MFCH 5E03A 1RZFH 3JVGC 1Z0MA 3L5XH 4K3JL 1QR4A 3QIWC 3Q6GL 3AROA 3EJZC 3BIKA 5BZDA 1RZGB 5GGRB 1T5WA 3G6JF 4JM2C 5I1GL 1OD9A 2JE8A 2J8UE 3O8XD 4KK9C 4OUOA 3FONA 1ZLUK 1WSST 5CKAA 2XKNA 2BNQE 1IC4L 4YIQB 4P23C 4G5ZL 4NUJB 4D9QE 1UZ8B 2DB8A 5DQDL 4UINH 3VFGH 4YWGH 4P5KB 5DSCA 3CVHH 3JWOH 2YD4A 2VLJD 2EDLA 2HVKA 4H1LH 2I5YL 1SM3H 2FGWH 5EU6E 1IAMA 1NBYA 1JGVH 1IT9L 3JSSA 1N2RB 1ETZA 1S78C 1I9RH 5E2JA 3VW3H 1PVHA 2B20A 2AKRA 3FT2B 2NX5A 4LDEB 2PO6B 2YK1L 2APVA 4L1HA 1MQKL 2VZ3A 5A2IH 1KJMA 1A02N 5JW5B 4WJ5B 3QULB 4Y4HA 3TN0A 2GCYB 4N5UA 2IH1A 3RIFF 1BREA 5EBLB 3RRQA 5FXCH 1DQJB 5JR1H 4M6NH 3WE6B 1I9EA 5EZIL 2DWEB 4F8TA 2CQVA 3BHBB 4OCXH 1CZ8H 4RAHA 4X98A 3KPRE 1TVHA 4W4NA 3BGMA 5H8DA 1JWUA 4Z0BH 5GRYA 5JLZB 4N90D 1F3DJ 4WRLA 5T33L 4ZFZA 1NL0L 1NCCH 5EBMB 3MNZA 3AMKA 4AZ8A 3ECBA 1N64L 3CFIC 1HZHH 3DMMD 2FEEI 2YSSB 4RX4A 5IJKA 5H2BB 4AY0A 2YR3A 1DJSA 3T3MF 4R9HA 3JWDH 3X3FH 4R7NB 5EUKA 1UZ6E 3KPMB 2IAMA 5M94B 4JDTH 4PV9B 4DVRL 2QBWA 4ZUTA 4UDUA 3RZCA 2HJKB 4P9ML 1LK2A 1N5YL 3HI6L 2BVTA 2DD8H 3W0WB 1CLYH 5D9SB 1NGYB 1QSEA 3SO3C 1T22A 4NO2A 5IWLA 2NNAB 2PUQT 2L7JA 2CDEA 4GS7C 1GOHA 2YD7A 3QUMA 1DEEA 1EERB 1OPGH 3QNYB 3GSUA 1GZQB 2VJXA 5F7YC 4Z8FH 1Q9WA 5DR5L 5ALBH 3CFBA 3VH8G 4CU6A 3AVEA 4WCYH 5DRNA 1CFQA 1TXKA 4XNUH 2HH0H 3O6MH 4L5FL 3W82A 1KN4H 1QRNE 1VESA 4NQCA 5ACMA 4LCUB 4PJEE 5AD0A 5I1LB 5MEPA 4D0DA 2R1XA 2YA1A 3HNTL 4LAQH 3K74B 2AW2A 3VWJC 3ULUL 5JUEH 4OLXL 2PYED 1JHLL 2FBJL 5EZJB 2DQUH 3PIQB 2BJMH 5LVEA 4MXQD 3CU1A 3FB5B 1FVEB 1R5VB 2P8LA 4IMLA 1FFNA 2VDKH 1XIWB 4HBCL 4M8QB 2BSED 3ZTNL 4XPFL 5AUMB 5IKCA 3NACH 4JVUA 1B0GB 1FGVH 3K2MC 4D8PB 3PQYD 2XQYG 4U0RC 3MLTB 3DROB 5CZVL 1OB1A 1JZ8A 4U7MA 3H42L 4EI5D 1V3JA 3GJFA 3LKOA 4PD4K 5C0BE 3WLWC 4XP1H 4NZRH 5BXFB 3HNSH 3QH3B 3BPOC 4JHWL 4XVUC 3HC3L 1J0HA 4I18B 4Y4KC 2DF3A 4F80A 3O8XB 1MCEA 1CGXA 4PJCA 3I75A 5A2LH 3IS0X 1OVZA 1TPXB 1VPOH 2UZIH 4H20H 3SCMB 1G9EA 2IH3B 2ZKHL 3QQ3A 3SDXB 3RKDC 4MWFA 5J1TC 4O2FB 3DGGA 3OL2A 1UCTA 4OD2B 4U3XA 4DKFH 3UBXI 3BP6B 5DQ9A 1CXHA 5EUOB 1MI5D 2NZ9D 1ZVYA 1SJHA 1R3HB 2K9UA 5I1HL 2ZWLT 3KPSA 4UIMA 1G7MB 3UCRA 1VA9A 5T5NG 1L7IL 2OL3A 4HCRA 1HSAA 2NTFB 1N7MH 2HJFA 4UUJA 4HWBA 4WWKB 3CXDL 3NN8B 4NRYB 2PR4L 3GSNA 4DGYL 4C57C 4E41B 3OV6A 4TYUA 4DGVL 4TSCH 1IFHH 4H25A 4OT1H 1NUNB 1H3TA 5CD3A 3LKQA 4LSDA 5AZ2L 1GSMA 4PPTA 3NH7L 5EUOF 5ISZA 1CDJA 2WWMD 2KDGA 1CIDA 4HJJH 3DURA 4YDKH 2A6IB 3MBXH 5H35A 2FRGP 3UDWC 3ZYOA 3QPXH 5H37H 2IPTH 2P5WA 2ENSA 4U31A 5IBUG 2PN5A 1XCTB 1T1YA 3F8UB 3MV11 3O3AA 1YEHH 3LKNB 5B39B 5I1CL 3DETC 3GSRA 1N0XH 3RVTD 1EEQA 1L0XA 3UPRA 4YHKH 3ILPA 1TTUA 2XG4A 2F53B 1QBAA 2KH2B 3AS2A 1RUML 3QXUA 3KPOB 1WV7T 1G0YR 1NCWH 3HR5B 1JUFA 4FXGB 2VDRH 4FQHA 1JYNA 3UTQA 3L7EA 2C1PB 4PYGA 1HILA 1SBSH 2EICA 4H5SB 4IOSD 4XPBH 2FH6A 1NBVL 2WY3A 2AEPH 5SX4I 1CS6A 4OD1L 4U1IB 5TDPA 1EEUA 4PJXF 3MV7A 4JRYA 4ZNEE 3EOAB 5DMJB 7FABH 4KQ3L 1F6AB 3BESR 2DBLL 5D71H 5C0BD 3SKUD 4YNYA 3WIFB 1BQHB 2J8UB 3N9GH 3CFCH 2FCBA 3EYQC 3HFML 2DYPD 2BNQB 3HC4H 4FQ2H 5EOTA 1ZEAH 4U1GC 1NGPH 4GRLD 4G6JL 1RZ8B 4CMMA 2QKIA 2ZCHH 2KQNA 2FHBA 1YMMA 5EU6B 1OP3H 3T3PE 1J18A 4NN6C 1WBYB 2WIIB 4M5ZL 1UWEH 3C09B 1KCSH 3BN9D 3QDMD 5J6HA 12E8L 5TPWL 4P5TC 1IBGH 4QT5A 2YUVA 2NW2A 3V4PL 4YAQA 3B9EA 1NMCC 2HKHH 1NUGA 5SWQA 3G5XB 1UA6H 5IIEB 4TTDD 3L95A 2UY6A 1MAKA 3WIHL 4KU1A 1JRHI 3C2SA 3BRDA 1FLTX 3PDGA 4AL8L 4WI6A 4PJFE 5T3ZL 5MHSD 3HLAA 5FK9B 4DWHA 5D2LE 4UTAH 4V3DB 3B2VH 2V9RA 4EI5B 5TDOA 3KPRB 4FFYL 5T3XD 4PP1C 4OZFG 3CZFA 1B6DA 4FQIL 4JB9H 2HTKC 4FFWD 1EHXA 4FABH 3HCVA 4KPHL 3WJJC 2JJTA 5JOPD 4OFYA 3RP1A 3CC5B 2R1WB 1MHPL 1CIUA 4UQ2B 4IIQA 4NHUA 4PUBH 4YHOH 4UAOC 4R6UA 1EJOL 4CN6A 4BK5A 4MA3B 3TVMB 4ZQKB 3DUSA 4F2MB 4WU7B 1U8JB 5E70A 4Q2ZA 2ZOKA 5LGJA 1HXMA 4JKLA 5JDJA 2AK1L 5FECB 1SY6H 4F33A 4LSQH 4UU9B 1OTSC 2B4CH 15C8L 4ERSH 1C1EL 2AGJH 4Y16A 2QQNH 4NN7B 3INUH 5E8DH 2VO5A 4IRSB 3D39A 2ATPA 1A9BA 1UZ6F 5DDHA 3VXMA 1X5YA 4G6FD 3QIWD 1QRNB 1IEHA 1RHFA 3EJZD 4NKQB 3FO9A 4NNXB 4PJEB 4JM2D 1RK1A 4G8EB 4LPUA 4MX7B 5TDNB 1MVUB 3IU4L 1SYSA 1UXSB 2IBZX 1BM3H 2A74B 4JZJA 4P23D 1T5XA 4TQEH 1H15B 4JO3H 1KB5A 4OQTL 2P5EA 3GMOB 4ODHH 5HGBA 2YPKA 3V4VL 4JZNA 1ROWA 4RISH 4I0PA 2D7OA 1CFTB 4N5EC 1IQWH 5GRJL 1XGYL 4PRNA 4EDWL 2PXYC 4GMSH 3GMQA 4AEIL 4POYA 3GSOB 3OKNA 3RJQB 4HUUB 1TJHL 1S7VB 2AV1A 2D2OA 3ROOB 4EEEA 1JV5B 3MGTB 3D9AL 1FDLH 2WIMA 1A14L 4W70A 4XMPH 5C0BB 4KRPB 2OR9L 3JV5A 1DSFL 3B3IA 1EHNA 3RNKA 3U0PB 3VCLB 2DDQH 3FQTB 1P1ZA 5I1DA 3GSQB 2F58H 3HE7C 4DGIH 1NDGA 4QWWC 1IKNA 2BHUA 1KXTB 1CI5A 4HULB 4M6OH 1C5CH 4WUUD 2ADIA 4GAYB 4TNWK 5HYJA 1MQ8A 4GRLB 4RQQA 1A5FL 3LDBC 1TENA 2VXUH 5I8OH 2OBGA 5HVHB 1LE5B 4LVHB 4TOYL 2P8PB 5KANI 1NAMA 5EIIA 1VGKA 3L7FB 4HGMA 5GJSL 2DM3A 3UTTD 3J7HA 1GC1H 3RHWK 1H3VA 4L29B 4J23A 2NW3B 1RAMA 1A6AA 2QSCH 3MZTA 3VMOA 4LKCB 3MC0A 1X5XA 4QRRD 5HDQH 1TCRA 2Z92A 3VGFA 1R0AL 2X6MA 3KG5A 1IEAB 4MQSB 1R5IA 5ESAB 1U8NA 4DZBB 3WFDL 2Y5TA 3RPIA 4MNGA 4X6DA 4M9PA 2RFXA 3UJIL 2VZ1A 2YKLH 4ZOAA 5B4MD 2O5XL 4EOWH 5DVMA 2J8HA 1A3RH 2M8XA 1JZ7A 3PNWB 4JHZA 1J1XL 4LSRH 1N3NB 4LCYA 4K94C 3QUYB 4GXVH 3RVUD 1OAKH 2MPAH 4UOW1 1U95A 5HHMD 3U1SH 2NY4C 1DE4B 3MRDA 4M61B 4KMLB 1SEQH 1FFPB 4P57A 2ARJA 4XP6H 5JIPA 3MRMB 2EDJA 4XXDA 1Q0YH 3SO5A 3EGSB 4OF3A 4YDIL 2ZUWA 3TIDA 5BJTB 5KW9H 1DEDA 5IHZA 2QHRH 1KPUA 4PY7B 5IVXA 1T2QH 1HE7A 4Z78A 1RZIB 2CR3A 2GK2A 3TGXA 1OAXL 2Q6WA 3A6OA 2BVEA 2DQIL 4G6FB 2ZP0T 3WNNA 4AIXA 1KF9B 1BD2E 1R6VA 3QEUB 3WLWD 2BSSA 3G6JA 1CBVL 1CT8A 4XVUD 4JM2B 1HCFX 3GGWA 4BZ1H 4Y4KD 1AIFB 5SWZE 3ARSA 2Z35A 5D1QA 1ZE3C 2A6DA 1ZXQA 4ZO6A 1I85A 1IQDB 1UACL 1MRFH 2X41A 1RV6X 4KKCC 1LO0H 4OCYL 3P4NB 3RKDD 1BJ1J 1T89A 2Y4SA 2CLRB 2NXZC 2ENYA 4RFEB 2PTUA 3AAZB 4Z7NE 1RZGA 5HHOD 5CGYC 3SE3A 5EFIB 5IVZB 2C3WA 5L7XH 4JM2F 1MCKA 1EPFA 5KTEL 1NCAL 1OAUL 4YIQA 1UZ8A 1U6AL 3H9ZA 4OCRL 3QXDA 3VXTA 3MGOB 4PJFB 5E9DE 5MENE 1BGXL 2EC8A 3T3PF 2CUMA 4NQEE 5D2LB 1J88A 4OGXL 1EGJH 5I1EL 1SJEB 3BD5A 1VB9A 4JN1H 1N2RA 4NQVB 3LS4L 1OAQH 3OR7B 4Z7VF 1A6UL 2VXSH 2AEWA 4JAMB 3AS0A 2EYSB 3BQUC 3FT2A 1GZPB 2G75B 2PO6A 3UAJC 3RGVC 4N1CA 4Y1AE 4WJ5A 3DETD 3QULA 5FA4A 4LLVB 4PJFF 3DRQB 3H7BB 4Z0XB 1DLFL 4V2BA 3W9EB 4S1DD 4PRHA 5EBLA 1ONQA 4JRWA 1DQJA 1HYSC 4FP8L 2JK5B 2R0ZH 2DWEA 3BHBA 2F8OA 4G43B 3U9PH 4WW1B 1WFNA 4N9GA 4XMLH 3OZ9L 5B38G 1T4KB 5JLZA 1IAIM 1LNUB 2VNCA 1NCNA 3P30L 2FWOB 3ULUC 2Q8BL 1KN2H 5T5FL 5EBMA 1YC8A 1MREL 3FQRA 4K9EH 1JFMA 3SO3B 2YSSA 1AC6A 1MCLA 1UCBL 3KLAB 2BP3A 1DBJL 4Z9KB 2DM7A 3O2DH 4S1QL 4TPRL 4GS7B 5FGCE 1T6WA 4FHBD 1F90H 1FL3A 1CL7L 4R7NA 4ZTPL 5GGSB 3VFVB 4HAGA 3KPMA 35C8H 3D85D 4PV9A 1IM9D 1D9KB 5HVGB 3QFJE 4HXBH 2Y06H 2RAMA 1UH2A 4NNPH 5C3LD 5D9SA 2YD6A 5SWZD 3QPQD 1I8IB 3WMSA 3EYQD 4FG6C 3TPUE 1KCGC 3IETB 1QLEH 3CCHB 4I0KA 4LEXH 1AO7E 3QNYA 1GZQA 4ZXBC 2CK0H 4Y8AA 3VWJB 3BJLA 4Z7QF 4XP4H 5GRVK 3GIVB 1CF8H 3OJVC 4K7PY 5CHNB 4HF5L 1QBML 4UTBL 5GGQL 1JHTA 1K2DB 1WWWX 2VDQH 4XMKL 4NOFA 3LQAC 4TUOB 1J11A 1JGDB 5I1LA 5E2UH 4M3KB 4XPAH 5FM5M 4L3CA 3N0PB 4P46C 2A9MH 2VDPH 5E9DD 4M1DL 3MBEC 4NQED 2W0PA 3FHAA 2DQDH 5EZJA 3B4NA 3PIQA 4HIEA 5E7BA 4U0RB 1KJ3L 3H9HA 2DLGA 5FYLH 1ZLSH 5F9WC 3MOBL 4GH7B 4GKSB 4PP1D 3IAPA 1A64A 2KZ1B 1FVEA 4Y4KB 4HMDA 3GMPB 1A7PH 2HTKD 1WLHA 2W91A 3FKUS 3DVNB 1B0GA 4D8PA 3MRPA 1EZVX 5TJWK 1EXUA 3IYLW 3QI9C 2A2QT 3DROA 3HN3A 3MLTA 3TYFB 3C87A 5EWIL 3KYMB 3FQUB 4MCYB 5BXFA 1K4DB 1PX4A 3QH3A 4JFEE 1PZ5B 3WFZA 4M1CC 2MQ0A 4A6YA 4P2RE 3O8XA 3MLWH 1YDPA 1MLCB 1D6VL 3SCMA 3W39B 2IH3A 4UNVA 4JFHE 4NKIH 5L8KB 1OTSD 3SDXA 3JXAA 3T2NH 3NIGE 4JPKH 4OD2A 5E5UB 1ZAGA 3IJHB 2VLJA 3BP6A 5EUOA 4LK4A 4XCCL 1NANI 5IK3A 3I6GB 2ERJC 4TUKH 1R3HA 1S7WB 1UWGH 3TNMA 3VRIB 4XPHL 5D96C 4MQTB 2NTFA 4UT7L 4XXCA 4BM7A 3NN8A 4NRYA 1NPUA 4JZOB 1LHZA 2D03H 3IFOB 1MWAB 5DUMH 3OKMB 1L8JA 5ADOL 3QA3B 3MLXH 1AO7D 1C7TA 4RGMC 5CILL 1YEDA 3FO2B 5FYJE 1JPTL 1U8OA 3JUYA 1DR9A 2EIDA 1KELH 4K8RH 2A6IA 3BVNB 5EA0H 3U6RB 5EZOL 2GQHA 3KS0H 1Q9OA 1XCTA 1W72B 5DRZB 1NCDH 5B39A 4MXWH 4OIIH 2EYRA 4YHYC 3MYZA 1D5IL 2FZ3A 4F7TB 4JY5H 1LWRA 4N5ED 3ISWA 3B8YA 2PXYD 3V9FA 1S7UB 2ORBH 3KPOA 2V7NB 4RMWA 3D18A 2KL6A 3HUJF 3JTTB 1TVDA 3HR5A 4FXGA 2C9AA 1BD2B 4HIJB 1IM9B 5DI8B 4NN5C 1GYAA 4BQBA 4G7VL 5D4QA 5F9OL 1XGRB 2GITB 2W59A 3EYOB 3L6FB 1MRCH 3UBXB 4H5SA 1C5DB 3B5HA 2W07A 1MCCA 1E6OL 5SWZB 3H3PL 1EFXD 4QWWD 2RB8A 4TNVK 5D8JH 5JHDD 2FLBT 3FOMB 3U2SB 1ZKAA 4U1GB 1F97A 5LGKA 4EXKA 1RZKC 3EOAA 3TYGL 2JCCE 5DVOA 1MCPH 4JFPB 4NN6B 3MRNB 4JFED 3MRBB 1OHQA 3IRZA 3DI2B 4M7KH 1BQHA 1PSKH 4M00A 4P2RD 5F1NB 5KVDL 4PJ9C 1RFDH 1A1OB 2HRPH 4P5TB 2CPCA 2GSIA 1NMCB 4JFHD 5CD5C 2IFGA 1RZ8A 5MENB 1NFIB 3MZGB 4R0LC 1CQKA 4TVPH 4LPYA 5EU6A 4HPOL 4Z7NF 2J4WL 3V0WL 2WIIA 1LK3L 3REWB 5J4MA 4OZIF 4YFDB 1H8SA 3KYKH 4JANB 1EAPA 2BHYA 2XV6B 5IR1A 4AJ0A 4H88H 5IIEA 4Y1AB 5C92A 1MY7A 5DD6B 2VSCA 4QRSB 4J3UA 4HGKC 5GIRB 4LF3B 4S1RH 1KXVC 4UQ3B 3QRGL 2APBA 4J3XA 3BSZL 2NY4D 5FYJD 1XGTB 2APWA 3SGJC 4UAOB 1AC0A 3HI1A 3O3EB 4EI5A 2IBGA 4MAYC 1KG0B 1JMZA 2UYLB 4FRWA 1XH3B 5JQHC 4HQQL 3QHTC 2R69L 2I07B 2YC1A 3EDJA 5DGRA 1U8QB 4ZYKB 2NY1C 4M62L 1AJ7H 3TBYB 1U2CA 3BWUC 3F62A 2NY7H 3CC5A 4WDIA 5I19L 2R1WA 3MLZH 2AI0L 4UQ2A 3GUTB 3T4AB 5FGCB 3TWCL 2A73B 1R3KB 3OKOB 4DUVA 3IDUA 5IHBA 5L2KE 1F11B 4KI5E 4ZQKA 4F2MA 4GG6F 4WU7A 1BZ7A 3DSFL 3QFJB 5DHVH 1U8JA 3LN9A 2AS5M 3DVFA 4J8RB 1MFAH 2A1WH 3I02B 4PRID 2AABL 3MJ7B 1IC7H 1INQB 3S3JA 3C08L 4LASH 1I7ZA 4UU9A 1AGFB 3TPUB 5JOFA 3P40A 2ID5A 4XRCB 5I0ZA 2DLFH 4TRPL 1AO7B 3L3KB 3VFOB 1PY4A 3EOTL 5LAXB 1T2JA 4NO5A 4IRSA 1T2XA 4ONOA 4KKCD 4M6AA 1NBZA 4P2QD 4ONGL 1G7PB 2MSPA 2NXZD 2R0KH 2YMXH 1YY9C 2VXTH 3RHWF 5CGYD 5F7FA 3QO1B 1WAAE 4NNXA 3MUZ1 4PJEA 4MX7A 1T1XA 5TDNA 5IUSA 1MVUA 5F88A 5GGTH 1NANH 4MLSA 1JNLH 3DX7B 2R29L 4ETYA 2A74A 3VFPB 1X7QB 3QJHB 5IW3A 3X13A 3L3IA 3NCYP 3MJ9L 3U9UB 3MRQB 3BIBX 1NLDH 3GMOA 3MRGB 3DYOA 4FQQB 2CR6A 5F8RC 4OLVH 3RU8H 2FX7L 4GMTL 2F74A 2W9DH 4MZ3A 4ONFH 5C9JB 4NGHL 4LPTA 3HE7B 1EFXB 1U8PA 3OAUH 2BERA 2P44B 4NSKB 3RGVD 3GSOA 1P4IH 1OW0A 2G2RB 2R0WL 1S7VA 4J3WA 4M03A 4H8WL 2Q76B 3MGTA 2BOCB 5GHWL 3V7AE 5C0BA 1ZLVK 1HYSD 4Y5YC 4JFEB 3VG0H 3VCLA 1XGQB 3WS6C 5F21B 3FQTA 4P2RB 5FM4A 3ZDYE 2YPVH 4Q9BA 5C08D 3ULUD 2ICES 4JFOB 4LHUG 3S34H 4GAYA 3TESA 4XBPB 1ERNA 4GRLA 1MJUL 4NZTL 5HBBA 2QEJA 1VEPA 1LE5A 4HLJA 1YECL 2P8PA 4M43H 3ZL4H 4OB5H 3ZYZA 2HFTA 1AI1L 3L7FA 1SBBA 5B8CC 5B3JE 3QDMA 4YH6A 3MA9L 4MDIA 4L29A 2NW3A 4FG6D 1KJ2B 4O9HH 2JELL 3LS5L 2HWZH 3B6SB 3EOBB 4IOIB 1OAZL 2NY4B 3EO9L 1WF5A 4ZXBD 1P4BH 1KENL 5I1IH 1EO8L 3SKJH 3MYJB 3S96B 4JFYB 3FMGL 3REVB 3NA9H 3KYNA 4PJIE 3ULVL 4YDJA 4B50A 4J6RH 1HI6A 1YMHB 1N3NA 3GKWH 4PRAB 3QUYA 4XVSH 5E0QA 4HSQA 2BY0A 1M05A 2CXKA 1C12A 4P46D 1DE4A 1URLA 1HYRC 3OPZL 4M61A 3RJDA 3CAFA 5I18H 3RX7A 1FFPA 1N5AB 2Y07L 4QXTB 3WFBL 4NBZB 4R26H 3QWRD 2X7LB 1MHCB 3PWJB 3EJJX 1KCVH 2O93L 4ZSOE 3ARFB 2DJSA 4MD5B 4OCMC 4IDLA 1JGEB 4LBEB 1NEUA 2QQLL 1CXEA 4BFIB 4L4TE 4D0BB 1RZIA 3TA3B 3BT2H 4ZNEA 5HHVH 2JLLA 3E6FB 3VJ6B 1J12A 3EYFB 1FN4B 3JVGA 3QI9D 2NXZB 3QEUA 1MHHB 4YC2B 1F58L 3QUML 5C0JB 5CBEA 4JM2A 2B39A 4WI7A 4XBGB 4M3JA 3ZTJH 1D6EB 4FQJH 5ESVB 1AIFA 3M8OL 1MIEL 5CWSB 3OKEA 1O5DT 2C1OA 1FH5L 4D9LL 1J0ZA 2AQ3A 4P23A 3QUKB 4GAJL 4G6MH 1IQDA 4JPVL 5KOVC 1W0YT 4NPYA 2JCCF 3P4NA 1J1PL 1H8NA 2CLRA 1G9MC 3MA7B 4ZD3L 1CLZL 4PJ5E 2OCFD 1BFVL 4RFEA 5E99H 5DVLA 5I74C 3PABB 3RWIB 4C58B 5EFIA 3LZFL 2GUOB 3G5VB 1Q0XH 5CCKL 4X4MA 4X6BB 4Z7VA 2WLYA 3WNPA 1L6ZA 4APQD 1F6LL 4ETQB 4R97C 4H0GA 2W65B 3JTSB 2HT4C 3BQUB 5C7XH 4B41A 4LCCB 1YEKL 3RGVB 4N1EA 3MGOA 1UC6A 4YHPB 4PJFA 1ND0A 2DTMH 4LPVA 5T1MB 2EIZA 3WFCL 2Q7YA 4U2YA 4JFQB 4YEFA 1E4KC 4PJ8B 5FCSH 4NQVA 1BWWA 1I3GL 1LDPH 3O6KL 4JAMA 5I16B 2EYSA 3FZUC 2G75A 2EYTB 1FJ1A 4ELKB 3PGFH 1QR1A 4IDJL 1JPFB 4LLVA 5IB1B 3DRQA 3H7BA 3P0YH 5BS0E 3BO8B 5L2KB 1NCUA 4CVXB 2DQGL 2XZCH 3ZT5A 5D7SL 1M6OB 1PEZA 1AY1H 2JK5A 2VLRE 4XBEH 4JDZA 2UUDK 5KSBE 4UDTB 4G43A 1GGIH 4WW1A 4JQXC 5DUPL 4HXAL 1LNUA 2FWOA 3O3UN 1GL4B 3ULUF 1H3XA 1UYWL 3ELAT 1RIUL 4L4TD 5EPMB 5F3HB 3KLAA 3U0TB 1IRAY 4EIGB 5EG6C 1P69B 2OL3L 2P43B 1LDSA 4HCRL 4X8JB 4HWBL 4ZXBB 3DJ9A 4MA7L 5FB8B 3B83A 5GGSA 1DDHA 1O0VA 2OTUA 4X7SL 1J5OH 3GSNL 3QDJD 1SMAA 3MJ6A 1A4KA 1D9KA 1DQLL 4PRBB 4U1JB 1KC5L 1H5BC 4QO1A 4LKXB 1EHLL 4OGYL 4MSWA 4NIKB 4RIRB 2V17L 2LABA 3GK8H 3MRLB 3WLBA 3BPCA 4WEUD 1I8IA 1YEIH 1E4XI 1YPZE 3TC9A 4FQCH 5CD5D 4RRPG 2J2ZA 2EXWC 5C0CE 3VWJA 5ITFB 1CXLA 2J6EH 4JKWA 3OAYK 4K7PH 5EORH 3MBEB 1ZGLB 1FYTE 4OCSL 3BGFB 3MLYH 2X70B 1TZHB 1RULL 1ACZA 3CFJA 3VFNB 1K2DA 1WAAF 2O5YL 4X5WB 1DL7L 3OHXB 3U7AA 4GAGH 4TUOA 5CJ5A 1JGDA 5I75C 3GSWB 3VXRD 3TBSB 1TJGL 2KZWA 3BZFB 1RZJC 2CDGB 2LTQC 4WHYG 4QHLB 4LLQB 2FD6L 3H9SE 1DBAL 4WY7H 3SJVD 3CK0H 2M2DA 1UJ3C 5I30H 4U3CA 4ZAKB 2VZSA 5DEZA 2AK4E 4YZFE 1C5BH 3MODL 4MAYD 3C8DA 4GKSA 4WU5B 5GJTH 3W11C 3C6LC 3STBA 3PHOB 1UQSA 4Y4KA 5LCVL 3MROA 1FNSH 1U42A 3Q0HA 4UB0H 4YGVB 2IG2H 4WFFE 4BUHA 3M17B 3DVNA 4L3ED 4YDLC 4DFHA 1PG7X 4NQDE 3RWDB 1W0VB 2D0HA 3TYFA 1OTTC 4ZFOB 1U8HB 5KS9E 3KYMA 5J11C 1G0DA 3ZDYF 1K4DA 2AJYH 1FGNH 5AWNL 1PZ5A 4JPWL 5I8KH 2EDOA 3T0EC 2BVQB 3STZB 4TNVF 1MH5B 1JGUL 3P0VH 4JJHA 3MMEB 3W39A 4HS6B 2HLFC 2WAHA 4DN3L 1VACB 2ZNXA 1DZBA 3IJHA 4X4ZA 1CD9B 5CMAB 1G7HB 5L0QB 5B3JF 1UGNA 2YUWA 2JB5H 1MCOH 1S7WA 4XVTL 4LSPL 2X42A 4RZCB 1FSKC 3HZYB 4O58L 5BQ7B 3W5MA 3CLEH 3UDWA 2ED8A 4PJIB 1X6NA 1YY9D 1U3HC 3EO0B 4YXLL 3VGBA 2YPLE 3IFOA 2HFGH 4WEMB 1MWAA 4LVOB 1ZLWH 4JM4H 5MP6L 3OKMA 3NFNB 4YQXH 3CMOH 1RUAH 2A9NL 5LWYL 5C0CD 3GO1L 3FO2A 4PRPD 2Q8AL 1H3WM 4GBXD 3N85H 4EVNB 1WZ1H 1FBIH 4OFPA 1FAIH 4S2SB 3BVNA 3SDCB 3GHBH 2BVUA 4PJIF 1SY6A 5I2IB 1NSNL 1JL8A 1W0WA 4ZSOB 1LD9A 3QG7L 1W72A 5DRZA 2EDXA 4LAJH 4X8XA 4WWID 4UV4L 4MMZC 2V7HB 1RMFL 2V2XB 4I3RH 4L4TB 3OX8B 1YN6B 3G6DL 3H9SD 2F5BL 1KULA 1S7UA 2V7NA 4JGJA 3THMH 1MCJA 5D1ZB 1B90A 1MCHA 4IMKC 4KVNL 4PG2C 3HPLB 3I9GH 3QEGH 5FYKU 1BD2A 4HIJA 1H3PL 1IM9A 1IGTA 3L3JB 1XGRA 2GITA 3EYOA 3L6FA 4O51B 4A2LA 3UBXA 5IFAL 5EU7C 1C5DA 4CDHA 2OX5A 5SWZA 2DQJH 1CVRA 4PJ9B 1FZJB 5K9QG 3BKMH 3WHXB 1P84J 1U8IB 1RU9H 4QHNB 1HQRB 4DN4H 2CDFA 4UILL 3FOMA 1KNOA 4WTXA 4NQDD 3P9WB 3M1BB 4R0LB 3RL2A 1CWVA 3VH8A 3MNVB 4I0CC 1QRKA 4PJ5B 4ZUSB 5LXGL 4YFLF 1I1AC 5TF1H 4HUMB 5F96L 4JFPA 3MRNA 4HKZB 3MRBA 3VXSD 4F58L 4YHNB 3HI5H 4OZIA 3BKJH 4KTEL 1YYLL 2VITB 1KB5L 1A1OA 4P5TA 2VABA 1TQCC 3QISA 3RNQA 3IDMB 5ERWB 5HYSG 5JW3L 2IC2A 5E9DA 3MACL 4BKLB 1KTKE 4NQEA 4Z5RB 4G9FE 4K3HA 1PY9A 2E9JA 3BUYB 1E4XH 2ZUVA 3REWA 3RVWD 4HIXH 4MAYB 4AENB 5FKAB 1JWMB 4C4KO 4OZGE 1IGML 1A7OL 4JANA 3O45A 2YPLD 2LFGA 4OFIA 1OARH 4I3GA 4LCIH 4WI3A 3O6LL 3WJJA 3VI3E 2WV3A 2NY1B 5D7LE 3RPKA 5DD6A 3IXTB 5BS0B 4QRSA 3VD9A 4XB7A 4LF3A 5L2JB 2J1KA 4ZUUB 1IM3B 4J3TA 4NWUH 5HPMB 1XGTA 4RFOH 4XHQA 1JZ5A 2Z31C 3IDIB 5KSBB 2VLRB 3O3EA 1KG0A 4URTB 1XH3A 3QRFM 4LOUC 4GG6A 1ITBB 5DJ6B 2I07A 4ODSL 4GRMB 1U8QA 4ZYKA 4F7PB 2EDNA 3TBYA 3R8QA 5JDSB 1NAML 2CUHA 2GSGB 2B1AH 3MLUL 3GUTA 1DN0B 4XGZB 3T4AA 2A73A 2Y72A 4WO4C 1R3KA 3OKOA 5GS1C 5KSBF 4R4NC 4RAVB 5GXBB 3RVVD 3QFJA 5F7EH 3MOAL 2XNAB 1YNLH 3QG6B 4J8RA 5A2FA 3FT3A 4HWEH 1LO2H 5I73C 3AGVA 1CLCA 3I02A 3MJ7A 2BRRL 1INQA 3SDDD 1L0QA 3TPUA 5HXMA 4C56E 5DVKA 3RAJL 1CE6B 1YPZB 4XRCA 3S35L 2JJSC 5DLMH 3W5NA 1AO7A 3B9KB 3L3KA 3VFOA 1ZHLB 4OM0L 2EE3A 4XCNA 3L5JA 5C0CB 2W60B 5ICZB 2VISB 1FYTB 3ZLQC 2FDBP 2XRAH 5JQ6H 4NJAH 1ZSDB 5M95B 1A9EB 2R4RH 4U7SA 4N8CH 3QO1A 2EEDA 1G7LB 4QOKE 4JFFD 1QHOA 5IB4B 1YPZF 4OZHE 5D7KE 3DX7A 1EH9A 4N5EA 1P7KB 1Z9LA 4XAWL 1X7QA 3H9SB 3QJHA 2HT4D 2PXYA 1U8MA 1BF8A 3ESVF 3MRGA 1S7QB 4FQQA 2AK4B 3S37L 3MCLH 5C0AD 1HH9B 2ITDB 1JFQH 1T80A 3ESUF 2YHGA 3D3VE 1QEWA 4Y5YB 5C9JA 2FB4H 3LHPL 3VFSB 2X1QA 4JO4H 1KB9K 3HE7A 1LO3H 3CGTA 1EFXA 3GBML 2VH5L 5HI5C 4HKJB 5JHDA 4LLMB 3FZUD 2AJXL 4NSKA 3NABL 1RIVH 4NQDB 5C3TA 1T7WA 5DT1L 2N7AA 2G2RA 4LGSB 2K7QA 4RDQG 2Q76A 1LEGA 2XWJB 2BOCA 2UWEE 2EDRA 4X6CE 4PR5B 5KS9B 2R8SH 1OP9A 3QCUL 3UC0H 4JFEA 3TBWB 1XGQA 1WC7B 3B5TA 1G7QB 3IAQA 4P2RA 5B8CB 3F58H 5I1JH 2OTWB 2JIXD 4JFOA 1OOAA 5FYKL 3HG1E 3T0EE 4XBPA 1T04B 1YQVH 4G3YH 4C54A 2AJZA 5FKPB 1FVDA 4XNYH 1L0YA 3U7WL 1YEEL 1VFAB 1EMTH 1ZV5A 1BZQK 1EFQA 3OKYA 3FFCE 1MIMH 1CG9B 3QXTA 1JPST 4WFGE 3VXNB 4KGLA 3RZCC 3V95A 1RUPL 3GHEH 4ODXB 1BQUA 2GK0B 3VRJB 2CMRH 2FBOJ 4HKXA 5ESQB 3WNKA 3WSQH 2VQ1B 1KJ2A 2F54E 3TO4C 5BO1L 1CGSL 1DQMH 3RI5F 3B6SA 4IOIA 1TNMA 4X7DC 2XYCA 1YN7B 2X09A 3V5HA 2ZJSH 1P7QB 5F8QC 4XX1G 4UV7H 4FFZH 5K59F 3U7YL 2CSPA 3LQZB 2C3VB 3S96A 4HUKB 5DRWB 5F7MC 3MXVH 4Y2DC 2VDMH 2VXQH 4JFYA 3REVA 3K80A 1CFSB 2UVEA 1S9VA 3EDDA 4PJHE 3KHOA 1RY7B 5CUSH 5D6CB 1YMHA 4MAUL 5DK2A 1ZHBA 3S36H 5ALCH 5IESH 3S5LB 4DAGH 3K3QA 4O5LL 2R1YB 3BD3A 4HZLB 5TH2B 1N5AA 1FFQA 2NPLX 4QXTA 4EUPB 2WQRA 1TETH 4K3JH 2NY5L 5DJ0A 1NC2D 3VXUE 2OSLA 1ZMYA 3D3VD 5JIIA 2X7LA 1MHCA 3PWJA 5C6WH 5I1GH 3LEYL 1IAKB 1XGPB 3C6LD 3W11D 5IF0A 3JWNC 4MD5A 2J5LB 3O9WC 5CP7B 4LBEA 2E6JA 4BFIA 4OZFH 4G5ZH 4D0BA 3MJGX 1SJXA 4L8BB 3VFUB 3VJ6A 3E6FA 2ATKB 3E1F1 1NKOA 2JCCA 4KKNA 5GS0L 4HMEA 1FN4A 5CBAA 3DHMA 4WTZA 5EO9B 5DZOA 3SGDI 1OTTD 3IFNL 2W0LA 1IMHC 1WFOA 4KMTL 1MHHA 1IT9H 3WS3B 4D2NA 5IJVA 3VD3A 5E2VL 5C0JA 2BK8A 3WHE0 2C3XA 4XBGA 1OP5K 3E6HB 5ESVA 5CWSA 2YK1H 3QUKA 1MQKH 4EZMA 4G9FB 5KSAD 2HLFD 1LGVA 3WYRA 5IFHL 1RJCA 3OB8A 3IRPX 4J3VA 5DWUL 1WZMA 5KVMC 3LN5A 3PABA 4WFGD 3RWIA 3HKFA 4XTRC 3DBXA 2AP2A 3L3GB 3RBGA 2GUOA 3G5VA 4OZGB 3VFMB 4KFZC 4X6BA 5C2BL 5T33H 1NL0H 1U3HD 3WO4C 3NIDE 4ETQA 5J6GB 3RWHA 5D7LB 3JTSA 3BQUA 1N64H 1NQBA 4Q9RL 1DUZB 3RGVA 1JTTA 1A7NL 3WUWB 4PLJD 4Q9QL 2CIIB 4KJQC 3RUGE 5J13C 1AH1A 5F7UA 5E24E 4JFQA 2JJUA 4Y19D 5GZOC 2L0DA 4XWGL 5BVPL 3EDEA 4P9MH 1N5YH 5I16A 3HI6H 1KBGL 2YD9A 2ZUYA 1QLRA 3LY6A 3UTZB 2EYTA 5FGBC 5FGSA 8CGTA 4ELKA 3UTSE 3FO1B 2NZIA 3A6CL 3IVKA 3BO8A 3OQ3B 4A6YL 4CVXA 3QSKB 3MUY1 1JI2A 1M6OA 5ID1B 3HA0A 3GM0A 2QJDA 4UDTA 2B5IC 4L5FH 4M4RA 1H5BB 4IRJC 1IGJB 3CMGA 3B8SA 1A7RL 4BFBD 2HJLA 4C56B 5JHLL 5T1DL 4JCMA 3ZKMC 5EPMA 1QYGL 4OCNC 3U0TA 1OGTB 3HNTH 2XN9E 5IBTH 4AMKL 4U6YA 2DI9A 3S4SG 4RGOL 4S0UC 4X8JA 2R56L 5HHNA 4ZXBA 5FB8A 3DOSA 3L3OB 1JYVA 4OLXH 5TE7H 1JHLH 2YA0A 2FBJH 4PRBA 4U1JA 3T0XA 3CVIL 1I1AD 3ZKXC 4OLYL 4LKXA 4M7LL 1WAAA 3MCKA 1GXEA 4QOKB 5DFWH 4PGDB 1CFVL 3U36B 2X2YA 3KYAA 4OZHB 4CN4A 4QGYA 1Z0NA 4HBCH 1B2WL 3MFGB 3ZTNH 1MFBL 4XPFH 3ARYA 3K46A 3L1OL 2LTQB 5ITFA 3BMVA 5LQBL 2P48B 3MBEA 1GOGA 3FQNA 1ZGLA 4RMTA 3H9YA 1UJ3B 5CZVH 3H42H 3D3VB 4X5WA 2BY3A 1A6VL 4NO3B 5HDBE 4JHWH 3OXSB 3GSWA 3TBSA 4OZHF 3SKNA 3BZFA 4X6EB 4UMGA 1JZ2A 1BIIB 1QSVA 3FRPG 5F7LB 5GRUL 4QHLA 2AXFA 5E4EB 2UWEB 4X6CB 1JPSL 5CS7A 2VLKE 4RNRB 1HINH 2Z31D 5DJYB 3QI9A 3DVGB 3ARTA 5TQ2H 4QRUA 4WU5A 5D72L 5J11B 4LOUD 5EDXA 2Z4QA 3PHOA 1L7IH 3F6IA 4XCEB 3CXDH 4AEFA 3HG1B 2EH8L 4DVBB 3T0EB 3C9NB 4DGYH 4YGVA 3Q6FA 2EDEA 4O2CA 3M17A 4NZJA 4DGVH 1D5XA 4CVZB 3RWDA 4OSUL 1W0VA 2UWEF 4HC1A 4I77H 4IIQC 4OF8A 5GISL 4WO4D 4ZFOA 3NH7H 1U8HA 3KXFE 4KY1L 5IOPA 4R4ND 3FFCB 4QXUL 3QT2A 3OSKA 4NBYB 1FSKB 3LH2L 2BVQA 3STZA 1U3HB 1MH5A 2ARJQ 3MMEA 4WVRA 3SGDH 3KPPB 1FC2D 3K7UA 2F54B 5I1CH 5I1AB 3G04A 1VKXB 1GGBH 1VACA 1UB6B 4LDOB 1RUMH 4PB0H 4M48L 2IADB 5CMAA 4P9HH 2PF6A 5CSZB 1CD8A 1A6TB 4DEPC 4RZCA 3HZYA 3NPSC 2F15A 4PJIA 4PJHB 3LOWA 3WNLA 5CSGA 3EO0A 5JIKA 5HD8C 5T1KB 1NBVH 3K1KC 1V3KA 2EEAA 5I8EB 4OD1H 4MJIE 5DJDB 5BV7L 4X99B 2GY7B 4FS0A 1Q9KA 3OJ2C 1G7JB 3JV4B 1PGRB 1LQSR 1EX0A 2LV4A 2LAGB 2QLVB 4JR9H 5L88L 2E3VA 3P4OB 2BMKB 4KQ3H 3VXUB 4NQUA 3SDCA 1CD0A 1MOEA 2AJSL 4PJHF 3AM8C 3VD5A 5B38A 5I2IA 2ARWA 2RCSL 4OUUA 1PKQE 1ZT4A 4ZSOA 2V5SA 3U82B 2E6QA 3HFMH 2V7HA 2V2XA 4L4TA 1OSZA 1CR9L 4ZG1A 3OX8A 1YN6A 2NY0C 2FH8A 2YN3A 2NX5D 4U33A 4G6JH 4PJAE 3MRRB 1S7XB 3O4OC 5IBLD 1N6QL 5IM7B 4BK4A 5E8PB 1WISA 3BIAX 2VLKD 3HPLA 4Y4HD 3B9VA 1I1AB 3HR6A 3L3JA 4NUGL 3SE8L 1I9IL 3HMXA 4O51A 3ZDZE 2FX9L 5DO2C 4AH2B 1KIPA 12E8H 5TPWH 1XF2B 3PGDB 4PJ9A 3ARDC 3V4PH 3PWPE 4QHNA 4LIQE 1TQCB 3MV01 4LPCA 1MFEH 4DTGL 2DIJA 1CDHA 3WIHH 4ZFFA 3M1BA 5FCUL 4R0LA 2CRMA 1HHKB 1J1OL 4AL8H 3MNVA 4PJ5A 5T3ZH 4ZUSA 5JPMA 1A22B 3I50H 2YOCA 4HKZA 4FFYH 3UTOA 2IQAA 2IAMD 3S7GA 3VXRA 1CU4L 2XXCB 4FQIH 4WEBL 3RZCD 4GUPA 3ZO0A 3TT1L 4KPHH 1BHGA 1A2YB 4DK3A 1U8KB 1OWRM 3RUGB 1MHPH 4Z5RA 1J8KA 3TO4D 3QFDA 1QFWL 3BKCL 5K9JL 3T08A 1EJOH 3BUYA 5GSRB 1UJTA 2Z31B 4P59L 3V5DB 3GMLB 4MAYA 4FQLL 5FKAA 3KLHD 4MD0A 1RZFL 3L5XL 4LLDB 4Y2DD 1DVFC 1T66C 2AK1H 5DJZA 4GQ9L 3UTSB 4NQCD 3IXTA 4FZEL 5D7IB 5BS0A 2IALB 4MJID 1JNHB 15C8H 5DFTA 5L2JA 2AJVL 1C1EH 4ZUUA 1IM3A 2IBZY 3FAWA 4ODVL 3ZYIA 5HPMA 4WO4B 2NCMA 5KSBA 1KCUL 2VLRA 5GS1B 5IP4A 5EZLA 3MNWB 1U0QA 3MUJA 5F1IB 3I3BA 4LQFL 3MO1B 4RFNC 5DJ6A 4ZS6C 2IANE 1TVBB 4U1LB 4GRMA 5I73B 1SM3L 4F7PA 5JDSA 3IU4H 2HAZA 2GSGA 2PETA 3BKYL 3DWTA 1UM4L 5TGBB 1BBJB 2XN9B 3O9WD 1DN0A 2OXHA 3TEUA 4XGZA 2DQCL 1WFTA 4YO0B 1F4HA 5ENWB 4PFEA 4RAVA 1NGWB 4WI5A 1BOYA 2VDLL 1FFRA 2PW2B 5I17A 5IFJB 1I8LC 3MR9B 2XNAA 3QG6A 3V4VH 5JR1L 2G60L 1FFOB 1FIEA 4W6XB 4HS8L 1DTUA 1YPZA 4PS4H 5GRJH 1XGYH 3KR3H 1ZHLA 4EDWH 3X11B 3IDNB 5C0CA 1NCCL 1PZUB 1P2CB 4AEIH 3C60C 5DRXB 4PRPA 1FYTA 2KKQA 1PBYA 3D9AH 1A14H 3GB7B 1ZSDA 2RJMA 1A9EA 1FE8L 2ZSVB 2OR9H 1LEKA 2XFXB 1DSFH 1G7LA 4EIZC 4TN9A 3KPSD 3X3FL 5IB4A 3WJLC 1P7KA 4GW1B 2C3HA 3H9SA 5JW4M 4OLUL 1CLYL 1A5FH 4KUZH 2VAAB 4FZ8L 3CFKB 1J0KA 4KJQD 2VLKB 1SYVA 4Z7UF 4TOYH 1H8OA 4BQ8A 4RMVA 8FABB 1HH9A 2ITDA 5D7JC 4NQTA 5HDBF 1T20B 1WCQA 3DRTA 5GZOD 1G9NL 4Y5YA 5GJSH 1UKQA 4XP5L 5ALBL 3WS6A 3VFSA 2WP3O 1MLBA 3BZ4B 3M07A 4XP9L 1WTGT 4NQDA 5B39G 4QHMB 2DI7A 2L4OA 1JBJA 2XWJA 5T3ZE 2GHWB 3KXFB 1MSPA 4PR5A 5KS9A 3R0NA 5K9OA 2HMIC 4NKDB 4NNYB 3WFDH 3VXSA 3TBWA 3DX8A 4BZ2L 1WC7A 1G7QA 4U05A 5B8CA 1FVCA 2D7TL 3O2VL 4WHTB 3UJIH 4Q6IB 4C59B 4IRJD 2BJML 3KPQB 2OTWA 2NY3C 2O5XH 2ZOLB 4G8FA 5KSUB 4CVWA 1AGDA 2G5BB 3CLFL 1T04A 5F71A 1J1XH 5KZCD 5FKPA 3ZKMD 5CINL 3TO4B 3MRFA 5SX5H 4D0CB 5E08L 1VFAA 2W1NA 4CNIA 3FN9A 2OMNA 3TFKC 5DZLA 4WUKL 3MV7D 3TZVC 3NACL 1CG9A 4F15C 4OGAC 3VXNA 1HWHB 1AGEB 2YPLA 4YDIH 2VQUA 2GK0A 1YUHB 1BQSA 1BQHG 5IGXH 5DF0A 5ESQA 4MJIB 1EEZA 1YN7A 2KBGA 3FAXA 4U6TA 3ARGC 1FORL 5FDWA 4H20L 2QQKH 2VE6B 3HTLX 1QOKA 43CAA 2DQIH 3LQZA 2C3VA 4M93C 5DRWA 1KEGL 1PKQB 2AXHA 3BEWA 3OAZH 4DKFL 2X89A 3I6LE 1JPGB 2CKBH 4K07A 5CZKA 1K4CB 5BMFH 5AYQA 5EB9A 3GIZL 4GKOA 3O9WB 3S5LA 2BY2A 3X14A 1V3LA 4PJAB 2FGZA 3T8XB 1UACH 2R1YA 1QP1A 4HZLA 3LMJL 2V2WB 3U83A 4OCYH 4EUPA 4TSCL 3ZSTA 3HZVB 3OB0H 2BRQA 4DW2L 4EBQH 2B2XL 1XGPA 4LDLB 5KTEH 3EHBC 3PWPB 1JNNL 1NCAH 4DZ8B 1OAUH 4ZPTB 1XIWC 3BYTA 1K8DB 1MJ7L 4I48A 4PJAF 4E42B 1U6AH 4GRWE 4L8BA 4OCRH 3VFUA 1P4LB 2ATKA 3QEQD 4R4FL 5JA9A 1I8MB 4KZEL 2PCPA 5JIHA 2DJ4A 4MA1C 3MREB 4OGXH 2DL9A 5I1EH 4WFHE 4X4XB 1K8IB 5DZNA 1F4WH 2MFNA 4HT1L 4I18C 3E6HA 2R2BB 2X4SB 1PYWA 5HDLA 3WO4B 1XGUA 1TPXC 1SBSL 1WFUA 2VMFA 5FFLA 4XCYA 2UY7A 2LVCA 1DLFH 5J13B 4OV6F 1UM6H 3PXJA 3L3GA 4OZGA 3V6FB 4D9RE 1T6VN 3VXMD 3TM6A 1UG9A 1OT2A 4Y7MA 3P30H 4WWKC 2Q8BH 5J6GA 3CUPB 5T5FH 5HD8D 1MREH 5D7LA 2FEEL 4CADB 3LCYA 3WUZA 4KJPC 2R2EB 3OKKB 1M1SA 5E8OA 3WUWA 1UCBH 1ZWIA 1D5BB 4S0TD 5J57B 4S1QH 4TPRH 1IAOA 1ZEAL 1MCQA 4K3EL 4ZTPH 3RX8A 1NGPL 2I9LA 3OG6B 2P5ED 1IZJA 4GQPH 5HY9B 3E3QC 1TFHA 2IANB 4GW4B 5DD1L 2B5IB 4JQXA 3VE0B 3I6LD 3IJSB 3UTZA 2JIXA 1OY3B 1NMAL 3PWUB 1BBDL 1KCSL 5FOJA 3VWKC 5DQJB 2VLME 2NY0D 5DD0L 4RDQF 5F70A 4GOSA 4BZYA 5EOCH 1JZ6A 4YHIB 2GJZB 4M7JL 5ID1A 3KS0J 3RDTB 1MJ8H 4HF5H 1QBMH 1WQVT 4UTBH 5FUCC 1H5BA 3ZKXB 5CEZE 4JFDB 1IGJA 3O11A 4ORZC 4XMKH 4UTAL 1I7RB 4C56A 5DO2D 1ULVA 1VFBB 3TT3L 5BZWB 3ARDD 2R0LH 1FNFA 5CGMA 2JTDA 3FN0L 4R4BB 3E2HC 4M1DH 3L3OA 1MWAL 4FQPA 1FCGA 3MRJB 1H3UA 2ZSWB 4WFHD 4ACPA 1KJ3H 1QBLH 4YHOL 1ZVSB 4FN0A 3MOBH 4QOKA 4PGDA 2DMKA 3GRWA 3RWGB 3U36A 4OZHA 4RAUB 2WUCL 4OIAA 3VGGA 2CK2A 2IPUK 1D5MB 1QSFE 3FHQA 5J1AB 2RHEA 1SY6L 2C26A 1CLOL 4UNUA 4LSQL 4I3SL 1W72L 2VOTA 1UJ3A 3SKMA 2YBRA 2AJUL 2ZUTA 4Q0XL 3D3VA 5FO7B 5EWIH 2AGJL 2X10A 4D9RD 1HHIB 2Y36L 1QA9A 4NO3A 4EKXA 1KIUA 2H8PA 3OXSA 5EC2B 3RFZC 3C6LA 3VI4E 4X6EA 1HKFA 1BVZA 2ZUSA 1C8PA 1T66D 1BIIA 4MNQD 2HFFB 4LVNC 1MUJB 2UWEA 1PJ9A 4X6CA 4WHCA 3HAEB 4RWYH 5KBNC 3WCYA 5DJYA 2D9QB 4TQEL 3QXAB 2H2SC 3NPZB 4KROD 3OWEA 1MF2L 4XPHH 2QSQA 4UT7H 1U91A 4LCWE 3AREC 4XCEA 4ZS6D 3TNNB 3HG1A 3T0EA 3C9NA 2DLTA 2RQ8A 1CD1B 4CVZA 4Y5VB 3SE9L 3TO2B 3MOQA 5FYJU 1WEJL 4DQOL 1HNFA 1YEJL 1JPTH 3TVMC 1CTNA 3WXVL 3V52L 3FFCA 2CO7B 2PW1B 3LPGA 4JPIB 1B88A 3NPSB 1EUTA 1U3HA 2H26B 5EZOH 3VDAA 3KPPA 2ADFL 3W0WE 2F54A 5I1AA 3FFDB 1D5IH 1QVOA 3TH4T 2B0SL 1UB6A 2WUBL 4LGRB 1ACYL 3MRHB 2IADA 3C60D 4N0YL 1YNTB 3VG9C 3ALXA 3SGKA 5CSZA 4F57L 1EEYB 1U58B 1P84K 4BSJA 1A6TA 1OTUC 5C0GB 4G7VH 4PJHA 5F9OH 4NOBA 1A0QL 3DTXB 4PRDB 3QIBC 4WW2C 4RCAA 1SEBB 1E6OH 4JGUA 3FOLB 1QSFD 2J12B 5I8EA 2ZZUT 5DJDA 4X7CC 4CUCA 5I66B 1G7JA 5FHBL 4QTHB 1GVIA 3O4OB 4PG9B 2OJZL 4IMKA 2BMKA 3PGCB 3VXUA 4Z18A 2JF1A 5C0DB 3KLDA 3BWAB 4I9WD 5D7JD 3OGCA 3AC0A 3L3HA 5KVDH 4K3DL 5F7WC 3KYOB 2CUIA 3V79C 3UZVB 3ARDB 4GRWB 1CICB 1NCBL 3RY4A 3LRSA 3MRRA 1S7XA 5IM7A 2EC9T 5KVGL 1UH3A 5E6IB 5E8PA 1A3RL 3DUUB 3WD5H 4S10A 2FJGB 2J4WH 1I1AA 1EAJA 3V0WH 4M4PA 4KRPC 1LK3H 5CLTA 2HMID 2Y25A 5HGAB 4NQXB 4AH2A 1XF5A 5ID0B 2XT1B 1XF2A 3PGDA 4BFGA 1XMWA 4GRWF 1JRHL 2C7UA 3LEVH 4MJ5B 3IB4A 5CIPH 2X4QB 3DECA 1MNUH 3JWOC 3OBAA 1HHKA 1WT5C 1AKJD 3QRGH 4YXKL 3BSZH 2R39A 2D4FA 1T2QL 2EC9U 3TFKD 1ZT7B 1I7TB 3TZVD 4HQQH 4ISVB 4OGAD 1KIRB 2R69H 5H37G 2ICWJ 3U4BL 4PGJA 4XC3L 1DVFB 3W0WD 4M62H 2WBWB 5GS0D 1B0RA 1U8KA 3JUZA 1K5NB 2F19L 5I19H 3RUGA 5IEKB 2AI0H 4J12A 2BSRB 1YYML 1IILE 4P2OC 5GSRA 1B4RA 5MI0C 2Z31A 1RJLB 3EIFA 4Q97A 3ARGD 5E00B 2O61B 3V5DA 3GMLA 3DSFH 2J8OA 5I71B 3KWWA 3CDYA 1FV1B 4NHCL 4AIZA 5IEHB 4JREB 4OD3L 1EO7A 4LLDA 4RFNB 3BP5B 4EQ3A 3E3QE 3ZE2F 3HB3C 2H32H 2XXMB 2AABH 3UTSA 1EO5A 3TIEB 3C08H 4JRXE 2IALA 5L7XL 1JNHA 3ARBB 4OJFL 2MCPL 4TRPH 1I9JL 4HLZH 3N1PC 2OP4L 4WO4A 3JWDC 3EJYC 5GS1A 2F53E 3MNWA 4POUB 1P6AB 4WHYH 5F1IA 4ONGH 1X9QA 1HNGA 1S5HA 1KIQB 5DC4B 3B2UC 4L8CB 4U1LA 4ZDHA 5HYFA 5FUCE 4I4WA 5DMYA 4HEPG 3UO1L 3EHBD 4HFUL 1CQYA 5TGBA 2XN9A 3WIIH 2R29H 1XIWD 3WFHA 2XPGB 2MNUA 4WENB 2JJSA 4OQ1A 5DHXB 3F7VB 4YO0A 3MJ9H 5ENWA 5HI3D 3C60B 1NGWA 1RIHL 2Y6SC 2MHAA 2A6KA 2FX7H 5IFJA 4QCIB 3MR9A 4HW6A 1KJ2L 1KXQE 3D25B 2LQRA 4L8SC 3P9LB 4GMTH 1OQXA 2CKBB 4K94L 2XWTB 5FYJL 4NGHH 4M7ZC 1FFOA 3CZJA 4LMQI 3CX5J 3DIFB 1QSFB 5BRZE 3X11A 3IDNA 4HJ0C 1P2CA 5D2NC 2X1PA 1HSBB 5DRXA 3WXWL 4K9EL 4U6VL 3SCMD 2R0WH 3D2UD 3HMWH 2I60L 4H8WH 4Z7UA 3EZJB 3QDGE 4NM8L 1I4FB 3GB7A 5GS2D 5CLWA 2WBJC 2ZSVA 3D69B 5ELIA 2XFXA 5D7JB 4QRQB 5HHQA 1F90L 1UADC 5BW7C 2VAJA 3B43A 3N1GC 1IGYA 1T83C 4L4VE 4F7MB 2BCKB 4WWKD 3ARUA 5INCB 4GW1A 4HXBL 2I9TA 2EDTA 3RWJB 1MRDL 5EU3A 4E41D 5GRWA 2VAAA 3CFKA 4NZTH 1KACB 3KLSA 5E8EB 2VLKA 3VFRB 2H6PA 3QEHB 8FABA 1T20A 2VZOA 1AI1H 2CK0L 4BFEA 2VN7A 3VI4F 4LCWB 4X7TB 1CXKA 2NTSP 3BZ4A 5F3BA 4XP4L 3MA9H 4O02H 2FLRT 3VFWA 2H1PL 2NY3B 4JRXD 2VDQL 2CIKB 1NMBL 2N1KA 3S6CA 2JELH 3LS5H 4GXUM 5E2UL 1AKJB 5JMOC 3B9AA 2F53D 3KXFA 1OAZH 3PDOB 3QDHA 4B0MM 4Z7WE 4HGWB 4NKDA 4NNYA 1IGFL 1KENH 1EO8H 1Z2KA 3TZVB 5JNYA 4WHTA 4F15B 1ORSA 5IMOB 4KKAC 3FMGH 2ZOLA 5KSUA 5GRVL 3ULVH 5KJRL 3UBXG 4N8VB 2EIBA 3CDCA 2G5BA 1CFNB 5HYSA 4PJDB 4XWOC 1HHGB 2VUOA 4PLKC 3TO4A 2NYYD 1EBAA 3OPZH 1A7PL 5MERB 5CEXB 2Y07H 4OCLC 1ADQA 3ARGB 2GW5A 3WFBH 5L6YL 1D9KC 1F3JB 3AXLB 1GHFL 4M93B 1AGEA 5HI4C 3BDXA 5I76B 4Y2DA 4I2XE 1YUHA 3A0OA 5HYEA 4F7CB 2X40A 5F6IC 5KG9B 4MJIA 2BNQD 2VTFA 2QQLH 4O2EB 4PJ7E 4J3SA 4D9QD 3SOBL 1PQZB 3MLWL 3OKLB 2ESVE 4NKIL 5EU6D 4M6ML 2YZ1A 1PKQA 5JXEC 1F58H 3QUMH 1QSZA 1IGIL 1JPGA 4Y4FC 4AEHH 4L4VD 4TUKL 5BVJB 3R1GL 3C5ZC 3PWVA 4G6AC 4D9LH 1FH5H 3O9WA 1QFUH 3ZKNC 4HUNB 4CGTA 4PJAA 4ODUB 4GAJH 1FO0B 2GFBB 4JPVH 3TBTA 3L9RA 4OI9A 2D03L 3IKCB 2E9BA 4LHUB 5DUML 3PV7A 3HHRB 1G6RB 3BDYL 3DV6B 1J1PH 5FUOL 2ILLA 4ZD3H 1CLZH 1BFVH 2X1OA 3HZVA 4MA1B 2P24B 43C9B 3K8MA 1KFAH 3LZFH 3KPRD 5CCKH 4BQCA 4C83A 4DZ8A 1F4YL 5INDB 4ZPTA 3ARED 1X5GA 2X4TA 1K8DA 4X83A 3KJ6L 4E42A 4QXGH 1P4LA 1YEKH 3DPBA 2BXYA 3D2UB 3WFCH 3LQAL 1I8MA 4LRIC 2NLJB 4FFVC 2COQA 3MREA 4PY8J 3TVMD 4ZUWA 4J7RA 3G08B 4JQIL 1PD6A 1I3GH 4ZO7A 5JZ7C 2OQJA 2W0KA 3HRZB 1ZA3B 4QGTA 1VSCA 1KCLA 1BFOB 3BPNB 3HZKB 4JEGB 1CXIA 2R4SL 5KSVB 3ZZ1A 3GJFH 1HKLL 4IDJH 3U0WL 1HDMB 1IEBB 1BVKB 3SDXF 4RWHA 1IE5A 4CVUA 4MJ6B 2DQGH 2XKUA 5FV1L 4IRSD 4X6FA 3V6FA 5E1HB 1UVQB 3MFFB 5DUPH 1OTUD 1QRND 3T09A 2FX8L 3CUPA 1MCPL 1NUFA 2Q20A 4Y0GA 4RA0C 4CADA 4JY6B 3QIBD 4JRXB 1RIUH 1XF3B 1TZGH 1FAKT 2Y23A 5FGBA 2R2EA 4Q7DA 3MRKB 4M7KL 1PSKL 5K93A 4HS3A 2DM4A 3QZWB 1YJDC 1D5BA 3QXVA 3VWKB 1I1FB 4HWZA 5ABDE 2HRPL 2OL3H 4HCRH 4FQXB 4HWBH 1G6VK 4MD4B 1IC1A 1NGXB 4HK3J 4MA7H 3V6OC 4KRNA 4X7SH 4L9LB 5IMKB 4ZS7L 4F3FA 5HY9A 3STLB 1DQLH 4HKBA 1KC5H 2YA2A 3VE0A 1ZGLM 2D31B 1EHLH 3LPFA 4ODWB 4OGYH 3IJSA 1KUMA 4HC1L 4IRJA 1FYHB 3WFEL 4ELME 4JLRA 1UT9A 2P8MA 4ZFOL 1DCLA 1C16B 2B4CC 3AY4C 3PWUA 4CJ0A 4PLNC 5CFHA 5DQJA 1Q1JL 3IDJB 3T1WA 4H88L 4YHIA 3TH2T 2GJZA 3U46B 1JGLL 1HH6B 3E2HB 1OAYL 2DL2A 1OP3K 1RULH 3SBWC 4KRPD 1DL7H 1MELA 3V4UL 3CH1B 3QBTB 2A83B 3Q2CA 1TJGH 2J88L 1F4XL 5C0FB 5BRZB 1LO4L 5BZWA 3IDGB 1UB5B 4R4BA 2FD6H 1DBAH 3ALPA 1J8HE 3NCYS 4P3CL 3QDGB 5D2NE 2HKFL 4AT6B 3MRJA 4R3SB 3NFPA 1ZVSA 2D7MA 3MODH 5DJ2B 3MXWL 1JTPA 3RWGA 2E27H 4L4VB 4RAUA 2J8UF 3EW3B 5LCVH 4U1SB 3DV4B 2X9XA 1D5MA 2EE6A 2HG5B 3T1FB 3QJFA 5J1AA 3DX6B 2A1WL 1JK8B 1FG2B 3IJYB 1IC7L 4LVNB 1V7MH 4LASL 4G8GE 1T1WB 1ZHNA 4PJGE 2BNRE 5AWNH 5EC2A 5EU5B 4M8VA 1S7SB 2X1XR 2CLZB 3LKRB 2N56A 4JPWH 1ZA6B 1RZKL 4IBLT 2EE2A 3AREB 1U2HA 1JGUH 5D5ME 5F9DC 1A21A 1OF2B 5C0IA 2HFFA 5BOPA 5CZXC 4WFEE 5JPNB 1HOCB 3HMXL 3QEQA 3PWLB 4DN3H 1MUJA 3QIUC 3QUYD 2Z8WC 4XVJL 1I7UB 3HAEA 5CP3A 4Z7WB 1YJDH 4EDXB 1AP2B 4MDJB 3EJYD 1JE6A 3QXAA 2DKMA 2FYYB 4XVTH 5FHAL 1S8DA 1Y18B 4LSPH 4YE4L 4CBPA 4U1MB 4HZAA 1GC1C 4O58H 3P11H 3TNNA 1U3YA 3B2UD 2GIYA 4YXLH 4XI5D 5KANG 4JFZL 4YK4B 5MP6H 2APXA 4NWTL 1TTGA 5LWYH 2A9NH 2FECL 3OXRB 3GO1H 4LMQE 3VDBA 4OF7A 2Q8AH 3U4EB 2CO6B 2PW1A 5MEQB 2Y6SD 3VG9B 4WTZG 5C09E 4I2XB 2P49B 3IFLL 1NSNH 1AD9B 4KKLC 1HHJA 2H26A 3QG7H 1RHHA 2BC4A 3QIBB 4WW2B 1WBZB 4UV4H 1KCRL 1RMFH 3FFDA 1WWAX 4KK9D 4PJ7B 4LP4A 5DS8B 3AMLA 3G6DH 3UJJL 3SQBA 2F5BH 5E2TL 4KK8C 1E4JA 2YPVL 4HJ0D 3MRHA 2ESVB 4LSTL 1YNTA 2DLIA 3SQOH 3VD4A 4KVNH 4MQXC 1EEYA 1U58A 1H3PH 4HUXB 2NXYC 5F9AC 5KAQG 5C0GA 2WBJD 1PLGL 2NQCA 3DTXA 3ZL4L 5IFAH 3AM8A 4U6HB 4LLYB 5TE4L 2PTTB 4DK6A 4A2MA 3QNXB 4G80B 4PJEF 3GSVB 1UKSA 1S78D 2E8ZA 3FOLA 3LSOA 5E7FA 4PJ7F 4CDGC 2OJEB 5I66A 5DURD 1JN6A 5DK0A 4Z7OE 3U48A 1QKZL 2GT9A 3W9DB 5A16B 5LXGH 3PGCA 32C2B 5F96H 5C0DA 4AQ1B 4N0FA 1JNJA 1ZS8B 5EOQH 1V8HA 3BWAA 4IS6B 4F58H 2W92A 2Q1EA 1YYLH 3KYOA 1KB5H 4JQVC 3SKJL 3WNMA 1AQKL 3ARDA 5JW3H 2GTZB 1W8NA 1CDUA 1X5AA 3S4SA 4J6RL 3DUUA 3CVHB 3RY5A 2FJGA 2DQHL 4H1LB 3F65A 3VRLE 3NCEB 4UNTA 2BVOB 2AQ1A 1FLRH 4LLWA 4NQXA 1T1ZB 4KJWC 5ID0A 4KDTC 4JRYE 1IGMH 1A7OH 4H0HB 3BH8A 4KKAD 5EO1A 3SKOB 2EDBA 4FF