4PGEA

Mhc class i in complex with modified sendai virus nucleoprotein peptide fapgnypaw
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pgeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4pgeA01
4WDIA 1DL7L 3I3EA 5EO0B 2AEWA 1ZT4B 3LKRA 4OLZL 3JXAA 5DRXA 3ZYZA 1DQTA 4GG6A 5FYLL 1SEQL 4PJXE 2I25N 3JTSB 3MGTA 1FZMA 1UZ6F 2D7MA 3DHJA 5IUSA 1R3HA 2FZ3A 3FFCA 4HWUA 1WTLA 1TTUA 4KGLA 5DD5H 1NDGA 4ZAKC 4NM4L 4HG4K 5HYEA 3KNBB 3KGRA 4KQ4H 4OGZA 5FDYA 1NCNA 5HVGB 3UBXI 2ICEA 4GW4A 4R0LC 3K4ZA 4Y5XC 4XNXL 1Q9LA 2R1XB 2XTJE 4LLUB 2N1KA 2VLLB 2NY1B 3AMKA 4CRPA 5A1AA 1EFXD 4LLMB 3GM0A 1EHLL 3OHXA 4KGJA 4DGYH 3QWQB 5SWZA 3SE8H 1ZHLA 2WLZA 4ERSL 2CDGB 1JWUB 2HJKB 3INUL 4OD2B 1LE9A 4TPRL 3DXAE 1WUNT 5LAXB 4N1CA 5F7DB 3KPSB 4ESKA 1A1MB 4KDTA 1KTKE 2XKUA 3GSOB 2ADJB 3MUGA 1ACYL 2Y23A 4JFPB 1N5YL 1CK0H 2GSGB 2C3VA 4ORGA 5DUBB 3ISWA 1MQKL 5DD1L 2YD6A 4P46C 3QQ4B 3N85H 2YWYA 4L9LB 1LVEA 1FNGB 5IVXE 4C4KT 1ITCA 5E9DE 4J3WA 4WW2A 2D0FA 4J4PC 2VQTA 3NOIA 4JREC 2EDKA 4G42B 3DYPA 4P57A 2CUHA 3RL1A 4OKVA 1F4WL 3O2VH 4NC2B 3S4SA 3MR9B 3LOWA 1R5VA 2DQJH 4ZD3H 1KCLA 1N8ZA 4Y5VA 2VZOA 3GMOB 5A2KH 1OTUC 1SJEA 4HLZG 4HIHB 4NJAL 4YLQT 5CZXC 4LCYB 4UOW1 4NKIH 4Z77A 1T0MA 5DMGD 1G0DA 1K2DA 4XBPB 3U7YL 4ODXB 2QQKH 1Q0XH 3UZVB 1IGCL 1BEYH 1A02N 4X6CB 1X4YA 5D7LB 1G7LB 5JMOC 4OB5H 5DHVB 5GGUA 1CXHA 3W11C 3T1FA 3SHSA 2W65B 2XN9A 4ZUSA 1XGYH 4AH2B 5EA0L 3FQTB 4R4FL 5DVMA 5KZCB 3JWDH 2R69H 5HHPA 1M4KA 3ZT6A 4HJGB 1OAZH 3QR2A 1JPSL 3GFUA 4NN7B 5E00A 3O4LE 1ZK9A 1FVDA 5C9KA 2X42A 3CLFH 1SYVB 1A5FL 2FO4A 4DCQA 2JJSC 1SY6A 1YEFH 3I02A 4R2GC 4NDMA 4JG1H 1WK0A 1CD9B 3FJTA 5A16B 5E8OB 1YY9C 3FAWA 4TUOB 3BQUD 5KSAC 5CBAB 2HFFB 3BP5A 3H9YA 3QUYD 1F45A 4N8PA 2VZSA 4UTAL 4L8CB 3MRCB 2XRAH 5JQHC 2Z31D 1XGRB 5DMIH 1IBGH 1HE7A 2YZ8A 3BWAA 2R2CA 5EZIL 1NCDH 5F1NA 4PB9H 4IIQA 3H8NA 5K9OB 2NTSP 4GOSA 3MLXH 1EAJA 2R2BB 1U3JA 1U2HA 4NZTL 4TNVK 3VFGH 1L4IA 1QRKA 3B6SB 3DYMA 3RGVA 3WHXB 3HFML 4LVOC 3U36A 5IB4A 3HNTH 1IL1A 4J1UB 1VEMA 3T0ED 1RZKH 4JZOA 4GW5B 4MA7H 1RIUL 2XTLA 4KUZH 1NCCL 4EDWH 4MLIA 2DTMH 4S1RH 4DUXA 4S2SA 1DQQB 4G8IB 4YUEL 5TF1H 5BMFL 4FQCH 4LSUL 1FZKB 2CJUH 5BZWB 1VFOA 2PO6A 2ADGB 4K23H 3D1MC 2EXYD 2A38A 4KI1A 4F57L 1QLRB 1K4DB 4KI5E 1GGCH 2Q86A 3OJ2C 5JDJA 4YHZL 4PJBF 4OCMC 4F7MB 3GMQA 4ZSOA 3QHTC 1E28A 3MBEC 7FABH 1Z0MA 3HZVB 2AKRA 1WZ1L 3BVNB 3L5XL 1QPXA 2BY0A 2NY4D 2IADA 1QG3A 2AERT 1RZFH 2AI0L 1YA5A 4IRSB 4Q58C 5I1GL 1XF3B 2DYPD 1A64A 4HXAL 4GG6F 1GAFL 1KJ3L 5DK0B 1J87A 3DNKA 1HKFA 2VAAA 4QHNA 5ISZA 3EJJX 1TFHA 5J1SC 1YUHB 1YEGH 1S5IH 1WEJH 5HHNB 2IAMA 3I6LD 3P0GB 2GCYB 2Q7YA 1CE6B 1S7WB 1E6JL 5F7EH 1PKQA 2BVUA 3W2DL 1U58A 2DLFH 3C5ZB 5HJ3A 3QIUA 2IFFL 3VGEA 1KLUA 4MNHB 5T3XD 1Y18A 1FH5H 1VPOH 2GIYA 3OWEA 4CADB 4XPAH 2F5BH 2NNAA 1OGTB 3HRZB 5IB1A 1J8HB 4YBQC 4PTUA 3ARFD 1FN4B 3B9DA 1YQ2A 3V5DA 1UZ8A 5DRWA 4RGMB 2BHYA 1UJTA 1FC2D 4WUUA 4LBEB 1HINH 4MNGE 2LABA 1KCKA 2IPTL 4NQVB 3QXWA 1L0XA 3T08A 3RY5A 1OAUH 1UM6L 4NT6A 1T21B 1WCBA 4RAVB 5JA9A 4YDLB 1P7QB 1UB6B 4X6DF 1MCEA 4WRLA 2FL5A 3J8F7 2B0SL 5A3IC 5E0QA 5BRZA 5H8DA 3TBWA 5EO1B 2BJMH 2HFTA 1F13A 1YMHA 5ICYB 4X7TA 4E9LA 5EBLB 1S7QA 5DJXB 1B90A 2FNBA 4KMQA 4WW2F 1ACZA 2A74A 1HHGA 4YC2B 4POUB 4LPUA 4NHCH 4X80H 1N4XH 3FQWB 3PWPD 4LCWB 3W5NA 4HCRH 2R39A 3BPNC 4R4BB 4S1DD 4XVTH 4RZCB 4U0RB 4G6AD 2P5WD 3QFJA 3MYJA 3BZDA 4OF7A 1VA9A 4JFQB 5DGRA 3LAFA 3LQAL 3SE4A 4F7PB 3H9SB 4GRLC 3VXQB 5JW3H 3WEXB 3RGHA 5GIRB 2CRMA 2UUDK 2R8SL 4K07A 4XP6H 5H2BA 3QNXA 2A6JB 3MRNB 2L4OA 4U05A 1GC1L 5DRNB 1KBGL 1FNEA 3LN9A 3C08H 3TT1L 3OXRA 4E42A 2PW2A 3BPCA 3QXTA 4H25B 1S7RA 1W0YT 3ZL4H 5INDA 5HYSB 4N8CL 4WFGD 1Q38A 4RIRA 4P9HL 1HHHA 3G5YA 4HQQH 1LK3L 1A3RL 2BNUA 1LK2A 1VCAA 4LIQE 3MNWB 1LWRA 1Q9WB 4M62L 4F7TB 4XWGL 2Y7QA 3HNVL 4H20L 2BVPB 2DWDA 4NWTL 5KSUA 3MV11 4L3ED 1LP9B 4OCXH 4HIIB 5CJQL 2VSDA 1P7HL 4QXUL 4H88L 4LGRB 4LF3B 2AEQL 4LVHC 1DQLH 1JE6A 3PHOA 5GGTA 2R29L 1C08A 3U0WH 1KJ2B 1T0NB 3G5VB 4ISVB 4R7NA 3LB6D 4EJ1C 3CCHB 1OT1A 2BOCA 2V7NA 3RWIB 4BK5A 5CEXA 1EFXA 2Z93A 1AE6L 4BK4A 4XCCH 2AABL 5D9SB 2A9NH 4KJPD 4LKCB 4XVSL 1MIMH 3ULVL 4LSQL 5HI3D 3C6SB 1F6FB 5E56A 3BPLC 4HBQA 3X3FH 4QY8A 1BFSA 2RQ8A 3MA9L 1X5ZA 2DL9A 3QO1B 4HK0A 5D6CB 3CXDH 4JFDD 2XNAA 3RZCB 5L6YL 2P47B 5IHZB 1CU4H 1YY8B 5GJTL 4UQ3B 1TETH 1UG9A 3QQ3B 1JPFA 1ZLWH 2EYRB 4XNYH 1SEQH 1PW3A 3IDMA 5C86A 2A6KA 4XAWL 1E4JA 2CSPA 4PDCE 2O26U 3QAZC 4JEGB 1V05A 4OM1L 4M48L 3QSKB 3REVA 1H3UA 2R1XA 2PXYB 2VLLA 2AV7B 2CUIA 1CR9H 1NGXB 5B8CB 3QQ9C 1F4HA 3O41B 1OY3B 3IAPA 2FX7L 2Q3AA 5DRZA 4L29A 3KLDA 1HXYB 3TBYA 5B38B 2JIXB 5ERWB 4ONGL 4WVRA 4O02L 2NLJA 4QXGH 5F7DA 3NA9H 4QHMB 1XGQB 3MXWH 4Q9RL 2VDQH 3QUZD 1XF2A 3HMXA 4TPRH 5E8NA 4JRYD 1H0DB 3I9GL 3QQ4A 4NRZA 2B5IC 2AK1H 5AUMA 2IPUK 4I5BB 3HMXL 2JJTC 1MFBL 3W0WE 1QVOB 1QSFA 1WSST 4JKPL 3WD5L 1A14L 4XBGB 2CIKB 4FABL 3JSSA 4Y16C 4TSBL 2ZPKL 3IETA 4GXVH 4G42A 3HAEG 4AIZB 2BSTB 1BBJA 4Z7UB 4MLSA 5FYJE 5IQ9B 5AD0A 3MR9A 2EEAA 2UY7A 1JUFB 2G60H 1C8PA 5KS9E 3ZKNC 3D85D 4CNIB 5ID0A 1F4YL 1F4WH 5HDQL 5MEPB 1LO0H 4I3RL 5E08L 3P9LA 3WIHA 3S8WA 4ZOAA 4V3DB 3OAYK 5EIIB 5KVMC 1UZ6E 3V8CA 3H2WA 4OLXL 3QUYA 1T1YA 3EGSB 3EKCA 4WWKD 5D2NC 5I1KL 1R5WB 4FQ2L 1J18A 2F53E 4ZPVB 2NTFA 4BKLB 3L3IA 3EW3B 4XPFH 4OCYH 3FQRB 5DHVA 3MJ7B 1Y6MR 2HT2D 2QQNL 2Z31A 5LBSL 3ZYJA 3HUJB 2W91A 3QIBC 1PQZB 1A2YA 1XGUB 2FYYA 4JDTH 3RBSA 4HUWB 4HJJL 1MJ7L 5CSBA 3VG0L 4I0PC 4LPYA 3FQUA 3X12B 1P84J 4YX2H 5T1KD 4P23C 2BZDA 3MRGA 1JPSH 2GFBA 1GRWA 2PTTB 3LDBC 3NIGF 1S5HB 2V9TA 4HSQA 2B2XL 3OKOA 4AY0A 3Q48A 3E2HB 3DGCR 2Q87A 1KT2A 4P5TD 4Y8AA 2C1OB 2IMNA 4LCCB 3S36H 3V9FA 1U8MA 3SO5A 3K3QA 5D93C 5ITBL 4Z7WA 1SY6H 1QHOA 2R4SL 1XGRA 2W9LA 2FD6H 1RIVH 4MAYD 2GYSA 2Z35A 4FQXC 4H8WL 2DYPA 5ICXB 4GUPB 1OM3L 4U6XA 5F1KC 3ARBD 1B0RA 5D1QB 2A83B 4NM8L 1AR1D 1M7IB 1MCQA 4M02A 3WDIA 3KLSA 2QHRH 3PWLA 3DRTA 3GSXB 5IG7B 4OM0L 1WAAA 1U8OA 3L3OB 4YHIA 5BZWA 3MFGB 2ADGA 3QULB 1XCTB 1ZVSB 3MLSH 2E9WA 4YIQB 3ULVF 4MS8C 2VLJE 3PIQB 4AM0B 4FQLL 3PF2A 1CGSL 3X11A 3O6FC 2W0FB 4WHYG 2BVQB 4QO1A 4WGWB 1ZWIA 1MCOL 5IEKB 4M9OA 5IJKA 4N5EC 1OP5K 4K55A 1OSPL 4I0CC 1WZ1H 3GIVB 4ZFZB 2QQLL 3MOBL 5DSCA 2AI0H 5BOZG 3QJHA 5DD6A 4LHUG 4IOIA 4R97C 4GXUM 4NPYB 1DBML 4IMKC 5IMKB 1MCLA 3K2MC 1RAMA 3VWKD 5LXGL 1GPOL 2W1NA 2DLTA 3L9RA 5C6PB 4GMSH 1CE6A 1GL4B 4JDZB 3VWJD 5J06A 4EQ2A 3SOBH 1FAIH 2FB4H 3WFCL 2ITCA 3WO4C 3DPBA 5DR5L 3UMTA 1BZQK 3LKNA 3WLWC 4KKCD 4OGYL 4XH2B 4C56A 3CX5K 5CJOH 1WWCA 3U0PB 4LMQE 4PGBB 3HRZA 2D7NA 3PWPA 4TTDC 3OR6B 4A6YB 5FGBA 3BI9X 2IFFH 2H3NA 4M6OL 4EUPG 4LDOB 2PR4L 3RFZC 1VGEH 1FN4A 3TBSB 1YQVL 2CRZA 4LBEA 3VGFA 4QOKA 3KXFB 4NQXB 4F7CB 3I6GB 3WHE0 1KEGL 1ED3B 1KN2H 1URLA 5KVGL 3JV5A 4UB0H 2E7LA 4JGUA 3U83A 4XNMA 3U9PH 1MY7A 2IPTH 4J2XA 4RAHA 1LO5B 4L1DA 1UM6H 12E8L 3D0LA 3DO7A 5F8RC 1G7JA 1AD0A 3CSYB 3LH2L 3NZHL 5ICYA 2YRPA 4KMLB 2B0SH 3EO9H 1PY4A 3RKDD 3IJSB 5C0ND 4MQXC 5CZVL 3SJVD 1KPUA 3VE0A 4WV1A 3P73A 5T1LD 5E2VL 2E6JA 3MLRH 3MJ6A 1R5IA 3KHOA 1C1EL 3VXOB 3MRDA 1JPST 1YN6B 5D1XB 4C54A 2VLRA 3K4AA 4LSDA 5FYLE 5BV7H 2DBLH 3CZJA 2W0LA 4JM2C 4K7PH 2AJXH 1R24A 4JFQA 4JFFE 1CGTA 4QRQB 3H9SA 4KJWD 4BSWA 1B6DA 3B9VA 2AQ2A 2JCCE 3GI8H 3MO1B 1I3GL 2E9IA 4ODTH 5SX5K 4ZFFA 4NO5B 1RIHL 4UBDD 4U1KA 1JGEA 1AFVH 1BM3L 3RU8H 1B4RA 1QO3B 3JWOL 2Z8WC 5FO9A 4JKMA 1GSMA 2JELL 1JGVH 5FO8B 2BX5A 3MUY1 4R90L 4H25A 4IJ3B 1VEPA 5EBGA 4GRWF 4PJ9B 2ZSWB 5EU6A 1VDGA 5JDSA 2EZ0D 2JB5H 4JFFD 3LRSA 3HE7C 3JWDC 5SWZE 4GKNB 4DFIA 3TFKC 5IMLB 4PREA 2Z4QA 2H8PB 4FXKA 4LCIL 5IB5A 4N8CH 2HRLA 2PNDA 4Q6YA 4S10A 3GSWA 4Y1AB 4JFDA 4XAKE 1M71B 3QXDB 5EC2A 3DARA 5MEND 2HYMA 1A3RH 4X6DE 3V5KB 1OWRM 4KROC 4H20H 5JORB 4EVNB 5CD3B 3MRFB 5E2UL 1E6OL 2UVEA 1OQOA 4OSUL 1KJ2A 4ISVA 4X0KA 4ODUA 4WO4C 3TP4A 4GAYB 3WS6C 4Z7WF 1CGXA 3RWIA 5LG1A 1KJ2L 3MV01 1IM9D 2F54E 4JKWA 1R3JB 3ZHKA 2FR4B 5D71L 1WTGT 4J7RA 2BY2A 3TJEH 3IS1X 3O9WD 2ZG3A 2IQAB 5F3HB 5BVJA 4NJ9L 2WP3O 5CBEB 1AH1A 5GGTH 1F3DJ 4DJMA 5ALBH 3PGDB 5F9OH 1AE6H 1JF1A 4M8VA 3UBXA 2IWGA 4UIMA 5C0BB 5L2JA 1VSCA 3G9AB 3HNSL 3L95A 2OBGA 1IRAY 3O2WL 3ULVH 4URTB 4ODVH 4AYFA 4LSQH 2KKQA 2QHLA 1UEMA 3RZCA 4NFBA 1RZKC 2MTPA 5FGSA 5JR1L 1WAAF 3MA9H 5I8OH 1F4XH 3HC3L 4FQIH 4M5ZH 5KTEL 4XVJL 4OZIB 5GRJL 4OIIL 5HYQB 2VKWA 3CNKA 3LEXA 1KTDB 2D4FA 3T4AA 4MZ2A 4XCYA 3PQYB 4PJGE 4LSVH 1BD2B 4K7PX 4XAWH 1G6RH 5B8CA 3EHBC 4KMTL 3O8XD 2XWTB 1IVLA 4N8VB 3QEQD 5LGHL 5EZJB 3G5ZB 2ZKHH 5L0QB 3RDTD 5B38A 5ERWA 3P9WB 3AS1A 4G80A 3CVIH 1ZT1A 4M3JA 1TVBB 4NKDA 1A8JH 2E3VA 4ZUUB 4EBQL 4WWKA 1SJHA 4X99A 1EEZB 4QXTA 4GXUN 4O02H 3QIWB 3PWUB 3BGMA 5MI0C 2M8XA 4LLDB 1H0DA 4HT1L 5SWSD 3VI3F 2I9LB 4JZNA 3UTQB 4JB9H 5CIPA 4PG2A 4M7KL 15C8L 5B3NA 4Q74A 3H0TA 3O2DA 4PRHD 5D1ZD 4FXGA 5I1HH 2VL4A 4WI7A 5IFAL 1TQCC 3I9GH 3BRFA 2AJUL 3CMGA 4G7VH 3BKML 4X7SH 5J12B 3O2DL 3PV6A 4XWOC 1CL7I 4AIZA 4Z7UA 1OQXA 3B2VL 1MEXH 4KPHL 2UZIL 1FNSH 2H1PL 4FABH 2IGFH 4TSBH 2YN3A 1FFOA 1S7VB 3LPWA 2D7TL 3RPIA 5MEPA 3L7FB 4KK6C 5JO5B 2VN7A 4ZYKA 3PXJA 4YHYB 3BP4B 3U6RB 3DWTA 1JZ8A 4AEHH 1RHHA 5F89B 4NNPL 3FRPG 3MSPA 5HDQH 5E7BA 4P5TA 3MUJA 8CGTA 1E0OB 5JLZB 5AZEL 4BKLA 1A3LL 4KKLC 3X3GH 3FN9A 4OLXH 3A0OA 5I1KH 2FX8L 3SO3B 3WIHH 3ZYOA 3SKJH 1FYTD 4HC1A 5L9DH 1RU9H 3EJYC 1NGZB 1Z3GH 4DZBA 4HS8L 5FYKL 3ARBA 2BHZA 4YQXL 1NJ9A 4R8WL 3DMMC 3QDJB 4HC1L 4GW1B 1HSAA 2YZ1A 1XCQB 3QDGD 3V6ZA 1CXIA 3RX8A 4FQJL 1FZOB 4I3SL 5GS0L 3RP1A 4GRWH 3GMNA 5D70H 4NZUH 5HVWA 6CGTA 1LEGA 3HB3D 5JNYB 4Q6IC 4DVRL 1PKQE 4FNLH 3SPVA 3BH9A 3MRIB 1L0QA 1U8NA 4JQVA 3MNVB 3PL6C 3SGEI 3S6CA 2XG5A 3RA7L 2QSVA 5EORH 2WBJC 4KWUA 4JFED 5GS3A 2AJSL 3L3HB 3N9GL 3GSVA 2VLKB 1AHWC 3BDBA 4Y4HC 4AQ1B 3SCMC 2O61B 2MKWA 2DOCA 4H26A 1F3JA 5C0RL 3RWJB 2HT4C 3F5WA 1A6TA 1MRDL 5D1QA 1RJYB 2A83A 2MCPH 1OAQH 1RUML 1W8NA 5BRZE 3HS0B 1NFIA 2ERJC 4OQ1A 5EO9A 1NANI 5IG7A 4UIKL 1ZXQA 2BNQB 3QULA 1ZVSA 3WFEH 3UTTD 3ZHLA 4LU5L 3JVGC 4PBVC 3DIFA 1MI5D 3BP6B 2SEBB 4C83A 5I76B 4XBEH 1J5OL 2DBJA 3PNWA 5E1AA 2W0FA 3QDMA 3RUGA 1EPFA 4LVEA 2XV6B 4G59A 3IDYC 4FQLH 1I7UA 5T3XH 4KTEL 5ANMB 4DOHB 3RKPA 3GIZH 1GZPA 2P45B 2APTA 3GIVA 3NFPB 2LAAA 1QLFA 3FQXB 5JQ6H 2VZTA 4HPYH 5DJ6A 3F12A 3LEVH 1AY1H 4FFVD 3NIGE 1CYGA 1IC1A 4IEFB 3MOBH 2A77L 2X44D 3ETBF 2HRPL 4YAQB 3AVEA 1PZUB 4NQEB 1QEWA 1DN0A 5KVDH 2P24B 2VABB 2NXYC 4OLVH 1HN1A 3RWGB 2X9YA 5B39G 3CXHJ 5DMKA 3U0PA 2GY7B 4X4XB 1JN6A 4GQ9H 4E5XB 3W39B 3C6LC 1XGPA 3TBSA 1T1ZA 1GXEA 5EUKA 1F3RB 2YN5A 4CVXA 4A6YL 5FA4A 9CGTA 4E41B 2WANA 3NN8A 2WMPA 3GSRB 4JZJB 3QWRD 4OLWL 2OI9B 4X7CC 3IFNL 4P3DA 1ZHBB 4BFIA 5IT2L 1FL5B 4MYWB 4M6AA 4PJ7B 2X9XA 2IBZY 4P2QB 2AK4D 3U2SB 1D5XA 1IQDB 1FIGH 3OL2A 1RFDH 2IC2A 3ULVE 2D0HA 5GGSA 2X7LB 3WCYA 3NZHH 3LKOA 4JY4B 4GMTH 4Z7UF 1MFAL 2MJWA 4LPTA 5KSVB 5IW6A 4S1QL 1ZMYA 5D1XA 4OCRL 4FZ8L 1KPRB 4RGNC 4HJ0D 2D7PA 2C1PB 2X4RA 5D96C 4D0CA 2E6QA 3MCKB 5MENA 5EU7E 3QXAB 3ALPA 1W0VB 3GO1H 4MCZA 5GISL 3OX8A 1HXMA 3IRPX 1KENL 4KRPD 4PRIA 3HE6D 2CH8A 1QQDB 4RAUB 3S34L 1KGCE 3TBVB 1T1XA 5I2IA 1VFAB 3VFSA 4PGEA 2PW1B 4HWBA 1A9EA 4CVUA 1H3VA 1YN7A 2R0KL 2EKSB 4F15C 2CDEB 4O9HH 4L8BB 4XCEA 1IM9A 4YWGH 4WTWA 4HWBL 3JUYA 5FO8A 3O9WA 3UPRA 1BM3H 4Y5VC 3JWOH 1I8KA 3BUTA 2CDFB 1K5NB 5IMMA 4JQIL 4LLVA 5HGAA 2NY3B 3FO9A 3AS0A 3QQNA 4N90E 3LMJH 4R90H 4W68A 5DLML 2H8PA 4P2OB 2NW2B 2ZJSL 3GM8A 4YO0A 5HHXL 1UXWB 2ICWI 5D7JB 1XF4B 3NACH 4O58H 3EYSL 3KPSE 2VZUA 1JTOA 4YJZL 5HGDA 5F9JB 5LWYL 1X5GA 3Q6GL 1X4ZA 1JV5B 4RDQG 4R6UA 4WUKH 3WFDL 4EVNA 2OL3A 2R56L 3TA3C 3MRFA 5A43C 1J12A 4FP8H 4G6FD 1JWSB 4JRXD 4XP5H 3O3UN 3HZKB 5DEGA 3TH2T 2IBGA 5TGBB 1QSFE 5D6DA 2DQHL 1E6OH 2G5BA 5ACLA 1ZS8A 3FL7A 2YPKA 2IQAA 4RQQA 5F3HA 3ZT5A 1JPGA 1YPZA 4Z0BH 3QEQA 3MLYL 3TF7C 4WTXA 2X89D 3RDTA 1X9QA 3T65B 1R3KA 4G6KL 4MD5A 2ZWLT 2M2DA 5I6XC 1BZ9A 5B3JF 3VXMD 5J7CC 4JCMA 1R0AL 4NC1E 1EXUB 5CKGA 2BNRA 4NYLA 2J8UA 1WT5A 1LNUA 5SWSA 1QFHA 3QEUB 4KDWA 3L3DA 3E3QA 1XIWA 4PP2A 4HKJB 5I1IL 1F42A 5CJ8A 5D7LE 1IGYA 4PRHA 1NLBH 1T5WB 4M43L 1I7TB 2EH8H 3RVWD 1FP5A 1ZHKB 3RUGF 1WFTA 1DFBL 1UB5B 4W6WB 2VXSL 4P59L 2W59A 2VDPL 5AAMA 5DEFB 4PJFB 5T5FH 1I4FB 3MZGB 1IKNA 5CJBA 1H9VA 1KELH 2XWTA 4K3GA 3S37H 4TSCL 1TVHA 2BSRB 3P9MB 1C12B 4J6RL 4HIEB 2AVGA 4XHJC 5TE4L 5CSZA 1YJDL 1RZ7L 3G6DL 1JK8B 5DD3H 4U1MA 2KBGA 4WEMB 4ZS7L 4CU6A 4WFFD 1ZLUH 1NCBL 4K71B 1KN4H 4LLDA 1YNKH 2R15A 2X5PA 3RPKA 1H5BC 3LZFH 4P2RB 5IIEB 2CK0H 2FH6A 3GZKA 4Z7WE 5HY9A 1J0HA 3Q5TA 1FFRA 3TNMA 1FYTA 3TC9A 2M1KA 3MPCA 4HXBH 4I2XB 2R23B 4PY7B 3VXUD 3C60B 3BHBA 4YXKH 4G8GB 2GQHA 4JO1H 1WBXA 5C7XL 4UQ2B 3SDCC 2AJUH 5F88A 1QRNA 3U4BL 1K85A 1QFPA 4RMVA 4BZ2L 3QIUC 5DJCA 1QD0A 4LCUB 1FIEA 5A2JH 3SDXB 3F58L 3L7FA 3RTQB 5JO5A 3VXRB 5H35A 3BP4A 5C0EB 2DWEA 3MRKA 4P4KC 1WAAE 3BDYH 5F89A 3N50A 5E7FA 3QXUA 4OV5A 2ENYA 2Y5EA 1P4LA 2E7CA 3STZB 1NQBA 4JFEA 4LSRH 5F44A 1WZLA 1GVIA 4NNPH 1FG9C 4MJIB 1KCUH 4GLRI 3P30L 5HVHC 1MFEL 4CW1B 1FG2A 5DC4B 5AZEH 3CFIC 1X7QB 3T09A 3HCVA 2YMXH 5LQBL 2ZOKB 3WN5B 2MOVA 4TVPD 2DQUL 4OFYD 1HYSD 4YHPB 3HAEB 2V7HB 5BV7C 1XCQA 3EDKA 3H7BB 4HS8H 5D7KD 2H2SC 1FZOA 4K94H 4L4VD 4F9LC 3CZFA 1BVZA 5IF0B 4R0LB 3TCLB 4HGWA 3CMOH 4HK3N 4AENB 4Y5XB 5DHYA 3ZZ1A 5JNYA 3UTTA 1AC0A 2XQBH 1OF2A 2ADFH 5ETUB 3VI3E 5E1HB 2P8LB 2CRIA 4DKAA 1NUDA 1FSKC 4PJAB 4HW6A 4DVRH 4C56E 3KJ4C 2LAGB 4RX4D 4DKDC 2E27H 4ZQKA 4LPCA 2FGZA 3RA7H 4R4NC 5FM4A 3FT3A 2X4QB 3TO4B 4NN6B 4L3AA 4K3JL 2E7LE 3EFFB 4V1DB 2H6PB 2NY2C 1RJYA 2XXMB 2W38A 1CG9B 5TJWK 2ARJQ 1BAFL 3PABB 4YPJA 1UWGL 2XWJB 2P7TB 5DJ8B 4ZUVA 4MXQA 3TYGL 2WWMC 1QZ1A 4X5LA 1J8HD 4XB8A 1HNGA 1RUMH 3D39D 2EYTA 2VLMD 2YD1A 1JP5A 1BJ1J 1E4WL 1CWVA 4JG0L 2ITDA 5F3BA 5HSFA 3VJ6B 1NBQA 4XP1L 3I84A 4Y2DD 4HF5H 4KU1A 1DBKL 4OZGB 4L8DA 3DV6B 2Q8BL 3UC0H 1YPZF 4FFYL 4PGZA 4LCWE 3B8YA 1CGUA 2VDLL 4NQCB 5ACMA 3AB0C 1BHGA 2FRGP 5FO7B 1FVEA 2HA1A 4JFHE 3DVNA 3VFVB 3RZWA 1PG7L 1Z6JT 1D5MA 3EYFB 4X4ME 5E2TH 1AGEB 3OB0K 5ESQA 3H9SE 2BRQA 5H94A 2DMCA 1BZ7B 5F6HJ 1T7XA 5C1MB 2J8UF 1S78D 4X6BA 1MHCA 4XZUB 2G75A 3MV9B 4P46D 4QT5A 4NO0A 1WICA 4MJ5B 5GGQH 3WNKA 3V4UH 4NHUB 3F7YA 3TT3L 3MLUL 4M1DL 3S96A 4HFWA 2Q20A 4LCWD 5MEQB 3RJDA 1WC7B 1WBYA 3WNPA 4X9FA 4X4YB 3GHBL 2VDRH 3AM8C 1DQMH 5ID1A 2WINB 5EU6E 1R3IL 4PJDA 2B20A 3MOQA 4X4XA 1SM3L 1C5BH 4IOSD 5CHNB 3VXSD 1T03H 2WIIA 2EDOA 3MRPA 1RUPH 3ECBA 4JR9H 4DN4L 3R0MA 4R7DB 1ZVYA 4E41A 2IH1B 2JE8A 3ZDZF 3G9VA 3EYVB 1SEBB 3C5SA 4Y4KB 2OI9A 1ZLWK 2LVEA 4BQ6A 1MCSA 3VI4F 2YD8A 1YMMD 3BO8B 2YD4A 3QUMH 4LHUB 1YEHH 4GFTB 4OLWH 1UM4L 1YEEH 4AJ0A 1HILB 4RNRA 4NRYA 4RGOL 1O7SA 2QSQA 2AXGB 3QZWG 5L2KB 1LD9B 4OBSA 1V7ML 1FL6B 3QHZH 3E8UL 3DO3A 5IROA 1HI6A 5HPOA 4EKXA 5F97E 5DMGC 4U6YB 4HKZA 4ODSH 5KAQF 3UX9B 5HPMB 1U8QB 2YK1H 5EOCL 5KG9A 2A0LD 4EUPB 1S7TB 1UKSA 2C1PA 1U8JB 3VFUA 4GH7B 1OGAB 2N7AA 1JNHA 3QCUL 4JPIB 5KSAD 3QCVH 2A73A 3ORJA 5I30L 1B0GB 4JRXA 3KAAA 2Z8SA 2ZNWA 4KTDL 5HHOD 5GISH 1KENH 1WLHA 1T2QH 3MBEB 5JHLL 4G5ZL 2PTVA 4YXLL 2ICWB 3R06A 5F21B 2E8YA 4WI5A 4WHDA 4Y19B 4D2NA 3BH8B 5IB3B 3CAFA 2GTWB 2B8OT 4UT6L 4Z78A 4N1EA 4RRPA 3KJ6L 3BQUC 1BQLL 3ALXA 1SYSB 3QEHA 4BUGA 4NQTA 1K3ZA 3VXMA 3B2UD 4BZ1L 4JQIH 4EOWL 4GKZB 4Z5RB 1EO8H 4AT6A 4XCNA 5D7JA 3FB7A 2Z31C 1DLFH 4UTBL 4PJCA 3OGCB 5DK2B 3BMWA 3TVMD 2OQJA 4LAQH 4WI9A 1NL0L 2PXYD 3WLBB 3EYSH 4P0DA 5MEOB 3UO1L 1EZVX 3WFBH 1IE5A 4L8SC 4B50A 4HAFA 2GAZA 1N3NA 5TGBA 3T0EC 5K9KB 2R56H 3PDDA 3HG1B 3FO0H 2HN7A 3TZVB 5L8LB 4AEIH 1U8LA 2XIDA 4F3FB 1J88A 2YPVL 5EWIL 5J56B 3WJLA 3BISA 4MX7B 2OL3H 5BS0D 4Z7UE 1ES0A 4JGJA 1FLRL 1HZHL 4PIRF 4PLOB 3S4SG 5FUZL 3TYFB 5J0BA 3NCYP 4KHXH 3S97C 5JOFA 4HGMA 4YEFA 1YNLH 2P8MA 1FNHA 1U92A 5GGVY 1S7SB 4Z7NE 2VL5B 1UQSA 3AROA 2NY4C 4OUUB 5F7FA 4MVBA 5BJTA 3D3VA 1D5IL 3HUJE 5IJVA 3O6KH 3BPNB 4MAUL 4MSWB 5EUOA 4NNYA 3AY4A 5C0AD 1WF5A 1ZHKA 1HDMA 3PJSA 4LNRA 5FYKE 1MCBA 8FABA 4XRCA 4PJFA 4GKSB 2F74A 2VE6A 1U6AH 3SDAD 3KPMA 4ODWA 1PJ9A 3ARGD 4TVSa 5FUCE 3TPUA 4H0GA 1HHIB 4X5WB 5FF6B 3ZKQD 3QRGL 4YDJA 2BSRA 4P9MH 5DURB 4U1IA 1S9YB 3DX7B 3MRJB 4HIEA 4DW2H 3P4MA 4JY6A 1WIUA 4Q97A 4PD4K 4JJ5A 1MF2L 1MCHA 2FWOB 2QKIB 3ARFC 2QV2A 3KPNB 4B53A 1OTSC 4QYOA 5I73C 1P4IL 5TE4H 3NAAH 1LEIA 5GRYA 1NDMB 1CL7L 2DB8A 3LKPB 2QBWA 4P2RA 1HHJA 2AXFB 4I8DA 1NCBH 1I7RB 5CEYB 4FFEX 4PJDF 3MRBA 3CFDB 1KIPA 1BVKB 4NKMA 3BKJL 4GBXD 3ZDXF 3IXAB 5GSRA 4TNVF 5E8PB 5F1OB 4ODHL 3T77B 2P8PB 1RJZB 2XTJB 5IR1A 3SDDA 2WUBL 4HPOL 4DGVH 2V2XB 4U1LB 2Y5TA 4L4VA 5F9DC 4Z7VA 4MHHG 4OF6A 5I1EH 2GJ6B 3ZTNH 2ZUUA 3QYCA 1GH7A 3IXTB 3CFJB 2NY7L 1D6EA 4S1DC 4PJ5D 1NMCC 2BXYA 1W8OA 4RA3A 2BFVL 3AS3A 3PGCB 3STZA 3TIEA 5DZNA 1I8LA 1RPQA 3BPLB 1ZEAL 2FBOJ 1K8IB 3QDME 1LDSA 2YEZA 5LGJB 5FK9A 3RUGE 4YZFE 1K9TA 4QRUB 4LOUD 2DQIH 1CIDA 4XC3L 3FT2B 4KVNH 3O11A 3V52L 2KQNA 1QP1A 2LFGA 5DTFA 4XMLL 5IVXB 5FGCE 2ZG1A 1HQ4A 3GMPA 3KLAB 1BIIA 4ZAKA 5KVFH 2DQUH 3X13B 1ORQA 4DUWA 4WV1C 4M93C 4XCFL 5IF0A 3TCLA 3BIKB 4Y5XA 3MCLL 4X8JA 4JVPA 3D39A 2EC8A 4I9WD 2PYED 3QDHA 2YBRA 2JB6B 4Y2DA 5GRVL 3VD4A 4M61B 4ELMB 2YC1B 1NGWB 2XFXB 1OHQA 3JV4B 3O0RL 3E1F1 3U7WL 5D5MA 2X70B 4PR5B 3NH7H 5FKAB 1JZ3A 3BW9A 2HFGH 1QLEL 4FG6D 3TLRA 3LB6C 3KXFE 4Z0XA 1A6WL 3DROA 2VUOA 3EFFA 4BSVA 4PJCF 3MV7B 4NGHH 1MAMH 1ZTXL 5C70A 2J6EA 4P46A 4KJPC 1QNZL 1UACH 2B5IB 4K8RC 4LLYA 2BRRL 3EOBA 1I8MB 3PABA 4K3JH 2XWJA 3A67H 3HR5B 4HZLA 2R9HD 5HI3C 3GSUB 1T2JA 3QFDB 4J4PA 4LKXB 5DD0L 2MKLC 4JFYA 3SY0B 3RWFA 4NQDD 4ALAL 3HC0A 1DBBL 5E03A 3RAJH 4ZNCD 2HMID 3NCBB 2DI9A 3VXSA 1RUAL 1E4WH 4JG0H 3WV0A 4W81A 1X5LA 1P1ZA 5DVLA 3I75A 2VZVA 1HQRB 5C09D 3TV3L 4LGSB 3FTGB 5D2NB 2BVOB 4PRIE 4GG8B 5D7IB 1YMMA 4K2UH 1G7HA 3TN0B 3FHQA 3GKWL 2P44B 5HGHA 3QIBB 4LAJH 3TIDB 5EU5B 3T0VA 2B4CH 1KC5H 5CCKH 1PX3A 5EUOF 5ILTL 3TT3H 3MLUH 4M1DH 1I8IB 5GZND 4I0PB 3PP3K 3T2PA 1K6QL 4PJFF 1MVUB 3QUZC 3BXNA 2I07A 4F8QA 3NFNB 4HBCH 3UYRH 3QCTL 1A6UH 4U3CA 1TJHL 3MRHA 3KYOB 4Z8FL 3WFHB 4QF1A 4Y1AE 2IH1A 4HZAA 4N9GB 2ED9A 2ZCKH 4GAFB 1U3ZA 1QYGH 4NCC2 5TFSH 1DEEA 5KSAA 5BW7C 1I9IH 2YXFA 5DWUL 4OCSH 3VD5A 5HHOA 3B9KB 4ONHA 3VCLB 1EZVY 1VEOA 4PJ9D 5J57B 5D93B 4GRMA 4LHUA 3MV8D 3VH8A 3CLEH 2B1AL 3T0BA 3CSPA 4BQBA 2UYLB 1UADC 5I1JH 2NXZD 4Z9KB 2YKLL 1Z5LB 1UM4H 2FEEI 3F7VA 1BGXH 4QTHB 2BOBB 4RGOH 4WWKC 4MB5A 3WSQL 5B39B 1EMTL 4OKDA 4IDLA 1S7TA 4Z95H 1NCUA 4YDKL 2HT2C 1AO7B 4PJIA 4Z7VF 2BNRE 4DGIL 1EIBA 2FX9H 5MERA 3L7EB 5TDPA 4RMUA 3HPLA 3IJHB 2VRAA 3DURA 4NO3B 1IT9H 2NY6B 3ULUE 1U8HA 3MGAA 4MA8L 3LN4A 3UYOD 1ZKAA 2A6DB 2P49B 1B3JA 4KTDH 4YK4C 3BEVB 5MHSE 2HKFL 5C0BD 1BOGA 1KEMH 3MMEA 3ES6A 4RFEB 4MXVF 5BS0A 4G5ZH 4N0FB 2MQCA 1BD2E 1NGQL 3GK8L 5CILH 2X4TA 2VO5A 4C58B 5J3HD 3LHPL 1W0WB 4GAGL 1N59A 5L88L 4R97B 2P43B 4P5TC 3FMGH 1RURH 25C8L 3MX0A 1SHMA 4K7FA 2DQEH 4GKZA 3BFOA 3WUZA 4HKXB 3ZDZE 1N6UA 4RISL 3UTSD 5JXEC 2DQTL 4MAYC 3MRMA 3WO4B 5J1AB 4EOWH 3VFTB 1G7IA 4K94C 1MJUL 3VI4E 3PQYD 1PYWB 2HWZL 1BD2D 5DA0B 1MHPL 4G9FA 2IH3B 4CN1A 3T8XA 1KIQB 3ARBC 5C0AA 3BIAX 3IF1A 3VFOB 3DBXB 2PYFB 1EHAA 3HG1A 4LP5A 1M6OB 5D5MF 3DUUB 1OP3H 1AR1C 2YPLD 3OR7A 3FB6B 2X09A 3F7QA 5JIIA 3BKCL 4U1NB 3SDAA 1HKLL 4MX7A 5DQ9B 3REWB 5M95B 3VA2C 5TE7L 3P11L 2XG4A 3ARGA 3MFFB 4KHTL 5BVPH 1YDPB 1OARL 1S9XA 1WITA 2V2WA 1QRNE 1PAMA 2GSIA 3QIWD 4U1HB 3D5OF 4MDJA 1NUFA 1I1RA 4PG9A 1H15B 4OZ4A 3CK0L 5IESL 1CXKA 3RI5K 1PEZA 2NZIA 1GGIL 3EOTH 3RNKA 5CKAA 2HH0H 1IAOB 1I75A 4ZS6D 2H9GA 4D0DA 3ARDB 1CFSA 3KPLA 4FQ1L 4L5FH 4QRRB 2HVKB 3LV3A 3MYZA 1EJOH 1ONQB 4LLWB 1ZGLM 1RZ8B 1DQJA 1IEBB 4HS6A 4JM2B 5LCVH 4GBXA 4JRWA 2ORBL 2VXQH 1T20A 5C9JB 3I6KB 4JHAH 3VWKC 2RB8A 1CD1B 4TN9A 4G6JH 3RWDB 4AZ8A 3VWJC 1AKJA 1MCPH 4MAUH 4M1CD 4GRLA 4XMPH 1DP0A 5FUOL 1YNTB 2GJZA 3GI9L 3QDJE 3I50L 2VDNL 4IHOB 2EEDA 4RMSA 4EEEA 3PHQA 1FORL 4HFUH 2H32A 3QP3A 3OKLB 1S9YA 3MRJA 4KKCC 2DQGH 1ETZA 2G9HB 2QADB 3CDGA 5B4MD 2FWOA 3C2SA 1TQBC 4DQOH 4PJ5A 4KKBD 3QRGH 4JM4L 3GRWA 35C8L 1OD7A 4DZ8B 2YD7A 1YYMH 3HI6H 4R9HA 3F6LA 1KG0A 4MQXD 4O4YL 5E95B 4KKNA 1V5JA 1G9MH 3GRWL 3HE7B 4IS6B 1P4IH 2IANB 1HWHB 2OTWA 1IGML 1HYRC 1VERA 2BSSB 5C0GA 1E27B 3S9DB 3QI9B 1HEZB 4IRZL 2ESVD 5CEZL 2W0KA 1L8JA 4JO2H 3FONB 4KROB 5C0DA 2UWEA 1FFQA 3RKDC 3LQMA 5DJZB 4LDEB 5C0NC 3IU3A 1GIGL 3RWEB 1U8KA 4ODHH 1FRGL 3BE1H 3EO1B 4WO4B 2B1HL 4TVPH 1RSFA 1K4CB 3STLB 2PYEA 2YD2A 4HPOH 5F71A 4EI6B 1ZA3A 5DJ2B 4OGXH 1TZIA 4NUJB 2BNQE 3EDJA 4PV9A 2VLKD 43CAB 3LD8B 1B6UA 3KVQA 2D9CA 4NP4H 4OJFL 3IS0X 3PGCA 4PRPA 5TQ0H 4LARH 1FPTH 5TDNB 4KJWC 3KPRA 3WS3A 4HS3A 3O3AA 1AQDA 5E8EB 2DAVA 3QHFH 2YD5A 4BQ8A 4YHLL 1OAYL 1F8TL 3HLAB 3EOYG 2CIIA 3IFOB 3O3EA 4UBDC 4W6YB 4AL8H 4K3DL 5C0JB 1I3RB 4Y5YA 1C5CL 3H7LA 2FCBA 2WQRA 5HI5D 1C7TA 3CVHB 4DOHE 1B4JL 4UV7H 5HYJA 3IJYB 3KLAA 4XC3H 3VG9C 1JHLH 3V52H 4OZHA 3QXVA 2FJGA 1X5JA 5CJ5A 2EZ0C 1BF8A 4MD4A 3WXWL 1QFUL 1FDLL 3G5XA 3QNYB 2IFGA 4CGTA 3NGBB 2BVTA 3UZQA 4NQDA 2EDXA 2EH7H 4NQEE 5IVZA 1Q1JL 1AJ7L 2O5YL 3U4EB 4ELMA 1IC7L 4PJDE 4BM7A 3AFLA 4PR5A 1ZGLA 1ZHNA 2F53B 3BEWB 3ZDYF 2HVJA 5IOPA 4WGVB 2Y36H 3ZDXE 1FGVL 1UGNA 4MHHI 3C8DA 5C09A 1J1PL 1OB1B 2YRZA 4KRNA 3O81A 1AGBB 5JXAH 4E41E 4ZDHB 5E4IA 3ILPB 1TIUA 3O9WC 2JJTA 4PJ8B 1YEKH 5I8CA 1U93A 1TQCB 4Y16A 5FA3B 1MCKA 4P2QE 4OD3H 4G9DB 4KJYB 1WZKA 3RWHA 5JHDB 2J6EH 4YNYB 1ZGLP 4LSSH 3UJTL 4UNUA 3OAYH 1EAPB 4ELKB 3QO0B 3QUXD 5F9WB 1DBBH 5DDHA 5EOQL 3HI1A 5I66B 3IFLL 5FHAH 2R2HA 4QRTB 5EBMB 5I8EA 1HQRA 2X1QA 4YBLC 2G2RB 2FHBA 3B9AA 3LS4H 4P4RB 3H3PH 2OJZH 5EZOH 3THMH 2DD8L 4P2QD 1AI1H 2P5EB 4G43B 1T5XB 3V0WH 1XT5A 3FB8A 5IW1A 3ZE2F 1U8PB 1Q9KA 4KK8D 4Q2ZB 3TV3H 3O8XC 5EU5A 3NZ8A 5GSVB 2FGWL 4M03A 1CZ8H 2HLFD 1NLDH 1IQWL 3RDTC 2D3VA 4OD1L 1QPPA 2D31B 4HWZA 2BCKA 1UWEL 4W4NA 4WENB 4TTGA 1XMWA 3MRLA 3GB7B 1RZGA 3DMMB 4CVZB 5JW4M 3QBTB 1G7QB 1W72A 4L4TB 1WT5C 4P23A 3ARXA 3ABZA 1QKZL 4TQEL 4FTVA 3MBXL 3E3QC 5EOCJ 1BOYA 1CF8L 5KW9H 1K6QH 3KYOA 1DDHA 2BMKB 1W72L 2AGJL 3D0VB 5D1ZC 2CO6B 3BP7A 4Q6IB 4HULB 1B0WA 1MIEH 1MHHA 5EBWB 7CGTA 3BD3A 4P2CG 1SJVA 5I1CL 4Z8FH 1LEKB 5AWNL 2I9TA 1AXIB 3Q3GB 5IVNA 3H9HB 3VCLA 4M5YH 4BH7A 2APWA 4CMHB 3BRDA 3HPJB 1CFTB 1DLHA 3GJFH 3VDCA 2UYLA 1AHWB 4NZRH 4Y4HB 4FQXA 4XNQA 3G04B 3SCMB 2FJHB 1LE5A 3BUYB 1N2RB 3U46A 1MHEB 4YHKL 4UU9A 5JMRA 4FMFA 5F7HA 5CWSA 1CD0A 2CKBH 2UWEF 2YKLH 1A7QL 5IHLB 4WHCA 1BX2B 5J13C 2ERJB 3UBXG 1H3PH 3FRUA 1ZLUK 3WSQH 4MMXC 4D8PB 2J8OA 4KKAD 4YDVA 5DJYA 3IDXH 3CFKB 2F8OA 3X17A 3LSOB 4ZO8A 1OP5H 3D3VE 1Q8MA 4M4PA 3O6FA 3IKCA 3VRJB 1JNNL 2VITB 2YPLA 3IAGC 3GHEL 5EUOE 4JHWH 3IDYB 4NUGL 4OQTH 1UJ3B 5F1SA 1KLGB 3ARUA 3ILQC 4YGVB 4FQQB 4MA8H 1IGFL 3LKQB 3SGDH 4PJFE 2XI9A 3HB3C 3RJQB 3QZWB 1INEL 4ZO6A 1A7RH 2V2TB 4F58L 2Y06L 5BZDA 3SEPA 4QRPD 5DK3A 3VFPA 2OK0H 1NH6A 1WFNA 3SGKC 4IMKA 1RZJH 4PJBB 1NGQH 5T3ZD 1N7ML 1QR1A 1NBYB 5B21A 2VZ1A 4OZHF 3RQ3A 1F02I 3OKEB 4NFCA 3JV6B 4HH9A 4PJHA 1CDYA 3WNLA 2F15A 5DFTA 1MJ8L 4AG4H 1A1OA 4WDIB 25C8H 4LPXA 3LKRB 2NXYB 3ARRA 5JZ7D 5DRXB 1SMAA 5DD5L 2DKUA 4GG6B 4FN0A 3CSGA 4P2RE 1MFCH 1D9KC 4PGCA 4ELMF 2H41A 3S35H 3MGTB 1FZMB 3BZEA 1R3HB 3FFCB 1NDGB 2HWZH 4M7LH 1P5VA 4I2XE 3ARTA 4OLUL 3OMZA 3SKMA 2I26N 4G8GE 4GSDH 4GW4B 3NTCH 4D3CH 2APVA 4DGYL 3SE8L 1Q9LB 5J6GA 1AGFA 3GBMH 4UAOB 2Q8AH 3OHXB 4KHTH 4Z7VE 3V6FA 1QFOA 3VXRE 1ZHLB 2DLHA 4JO4H 2WUCH 5AZ2H 1D6VH 4LSTH 3V6OE 1A6AA 1CK0L 5FIEA 1LE9B 3KWWA 1CS6A 4J3VA 1G0YR 3S98A 1GGIH 3SQOH 4QRRA 1G9EA 2YUVA 3OAUH 5EH1A 3GSNA 1VFMA 3N85L 1RULL 4LLWA 4FQ1H 2C3VB 4MJIE 4UV4H 5F6IC 4Z7OE 4ORGB 5FKPA 1UYWH 5IHUL 4LRIA 5D96B 2C3XA 4FFVC 2YR3A 2NYYD 5KANG 4TSAH 3QH3A 5C2UB 3VGGA 3O2VL 1YNTA 1XH3A 1GOGA 2AQ3A 5GS1A 4WW2B 2ORBH 4U1GC 4XNZC 3VXTA 2NX5A 4P57B 5JPNA 3RL1B 4OKVB 4ZD3L 1ADQA 3S4SB 5AAWA 3DOSA 4F15B 1FE8H 1R5VB 4NKIL 1KLFA 3CFCH 2ED7A 3UJJL 5HBBA 1K3IA 3RX7A 3OAZH 1N8ZB 2QQKL 4Y5VB 3ULSA 2Z8RA 4KTYA 1IKFH 3VDBA 1SJEB 3CH1B 2B4CC 1FV1A 4PJAE 4JM4H 1T0MB 1K2DB 4N0UB 4ZNEE 5IFJA 1J9CT 3CX2A 5I1LA 1E27A 1XGYL 3I2CH 2JJWA 3R1GH 3JWDL 2X4SA 2R69L 1BQHA 1FL3A 1UENA 5JW4N 5GGUB 2UVFA 3UTPE 3WKMH 3T1FB 2XN9B 4ZUSB 1G7MA 1XZ0B 4ZUTA 3IVKA 5HHPB 4V1DE 1OPGH 1P4BH 1PDKA 4X9BA 4XVUD 3MLZH 3RVXD 5E00B 3AU1A 4D9QE 4MXWL 1YEFL 3WS6A 5JOPE 4JG1L 4XPGH 4F9PA 4HJ0C 2FO4B 3MREA 3O6LH 4YHNB 5MP6H 4DCQB 2B1HH 5L8KB 3I02B 4LFHG 2CLZA 4NDMB 3TO4D 4GLRH 4R96A 1NMBH 3G6JA 3HE6C 4JAMA 4OZGE 2XRAL 3BP5B 2VB5A 1N6QL 5DMIL 1FYHB 1IBGL 4OJFH 4NQCE 1NCDL 3UP1A 5IV2A 3MUHL 4PB9L 1HIML 4UNVA 1I1CA 3AS2A 3N1QC 3VFGL 1INQA 3BWAB 5F1NB 2VXUH 5FHBH 3HNTL 3P40A 4IIQB 2F8XC 1RZKL 2R0WH 4MA7L 4MD0A 1IAIH 4KUZL 3AC0A 4EDWL 3MV9E 4S0SD 5T1MA 5IROC 2DQCH 2DTML 3U36B 5IB4B 1EHXA 5TF1L 2ZUWA 1RZIA 1TLKA 4FQCL 4X98B 3OV6A 2CJUL 4JZOB 1F11A 4K23L 1QFUH 4I1NB 4S2SB 3VGHA 1TVDA 1Q1JH 1AJ7H 2EDTA 3MXVL 5K59E 3D25B 2Q86B 4HUKB 1JZ2A 1QBMH 3WIIH 3GMQB 1PLGL 1RZFL 2PETA 4ZSOB 5FYJU 4XMKH 1E28B 5IFHH 2V9RA 4PTTA 4PJHF 5KVEL 3BN3B 2ATKA 2IADB 1MCJA 1PKOA 3E6FB 1YEGL 5C07D 4TULL 1S5IL 2J5LB 1WEJL 4JVWA 2QJDA 4G7YH 2VAAB 4QHNB 5ISZB 3LQZA 2UZXB 5F7EL 5DFWH 2DLFL 1JZ4A 3A6BH 5CFHA 4G9DA 2UV3A 5LGKA 2IAMB 4H1LA 4KJYA 5L2KE 2Q7YB 1FH5L 4PY8I 1VPOL 2YS4A 3SDCB 2EYSA 1PKQB 2GK0A 3L5JA 4XPAL 1U58B 2F5BL 5HJ3B 3QIUB 4Y4KD 1KLUB 2Y6SD 3ZKXC 1Y18B 2OS7A 5DFVD 4BA8A 5GRWA 1HINL 2NNAB 5IB1B 1OGAE 3RVWC 1OAUL 3LPGA 4PTUB 3V5DB 4GJTB 5EOQH 1UZ8B 5DRWB 5DZLA 4WUUB 2P5EA 1T5XA 1LGVA 3BAEH 2H2PD 5E6ID 5BCAA 3L1OL 4FQHA 2BJML 1EO7A 1WCBB 2CD0A 5HVHB 1QSED 2J1KA 1Q9OA 3DSFH 1JIBA 6FABH 2AXHA 2FL5B 1BIHA 5BRZB 5IVOA 1X6NA 3MRRB 3TBWB 5C0IA 5AG9A 4NOBA 3QDAA 1BQUA 4B41A 4HCRA 2AJZA 1YMHB 3DMMA 3FFDA 5BV7B 3L5IA 4OD1H 4NHCL 4X80L 1N4XL 3ZDYE 4HCRL 2A74B 1HHGB 1N26A 2D7QA 4XVTL 3MLPA 2BMKA 4S1SH 2CXGA 1REIA 4Q6IA 3DX9A 3I3BA 4TQEH 1V8HA 3HKFA 4AIOA 5JW3L 3PL6A 4C4KO 2IQ9H 1W72H 4Y19D 1FSKB 3QFJB 1PGRB 3MYJB 4XP6L 2FEEL 2WBJA 3DGGA 2RCSH 2ZUSA 4G9FE 2ZOLA 1BWMA 1QA9A 1RUQH 2BXZA 4LVNC 3BJ91 3HG1E 5IK3B 3C08L 4Y4HA 5H2BB 1G9MC 3QNXB 2FJHA 4HH8A 1N2RA 2ICWJ 1EUUA 3ZL4L 1FNEB 4QRPA 3DVGA 3CX5J 3OXRB 4E42B 2PW2B 1BLNA 3BPCB 4HQQL 1I7ZB 1S7RB 5I75C 3RHWK 4YHKH 4RIRB 5T3ZL 3D69A 4D8PA 3G5YB 1A7QH 2BNUB 1LK2B 5T33L 3TZVD 3ROLA 3CFKA 2Y7QB 3JVGA 3DUHA 1ZANH 2X40A 3S3JA 3N1MC 3ZE2E 2R2EA 1U3HD 1DQLL 1HYSC 4QNPF 2JJVA 4C55A 1KB5A 3SBWA 1F6AA 3G6JF 3SKOA 4YFEA 1MRCH 1DVFD 4YDIH 3AB0B 3PHOB 4YGVA 1C08B 5D2LA 4R7NB 2A9NL 3TBTB 1KB5L 4I48A 1NCAH 4P5MA 5DJ0A 2BOCB 5FCSH 43C9A 3QZWA 1JYWA 1MIML 2V7NB 1T04A 4JPVL 5CEXB 1EFXB 2Z93B 2P1YA 1T0PB 1IGFH 3X3FL 2I5YH 3H42H 4M6NH 3T0AA 1PZ5B 2PTUA 3DI2B 5ADPL 3OKDA 5JIPA 1T66D 3CXDL 1N7MH 2DKMA 4X7DC 1CU4L 4QY8B 1SBBA 1X44A 1VENA 4FQPA 1TETL 1FO0A 4HK0B 1MJ8H 3DX6B 4XNYL 2XNAB 4BUHA 5C0CA 5CEZE 4MNQD 3C6LA 4CMMB 1G6RB 1H8SA 4M1GH 1Y0LA 5F8QC 1JPFB 4DAGH 4PLKD 4Y8DC 5L8JB 3IDMB 2A6KB 4XC1H 3MJ8A 1CR9L 4D9RD 3MROA 1K8DA 2YSSA 3REVB 1FVCA 3ET9F 1S3KH 1FNLA 1A6VL 5ENWA 1LQSR 2UWEE 1P2CA 2GITA 3C8KA 5KAQG 4OLUH 4ENED 4HX1A 1JZ6A 5FDWA 4Y2DC 3WIFA 3T3ME 4QXGL 3OGOE 2GJ6E 2N7BA 1NAKH 2Y4SA 3NA9L 4YDLC 5DRZB 2ZUQC 3M07A 4L29B 1CQKA 3TBYB 3MXWL 3QWOA 1CBVH 2VDQL 4HIXH 4I18C 2NLJB 5CUSH 1U3YA 2XZCL 1TNNA 2XYCA 4LEXL 2AK1L 4PRPE 2XKNB 1X5HA 5C3TA 1XF2B 3KPRE 4P5KA 2XTJD 1S78C 5E8NB 5ALCH 3OKNA 4NRZB 5AUMB 3NIDF 3MJ9A 3W9EB 4DKEH 4GXVL 1RULH 1OVZA 5EZLA 1QSFB 4JHBA 1DN2A 2I60H 5IHUH 1MRFH 4YE4H 5HYJE 2HJFA 3GSNH 2G60L 4X7FC 2RR3A 3DXAD 3IETB 5INCA 4U0RC 1BBJB 3IRZA 1CLZH 1LO0L 1ODAA 5AD0B 2MQ3A 4NBYB 4Q0XH 1OAXL 2NW3A 2V5TA 2Q3ZA 2EIZA 4Y4FD 1JZ5A 5ID0B 4HLZH 1KJMA 3FOMB 3MRQA 3CH1A 2BK8A 1YYLH 2K3TA 3P9LB 4ELME 3N1GC 4LL9A 4XPFL 2R1YA 4OCYL 3UJJH 1ADQH 2H26B 3FCTB 4N0UA 4EQ3A 3QUYB 1T1YB 3D2UD 4ZPTA 5E9DD 5GS2D 3WMSA 1NUGA 3BRGC 1JHTB 5JA8B 5I15L 4JDTL 2NTFB 3S5LG 3L3IB 5HHMA 3U0TA 4L9DA 1EH9A 2Z31B 5KSBA 1GZQA 4KY1H 5I18H 1OTTD 4PRDA 1A2YB 1XZ0A 2FYYB 1FFPA 5SWQA 4GRWB 3TA3A 4YX2L 2O5ZL 3MV7E 3N1FC 4DK3A 1C7SA 1F58H 4PB0H 3FQUB 1J0KA 4NNXA 4ZOBA 2A1WL 1UVQB 4UMGA 3MRGB 2A0LC 3GBNH 3KYKH 4YHNA 2GFBB 1EGJA 4MXWH 2YUZA 4CN6A 4J3TA 5KANI 1ZSDA 2ICES 3S36L 4JFXA 3OKOB 1UM5L 3TF7A 3B5GA 1OL0A 4XT1C 4AEEA 2V6HA 1EGJL 1SY6L 1PFCA 1KT2B 1Y6KR 4KK5D 4JY5H 4PJEA 2FD6L 1RIVL 2GJJA 2Y25A 1T22A 1U8MB 3O3BA 2VDOH 3O4LD 4PUBH 3VFMA 4Z7WB 1U91A 2EDJA 3VFWA 1N6QH 5DVOA 3UJIH 3PWNA 2XWBA 2ZUYA 4WU5A 5D2NE 1M1SA 1HIMH 5JIKA 2Z35B 5D7IE 5C07A 3LKSA 2DYPB 1AGDA 4WTZA 1ZAGA 4U6XB 2QHRL 1HK6A 4DKFH 3GEWB 1B0RB 4X98A 2J3SA 1FNAA 3NABH 3B2UC 2W92A 1J1XH 3MLSL 4PYGA 2AS5M 1NC4A 3PWLB 3DRTB 5HTSA 5D2LF 1IGJA 1U8OB 4YHIB 3TVMC 1S7XA 1L7TH 2PXYC 2VOTA 3R0NA 4LNVA 3D25A 4FTVE 3TM6A 4XXDB 3TN0D 1QFWI 3X11B 1PG7W 2X4PA 3ARFB 3MXVH 1RZJC 4XPTH 5E8DH 1ZWIB 5I17A 5I73B 1H5BA 1PLGH 3E6FA 1QSEA 5C08A 5KVEH 4PFEA 3K2UL 4GMSL 5DSCB 3PE9A 3QJHB 2W9DH 5DD6B 4IOIB 3RWCA 3SOBL 1FAIL 3CUPA 4KI5D 1MCWW 1F6LL 4TULH 3AAZA 4UDUA 2FB4L 1MCRA 3L9RB 1JFMA 3JWNC 3VGAB 3SDCA 1JYXA 5CJOL 3VXPA 4A2MA 4QTIL 3QA3A 2ITCB 1VGEL 3GUTA 3B9KD 3LKNB 2DF3A 4C56B 3PWPB 1AO7E 2PF6A 1KN2L 4H1LH 4P4KA 2H3NB 4PS4H 4LMQI 4B5EA 4UB0L 3F7PC 1OTSD 2HG5A 3GSQA 2P5WB 4ACPA 2X4OA 4QOKB 3U9PL 1N5AA 2LU4A 3SDAC 3DV4A 4HV8B 2X4UA 2XQYK 3ARGC 4JANA 1OP3K 4NRXA 5IMOA 4XNMB 3EO9L 4NZDA 1PG7X 3MRRA 3L1OH 3D0LB 3DO7B 4OCWH 5LKNA 4D0BA 3P0YH 2AQ1A 1WJ3A 1G7JB 1AD0B 4EI5D 3MLRL 4XP9H 1G9NH 1CXFA 2EDYA 4RSVA 3NMEA 5AG8A 4RRPG 4POZD 1BFVH 1KPUB 3VE0B 5BV7L 2DBLL 2NY6D 3P73B 4M93B 4I0KA 4WV1B 4F9LA 1IC4H 4K7PL 1R5IB 2AJXL 5FUCC 4J8RA 4PJHE 3IDIA 3MRDB 5AYUH 2VLRB 4GQPH 4L3EB 4GKOA 1D5BA 4GBXC 3OJMB 3GI8L 4F2MA 1JF5A 4ODTL 1R24B 2R4RL 4Y2OA 4FFZH 1AFVL 3RU8L 3KYAA 1RD6A 4BSWB 3E2HC 5IK3A 4Y0GA 3CU7A 1JGVL 1XAUA 4LCCC 4ZFFB 5I74C 3FO1A 4JCLA 4U1KB 2AJYH 4OAWA 1JGEB 1U8IA 3FT4A 3K1DA 1EEYB 3D18A 2V17L 3G08A 5FO9B 5KSBF 2WY3A 2JB5L 3WUWG 4WNQA 3BJLA 1LO2H 4M9PA 2GT9A 2VMFA 4WEBL 1I7ZA 2EE6A 5EU6B 5JPMA 1J05B 5DUPH 5JDSB 4O5LH 3BZFA 3LRSB 4IMLA 2DI8A 4WU7A 4PGDA 1KSRA 4JFOA 4PREB 2Z4QB 4FXKB 4LOUC 5IB5B 4HIJA 5JW5A 1WVZA 2X10A 3GSWB 4JFDB 2CLRA 5T3ZH 4QRRE 5EC2B 1IC5H 3GGWA 4MNQA 5T33H 4AEFA 4G8EA 3OB0H 1EVTC 5CGYD 3VU2A 3C2AL 3GJEA 3U9UA 2WLYA 2DMKA 3A6CH 5EPMB 4PJEF 3C9NA 1D7FA 4X0KB 4ODUB 3TBTA 4HUNB 3TJEL 5GGTL 3HC4H 1VKXA 5ALBL 1JJUA 1OCWH 3ARDD 5F9OL 3QPXL 4JLRA 2C3GA 1KB5H 4PJXA 4K8RD 5BVJB 3Q0HA 1RK0A 1PZ5A 5HDBE 4JPVH 4ODVL 1XR8B 1TDQA 4QHUA 1JF1B 3UBXB 5HHQA 1MNUL 4UIMB 5L2JB 3IFPA 5DO2D 2X1XR 3L95B 4OLYH 4FG6C 3HZMA 5ADPH 5I8OL 1F4XL 3AM8A 4TRPH 2J7LA 1GGBH 5EULV 4FQIL 3DX6A 4Y5YC 3EOAB 4M5ZL 3R8BB 5FAAA 4BELD 4JRYB 4CMMA 2IANE 1G6RA 4ZMAT 2MFNA 1JPTH 5TQ2H 4LSVL 3M1BA 1LO3H 2R9HC 1G6RL 1FO0H 5J89A 3LEXB 3GNML 4F33A 2JK5A 3DXAA 3T4AB 4XCYB 1Q72H 1W2KT 2ZKHL 1JTTA 2HMIC 1A22B 4O51A 1A6VH 3CVIL 2VWEC 4Y4FA 5FB8A 2ID5A 1EDQA 4V2CB 1NCWH 2HTLD 1I1AD 1NEUA 3QI9D 4G80B 3NIFF 4HUUA 4LLQA 1ZT1B 2ATPA 4NKDB 2OR7A 3BESR 4O00A 4JB9L 3D2UA 4WWKB 5E9DA 2XKNA 1SJHB 4X99B 1EERB 4QXTB 1CFVH 2DQFA 3BGMB 1T3FA 2XZCH 5I1HL 3P4OA 4LEXH 4JZNB 5CIPB 3W9EA 4G7VL 4X7SL 3KPOA 1IGIL 4UOW0 4KV5E 3H0TB 2X05A 3GMMA 5GGRB 1M05A 1MAKA 1MEXL 4FXGB 4WFHE 4WW1A 1FNSL 5SV3A 3MJGX 3C09B 2IGFL 3PV6B 3EDEA 2KH2B 1A3QA 4JKKA 5GZNC 2F8VA 2XZQH 1MELA 1Z0NA 1Z2KA 1QOKA 2ZSVA 4H0IA 3MJ9H 4HEME 1FFOB 5DHXB 4AEHL 4YK4B 4DTGL 3L3KB 3RPIB 2AP2A 3GBLA 4NIKB 4LK4A 2XACC 3DUSA 3FOMA 3WJJC 1OAXH 1CGWA 2BVEA 2WM0A 4ZYKB 1NC2D 3W0WD 4ZO9A 3BQUA 1RHHB 4UT9H 3X3GL 2IPUG 1VGKA 2VR4A 2H26A 3FCTA 4P5TB 3VW3H 1G84A 1JHTA 3WIHL 3SKJL 1WZMA 5D8JL 4PJ9C 3O4LA 3IU4H 3EO0A 5FYJD 3GMLA 1RU9L 5L9DL 1I9JL 1NBVH 1Z3GL 5BO1L 3CFBA 3OKMA 5GRUH 1H8OA 1AD9A 5I15H 3VFNA 5K93A 3ROOA 2NXZC 5SX4H 1A7PH 1KTLA 4X5XA 1T6VN 4DZBB 4J3SA 4L8SA 1P7KA 1X3DA 1CT8A 1GOFA 3ARBB 1NJ9B 3WDJA 3T0EA 5D70L 1HSAB 2WWKO 4NZUL 1MVFA 3B83A 2O5ZH 3V6ZB 1UVQA 4FNLL 2F53D 1KNOA 3MACH 2DMBA 5J9PB 3TJHD 1CE1H 4G6MH 3T4YB 3GMNB 2NR6D 1LO4L 1LEGB 2XPGA 5JHDE 1L7IL 2A1WH 5EORL 3RY4A 3N0PB 3UXFA 3SPVB 2EDFA 3UTZA 3BH9B 1U8NB 2NQCA 3NIDE 3OJVC 2G5RA 1UM5H 4AMKH 1EGJH 4M7JH 4I77L 3U48A 5JXED 2R0ZL 3GSVB 1A7BA 2P5EE 1S9VA 2MCPL 1DSFL 1OAQL 1QSVA 4H26B 5JHDD 4KFZC 4KZEH 1AIFA 1F3JB 1QBLH 5J3HC 4IRJD 3GJFK 3F5WB 1AC6A 1A6TB 4OI9A 3WFEL 2W60A 5KN5A 1NFIB 5ITFB 3VWJB 3FOLA 2VDMH 5EO9B 3HRPA 1EBAA 2HTKD 4OZFA 4PRNA 4XBEL 1FCCA 1QHPA 4MZ3A 3RNQA 4L4TE 4F7EA 1UA6L 3DIFB 2Y07L 4XXDA 4JGMA 4C83B 3MQIA 5I16A 1NMAH 3JBG7 4PJXF 1TQBB 2V5MA 5T3XL 2HJLA 3ARFA 3PNWB 5E1AB 3QDMB 3RUGB 3QNZA 1T83C 3GIZL 1I7UB 1MLCA 5JQ6L 3BX7C 3GDBA 4HPYL 4M7ZC 5FGCB 4OFIA 2YRLA 3LEVL 1AY1L 1GZPB 2O93L 1QLFB 3QIWC 1KPVA 3ARED 5DJ6B 3VH8G 2VLJD 3F12B 5KVDL 3LN5A 4KAQH 4OLVL 3KLHC 3RVUD 3K2UH 4ZS6C 5KJRL 5I9QC 4BFGA 1QEWB 1U95A 4MNGA 1DN0B 4GQ9L 3SJVB 5T1LB 2OP4H 4BZYA 5DMKB 2VAJA 4UINH 4EUPH 5K33A 2CR6A 4QTIH 1JN6B 4X9IA 3WL9A 2BVYA 1XGPB 1ZT7A 1T1ZB 1WQVT 1T7YA 2P5WA 5EUKB 3RVTD 4CVXB 5FA4B 5DVNA 4P49A 3K4DA 4M1CC 4YHYC 5KBNC 4HV8A 2VNCA 3NN8B 4PP1D 3WXVH 3AXLA 5DQDH 5TE6H 4P3DB 4BFIB 1FIGL 2VIRA 1RFDL 2D4DA 4WJ5A 5B4MC 3C5JA 2XY2A 1YEJH 1GHFL 4KKBC 4GMTL 3PG2A 3SO3C 3VG9B 1D5XB 2A2QT 2VXVH 1KCRH 3RIAK 1DBAH 5GGSB 1RUKL 2FSEA 4PJBE 3LKOB 1RK1A 4D9LL 2WWKT 1XEDA 1A21A 2Q76A 3MNZA 5IW6B 5I1DA 3GO1L 1QUNA 5HVFB 2NY0D 4LRIC 4L3EA 5IW3A 2X4RB 2XA3A 4D0CB 3TNNA 1A4KB 4HLJA 5MENB 3Q6FA 1DQDH 2OXHA 4GG6E 1V3LA 4MCZB 3OX8B 1HXMB 2RFXA 4PRIB 4EIGB 5GS1C 3FFCE 4O9HL 1T1XB 5I2IB 2WNGA 4YWGL 4NC0B 2R4RH 3VFSB 1P53A 4PGEB 3V0AC 4KRMB 2HLAB 5IB2A 1A9EB 4M6MH 4X9HA 1YN7B 3PDOA 1EEYA 3BN9D 4WCYH 4XCEB 5FOJA 1IM9B 4MQ7A 5FYLD 1RQ5A 3O9WB 3UPRB 3LMJL 1IEAA 3LEYL 1I8KB 5IP4A 1MJJA 3R4DA 2APXA 2V17H 1J05A 3SE9L 5IMMB 4LLVB 3KYMA 5H37H 5HGAB 4KK9D 3RI5F 3FO9B 2J12B 3NACL 4K8RL 4O58L 4M8QA 1CCZA 4WEBH 3OAZK 3VA6A 2DKSA 3RIFK 4YO0B 4WUKL 1FJ1A 3G6AB 4FP8L 5HI5C 2AJ3A 4XP5L 2GY5A 5HGDB 5FXCH 1KF9B 1CICD 1HSBA 4BJLA 2OL3B 1N0XH 4RGNE 2KUTA 1WWWX 4XPHH 5DEGB 5EPMA 3O6MH 1E4KC 1ITBB 4G3YH 4HUXA 1TMCB 4S11A 5SWZD 2IBZX 3C2AH 3MGOA 4Z0BL 2G5BB 4F9PC 1ZS8B 1ERNA 4EN3D 4M00A 2YPKB 4XAKD 4RQQB 3O8XB 3OXSA 1JPGB 3WE6A 1YPZB 3QEQB 1XR8A 3PP3H 4WFEE 4O2FA 1I1AA 3RDTB 3KPTA 3QPXH 5J8OA 1R3KB 3OZ9L 4MD5B 5FM5M 1BZ9B 1J0ZA 4KI5F 3HTLX 2XY1A 3TH4T 1OAKH 2A6IA 3VGDA 3EOAA 3QUZA 1MNUH 2BNRB 1NLBL 4NYLB 2J8UB 4WI3A 4EXPX 4JRYA 1LNUB 2EH8L 4N0UE 5SWSB 4MCYA 2F54D 3L3DB 3NPSB 1XIWB 5A2IH 4NCDA 4PP2B 5DUMH 1JZ7A 1C5DA 2FATL 5HHME 1IGYB 4PRHB 2CXKA 5CMAA 1BJ8A 5T5FL 3OKKB 2XN9E 5BW7A 1KELL 1J10A 2F58H 3S37L 2NPLX 4MWFA 1KB9K 2OR8A 1G1CA 3GNMH 4JN1H 2IF7A 1QFWM 3D85A 5DD3L 3QUXC 4MJ6A 1TVHB 1DUYA 2DDQH 5T1DH 4WHTA 1NC2A 3W0WA 1KN4L 1YNKL 5CSZB 3LZFL 1J86A 4U1MB 2Z8VC 1X6LA 2CK0L 2QSCH 1N64H 1HCFX 5E99L 5J13B 1KYOK 4KK8C 4HXBL 4CN4A 3N1PC 5CS7A 4YXKL 3FB5A 5KS9A 2RHEA 4I4WA 4X9GA 5GGRA 3L6FA 5HY9B 2HLFC 4JO1L 3TNMB 1FYTB 5GS2H 1IGIH 3BHBB 1WBXB 3IDJA 5T1KA 5F88B 3V2AR 1QRNB 4JQXC 3O3DA 3BDYL 5DJCB 3L3KA 3IDNB 3Q5OA 4F37K 2FLBT 5H35B 2DWEB 3A6OA 2NY5H 3MRKB 4LSRL 3VGBA 4DTGH 5J1TC 4OV5B 1KCUL 2X2YA 1P4LB 4ZXBD 4JFEB 2FIKA 2YMXL 3KR3H 1G9NC 4RMTA 3FKUS 1SBSH 4ZSOE 3OKYA 3RGVD 5JXEA 5FOBA 4MAYA 1FG2B 4K3HA 4NQSA 5D8JH 3BPOC 4G8FA 3HCVB 3T3PF 1I9JH 5BO1H 1L9NA 4KVCH 3AUVA 4IOFD 2FBJH 5FEBA 4K94L 5C08E 4PD4J 5C0FA 2PO6D 4YHOH 3CMOL 5ISZE 1G7PA 1DUZB 2XQBL 3NIFE 1H3XA 2ADFL 3V4PH 3ILQD 4CBPA 1A9BA 5J9PA 1CXLA 3NCJH 3T4YA 3CZFB 1NGYA 5KOMC 4HGWB 4KKAC 5DHYB 3UTTB 3V0VA 3DI3B 4W70A 2DM4A 2E7BA 1OF2B 5I0ZA 5FECA 5FYKU 2E27L 1TNMA 1AQKH 1NEZG 5CJXA 1LO4H 1L7IH 4LASH 4UDTB 5TPWH 4APQD 4XXCC 3S5LB 4ZQKB 3Q1SL 4O2EA 5CD5D 4KZDH 1RVFL 3MOAH 2DL2A 3FT3B 1IMHC 1V7NH 4WUUE 2YXMA 4HD9A 1JGDA 1RY7B 3L5WA 4FZEH 3CPLA 4I77H 1IFHH 2R0ZH 1D9KD 3AREA 2VC2L 5F7WC 2GUOA 2VLJA 1DSFH 3OQ3B 5CSGA 3VWKA 5ITFA 2YD9A 3VWJA 1QFWL 1KFAL 4ZUVB 1CLYH 5IWLC 1J7VR 4HF5L 4U1GB 1JHKH 2EYTB 1I9RH 3UC0L 4U6HA 5JZ7C 1SVZA 2QEJA 1X5IA 1TENA 2ITDB 5F3BB 4JFZH 2GI7A 3SKNB 1DBJH 5DF0A 4PPTA 4L8DB 5L7XH 1UA6H 5EFIA 5E2TL 5C6WH 3SBWC 2Y07H 4OZFH 3NFSH 2CLVA 1FVEB 1MREL 4QEGA 5BRZD 3DVNB 1MFDH 2Z91A 3QFJE 3ZO0A 1D5MB 1JYNA 2NCMA 1QBBA 5ESQB 5GGQL 4K71C 5H94B 3V4UL 1D3CA 4X6BB 3CH8A 1MHCB 1S8DA 1T89C 2QR0A 3JTTA 2G75B 3BZ4A 2C9AA 4QT5B 4NO0B 3V7AG 1JGLL 1MUJA 4XNUH 4CU7A 3F7YB 3ZE1F 4H5SA 2AK4B 2VDRL 1DQML 4R26H 3S96B 5GHWH 4BFBD 4HFWB 3X14A 4P99A 1ND0A 4N1HB 1J0IA 1WBYB 5BOPA 1C5BL 1DANT 3QG7H 4HHAA 3SJVA 3RBGA 1TCRA 3OF6D 2P46B 4LEOA 2HP4A 2MHAA 3BGAA 5T1LA 1T03L 5KJRH 2CUMA 5ID1B 4JR9L 1RUPL 4PJDB 1AXSA 1CDJA 1UWXH 2WIIB 3QUMA 3KPQA 2AW2A 4RCAA 2NYYC 3ESUF 3ECBB 3MRPB 1NFKA 4KC3B 3FN0H 4KRPB 1H3WM 4X6EA 3HE6B 4XPBH 3QUML 1YEHL 1NAMA 3C5SB 1JRHH 5D72L 1YEEL 3WBDA 2F19H 3B5HA 3BGFC 4YPGA 1NAML 4YH6A 4HGKC 3HZYA 3CC5A 4OFDA 4UT7H 5E5UB 3QHZL 4RNRB 1LMKA 5DS8A 4NRYB 5KS9F 4ODSL 4N0YH 4U0QB 1X4XA 5E4EC 3QG6A 1ZLVH 4DEPC 2YK1L 4FFWD 4JFFA 5GRZA 3WN5C 3OJDA 1GHFH 2ZP0T 5I19H 1HI6B 4HKZB 2JCCA 5EN2A 2OR9H 3IGAA 2E6PA 3BSZH 3VRLF 1RUKH 3EFDL 5KG9B 2VDKL 3MLVH 4I13B 4D9LH 5A40E 3QCVL 1A4KA 3VFUB 5EB9A 1OSZA 4NQUA 1CDIA 1DEDA 4BSJA 4XTRD 1A1NA 1CICA 1MCNA 1JNHB 1T2QL 2CRYA 3C87A 4P3CH 3ULVD 4G6FB 2A73B 1JNJA 4JRXB 2ZCHH 2F5AH 1KCVL 2HT3D 2OJEA 4XVUC 3RVXC 2HLAA 3EYOA 1Q94A 2X9WA 3B3IA 4J3UA 1E4XI 3DYOA 3R06B 1UT9A 4LPWA 4EN3A 3TO4C 1VACA 4X6DA 3VRIA 4Z78B 4NN6C 1EO8L 3PDGA 3SGDI 1X5XA 4JDVA 1TJGH 1DLFL 1KGCD 3QEHB 3LEYH 1JGUH 3TWCH 4LIQH 5F1IA 3VXMB 4DN3H 4LAQL 5HHVH 3SE9H 2C7UA 4LQFL 1BPVA 3SDYH 4AT6B 3G6AA 4XCNB 4K8RH 5FCUH 3FB7B 3ZSSA 5IHBA 3IDUA 4NKOA 3WFBL 4PJCB 2PN5A 3OPZH 4MA3A 2F54A 5K9JH 2OQJB 4XP4H 4DVBA 2H45A 3ZKXB 4E0RA 4J3XA 3FO0L 2NY1D 4AEIL 3CFEA 2D9QB 1Q0YH 4WI8A 5GPRA 3TGXA 2GAZB 5GGVH 1M7DA 1N3NB 2OL3L 1TMCA 4YFLI 4N90D 2HN7B 1C16B 1MCFA 1U8LB 2ZCLH 4MQTB 5I71C 3WUWB 1TJIH 4KHXL 3KPSD 3O8XA 2GW5A 1ES0B 1YNLL 2VUYA 1P5UA 3M17A 1XF5A 1M7XA 1MOEA 5ESAB 2FJFA 5JOFB 4TOYL 2P8MB 5EC1A 2ICCA 1U92B 1MH5A 1R6VA 1N0LA 5IQ7H 3OZ9H 1UQSB 1QSFD 5E2WL 5CGMA 4PJGA 3O6KL 1BBDH 3L3JB 1ZVHA 5BJTB 1N6VA 3D3VB 4YFDB 5DJAA 5D1ZA 1BF2A 4LRNL 3RY6C 4OGAD 1EO5A 5IJVB 3OKKA 1U6AL 5EUOB 2AAVA 1BQHG 4NNYB 1HDMB 3PJSB 4LNRB 5EU3A 2FATH 3VXUB 4GRWE 3DTXA 8FABB 4XRCB 4P9ML 2F74B 2VE6B 3IKKA 4DW2L 1ZOXA 3KPMB 1FFNA 3PWJA 1UXSA 4ODWB 2HKHH 32C2A 3T0EE 3TPUB 1XR9A 4LVNB 4Y4KC 3W9DA 2Y6SC 4YDJB 4Q9QL 4U1IB 5DFVC 3P4MB 4JY6B 5I1AA 4RMRA 4JJ5B 3NAAL 5D7LD 2NZ9D 2WQ8A 2IALA 3DETD 5IKCA 5EU4A 4QYOB 3PP4L 1GYAA 4Z76B 5KZCD 1LEIB 4ZXBA 5I75B 2H2PC 5E6IC 1HHJB 4WWID 2Z0BA 4MGXA 1A7NL 3MRBB 5E99H 1P6AB 3CVHH 2Y9RT 1KIPB 4CDHA 4NKMB 3KDMA 4DGVL 5GSRB 3L3GA 3MLTA 1MPAH 3U7AA 2EC9T 5FYJH 5I1EL 1H3TA 3QDGA 3ZTNL 5E24E 5IR1B 3SDDB 1KV3A 5DC9B 3FQNA 1A7OH 1OT2A 2R1WA 2Y5TB 4L4VB 4Z7VB 3IDNA 1UCBL 3I6LE 3VD7A 5HDLA 4XGZA 1Z9MA 5C2BH 1D6EB 4U6VH 5DC0A 3SGKA 5T3XE 2AV1A 1JWMB 3UAJD 2DQIL 1T2XA 3TIEB 4APQA 3N06B 3QT2A 4IDJH 4KVNL 4J23A 1I1YA 3KPPB 5HYIA 1VFBA 2JCCF 2YEZB 5FK9B 3D87B 2DM2A 2OTUA 1R3LA 3PGFL 3O11B 4LGPB 4J3OC 5DTFB 5DJDA 5KVFL 1D9KA 3SQBA 4QKXB 3V4VL 1HQ4B 3GMPB 4JPWH 1BIIB 4ZAKB 2BHUA 2X4NA 2XICA 3NBNA 1DUZA 4PYHA 1KIRB 1ORQB 4QGTA 1IAII 2X1OA 4X8JB 5C92A 3LS5H 3D39B 4H1LG 2ARJA 3TZVC 4NO2A 3S3PA 1MI5A 2YBRB 2C4FT 3NH7L 2Z92A 1U3HC 2LTQC 4Y2DB 2V9QA 4IRSD 4PRBA 5FM5O 2HFGL 2YUXA 3FO2B 4UDTA 4UILH 2ZUQB 3PWPE 4RBPH 5D5MB 3S5LA 3DRQA 1DVFC 2YWZA 5BQ7A 3P4NA 3BW9B 4I18B 1HH6A 2FEDD 4U1SA 4L3CB 2P5WE 3QUKA 4NGHL 1MAML 4QOKE 2A9MH 4Z0XB 1UACL 4PY8J 1A0QL 3Q1SH 3DROB 1LDPH 1RVFH 4BSVB 3V5HA 3A67L 3C5ZD 5ICZA 4KXZH 4P46B 3WHE1 4TYUA 4LLYB 3EOBB 2J2ZA 2AEPH 1T66C 5DQJA 2OMBA 4C56D 4NWUH 5CINH 4FS0A 4HZLB 2VC2H 1P9MA 3RAJL 4X7EC 1MWAH 2XA8H 3OF6A 1WWBX 4JFYB 4JREB 3RWFB 2X6MA 5ACZA 1QFWH 2GTZA 1KFAH 1TXKA 3CD4A 3HC0B 4QOKD 4WFGE 1ZLSL 3SKNA 5E94A 1CDCA 1UFUA 2KDGA 1RMFH 3VXSB 1I85C 1P7QD 5IM7A 4RFOH 3M8OL 2VLRE 4PLKC 2ZZUT 3T3PE 3V6BR 1P1ZB 4L3EE 2Z9TA 4K2UL 3I75B 4N68A 3KHQA 1CLOH 4Q9BA 3QWRA 2IPKA 2DQDH 2ZUVA 5BXFA 1MREH 2B4CL 4ENEC 1KC5L 5CCKL 1YMMB 1G7HB 4PJGF 2R0LH 4HUVA 2LVCA 5HGHB 2AK4A 4DFHA 2C4XA 4NOFA 1A4JA 3PWVA 2Q6WB 5J6HA 2VLRD 4O2CA 1JGLH 4JFHD 5C6TH 1J1OH 4HBCL 2FLRT 4U2YA 4JHZA 4R3SA 1A6UL 3UYRL 3RHWF 3ZTJH 4C59B 3BXNB 3LVEA 3V8OA 2I07B 3H9SD 4K9EH 5TDOA 2XTJC 2ZCKL 4ZFGH 3RL2A 1QYGL 5TFSL 1I9IL 4EDXA 1XGTA 3MRHB 4R2GB 4OCSL 4OTXL 4QF1B 4POYA 4JFDE 3GJFB 2YA0A 3CIQA 5I8KL 2ADIB 3HE6A 4HWEH 1IAKA 1ORSA 5KSAB 1DEEB 4C57C 4RMWA 3CLEL 4GAJH 3ZKSD 2CPCA 1S7UA 5HHOB 3K8MA 4ONHB 5I1JL 4GRMB 5EU6D 2CKBB 3SGJC 1CI5A 5D72H 3VH8B 4KQ3L 4Y4FC 1BGXL 5EO0A 1ZT4A 3S88H 4U4BA 1NAMH 3ZLQC 4KH2A 2X41A 3F7VB 4Z95L 1DL7H 4LVOB 3JTSA 1RJLB 4OLZH 3WNMA 5FYLH 5CLWA 2FX9L 3LIZL 5FV1L 3KNBA 2E7MA 4PJIB 1IT9L 4Y7MA