3QUKA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
275
structure length
262
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 262
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qukA01
2WAHA 2OP4H 3I3BA 4TUKL 3MGOB 2LTQB 4M7LT 4OCLC 3QUYB 1YEFL 4G9FA 5TQ2H 3X12A 2W9EH 1NQBA 1CE1H 2AJVL 3CXHJ 1FIGH 3LKSB 4XPFH 1I9IL 4XRCB 5IW1B 1Z5LB 1CBVL 4GBXD 2EXYD 1A6ZB 1NMBH 4JPWH 1BZ9B 1S9XA 2ADGA 5CEZL 1I9RH 4JAMB 4X7FC 1HSBA 3VGBA 1LWRA 4PP8C 3QDGE 5FGCE 1AR1C 1YY8B 3TESA 2J1KA 5DT1L 3K1DA 1VB9A 3GJFK 3GFUA 4JDTH 5F88B 4N8VB 3WXVH 3GMPA 1GOHA 1YMME 2MKLC 1OTUC 3RU8H 2IF7A 3C5JA 4ODWB 1YN7B 3PABA 5HGHB 1I1AB 3ARBC 3NA4A 1FL6A 3P77B 4P57B 4ZFOB 3ROLB 3G5ZA 4RAUB 3O4LD 3L3OB 1MHEB 1HYSC 4MNQA 5IBUB 3ROOB 3VXRE 4OZFG 4J23A 1P7KA 4F8TA 5JOPD 5E8NB 1N59B 5GJSH 4KMTH 2NX5A 4JZOB 3Q5YA 4LSUH 4E9LA 1OHQA 3MREB 3SBWC 1RVFL 4BFIB 3SE9H 4CVWA 3A0OA 3LKPB 4XNXL 1AI1H 3G5YA 1FV1B 4KRPC 4ZFZB 4ONHA 3W9EA 5K33A 4KK5C 1YYLH 4CN6A 1MCLA 4PJHA 1R24B 1UC6A 3IJSB 4Y5YB 3E2HB 4J3TA 2I27N 2UZXB 5KSBA 5E5UB 5C70A 3CD4A 4OB5H 4WI4A 4WNQB 4ZUUB 3UPRA 2E7CA 3O3UN 4URTB 1M4KA 3HE7A 3V6OA 4A2LA 4X6DE 1MAMH 2P1YA 1FG2B 3AB0C 5F1NB 1ONQB 3VFSA 4JGUA 2GW5A 1HK6A 1HH6A 2OSLA 3ARED 4LPTA 5AUMB 4LMQE 5C07D 1LK3H 1IT9L 1EFXA 1JGLL 2MKWA 2V2WB 3MPCA 1VACA 2NY2D 4PJFA 1BVKB 3GK8H 3KYKL 1WBZA 4KMQA 4XTRC 5ICYA 1X4ZA 2YA0A 3NVQA 3U4EB 4NRZB 5SWZE 1H3VA 4Z7WA 3LHPL 5HYSB 4LSSL 4IIQB 4OF6A 3BKJL 5CJQH 1JF5A 5IBLC 1EO8L 5FF6A 2Y06L 4POZD 1DQLH 3PNWB 4YK4B 3SDCD 4F3FA 1MCPH 4IJ3B 5FV2A 4KHXL 1GPOL 3QHFH 4XVUC 4KZDH 1ZVYA 3VFWB 1A4JB 4EN3A 5LCVL 1DUYA 4MHHG 2YUXA 3BKCH 3AAZA 4ZTPL 3TCLA 1RJLB 3GMMB 2BY2A 3BI9X 1MQ8A 3MACH 2HAZA 3W81A 2VLRB 5JXEC 3RVUC 4GG6E 1IC5L 1CDGA 3IETA 3QR2A 1A02N 1AP2A 4YHYB 3L95B 4HWBA 1Y6KR 3QI9D 3HC3L 2SEBB 2J8UF 1A7NH 3BH9B 3MRJB 2I24N 3MLTA 3MRBA 1M05A 2V9RA 4JG1L 1VEOA 3WIFA 1TZIA 3ARUA 1D6EB 2PCPA 3IDNB 4P2OD 2HFFB 4K3GA 4CRPA 3KLHC 2BSRA 5IOPB 1LEKA 2CKBB 4OFKA 4PY8J 5CZVH 5J12B 3RNQA 5GRUL 2OMNA 4AH2B 3RWDB 1IGCH 2BNQA 3SDDA 2Y36L 1JF1A 2OXGA 1KC5H 3JTSA 1FN4A 4TSCH 4KJQD 4HLZG 5ANMA 4Q97A 4I77H 3DETC 3E3QE 2BC4A 3I02A 3RL1B 4HIIA 1IGTA 4ZMAT 2DQCL 5C0ND 3T4YA 2Y72A 4FS0A 1UG9A 3HB3C 5I1AA 3I6GA 4I48B 4UDTA 3HC4H 1F3DJ 3DV6B 3OF6A 4PUBL 3K2UL 3G9AB 5C0CE 5M7QA 7CGTA 1DL7L 3MJ9L 3QXDA 4JQVC 2BX5A 2D0GA 1CGVA 2ZUTA 1SVCP 1MJ7H 5ENWA 1J1XL 5HHXH 3QNZB 4DK3A 4P2QA 2BVEA 3EYUL 1ZHNA 1XAUA 1V05A 5ETUA 5E99H 2BOCA 5EO1B 4GRWE 5ITBH 5T3XL 2FNBA 3P30L 1BQHG 4FMKA 3TBWB 3X14B 4DAGL 1LEGB 2PN5A 4Q6IA 5GRZA 1NCCL 4K2UH 3VXUD 4EDWH 5FK9A 3PWUA 1WT5A 5A2LH 3BIBX 5IB4B 4U0RC 4HWUA 4OZIB 5KBNC 4GW5A 4JKWA 1ZVSA 1YEEL 4G6ML 4X7CC 5DFTA 4NRYA 1DE4A 1NGPL 2VAAA 1IL1A 1PKOA 2GK0B 2FX8L 3T0EC 2DF3A 3O3AA 3BWUC 3ARWA 4XX1E 3QXAA 5EOCH 1NDMA 3CH1A 5J1SC 4XMPL 4NBYB 1ZLVK 5BXFA 2NYYC 3M1BA 1Y18B 4WENB 2PF6A 1U6AH 4H8WL 3GSVB 1HHIB 1RUPH 4DKEH 4ENEC 3BRGC 3VFPA 2W0PA 2CLZA 5DA4A 3WO3B 2G75B 3PP4H 4M7JH 4C56A 5JHDE 2VQTA 5JIIA 3BGFC 3CK0H 3K0WA 5C09A 3LEYL 5GS0L 3ECBB 2IWGA 1OGAE 3BIKB 4GMTH 4ZYKB 1H0DA 3PUCA 2P5WD 5J0BA 1AXSA 1T2QL 4FQHB 3O2WL 1FO0L 3SKOB 4NBZB 4PJAE 2OR8A 4YHOH 4JFHE 5I6XB 1VESA 4S1SH 3GSOA 4K7PY 3IDJB 3EOAA 3L3JA 3W9DA 4N8VG 2FGZA 3OKNA 2BNRB 4FXKA 3D69B 4HX1B 1FNFA 3IAQA 2FZ3B 4Z7VA 4L1DA 5H2BB 4XWGL 5FXCH 5EBMA 3RUGA 2HJLA 4HKBB 2D4FA 3D85A 5ICZB 4MCZA 3B6SB 1U3HB 1XIWB 1JHLH 1PX3A 4NOFA 4P5MA 1AC6A 3RWIA 4HKXB 1QBLL 2EE9A 3RVVC 5E8OA 4M43L 1MFCL 1MLBA 4LIQH 4L8BB 1JNNL 2JLLA 3WD5L 3I3DA 1JVKA 5JR1L 5B8CC 2CR6A 2G9HB 1KCUH 2UUDH 4JZNA 1ZS8B 2DB8A 1E6OL 1AGEA 3MODL 4NQXA 3HCVA 4D9RE 5TE4L 1NDGA 1MFDL 1X44A 2VDLL 3IFNH 1GSMA 5BRZB 3WHE0 3SGEI 4OM1H 3ZL4H 1FPTH 1FL5B 4JANA 4UDUB 2P8LB 5F44A 1ZGLB 2EDEA 3H9SB 4TYUA 4HIXH 3ARGC 1R3IH 1WZMA 4S2SB 3C6LD 2GJ6D 1DZBA 3QFJA 2ZSVB 3RPIB 4YUEH 4Y4KD 4E41E 1LO3L 4G9FD 1JFQL 3IS1X 4WGVB 2AABH 4PJ9B 4GKNA 5F8RC 1I8LA 1X5XA 3OKOB 1KUMA 5HYSG 3BKMH 5FYKH 4FABH 5C8JB 4HULB 1MY7A 1QSVA 4LPVA 4L3EA 1OSZB 2MCG1 3ZYJA 1U2CA 4YPJA 5D72H 2ARWA 2V6HA 1E4WL 1LO5A 4MDJA 1KG0B 5F7EH 1OARH 5IF0B 3DXAD 4HJ0D 3CC5A 2V2TA 3GI8L 5T1LA 3RNKA 3WFBL 4S0SD 1JPSH 3OAUH 4K3JL 4OFDA 1K4CB 4TOYH 3VXQA 3DRTB 2XN9A 3O11A 4MNQD 4NKIL 4HFUH 5BCAA 2EDKA 4OAWB 2C7UA 3B8YA 3G08A 3PWJB 3SGJA 1MFBH 1OQOA 3BWAA 2AP2A 2PO6C 1HOCB 2EH8H 2ESVE 5I71C 3BH8B 1KJ2A 2DRUA 1A7OH 5EIIA 1KLFA 1HN1A 1T0MB 3MLWL 5EU4A 4QHNA 1K4DA 3R06B 3VA6A 3DVNA 1A7PL 4UUJA 1BWMA 2XA3A 3BKYH 4P99A 4HC1H 3JVGC 4DKAA 3MJGX 4TSBH 4X99A 4EDXA 3GMQA 3RY6C 1X7QB 4D0CB 5TE6H 1KIQA 3VFTB 4YBQC 3TYFA 3IJYB 4M6ML 1U8HB 4KWUA 3DX8A 4AEFA 3HE7D 1KCVH 4X9GA 1XF3B 3D18B 4M3KB 4WCYL 5BV7C 1CICB 4O5LH 4XVJL 1KB5A 3ULUL 2EH7L 4BQCA 2IALB 3BT2H 1RJYB 2K3TA 1WFNA 5EZIH 4HHAB 3ZO0A 4I0PB 1S7WB 3PQYB 3MYJA 3WIIH 4NZTL 1S7UB 1KNOA 2OMBA 3I85A 1KT2B 2DQGL 3LS4L 4GJTB 4QYOB 4MB4A 1SBSH 1UKSA 3Q6GL 3SCMC 1DTUA 4ALAL 1CDUA 4DZBA 5GRJH 1T20B 3P4LA 1C7TA 4Z7UE 1A7RL 1C5BH 1FGNL 4GUPB 2FLBT 4G7VH 4NQDA 5E94B 2QQLL 2GFBA 3L7FA 3BESR 3PDGA 3T3ME 3P4NA 3BO8B 2HG5B 1UJTA 4OZGB 4LDOB 4OGAC 5K9KB 3V6FB 3C6SB 1NBZB 4L8DB 3LS5H 4EN3D 3ARFB 4M4RA 3GBNH 5D5MB 3HG1A 4CNIA 2XICA 5DQ9B 2NY3D 2D31B 5EZJB 1DP0A 3K81A 4P23A 4YGAB 3TN0C 1G0DA 2I5YH 3AU1A 2CUIA 2B5IB 4KI5E 5D7SL 4LVHC 4WWKA 3O6MH 5E6YA 3SGKC 4XB7A 4MA1C 3HZKB 3W2DH 4AJ0A 3ULVE 1LHZA 1JWUA 4QCIA 4GG6F 1K2DA 2X42A 3P9MA 5F1KC 4XAKE 4ZDHA 3CUPA 5ID0B 3CFCH 5KN5B 3ZT5A 1BECA 1ZKAA 4X7TB 1TQBB 4KVCL 4MD4A 4Z0BL 4ZSOA 3QEQB 3LN4B 4YHIB 2P8MB 4M7LL 4QRSB 5DJ6A 4WTZG 3VI4E 4CMHC 4CVXB 5BW7C 1YN6B 4I0KA 4G5ZH 4LLUA 2BNQD 3SDDD 5IB3B 1INDH 4OF3A 3G04B 4ZUWA 5DMIH 5BZWB 4QRPA 2WBJC 1W72L 2XKSA 4LU5L 4QHKI 2X09A 5C7XL 1BP3B 3A6OA 4JFDA 2VN7A 4E5XA 4L9LB 4OZFA 2H41A 2VLKB 3LZFH 1U8MB 2CIIB 3O3DB 2Y5TA 3OF6D 3QUXD 4HIJB 3MRHB 4HK3J 1LILA 2IPKA 1LP9E 3PP3K 5JNYB 2VDPL 4WU5B 2VYRE 1NCAL 7FABL 1YNTA 4LCWA 3KS0J 2X4QA 3OKEA 5HVGB 2B0SH 1TCRA 4PP2B 3WUWB 1XT5A 2EKSA 2VDKH 4IS6A 1AH1A 5D7IF 5KVDH 4NNPL 4N90D 1JL8A 3RIAK 1AJ7L 2UZIH 5DMKB 4GRWF 4DCQA 1QBBA 2R39A 1FZOA 4PY7A 1XCTA 5DGRA 1OM3L 2CJUH 4TQEL 4PB9L 5LGHL 3BD4A 4HZLB 3ZYZA 1OTTD 2ZCKH 3DGGA 3KPLA 5CIPH 4YHZL 4OLVH 3F12B 4M5ZH 2AXGB 4FZ8L 4BJLA 2EDOA 3H7LA 4JJ5B 2IPTL 2APWA 2Q8BH 4D9QE 2NW3B 5BZDB 3TF7C 3KPRB 2QADC 3BYYA 2QSCH 4ETQB 1EXUB 3TVMC 2G2RA 4ZD3L 4OTXH 4OD1H 3MOAH 4X4ZA 5L6YL 1RZ8A 4E42A 2JJSA 3T0EB 4LCCC 3T8XB 4ZQKA 3X11A 4C56D 5AG9A 3CVHA 1IE5A 1QFWH 2X4RB 2JTDA 4ZS6C 1DANT 1QSEA 3EDFA 5KZCD 5C09D 3BPLC 4B50A 4TUOA 4JFZH 4NYLB 3D2UA 2B1HL 4PRAA 1BZQK 2AXFB 4P3CH 4TNVK 4WV1A 3RWHB 1FNEB 1X5JA 1CXIA 2VC2H 4HXBL 3FHAA 4FP8H 5E1HB 2J2ZA 4A6YA 3B2VH 1FYTE 1NCNA 1OB1B 1G9NL 4RDQG 1BBJA 4PJAF 1ZHLB 3CLEL 1XGYH 1RUAL 1XF5B 4RISL 2PXYB 3HFMH 1KLUA 2XTJE 3VRLE 2F54A 4H5SB 5C0JB 4NSKB 4QRUB 2DQIH 4NQEB 4UINH 4IRJB 2VLJA 2P8PB 1AHWB 2FO4B 3D85D 1YEDB 1CFSB 4XI5D 1HHJA 3U46A 5L0QB 4RGOL 5FUOH 5C6TL 5HHOE 2BERA 1IGYA 3O0RL 3PWPA 4QHLB 3WSQH 2WBKA 4O4YL 3NIDE 4N8CL 4MMXC 5DD5H 3QPQC 5FM5O 3UX9B 4IM8A 5J7CC 4Y16B 4WW1A 5ESVA 3UTZA 4MD0A 2W9LA 1NEZB 4QO1A 4LNRB 2IEPA 2DBLL 3FT4B 3HPJB 4M7KL 3WEXB 1MCSA 5D1ZA 1BIHA 5ALBL 5CJXC 4IDLA 1UACL 5CHNB 4PLNC 1HKLL 2ICES 3VG9C 1ZSDA 5L9DL 4XBPB 4ZUSA 4AYFA 5KSAB 1YQVL 3CFKA 3IFOB 4YPGB 5IFAH 2XWBB 3FZUD 1GGIL 1KCKA 1AXIB 1GGBH 1XF4A 2EE6A 1PYWB 2VQUA 5I1GH 1EERB 3QFJD 4FFZL 5KS9A 4UV4H 3JTTA 3U0WL 3EOBA 5FIEA 1JYXA 3RBGA 2PYEE 2IPUK 1HE7A 1SMOA 3TH4T 5F1IA 4HCRA 5C0AB 4Z8FL 4M48H 2YBRA 3TJHA 1CK0L 5EFIA 5DS8A 3GJFH 1R3JA 4WUUA 4ELKA 1OTSD 4L3ED 1QQDA 1T83C 1F2QA 4RQQB 4HWNA 1WTLA 1HQ4A 4JY6B 5FOBA 4JO3H 5EUKA 3RTQA 4XC3H 2GSGA 1RUKL 3PE9A 2KH2B 3T4AB 5IHLB 1Z3GH 5D93C 2GUOA 2EECA 5EZOL 2QHRL 3BP6B 5CZKA 2I07A 4ZTOH 3OSKA 5T1LD 4RGMC 3KPSB 3QXWA 1CLOH 1WFTA 4QOKD 5E6IC 3IDUA 3QHZL 4XRCA 2XN9D 3TT3H 1PFCA 3BW9B 1A6ZA 5DRWA 1TVBB 1BZ9A 1E4XL 3RDTB 2B1AH 1RZJC 2CR3A 3KWWA 1L9NA 1QLFB 2WLZA 2OJEB 5JORA 3GSNH 3VFNB 1BD2A 4Y1AA 1UFUA 1NAML 2P24B 3QEUB 4PRNA 4XP6H 4PV8B 4ZAKC 1FBIL 5LQBL 4HUXB 4GRWH 4G8IA 1JUFB 3DX9B 1U58B 1P4IL 1UGNA 1YN7A 4R90L 4U6HB 4ZO7A 4F7PA 5HGHA 1I1AA 3WLWC 4P57A 2BRRL 3TH3T 3ROLA 3GHEL 3L3KB 3L3OA 3ROOA 2A6JB 5BVPH 3KR3H 5ESQB 4IOFD 2FECL 3CSYB 3PV7A 5E8NA 2JELH 2XZCL 1CCZA 1BFSA 4S1QL 3MREA 1QSZA 1C5DB 2VR5A 4G42B 2EXWC 5HD8D 1C1EH 5IEKA 5A40E 1JHTA 3LKPA 4TTDD 5BV7B 5JLZA 1LE9A 1FV1A 5C2BL 1FNSH 3WUWG 2JB6A 4OCNC 3RZCC 4Q9CA 1LNUB 4JRXE 4L3AA 4QXGH 4Y5YA 1A6AB 2IBBA 1ZT7B 4LLWB 1MCOL 1Y0LB 1A3RL 1V3JA 4NQDD 4WNQA 4YIQB 5DHVH 2IBZY 4P9HL 1F58L 3WJLC 4Z7UF 1MCHA 3ZTJH 5CEYA 3NCMA 1FAIH 4HWEH 4NZUH 2P48B 4KPHL 3DO3A 3HG1D 4G6JL 1M7DB 2YRLA 3MRNA 5AUMA 2H45A 4O58L 3MV11 3QCUL 4R2GD 4NCC1 3GB7B 1MCBA 2OTUB 4JO4H 3UTSB 3CFDA 1U0QA 1LEIA 1LO4H 2D7TL 4WWKD 1X4YA 4XP4L 5E2VH 3V5HB 3ZE0E 1OAYL 4Q9QH 1UH3A 3QBTB 4KI5F 5C0IB 2Z4QA 1T89A 3U4EA 3CJJA 2R2HB 5EU7C 3ULVF 3GSXB 5JPNA 1UYWH 3CSPA 4HH9B 4OM0L 5L2JB 3CGTA 3DMMD 4GRLB 3VW3L 2VXTL 4JPIB 4NNXA 1T4KA 1SHMA 1A4JA 3GBMH 4ZFOL 1D5XB 3VI4F 1Q0YL 5CJOH 3GMMA 2NR6C 4Q0XH 5FYJE 4QRPD 1DVFB 2VH5L 5CIPB 4LSPH 2LU7A 1JGUL 4DGIH 4FQJH 3FAWA 3TT1L 3QDGB 5FUZL 5FGCB 2MOVA 3L95A 2X41A 2SEBA 4JFDD 4U1KB 2DMKA 2H26A 3QNYB 1A3QA 2IFFL 1EAPB 1NMAL 2EC9U 3KLAA 4PJIA 5FFLA 3SKJH 4UT7H 4K94H 3DSNA 1YMMB 3AS0A 1D6EA 4PFEA 5CEZE 4HPYL 4XHQA 1MPAH 2A1WH 3IFPA 5JMRA 3HS0A 4JJHA 2ZOLB 3W39B 1A4KA 5C9KA 3P9WB 3RWDA 1LP9F 2DICA 2VXVH 4LCWD 4JO2H 1EHNA 1YPZF 2D3VA 3MCG1 3OL2A 4X83A 3VXRB 1R0AH 3GSRB 2YC1B 3O4OC 5DK2A 3VFRA 2NY1C 1MUJA 2Q7YB 4M93B 3I75B 1IEHA 1NEZG 1H3UA 4LRNL 5MEPA 3KYMA 5DHXB 1NGXB 5CGYC 1JBJA 1I85A 5DD0H 3MV8D 1N26A 4MA7L 3P11L 3N9GH 1YNKH 5I74C 5F7LB 3IB4A 1X5LA 5E2WH 3DV6A 4F58L 2X9YA 1HSAA 4OLXH 3O8XA 3QULB 1SEBB 2B20A 35C8L 1J10A 2XNAB 3TO4C 3KYAA 1DQQB 4LOUC 3V0AC 4J8RA 1OPGH 4PV9A 3KPOB 3WS6C 1BVLB 5I1HH 4X6DB 3UZQA 1KCGC 1BVZA 3H7BA 4B53A 3C9NB 1DLHA 4FQCH 2CXGA 3FFCE 3HZMA 3EDEA 4PLOB 2QADB 4WI6A 2VR9A 2R4SH 1F2XK 2DS4A 1N6QL 4I2XE 2R56H 2VDQH 5EN2B 2A77L 4HF5H 5GHWH 1UVQA 3D2UD 4H88L 3S97C 3T2QA 1AGFB 2HKFL 2DTMH 4NWTL 2HA1A 4GAYA 5DQDL 5TPWH 5SWZB 4NO2A 1A8JH 2DM3A 5IIEA 3HMWH 1IILE 1Q0XH 4JDZB 4Y5XB 4HJJL 1VGEH 2NPLX 4PGEB 4J3UA 4NO0D 4MB5A 1A6TA 3WDJA 1RZGA 1I9JH 4RZCA 2CKBL 3GSVA 1HHIA 2OS7A 3QAZB 4TVPH 2ZUWA 4RGNE 1NJ9B 5CINL 1DUZA 3QDME 2VLJD 2G75A 1A5FH 2YUWA 3QJHA 3OXRB 3D39D 3QUZC 4NJAL 4HFWB 3Q3GB 5T5NF 3VRLF 4IRSC 1TJGH 1PAMA 4GG6B 4WW2F 3BIKA 2PETA 1D5IH 1ZOXA 3PWPD 4ZYKA 1BEYL 1JPST 4EIGB 5D71L 3UDWC 1AGCB 3GJFB 3UBXB 3L5HA 3IDJA 1FZJB 2XZQL 3NPSB 4WI2A 5GRVL 1K85A 5J6GA 1IQDB 1FZMB 3TEUA 4RWYH 2QEJA 2BNRA 3D69A 4HX1A 4I8DA 3SQBA 5LVEA 4BZ1H 3NCFB 2FZ3A 1VSCA 1GZPB 4FOMA 1J18A 3GI9L 4YO0B 5H2BA 1S7XB 5IUSA 4ORGB 2VO5A 1GH7A 4ISVB 3IFLL 5ICZA 4Y5VC 4R8WH 5HGAA 3V7MA 1U3HA 1UXWB 4AENB 1TMCB 5CCKL 3OB0H 3WNNA 2ZWLT 2DIJA 2VLMD 3PIQB 3MJ7B 4HKXA 3L3IA 5DRZB 3VG9B 3FO2B 4M6OL 4LBEB 5GSRB 4FQ2H 4EBQH 2XYCA 3BYTA 3BQUB 3MLPA 4QXUH 5C0CB 5GGTL 4S11A 5E1AB 3EYVB 4KU1A 3TBTB 4PJEE 4HKJA 4AM0B 4KJWC 1ZS8A 3GSNB 3NABH 3ULVH 2LE9A 1V3MA 1MCRA 4XP1H 4YEEA 5D1XC 5BRZA 32C2B 2AV7B 3RX7A 4MDIB 3LOWA 3MLZH 4W4OC 4ERSH 4NQCD 4WUUD 3K8KA 4NNYB 5CJ5A 4KJPD 4FFEX 3EJYC 5E7BA 4GRWB 5FUCC 4UDUA 2V2XA 3O2DL 4LPCA 3H9SA 5KVEL 4FQIH 1CR9L 5CP7B 2AEQH 2ICWA 2L0DA 3GNML 4IDJH 4S2SA 5DJDA 4TTGA 1T22B 5JA8B 4N0FB 3C87A 5DVLA 5I1IH 1NBVH 5CD3A 3KXFE 4YHMH 3QDJA 5JUEL 5MERA 4JG0L 4OIBA 4RFNC 4PJ9A 3VXNB 4OCSL 2VDML 1QSFE 2FL5B 4TNVF 4HZAA 5ACZB 3N50A 1DLFH 5EUOF 4JHAL 2CSPA 3MRGA 4WFHE 4PJ7E 5L2KE 5C8JA 2R9HC 2YA2A 3MRPA 4BH8B 2DQJH 3MNVA 3EO1B 2HFEA 4Y1AD 2QQNL 1NLBH 2EIDA 4OGYL 5JZ7D 1QLRB 1GIGL 1YJDH 3TBVB 2NCMA 1HHKA 5JHDB 4F57L 4MNGA 5DHVB 2MFNA 1KTKE 1IEBB 4YR6B 2ZUQC 4M1CD 3P0YH 4G8GE 1W0WB 1HDMA 2OP4L 1ULVA 2EXYC 4ODVL 1OGAB 1WGOA 2XQYK 4ZOEA 4X4YA 5TQ2L 1I1AD 3C60B 1CE1L 1I1FB 3DBXB 2O5XH 4X6BA 1FIGL 1K4CA 5FO9B 4XPFL 4PJAB 5HI4D 4PRIE 4WFED 1MCJA 1T1XB 4JPWL 5J13B 4LLQB 4PS4H 4S10A 2FIKA 4UOJA 2GCYB 3ARBA 1T80A 1YDPB 4KQ4H 3IU4L 4PJCA 2FRGP 4G3YL 1CVSC 1X4XA 4B41A 4H1LH 4PJBA 3R06A 2GI7A 1P5UA 1BX2B 1P7QB 3WXVL 1YEJL 3SJVE 1R3KB 1G7QA 3EYSH 5DJXA 3RU8L 4PP1D 3PGFL 4ODXA 5HJ3B 3SBWA 4LVNB 5JW5B 3DARA 4LHUB 2APXA 2BRQA 3VFTA 4OKDA 2GT9B 5FGRA 1RIHL 3I84A 1NMCC 3T0XA 1XF3A 2W0LA 4PTUA 5AAWA 3U0PB 2V9TA 3LRHA 4H26A 4KMTL 2IALA 2NY5L 4LSUL 4BELD 5EG6C 1RJYA 1PQZB 3MBXH 4HHAA 5ELIA 5ITFB 1S7WA 2AEWA 4UIMA 3L1OL 5D8JH 1UJ3C 2BMKA 3TPUE 1AI1L 2EYTA 5ACMA 5E6ZA 3GIZH 1G7IB 2WMPA 3ZE0F 4XNUL 12E8H 4NT6A 5IB1A 5I0ZA 4GXUM 4GUPA 4YNYB 5LXGH 4OB5L 3AREC 1KTLB 1MELA 3HKFA 4E41B 3BO8A 1M7IB 5ISZE 1RJZB 4OZGA 5K9KA 4RIRA 1NBZA 4L8DA 1DANU 3ARFA 3LKOA 2X4TB 3NZHH 5D5MA 1CYGA 2DD8H 3IU3A 3VXSE 3MV01 5JW4N 1I3RA 3AMLA 2C4FU 5F9DC 3GUTA 4L4TE 5FA4B 4NGHH 3T09A 4UTAH 2VLRD 3GK8L 5GPRA 4GRMB 3PP3H 4K8RC 2R0WH 5E70A 5T3ZD 4POZC 4L8CB 1FFNB 4M02A 3HMXA 1TPXB 1YYMH 1DBKL 3I6LD 3V0VA 1F90L 5ID0A 5KN5A 4PGCB 5KTEL 5K9OA 2IG2H 2OTWA 1UZ8B 2DQTH 2E9JA 3QEQA 4NM4H 3LN4A 1MCPL 2OZ4A 4YHIA 3QHFL 2YZ1A 1EGJL 4CVXA 1MCIA 3U0TB 4KZDL 3ARYA 1UWGH 2ARJB 3P4OB 4O2FA 5HHNA 2DKSA 4C55A 5GGUA 1PZUB 4UB0H 3FQXA 1NCUA 3U6RA 2X7LB 1CXEA 2ESVB 3VGAB 1QA9B 5C0FA 4D0BA 4OLWH 4XVSH 5E03A 1A7NL 3AS2A 4U1IA 2YS4A 2VLKA 2FCBA 1ZXQA 5D70L 1EJOL 5FHAL 4WY7H 4HMEA 5DQJB 2D4DA 2P7TB 4O2CB 3C09C 4N0YL 2NXYB 1OAZH 1AR2A 4C58B 4WU5A 4GQ9L 4OT1L 1TQCC 4KJQC 1I8MB 2C3WA 2HRPL 5DJYA 2H3NB 3P0VH 1Q9OB 5GRYA 3S96B 1E6JH 4PP2A 1KC5L 4O2EB 3I50H 4TSCL 4JQVA 3QQ3B 3QZWB 4MLSA 4PLJD 4Y2DB 5HHVH 5MI0B 3GM8A 5EOCJ 5DMKA 1T5WB 3NZ8B 4N0UE 1N64H 5C1MB 4RFEA 5IVNA 1REIA 2HFTA 4KMLB 5FYLH 1I3GH 4YDVA 3VWKC 4YDKH 3HC4L 1I8KA 3QO1B 1P4LB 2QBWA 1E28A 3EYQC 1IM3B 1ZLUK 2DYPB 2DDQH 4Z7UB 3D0LB 3KJ6H 5F7UA 3IDGB 2HTKD 4XC1H 4BQ6A 3CFJB 4WJ5B 1JI1A 4ETQA 4PJ8C 5JIHA 1FL3B 2YN5A 3VCLB 3HHRB 3PL6B 2GY5A 5TDOB 4Y8AA 4V1DA 1JPTH 1IC4H 4QHMB 15C8L 1HH9A 3MUHL 3T0EA 4K71C 3EGSB 3EO9H 3T8XA 2ZG2A 1QRNA 1GRWA 4JVUA 5DTFA 5C0BE 1VKXA 4LLDA 2DWDB 3IRPX 4LASH 1INEH 4ODBD 3D3VA 1NCWL 4P4KB 4UIKH 3RWHA 4OF7A 1F3JA 3EFDH 4YBLB 5IFHH 3LQZB 1F4WH 5I1DB 5EOCL 4FQXB 1IKNC 3TIDB 1R5VB 1MFAH 1XF5A 3FT3B 5IB2A 2BNRD 1MY5A 3NACH 2AI0L 1RUPL 1CZ8H 1NC4B 2I26N 2WP3O 5DFVC 4X80H 1YUHB 2F19H 1ZV5A 2P8PA 1AQDA 2IANA 5CS7A 1O0VA 1AHWA 4AIZA 2NNAB 4L4VA 2R29H 1U3HD 1A1MA 1YNLL 2W1NA 4PGBB 5EBLA 2OL3H 4OF0A 3IXAB 1N0LA 4GMTL 4U1LB 2IBGA 4KZEL 2IQAA 4FZEH 1J0IA 3ISWA 1SJEA 3MO1B 3BMWA 3BPOC 1N5AA 4YHOL 1AIFA 1RK1A 4XH2A 1MI5E 3OJDB 4S1SL 1FC2D 1I7RA 4FRWA 1NEZA 2LQRA 4AEHH 1LP9B 4LNRA 4L29A 4U1GC 5I66A 4DN3H 1ETZB 3ZT6A 3FT4A 2MCPH 3HPJA 1MIEH 5BRZD 4PJEF 4DVRH 3VG0H 4LHUG 2ZP0T 2VZ1A 3HAEH 1GVIA 4XBPA 2JIXB 2AJYH 1WCBB 5DD6B 5KSAA 3IFOA 2IAMB 3H9SD 1IAIL 2NY6D 5SX5K 2PTUA 1A64A 4ETYA 3VGGA 2O61A 3SEPA 1PYWA 5C0RH 2VZTA 5FYJH 3BFOA 3WFEL 2AJUH 4LIQL 1ED3A 3WXWH 1H8NA 2QR0A 4TUKH 3O3BB 1UT9A 2Y7QB 1BGXL 4XPBL 2XI9A 1MFEH 1YEFH 4PJ9D 4XMLH 3GIVA 3IFNL 3QQ4A 4H1LB 4MJIE 3PJSB 3L5IA 1CBVH 6FABL 4OM1L 1GC1H 1KN2L 3CIQA 3ZL4L 5DC0A 4I4WB 3C6LC 5CEZH 1FPTL 5F3HA 1YQ2A 3VFMB 4HMDA 4Y4KC 1KPVB 5DMGD 2DL9A 5FKAB 4ELMA 1A2YB 3F7YA 1WZ1L 5IWLC 1MLCA 4KTEL 2E9WA 2B4CC 3BP6A 2VAJA 4YUEL 1T7YA 1KEML 3KPSA 4Y4FB 2NXZB 1D9KB 3MCKB 4R7NB 4K23L 3BW9A 2XXMB 1FYTB 1TVBA 2ZUQB 2FH8A 2GHWB 1D7FA 3D25A 1BOGA 5D7JB 3DI2B 5KOVC 4FABL 5FYKL 2MQCA 3B9VA 1HYRC 4J3SA 2XTLA 3VFNA 2XTJB 1OL0A 4HJ0C 4M1DH 3JV6A 1HILB 4PJ5E 5I1JH 3QEUA 4WW2B 1H8OA 3EHBC 3MJ8B 3IKCB 4PV8A 4X7DC 4YHNB 1OARL 3O9WB 4XNXH 5F7HA 2PO6A 1KYOK 5TDNA 5HHOB 3DX9A 5ALCL 2GTZB 4NQSA 3P73B 1WBXA 3DRQA 2E7HA 1JPSL 2VN4A 1IEAB 4TOYL 1JPFB 3L3KA 2I25N 4PGJA 5E00B 4U1SB 3FQRB 5ESQA 3JVGA 3CSYA 3CU1A 2H8PA 4X4ME 1U95B 3BZEB 1TZHA 1CD1B 2D7MA 2EH8L 3HE6B 4OZ4B 1A7OL 1C5DA 3O6KH 2K1MA 1JRHL 2Z31B 1IT9H 3STLA 1NMCB 1JGLH 4PJDF 1RUMH 4YH6A 4U6XB 3B43A 4HC1L 3KYKH 4HD9A 3STZB 1PVHA 1JK8A 4TSBL 3HE7C 3ARSA 1DR9A 4Y88A 1UZ6E 3MUY1 3LB6C 3BVNB 4UU9B 3T04D 1I1YB 3ULSB 5E5MA 4WI7A 1ZT7A 5C0DA 1Y0LA 2GAZB 2PW2B 4TUJB 5INCA 5HHME 1L6ZA 2UZYB 3BKJH 3H3PL 1WWCA 3E0GA 5CP3H 1EO8H 2DL2A 1KCVL 1MAKA 2PYEB 1R3HB 3OKDA 3ZE1F 3SCMA 1GPOH 3ARFD 2XY2A 2L4OA 1M7DA 3BT2L 5IVZB 1J8HE 4R26H 4XCCH 3GB7A 5LCVH 3ZHKA 3FRPA 3UTSA 3WIIL 4JHBA 3VMOA 2VABB 3V52H 4XVUD 3EOYG 1G0XA 4FXGB 3DYMA 4DKFL 1EEUA 2MHAB 1IC5H 1SBSL 4APQB 1BZ7B 1NFIB 4IHOB 4ONFH 5AD0B 5GRJL 4PRPE 3MA7B 5DEZA 2J4WL 3TN0A 4BUGA 1C5BL 3IAGC 5H35B 2CH8A 4G7VL 3QEQD 2FYYB 3NOIA 3SGKA 5HPOA 2JK5B 4MMZC 3GBNL 3LPGA 4BYHA 3KLHD 2Y36H 5GS1C 3RIFF 4QLRA 5BW7A 3KPMA 3O6ML 4JKKA 4H8WC 3W2DL 2CLRB 3P4MB 2CPCA 2VLKD 3QNYA 4PRBB 1FNHA 1CXFA 4W6YB 5GISH 2DQCH 3PGDA 1AKJB 3ILPA 3SDDC 2A83A 4QWWD 2HJKA 2FHFA 4OD3H 4PUBH 3K2UH 5GS0C 5AYUH 1UH4A 3IXTB 1NH6A 4G5ZL 5DK0B 3VMPA 2YD1A 4KDVA 4G9DB 1KPRB 1INDL 3EYUH 3NTCH 2ZPKL 2QQKL 2VIRA 1U8KB 5DMIL 3VGHA 4M7ZC 1MHPL 3U30B 2NTFA 4OLEA 3I75A 5D2NE 2DN7A 3WHE1 2N1KA 3QUXC 1NGXA 4DAGH 4MNHA 4HUWA 5DRXA 3I6KA 3E6FA 1RZIB 2UY7A 2VISA 2A9NL 2PYFA 3FQNA 2J88H 5CKGA 3U7YH 3ES6B 4G6MH 4JRXB 1HI6B 1NGPH 5GGRA 2DQEH 2FX8H 2RAMA 2XNAA 2R1XB 3I2CH 1DQQA 5F70A 5D2LA 2C4XA 3KPOA 3M45A 1J0YA 5JOPE 2Z92B 4XMPH 2H32H 4X6DA 3OB8A 1MWAA 2VDKL 2OL3B 3BN9D 4G80B 2WK2A 1EAJA 1OTTC 3T0ED 4JQIL 5FO8A 1FJ1B 3HN3A 3ZDXE 2UZIL 3HNSL 3C9NA 4WUKH 5EC1B 1UH2A 1F3DH 3NFPA 2CJUL 5KSUB 5KJRH 1DBJL 3BEWB 3TVMA 1JWSB 1TVDA 3AMKA 3N1MC 4KKNA 4NZRH 1XMWA 1H8SA 3AM8C 3D3VD 3T0BA 1CG9A 4HUVB 2ZNWA 4LCCA 4U6YB 4UOW0 3CVHL 4KROB 2Q8BL 2R0KL 3KYOA 3G6JA 1C5CH 1T2QH 4BFEA 1FO0H 3HAEB 2FBJL 4JDZA 5DI8B 2W60A 3L3HB 2X70A 4C57C 5F96L 1B9ZA 1K8DB 4OBRA 4PB0L 1KPUB 3S36H 1BAFL 1RIUL 1UB5B 5C07E 4NOBA 1C08B 2ITCA 1T7WA 2RQ8A 2IAND 3OXRA 3P2TA 4XWGH 1DN0A 1IBGH 1WBYA 4PRDB 2X2YA 4L4VD 2F53A 3GGWB 1QFWL 5E4EC 4OLZL 2A6DA 1FDLL 3WFHA 1LD9B 5F9AC 2FX7L 3QQNA 3PHSA 2DKUA 4P3CL 4PRHE 3OKMA 3LSOB 2JCCA 2Z91A 1C8PA 4JFYA 1XR9A 2VC2L 1B0RB 4FP8L 4Y16D 3UXFA 1QBLH 1HINL 3JWNC 4M43H 1RSFA 1IQDA 1ZT4B 3F7QA 2CMRH 3FB7B 1A6WH 2D03L 2APFA 3S4SB 3HFML 4Q74A 3RVVD 1E6OH 3SKMA 2A73A 2YUZA 1GZPA 5TE4H 2VDLH 4ORGA 1S5HB 4UINL 3ZKSD 1HQRB 4ISVA 5KSAD 4KI1A 5MEOB 4F7MB 1PY9A 1Q38A 3DO7A 1B3JA 3ZYIA 5FUOL 2YD8A 1KACB 2FDBP 1EX0A 3EO0A 3Q0HA 5CJXA 3WSQL 4OFYA 1ZMYA 3LVEA 4P4RA 5DRZA 1MJUL 3FO2A 4CU6A 4LBEA 3CPLA 4WTXA 5EBWA 1M71B 3BQUA 3SPVB 4DZ8A 3ZHDA 5C0CA 5FEBA 2G5BA 4RMUA 2XWJA 1FVDA 5C0AD 1JFQH 3T65A 4IOIB 3FQWB 4N1EA 3FZUC 1A47A 3DX6B 5CKAA 1JYWA 1NANH 2Q86B 4LF3A 2Y5EA 3ALXA 5IFAL 1G84A 4NKOB 4BH7B 4JFFE 1OD7A 3UPAA 3FFCB 3ULUC 4NKDA 4Y19A 2J5LC 4X6FB 1T22A 3DGCR 5K9QI 1UXSB 4N0FA 5I1GL 1E4WH 4I2XB 3WNPA 3L5WB 4BFGA 1UCBH 5K59F 1T83A 2XIDA 3BX7C 3KPSD 4HGMA 4HK0B 4JDVB 1U8OB 2R1WB 3FRUB 5HGBA 1MCFA 1OTSC 4M48L 2Q76B 2ICEA 5I76B 2APVA 5ACZA 3WN5B 3RDTD 5I9QC 4NKIH 4AEIL 1F13A 1PEZA 2ZCHH 2W59A 4X9IA 4BH8A 4Z0XB 2X5PA 2LU3A 1Q9KA 4RGNB 1PEWA 3K3QA 3MRCA 3QUMA 3QDMB 3VXUE 5DRNB 5FM8A 5JHDA 4LGSB 4QXTB 4XC3L 1FH5H 4YR6A 1CQYA 1PKQE 1XGPA 1W0VB 5IMKA 4LVOC 3QFDA 1SJVA 3DROA 4Q9RL 1A9BA 3WL9B 2F8OA 3SE3A 3SGJC 2HLAB 2WNGA 3C60A 2AJ3A 5CSGA 1BF8A 4X6CA 2EC8A 4LKCB 3BGAA 4KJYA 2WIIA 1TTGA 5I75B 3V2AR 5F93C 2PTTA 5J1AB 1KCSL 3O6FB 3RGHA 4U2YA 2EDWA 4ZPVB 1ZA6B 2EH7H 4YBQD 3VXTA 3GSNL 3OX8A 3SE8L 5IEHB 2AV1B 1NAKH 4XP6L 5C3TA 4X6EB 2CIKB 3OGOE 5EC2A 2DQGH 2HT3C 1OD9A 5HGDB 3FHQA 1YZZA 5JW5A 4LHUA 4HG4K 1QHOA 5E2TL 4G43B 3BDYH 1UZ6F 2GT9A 3UTTA 1A7RH 2VQ1B 1RZKL 3NCYS 5BVPL 3KR3L 3VRJA 2GITA 4RA3A 2EDLA 5HD8C 3U0PA 1CFTB 3SCMD 3RZCA 4KUCD 4PJEB 3CFBA 2JELL 4ZFGL 5DJ0B 4M5YH 4TTDC 2C3GA 4NUGH 4ZPTB 1J86A 3U48A 1VDGA 1W8NA 3CFEB 3K7UA 2X05A 3UTSD 3WJLA 2V7NB 3DSFL 1NGQH 4XCFH 1OGTB 4OGAD 5E8EA 1QD0A 1FNSL 3BZFB 5D7SH 3KNBA 1DQDH 2QHLA 1G7IA 4DEPB 4QXGL 1QUNA 3TN0D 5KW9L 1DEEA 3M17B 4UILH 3JWOL 1G1YA 5IKCA 1KJ3H 3WO4C 4R2GC 4KVCH 4E41A 1T21A 3HC0B 1RJZA 3KXFB 4Z0BH 1FZKA 3EJZC 4HWEL 4MX7B 4NZUL 4WI8A 4Y2OA 1QSFB 1RPQA 4JFEA 5CMAB 3FQUA 3GM0A 1NCDH 1I7UB 1ORSA 1DVFD 2X4PB 4PJ7B 5L2KB 4JO4L 5FA4A 1MF2H 3HAEG 1RK0A 4DUVA 2E6JA 4XNQB 1LO4L 4JE4B 5F9JB 4GRMA 3L9RB 5E2VL 4MSWB 3GRWA 4NCDA 3GMLB 5C9JA 4NUJA 2E7LE 4L3CB 3DMMC 3MV7E 3X17A 3UMTA 2EE3A 1XGTB 1X5AA 3UTOA 4EI6B 1NFDA 1YMMD 4L9DA 4HW6A 3RVTD 4GKZB 4G8GB 1WC7B 1UYWL 2J6EH 2H32B 4R97C 3Q48A 4YXLH 4XXCA 1ZAGA 2NMSA 1D5MB 1H5BB 5HHQB 3U0TA 2ZKHL 4HIHA 4L8SB 1QBML 4YHKL 1NCAH 7FABH 1CGSL 2ARJA 3RWFA 3P4OA 5C08E 4PRIB 2PR4H 5CJOL 5EU5A 3VXRD 4X7EC 4DK6A 5BO1L 1QEWB 5KSVA 3BPCB 5SV4A 4DGVL 4XGZB 1G9NC 4LSPL 4YEFA 4OI7A 2X7LA 4UTBH 3ZYOA 3QA3A 1KIRB 2ESVA 1R6VA 4NNPH 1QA9A 3ARVA 3KJ4C 2CDGB 4MHHI 4H25B 1FO0B 4TQEH 4PB9H 4G7YL 5LGHH 4RAHA 1XH3A 5J3HD 3SKJL 4K94L 1MFNA 2P7TA 3WNMA 3SJVB 2P44B 4S0UC 1MPAL 2A1WL 1FNGB 3B2UD 2B7DT 3DI3B 1T04A 4FZ8H 5LWYH 2HFGH 4KK6D 2IPTH 3DUSB 3FB6B 5HGGS 4JO2L 3SDXA 2C1PB 2DWEB 2NX5E 4ZD3H 5DDHA 2XA8H 3S5LA 5L6YH 4FQLL 2JJTC 2QADD 1IFHH 2BJMH 4I9WE 3ZDXF 3NFSH 3WS6A 4LVEA 4K7PL 1MEXH 1S7QA 3TPUB 5E2WL 2ATKA 3IS0X 3QO1A 4PJHE 1N8ZB 2N4IA 2B1HH 4XBGA 4M6AA 5I30H 3AXLA 1IM3A 1DQJA 4GKOA 4M3JA 3OKKA 3TA3B 5SWZD 4ZS6D 2ZUUA 1ZGLM 3D0LA 5HHPA 3V6OE 4ZXBB 3CFJA 1U3ZA 1OPGL 3LEVL 5I1HL 5ISZB 5TDOA 3T3PE 3CLEH 1RUAH 5SWSA 4YAQA 4RISH 5AWNL 3L5XH 5BVJB 1U8QA 3ALWA 5J11C 3VXSB 4WV1C 5HVHB 2F53D 2P45B 4G8EB 3TIEB 4L4TB 2NY4B 1JGEB 2ADIA 2AERT 4HF5L 5GHWL 4LEXH 5B3JE 4RGOH 5C6TH 4JM2B 5DF0A 2KQNA 2DTML 2YSSB 2HH0H 5F3BB 4Z7WE 3O0RH 5TPWL 3QUZA 4NN5C 4O4YH 4N8CH 5I1LA 1P9MA 2VE6B 4IRSA 5D1QB 4C83A 3MMEB 1TXKA 3BMVA 1R5VA 4OKVB 2DKMA 4XBEH 3N06B 3OTTA 1V8HA 1I9JL 3MV9A 1DCLA 4CDHA 1KBGH 4TVPL 3UDWA 1II4E 4AMKL 1QR4A 1NC4A 2ICWJ 3UZEA 5ALBH 3UEZA 1YUHA 4LPXA 1A5FL 3H0TA 1IAKB 4UAOB 1HKLH 5IR1A 3VA2C 1BLNB 1TJGL 2ZSWA 3ZDZE 4NQVA 1YQVH 3ZTNH 3HI1B 3IXAA 3O41B 1GGIH 5FGBC 3RJDA 4OFYD 3CCHA 5JPMB 1JE6A 3MO1A 1Q8MA 2DTSA 4YHPB 5IVXA 1A6VH 4BSWB 1A14L 3FT2A 4FFZH 4Y5VA 3BQUD 3OJDA 3U0WH 5C0CD 1QO3A 5F6HJ 5A2FA 3B9KB 1ETZA 2V17L 4BZ1L 2BNQE 3REVB 4Q58C 1J8KA 4WHYH 5ANME 1WCBA 4YDIL 5DD6A 5DJAA 3HUJA 4R8WL 3V7AE 1LVEA 3SDAC 2YK1L 3V4VH 5DJZB 3UP1A 1SY6A 3MZGB 3QWOB 1MCWM 4Y19D 5D1XA 2QSVA 4N0UB 2WUCH 3U36B 4W4OA 2YWZA 2DQFB 3EYOA 4FQ2L 3VGDA 1U8PB 2R2CA 4GH7B 1T1WB 5HY9A 5IHBA 3GEWB 1J5OH 3WFCH 4QXUL 5KVGL 4LLAA 5EZOH 4KC3B 4KJPC 4P2QE 1HXYB 3RKDD 3BPNB 2VUOA 4XP1L 2R0LL 1U8NA 2GKIA 3QHZH 4AT6B 1U8IB 5I19H 2B2XH 3ARQA 2IH1B 3MLZL 4ERSL 1G7PB 4PPTA 1E4XH 2E6QA 3U9UB 4UQ2B 2XG5A 4GAFB 2BY0A 4P9HC 4N90E 5FOJA 3F58L 4FQIL 3V5KB 5FA3B 2AEQL 5CFHA 5J57B 2H2PD 2LTQC 1DFBH 1KPVA 1JGVH 3V6ZB 3QUYC 5J9PB 5JHDD 4JB9H 2BOBB 3EYFA 5C0BB 4MQ7A 3U9PL 4H0GA 1NAMH 2VZ3A 4P9ML 3VGFA 2ED7A 1FBIH 3JWDH 3MROB 4QY8B 5I1IL 1NBVL 3CZFA 3C60D 1IC7L 4YFDB 2VSDA 2BRRH 2MSPA 3S3SA 4WO4B 1JNLL 2NY0B 4JY4B 1VGKB 4P46B 5DFWH 5DVNA 1XF2B 5T1MA 5IV2B 1GGTA 2DQJL 3QB7C 4JREB 1CE6B 4IRZH 4BFBD 4S1QH 2YD7A 1NLBL 1U3YA 5T1KB 2LVCA 1YJDL 1I1AC 2QTEA 1P7QD 1N5YH 3P0YL 3ARPA 1L4IA 4HH8A 2VOTA 5HHOA 5HI4C 2DLFH 2FSEB 5TE7H 3HZYB 4D9LH 3P73A 3F6IA 2EXWD 4LHUD 3MUGB 3MGTB 1BFOB 4KGJA 2O5XL 1T3FB 3MOQA 2OTPA 3UTTD 1JPFA 4WU7B 2NQCA 1MI5B 5GS2D 3ARDB 1EHLL 2RIKA 1FFPA 1CWVA 3R0MA 2KQMA 4PS4L 3BZEA 3C5ZB 4H20L 5AAMA 4Z7VE 4D9RD 4Y8DC 4KPHH 2VL5B 4QRQB 4KQ4L 4G6JH 3RUGE 1F45A 1XZ0B 4HS8L 4PP1C 3QCUH 2YPKB 2X1OA 2Z31A 1XGQB 4Y5YC 1CL7I 1GOFA 3E2HC 4U6XA 2J8HA 1MJJA 2D7TH 3EYSL 3J7HA 4U7KA 1OAYH 4UU9A 3L6FB 3ULSA 1NGYB 4GKSB 4JFQB 3MRIB 2GAZA 1HKFA 1JPGB 1DBBH 1AY1L 5E0QA 4NZJA 4E41D 5DYOB 3TBYA 4NM8H 2PYEA 4OM0H 3CFIC 3WS3B 2YEZA 3VW3H 3QEHB 3WNKA 4YE4H 3ESUF 4JFED 4KKBD 1OAXH 4MJIB 4DQOH 5E8PA 1H3XA 4YDJB 1T89C 4R7DA 3L3GB 1NSNH 4IIQC 4ONGH 3TZVB 3GSWB 2MHAA 1WISA 4QGTA 3TT1H 1XCQA 5FUZH 4IJ3C 3GIZL 5AD0A 3A67H 1IAIM 2BVPB 2YMXH 3QFJE 2IFFH 4CMMA 12E8L 1FNAA 3OXSB 5D7LA 5H35A 5I0DA 5LXGL 3PDOB 4LLMA 1VEPA 1B88A 1U36A 1BREA 2J3SA 1KJMA 4HPYH 3BP4A 4LLVB 3Q5TA 1QTYT 1VFMA 5FECB 1CQKA 5DD1L 3NZHL 3CVIH 4AL8L 4YHYC 4EI5B 2OZ4L 2UY6A 1EEZB 4L3EE 4UTAL 3FTGA 2ESVD 1NGWA 3TNNA 3JXAA 3CDGA 2J8UE 4KQ3H 4BSJA 1FCGA 5KG9B 2R0WL 9CGTA 4I1NB 3S35L 3QXUA 1YYML 4KXZI 5J12C 4PJ5B 3O3EB 4HUKB 3P11H 4NO3A 3MRMA 4NM4L 3VRIB 4F58H 1HXMB 3QIWB 4K7FB 3IXTA 2XN9E 3S37H 5DURB 4JFOB 3MR9B 5DK0A 1UWGL 3DURA 2VDNH 1I85C 2Y25A 2ZOKB 4TN9A 2FIRT 2BDNL 4UB0L 1EZVX 5TJWK 3G5VB 1QPPA 4HWZB 4WEUD 3CMOL 1G6RH 4W68A 3C5SB 1ZHKB 3GSUB 5ERWB 1HWHB 1UENA 2GSIB 1RZIA 3Q2CA 1S9YB 3RWEA 4NN6B 1N3NA 5DJ8A 3LQAH 4YXHL 5BQ7A 4WY7L 2WWKT 4H88H 3ES6A 3MRRA 3U2SA 2V5RA 4JRXA 4NWTH 3HRPA 5IM7B 3VH8B 4LSDA 1CLYH 4PJHF 5DQDH 4JKPL 1XR8A 2R1XA 3VWKA 5HHMB 5KSBF 1PDKA 4MWFA 4UMGA 4MJ2A 3PL6D 1ZA3B 1NBYB 2Z92A 4HJJH 1E6JL 3RWCB 1U91A 3I50L 5SWSD 2OL3A 1KCLA 3Q5OA 2CUHA 1FJ1A 4HEME 1G1CA 3RL2B 5T5FL 2R69L 5EWIH 3T3PF 3U4BL 3GKWH 5EC1A 5BS0A 2IC2A 2BVQB 1J8HB 1FLRL 2DLIA 5CINH 2Y6SD 1AO7E 3NCBB 1I75A 4PJ8A 3B5HA 3BEWA 5EORL 3TCXA 1GZQB 1OWWA 5FYLL 5I8CB 2AKRB 3E8UL 4YDKL 1PG7W 1TITA 5AYQA 4N0CC 4P4KD 3ULVD 2E7MA 3TLRA 3PHOB 2HN7A 3QUZD 1BEYH 3EIFA 3DTXA 4GT7A 4XAKD 4HS3B 4ZO8A 3LN5B 5D71H 1UA6L 4NQDE 2FHBA 4PRPB 4Z7WF 1KLGB 3HAEA 1BFVH 5DI8A 3FONB 1Z9OA 2WWKO 4O51B 4U1NA 5DA0B 3LKRB 3VI3E 3RPKA 3UJIL 1K8DA 4LPUA 3MV9D 3BSZH 1KPUA 1JPTL 4TNWK 4Y7MA 3HI5H 2MJWA 5DR5H 5IG7B 1NC4D 1UB5A 4OLUH 3SY0A 4OD2B 3BN3B 3NIFF 1IKNA 1JZ8A 5DUBA 4NIKB 5I6XC 3IFLH 4LASL 1XGRB 4NN7B 3ZDZF 5HI5D 3QEGH 2X4SB 3EFDL 3TO2A 4M6OH 5IFHL 4ZUTB 4ZSOE 3S3JA 4RX4A 2UWEE 1IGMH 1P2CB 4FTVE 5I8EB 4HKZA 1CIDA 3A6CH 3FB7A 4J1UB 1FSKB 2I60H 1IKFL 3PWNB 4JFPA 5ID1B 1U3HC 1XIWC 4GBXB 1RFDL 2DLGA 4HIEB 1S5HA 2F19L 2JIXD 1NAMB 1HQRA 5EOTB 5K9QG 2IAMD 4KJWD 2YPVH 1N0XL 3MLRL 3ETBF 5D2NB 2QJDA 4O9HH 2ORBH 3O2DH 1A1OB 3QIUB 4JFDE 1TIUA 5KVEH 1H3PH 3Q1SH 2WINB 3QRFM 2C3VB 2C1OB 4NKMA 1MCNA 2OK0H 1WFOA 3R1GH 1RV6X 4EUPA 1S8DA 5H37H 4PJXA 5B38B 1JHKH 2FR4B 3SPVA 3TBSB 1CFQA 3SDAB 3LY6A 3WFZA 2VDOL 4NC1E 1WEJH 5JUEH 4IOIA 4JG0H 1MCQA 1U92A 4OBSA 3TV3H 4MQSB 4DVRL 2VDMH 5IB5B 3DX6A 4XCNA 3IDIB 5CBEA 2Q86A 4XNZB 4ZNEA 3KPNB 1BIIB 3SDYH 1OP9A 2H2SD 4BH7A 3FFCA 2B4CH 1QFPA 4QNPE 2QQNH 4OGYH 4NHUA 1IJ9A 1GIGH 5C0RL 4NPYB 4PJ9C 5EOQH 4F57H 3C6LA 4GSDH 5D6CA 1X5GA 2AJUL 4PJGA 1Z0MA 3MRKA 3WXWL 3BD5A 5TDPB 1B6DA 1R5IA 4ODVH 4HK0A 1OT1A 4Y4KA 1SQ2N 1U8OA 1MNUH 2R1WA 1MFEL 3FRUA 2NXZD 4XMLL 1D9KD 4B7IA 1GYAA 4J3WA 4Z5RA 2N56A 4LSTL 1INQB 5I76A 1A0QL 3WN5A 5IWLA 3LKNB 5D7JD 1UWEL 1GC1L 1KN4H 5DMGC 1MHCB 2BVUA 3RWJA 2F58H 2YD2A 5C07B 2EDXA 4U05A 5DGQA 1X6NA 4EIZC 2EYSB 3TGXA 3IU4H 1QSEE 4G3YH 2NY2B 4JEGB 2AJZB 3O9WD 3ZKQD 5HHOD 3QH3B 2EO1A 1YEJH 5B39B 3LDBB 3LKQB 3PGCA 3DXAA 4WI9A 2HLAA 4PRHB 1SYVB 5F9OL 3PGFH 1MJ8H 5LGKA 2D7QA 2ATPA 4R96A 3RAJL 1QVOB 2HVKB 5F7YC 4WTWA 4X7SH 3SDCB 1JGDB 1RIHH 2F15A 4G8FA 4XCEA 5HVWA 1M7XA 2Q6WB 4GFTB 3O6FA 3HE6D 5MENE 2F54E 5EBGA 4YQXH 5FO7B 1H3TA 2VLJE 3RWGA 2NY5H 1YMHB 4Z7VF 2Z31D 4M1DL 3BZ4B 3UPCA 5I1JL 2Q7NA 3RUGF 3L1OH 3MNWB 4RNRA 3HPLB 4X6EA 2JB5L 1QFWM 3WHXB 3QI9B 2FWOB 5HGDA 2A6KB 4PYHA 2CD0A 4MD5B 5F89B 2P5EE 1CICC 4FQQB 1CT8B 1C16B 3QG6A 4G43A 4XNUH 1K8IB 2VQ1A 3MA9L 4P2OB 1G9MH 2PYED 4I0PC 4F7CB 1CFTA 1AE6H 2ITDB 5D7KE 1JV5B 2DQDL 4JCLA 5DJ0A 4JN2B 3WKML 5FYJU 1WAAA 43C9B 4ZPTA 3WIHL 3LH2L 3IDMB 3O6KL 3VH8G 3F7RA 3CFEA 3C8KA 4J2XA 1G9EA 3FOMB 1CD8A 5LBSH 4QRRA 4OUUB 2GK2A 3U7WL 1RUML 4Z78A 3LEXB 3K2MC 4GAJH 4OLYH 3BZFA 4LKXB 3MJ9A 4APQD 5IW3A 4JFFB 1QKZH 1A1NB 2AXHA 3FL7A 4LARL 3BGMB 1DBKH 3ARFC 1F90H 5D7LD 3EBAA 2WZPD 4X5XA 4HAGA 2HP4A 3ESVF 1J9CT 4K8RD 5KTEH 1AGDB 3KXFA 3VXME 4AY0A 1G6RB 2E8ZA 1NL0H 2B5IC 4FXLA 1UB6A 3VD5A 3IT8D 1EGJH 3FJTA 1QSFA 2RR3A 2CDEB 5CMAA 4R26L 4NO5A 2WV3A 4XCCL 1I8IB 4KHTH 5SWQB 2CDFB 2X4PA 4PJ7A 1DDHA 4ODHL 1ORQB 4WHYG 3V52L 1HEZB 3O45B 1L0QA 5F9JA 1TQBC 5IMOB 2FEEI 4N9GB 1FFOB 4I5BA 1NFKA 3VXUB 3LN9A 4MJ6A 4ONFL 5LGJB 2CQVA 3RA7L 4ZFFB 1VFOA 1AKJD 2AEPL 5GS1A 1PKQB 3UJJH 4X4XA 5D70H 1EJOH 2WUBL 2XY1A 3H9HA 5D6DC 5FHAH 1F11A 4N0YH 3K74B 1RQ5A 1VFBB 3GHBH 4Q9BA 4Q7DA 4GQ9H 5LG1A 4OT1H 3BP7B 1ZEAH 4I18B 5I1KH 1IVLA 2HRPH 3ZLQC 3JZ7A 2MMXA 1Y6NR 4WEBL 3BPCA 4L9LC 2JF1A 8FABB 1VADB 4GW4A 1PZ5A 1KIRA 1BD2E 5LAXA 3WLBB 5IJVA 4MQTB 1UEYA 4Y1AE 2HMID 2O26U 3OJVC 3VE0B 3BEVA 4XXDB 4M61A 4QWWC 1HZHL 1SBBA 1TNMA 2X40A 1IAMA 5GISL 5GGVY 2HTLC 5A1AA 2EDRA 3SJVA 5EU6E 3T77B 3K46A 1FNGA 2D7PA 4JRXD 1H15A 4OD3L 3QUXA 3T1FA 5AYUL 1X9QA 4D94A 5KANG 5FCSH 2EYRA 5IHUL 4WFEE 3VWKD 5FB8B 1Q9LA 4U1MA 5IFJB 3FN0L 3QUKB 2ERJB 1TFHA 3NTCL 2IADB 5D7IE 3EYQD 2VSCA 5B38G 3CSBA 5BS0D 15C8H 3KDMB 2MPAH 1CF8H 4JR9L 4PJ8D 2Z35B 2A74B 2DJ4A 1H3WM 1EDQA 1N8ZA 2OQJB 2J88L 3U7YL 4KROD 5MHSE 1NCWH 3DLQR 1DBAH 3UO1L 3QQ9D 3BN9C 3QXTA 2DQEL 4ZXBA 4WIQA 3I2CL 3QWQB 1N2RA 5I17B 3AM8A 3NBNA 2GIYA 5D96B 2YXMA 1PX4A 5ICXA 1T1ZB 2R2EB 2HVJB 4P3WA 1S78C 3VI3F 1P69B 2AI0H 3RI5K 4WUKL 3VXSA 2FJFA 3IRZA 2V7HB 4V2BA 5FYJD 1NC2A 3FO1B 4BSVB 5KJRL 3TIEA 1VERA 5KAQF 1AXTH 4Z7OE 5IQ9A 5DO2D 1YC7A 3H2WA 4NZRL 5IBTH 1KXQE 1YNLH 2YRPA 4JM2A 1NCTA 4MAUH 5DFVD 2C26A 2VR4A 4KZEH 4UQ3A 3MV7B 2PXYC 4JVPA 2VE6A 1C5CL 2GTWB 4RX4D 5CEZD 3X12B 3NAAH 4OKVA 4IRJC 1K5NB 2MNUA 1AHWC 1SVZA 3N1QC 4MQXC 3UJTH 1P5VA 2UWEF 4Z76A 3S36L 5B39G 5L0QC 2BVOA 5DUML 5C08B 2Z8VC 1HSBB 1IBGL 2Z8SA 1WCQA 1BLNA 3TNMB 2FB4H 2QKIA 2RJMA 2W0FA 3HI1A 2HLFD 4LEOA 4Y16C 5IBUG 3O41A 5T3ZE 1IAIH 3ILQD 2VWEC 5D4QA 4FFWC 1F02I 5JDSA 2P47B 2ED9A 5I2IB 4PJIE 1XFPA 4YHPA 2AQ1A 1SEQH 2UYLA 3OGCA 3P9LA 3C5JB 2YRZA 4QTHA 3OWEA 3WFEH 4ZOBA 3PABB 3B3IA 2CMRL 1BQSA 1ACYH 1FL6B 3B9KA 5KSAC 1A6WL 1JWMA 1BGXH 4XPBH 2DI7A 5IROC 2EEAA 4NRXA 1H9VA 5F7DB 2A0LD 3HLAA 6FABH 1CFNA 1ZT1B 1KN2H 2NX5B 3EFFA 1F6AA 4OGXH 1WFUA 1KIPA 3VFOB 2BP3A 3FFCD 1RZFL 2EO9A 3BZDA 5HYJE 4N0UA 3U36A 2WWMC 3N1PC 4ZS7L 1T0PB 4F2MB 4QNPF 5E24E 1WZ1H 5A43C 1L0XA 1TLKA 4QHUA 4KTEH 4PJHB 2G60H 4OV6F 5E4IA 5F21B 4U1HA 2CK0L 2FJHA 1KEMH 1VCAA 5HYQB 4GG8B 4CW1A 3UPRB 3O2VL 5CWSA 1U8IA 3IVKA 2IH1A 4K23H 3RY5A 4RSVA 3LRSB 3VFSB 3U9UA 4UQ2A 4HS6A 5CSBA 4WFFE 4RGND 3GMOB 5FA3A 3RKPA 1EFXB 3QDMD 3SKNA 3V5KA 1MVUA 1T66D 1VACB 2BOBA 4TNWF 5C0BA 1DBMH 1WBZB 3KPQB 5ICYB 1UCBL 3MROA 1IGFH 4WHCA 1KJ2H 3RDTC 3AGVA 3IF1A 1LO0H 3VMNA 1D6VH 5ALCH 4D8PB 4GS7B 4Z7WB 3R8QA 3EOTL 3EHBD 2D9CA 5FF6B 1E27B 4QOKA 4F3FB 5E9DE 2EDNA 4JY4A 1VGKA 3ELAT 2ZCHL 2B8OT 4G6KH 5DJCB 1NLDH 3BUYA 3O6FD 3V0WH 5IMMA 5IV2A 4EN3B 4NFDA 1DUYB 1CE6A 3GSQA 4OF5A 4LLYA 4K07A 2NY3B 2ZCLH 4PD4K 1MREH 1JRHH 4DW2L 4RMVA 3IETB 1FH5L 1AP2B 3EDJA 4OZHA 4XZUA 1W8OA 4Q2ZA 3MLTB 3MRBB 4JRYA 1BFOA 4YC2B 4TVPE 2CXKA 1T3FA 1FFQA 3QDHA 3WIFB 4KRLB 5SX4H 1TZIB 4XPHH 2PCPB 2BSRB 3ZKND 1LEKB 2RBLA 3H3PH 3RNQB 1OP5H 1W72A 2I9TA 3LB6D 1OCWL 5FDWA 3C5ZA 1IZKA 4XNYH 4V3DB 2VL5A 2BNQB 1FVCA 1JF1B 3JTSB 4QRRD 5ANMB 3HRZA 4DTGL 1I3UA 1NAKL 4OCWH 3HR5B 1P1ZB 1P4BL 4LAQH 2KDGA 2XACC 4DKFH 1IGJA 2PTVA 1S5IH 1IGTB 4YZFE 3L6FA 5GJTH 2HWZL 1IARB 2VERN 3T4YB 1KCRH 4GKSA 1IAOB 5I1AB 3I6GB 4G59A 2EZ0D 2VITB 3BDYL 5KS9F 2ZG3A 1IM9B 2J4WH 2V5TA 3G6DH 3SO3B 4YDLB 3KXFD 4O02H 5T3XD 2FBOJ 2X9WA 5ENWB 3QEHA 4P2QB 3FCTB 4M5YL 2AK4A 1QSFD 3MX0A 4DN4L 2XXCB 4NUGL 5ETUB 2BOCB 1BJMA 4WFHD 4S1RH 5L2KD 4YDJA 1ES0B 4P2RE 2F74A 1NGQL 4XCFL 1FYHB 4Q6IB 4Z95H 3FN9A 1LE5A 1JZ5A 1DQDL 2DM4A 4GRLC 2XKUA 4LCUB 1JF6A 5FK9B 3PWUB 3T0AA 5FHBH 4G8GD 3OXSA 2R4RL 1BBDH 4UILL 3MXWH 2LVEA 2F8XC 3GRWL 1ZVSB 1OVZA 4ZOAA 4NRYB 1KJ3L 5H37G 3QDJE 1IL1B 1T1YB 4UBDC 3VFVB 1DVFC 3F7PC 4BQBA 3O3AB 1TENA 3DMMA 4HEPG 2NLJA 4UI2A 4OZFH 4OQTL 3QXAB 4QT5A 5GGSB 3CH1B 5CSZA 4LMQI 3GMRB 1NCDL 3REWA 1GL4B 2MTPA 2XZAH 1QOKA 3INUH 4F7TA 1MF2L 2ZPKH 5GS0D 2QQKH 4F80A 1QP1A 4DUXA 1MHPH 5F9WB 4NCC2 3MOBL 3N85H 4RFOH 3MC0A 1NCBL 3RVTC 5KG9A 1E4KC 4MNGE 3ERYA 4PJ5A 3BXNA 3O3EA 4MCYA 4JKLA 5DZLA 2K7QA 1I3VA 3SJVD 5E8DH 2A9NH 2J6EL 4YXLL 1J12A 1AXSB 5DEGA 4LCIL 4F15C 4M93C 3MRLB 1YPZE 4JFOA 2C5DC 3C08H 3EOAB 3L3JB 3ZHLA 2CO6B 4FFVC 5GRWA 3W9DB 2PR4L 5F6IB 3OKNB 1OT2A 1G7HA 3MXVH 1UKTA 4CVUA 4UTBL 4HWZA 4X8JB 4L5FH 4Z7VB 4PJCE 3OG4B 5J3HC 1ZHKA 3GSUA 4JQIH 4K7PX 1Q1JH 3A6BH 3DV4B 4PJBE 4Y4HC 3RUGB 2HJLB 3HNSH 3WDHA 5EO0A 3KYNA 2GSIA 3B2UC 3D85B 3OR7A 4MCZB 1S9YA 3MV8A 1DBJH 3LAFA 3UYPA 3UROR 4KK6C 1DEDA 2A9MH 1P53A 1ERNA 2JJTA 1MCKA 3NCJL 3TA3D 3VH8A 3CVHH 2YD6A 5E8OB 4KDWA 5LWYL 3TWCL 2HFGL 1MLBB 1S3KH 2IGFH 2R0KH 4ZXBD 4HV8A 5MEQA 5IESL 5HXMA 2FBJH 1ZA3A 5ISZD 2AW2A 5FDYA 4NQXB 4GLRH 1AGEB 5F96H 3HCVB 2RB8A 1NGZA 1NDGB 4HGKC 5C0GB 1I7ZA 2XA8L 4PB0H 3RL2A 1BAFH 1RIUH 5A16A 4A6YH 4LCYA 1J8HA 3VXSD 1PBYA 1MH5A 1IFHL 1NC2D 2EDTA 2BJML 3NFSL 4HQQL 2NY4D 4JANB 4E0RA 1GZQA 4R0LB 2AXJA 3QNXB 3X3GL 4BZYA 3RJQB 1MEXL 3QIBC 4OLZH 1FDLH 2XWTB 4JM2D 4Y5XC 4Z7OF 5J6HA 2FX7H 3V5DA 5I30L 1VHPA 3QFJB 4HS3A 3LN5A 3QAZC 3MNZA 2CK2A 1ADQA 4ODUA 5D1QD 1A3LH 1B90A 1PSKL 1C12A 4MZ2A 1HINH 4B7LA 4Z77A 4L4JA 4O51A 1CN4A 1OP3K 2VZSA 4K3DL 4YGVB 4NO0A 2D03H 4OD2A 1BHGA 3L5XL 5GSVB 5EULV 1HCFX 2EDBA 3D39A 4OV5B 2Q3AA 2UUDK 3CDCA 5CZXC 4LEXL 3NPSC 2J8UB 4QEGA 4QF1B 4ZNCD 2HH0L 5F7WC 3SQOL 4GXVH 1MJUH 2HJFA 3CC5B 4PJIF 4F37K 1YY9C 1P2CA 5T1LB 3RNKB 3PG2A 4M03A 4XBEL 4J1UA 3B9KD 5FGBA 5ID1A 1KBGL 2XN9B 2BK8A 3EDDA 2C7UB 4HIEA 3MBEC 1UM6L 3G08B 3E3QC 2ADJA 5EOTA 4C59B 3BWAB 4M9PA 5DZNA 1KJ2B 4HCRH 5D2NA 4KKLD 5EIIB 3ZTNL 2X44D 3G5XB 2YD5A 1A1OA 3QIUA 3BQUC 1K4DB 2C1OA 4GW1B 2VKXA 1S7SB 2NZIA 5B3NA 4UUJB 5EO9A 1KTRL 4PDCE 1KYOJ 1OSPH 3QO0A 1A6VL 5JO5B 4C4KT 1B4JL 5B38A 2FR4A 4X99B 1SY6L 3L3DA 4KUZL 3S3PA 3SDAA 5JXAL 1BQHA 4NBXB 3ULUD 3V7AG 2D9QB 2W65B 5DXWA 4JM4H 1Z9MA 3DX8B 3PWVA 2VKWA 5IB5A 5JW4Q 5JW3L 4JCMA 3BE1L 3WKNA 4AEIH 4NQCA 1AD9A 4AEEA 4DJMA 3NCEB 5FKPA 3V4VL 3GBLA 1FP5A 1WIPA 5FGSA 4DGYH 2WUCL 1KNOB 5C0BD 4AQOA 1AO7B 4POYA 4NPYA 1JZ4A 3RI5F 1V5JA 3RKDC 5CUSL 4CADA 1J5OL 1NEUA 3WFCL 1KJVB 1JYVA 4Q9RH 1A7QH 3MGOA 3VFUB 4DZBB 2OM5A 4IMLB 3QUYA 5EUOE 4NQDB 1RMFL 2GFBB 1INQA 3LKSA 2IMMA 5IW1A 3LKNA 5I19L 2B2XL 1RULH 1Z5LA 2NY0D 5ESAB 2H2PC 2E7BA 5DVMA 5FYLE 1HHGB 1RU9H 4V1DE 1TJIH 4JAMA 1KCSH 4CNIB 1QRNE 1YY8A 4FFYH 4PREB 1DFBL 4P23B 4RWHA 4KDTC 3SE3C 1JGVL 2W38A 4WVRA 3LMJL 3C60C 3AU1B 4JB9L 5DUPH 3SE8H 2AJZA 4PG2C 3OG6B 5F88A 3D3VE 5I8KL 4N8VA 3BRDA 3DVFA 3QH3A 3JWDL 5B39A 1JWUB 4QCIB 5J13C 3LKQA 4KAQH 1FE8H 4JRYD 4PRHA 1K2DB 4ODWA 3D0VB 4ZDHB 1CLZL 1MRFL 3P77A 4ZFOA 1QVOA 5E2TH 1MI5D 4RAUA 2BHZA 4ZSOB 3ARDD 1MHEA 1WJ3A 2UWEB 4HUNB 4JGJA 2HT3D 1RZKH 4FTVB 2Q6WA 3C5ZD 1EMTH 4LLUB 4MXVE 4PR5B 3W0WE 1N59A 4ZFGH 4ZO9A 4IRZL 4JZOA 1S7VB 5TFSH 2IANE 4ZUWB 3FMGH 2Q87A 4L4VE 2PNDA 4J6RL 4LVNC 3BZ4A 4BFIA 1VFAB 4MS8C 3MLSH 3V6BR 3DSFH 1N5YL 2FWOA 4JFDB 2DLFL 4ZFZA 4E5XB 5TE7L 4D9LL 1JTOA 1BQLH 5F89A 1R24A 3IJSA 1CT8A 4HT1L 4PIRF 4YZFF 3E2HA 1K8IA 3MRFB 5KW9H 5B4MD 2IPKB 4JQXC 4ZUUA 3JWOH 2WM0A 2ITDA 1MIMH 1JV5A 1T0NB 4K94C 3FQTB 3UYRH 4JN2A 1FG2A 2AK4D 5F1NA 1YNTB 1ONQA 2PW1B 1QFOA 43C9A 4MJID 3ZE2E 4M6NH 1FNLA 3R8BB 3FOMA 2UV3A 4OUUA 1SM3L 2O5ZL 2V2WA 3TZVD 3EJZD 1BVKA 3CAFA 1FZOB 3PXJA 4LKXA 4PY7B 1XCTB 4WDIB 5IW6B 1FORL 1NKOA 1Y6MR 5J89A 4J3OC 1J05B 3BGMA 4QTIL 4NRZA 3NH7L 3KPLB 3TFKC 5HYSA 4IIQA 1DBBL 3J8F7 4KKBC 1URLA 4HBQA 4NM8L 3PNWA 3T0DA 3QDAA 5T3ZH 5JDJA 1IMHC 1CL7H 4YE4L 2ZKHH 2XZZA 5F7NC 1QBMH 5GRXG 2QSQA 3VFWA 4YHKH 1OAXL 2BNUB 1CGSH 1I8IA 5SWQA 4DQOL 1TPXC 2CDFA 4NFCA 4MXQD 1RZ8B 1RJLA 5BO1H 2VZUA 3S35X 4DGVH 1CGTA 1NSNL 4ONGL 3T0VA 5JOEA 1TZGL 4J7RA 2VLRA 4AK1A 4U7SA 3MYZA 3X11B 3IGAB 4ELME 4XXCC 3CVHB 4N9GA 2Q8AL 1MQKH 4PJ5D 5LGJA 3BH9A 1QSEB 3A67L 3MRJA 4ZFFA 2YMXL 3JSSA 2LV4A 4G7YH 4ZUVB 1PKQA 1AQKH 4OCXL 4QKXB 3IDNA 2EDDA 2HFFA 3QIWD 5IOPA 1GAFH 2CKBA 3KLDA 3LD8B 3U7AA 4A6YB 3CXDL 1DQMH 3BP7A 3VGAC 4OCRH 1ITCA 4AH2A 3CVIL 1BBJB 1XGUB 4LHJB 1PY4A 5HDQL 5DSCB 3VD4A 2PUQT 3QRGH 1O7SA 3LPWA 4M1GL 5MENB 2F54B 4F15B 4XPGH 4KQ3L 5CD5C 2VLJB 3P40A 4FQLH 2NXYC 4PJCF 3RL1A 4PJBF 2E8YA 4K7PH 1L7TL 1IGYB 4I48A 1RHFA 3T77A 1ZLVH 4Y4HB 5I73B 2P5EB 1R5WB 4Y2DC 5MI0C 3S37L 4WW1B 5HHMD 3UTZB 3D6GA 4MD0B 3QNZA 5F6HI 2VDNL 3PHQB 2IADA 1UKQA 5EO1A 3LEVH 5D1ZB 4KXZH 1J7VR 1G6RL 1WQVT 1J8HD 3JBG7 3PXHA 3KDMA 1ZSDB 1CDYA 5AWNH 3TBWA 1P6FA 3X14A 1LEGA 4ZUSB 1PLGH 2V5MA 2X6MA 4F7EB 5CLWA 3QYCA 4EKXA 3LQAL 4PTTB 5IB4A 5GGTA 4OZIA 3PL6C 1IQWL 3MSPA 1CLYL 4PRPD 2GK0A 1EO5A 3QIBB 1DN2A 2Y6SC 5F1IB 1YECH 4N0CA 3VXMB 2AJSL 2BSSB 1T1ZA 2F9BT 2R2EA 2HVJA 1Y18A 4OZGF 4KY1L 1P6AB 4KI5C 2GEEA 5DS8B 5EWIL 3GKWL 4AMKH 4P4KC 3ULVC 4ELKB 2V7HA 3RRQA 3FO1A 3MRQB 4BSVA 4YBLC 1P9MC 3T0WA 4ZO6A 2W07A 1HQ4B 4FQXC 4IBLT 1SYSB 3ECBA 5FOBB 4WTZA 5GGRY 1ZLWK 5EUKB 3RTQB 4MGXA 4OSUH 2GSGB 2J8OA 5KAQG 2GUOB 4FQHA 2GTWA 3SKOA 1A14H 1BFVL 2I07B 3BDXA 1K5NA 2CGRL 2KZ1B 3TC9A 3BSZL 5DRWB 3HI5L 2V17H 5DR5L 5A3IC 4OLUL 2DLTA 5C08A 1EV2E 5DWUH 4G6AD 3KWWB 4KVNH 5HI5C 3PDDA 3TNMA 4HKBA 4YDIH 3U4AA 5JORB 5EZLB 4U31A 3B6SA 1BD2B 3QIUD 1XIWA 5JQ6H 3HA0A 4Y1AB 2OI9C 2YK1H 3OAZK 3F62A 4HJGB 3MBEB 4PRNB 4N1HB 3QEGL 5I2IA 4FMFA 4UZGA 3RIAF 4G8IB 3IDYB 1YJDC 3SDAD 1IGML 4L8BA 5EU6B 4F7PB 2P49B 3A6CL 4DVBB 5KVGH 2I60L 2IAMC 1PD6A 3AC0A 2G9HA 4XPAL 2BY1A 2R0LH 5F7DA 2QSTA 3MUJA 4JN1H 5L8KB 5D7IB 3NA9L 1ZT1A 3V79C 2YPVL 1FL5A 4O9HL 2ORBL 2P8LA 3VFOA 1ZGLA 3M8OH 3CDYA 5IEKB 3F58H 2DJUA 1L8JA 1H3PL 3Q1SL 2OBGA 2JJVA 3NN8B 2OK0L 2FGWL 1JHTB 4JZJB 3DUUB 3R1GL 1NBQA 4F2MA 5JLZB 1LE9B 3U9PH 4P9MH 2JB6B 1JHKL 2ZSVA 3RPIA 4HG4J 1TTUA 1ZANL 3QUYD 4L1HA 3RZWA 4MXWH 1IC7H 1WEJL 5HYQA 4XPTH 4GG8A 1U42A 2FX9H 5D2LE 1BM3L 3TV3L 2H2SC 3B8SA 3OKOA 3FO0L 5CEYB 4TPRL 1JNLH 3LRSA 4KGLA 4J4PC 4W4NA 1HIML 3MRNB 5INDB 3SDYL 4JY5L 1CI5A 1CS6A 1G7JB 2IBZX 3GMOA 5IT2L 2P43B 1OSZA 4KKCD 4P5TB 4OFPA 1RURH 2B4CL 3CFDB 4Y4FC 1LEIB 5EOQL 2NXZC 1D9KC 1KG0A 4GSDL 4LP5A 3W5NA 3KPQA 4V3EB 3VWJB 5IF0A 4W81A 4PRHD 2Z4QB 5D7JC 3AROA 4WFGE 4Y89A 4D8PA 1MCEA 3G6JE 1MNUL 3QHTC 5JPNB 1E27A 2XTJC 2G5RA 4UT9L 1RI8A 5C2UB 2BVYA 2VJXA 3DRTA 2FHCA 4OAWA 1KN4L 4NNXB 1EHLH 3PWJA 1TTFA 1T4KB 4WW2C 5DJCA 3UAJD 4YFLI 4F37F 4H20H 4JFXB 3RVWD 3O9WC 2F58L 5EA0H 1HOCA 3BH8A 1NUGA 3MJ6A 2F53E 4MXVF 2WSKA 1T0MA 4HS8H 4N5EA 5E56A 2JCCE 3B5TA 2H26B 1EGJA 2A2QT 5ECJE 1MJ8L 1X7QA 3KLAB 4PJIB 2WQRA 3HE6C 4D0CA 2A6IB 3IJYA 4X7SL 3IFPB 1U8HA 1AY1H 3N0PB 3HS0B 2Z31C 1A4KB 1FG9C 3D18A 2YD3A 1CICA 4YQXL 5DK2B 4PJDE 1CFBA 3VFRB 1WIOA 5I1EH 1MUJB 4I0PA 3ZE2F 3PQYA 2EDQA 4X9HA 3HR5A 1P1ZA 1S7UA 3WJJC 5MEPB 3KYMB 1KT2A 4JFFD 4QYOA 5HYJB 1N4XL 2XPGB 1IAOA 4U3CA 4CL7A 4YX2L 2VITA 1T20A 1IM9A 1G9ML 1HSAB 5E94A 3O8XB 3G6AB 3ZE1E 1AE6L 2HG5A 3HMXH 3FCTA 4HBCL 3V6FA 3C6SA 4JHWL 5CGTA 4J8RB 4PV9B 5DD1H 3VD9A 4AL8H 4APQC 1CTOA 4XWOC 3ZKMD 3F6LA 5CJBA 5DQ9A 1ES0A 5LBSL 2OZ4H 2D31A 5EZJA 5C92A 3H7BB 4KK8D 1DLHB 1FLTX 2ADFL 2ZUSA 3HZMB 2DI8A 4GAJL 4OLYL 4Y19E 3UZVB 1MRCL 1QKZL 1CGYA 1UM4H 3HZKA 4LCUA 4BQ9A 3GJEB 3S35H 4ELMF 2Z0BA 5L8JB 3U1SL 1UVQB 1Q94B 5DZOA 5DMJB 4X7TA 4GAYB 1T1YA 4HWBL 3VFVA 2H6PB 3MLXH 1NL0L 4NO2B 2P8MA 5IIEB 4QRSA 5GGSA 5BMFH 3O81A 3RGVB 1YN6A 3G9VA 3GMRA 3EW3B 4KHTL 5E9DB 5IB3A 1A6TB 2BY3A 5D6DA 3C2AH 1RZGB 3G04A 4RZCB 5BJTB 2BDNH 1CVRA 5CEXB 5BZWA 3UBXG 1DUZB 1QZ1A 3QJHB 3CMOH 1JTTA 4OF8A 1OLLA 4L9LA 2BSTB 3UTPE 2D0FA 1JIBA 1U8MA 2CIIA 4GXUN 3UJJL 1GCFA 3O3DA 4YXHH 1Z2KA 4HIJA 3MRHA 4X6CE 3GHBL 3U30C 1J0KA 4FQ1L 3WNLA 4O00A 3MRLA 5JNYA 1V7NH 5I1KL 1ZEAL 4JKPH 4EQ2A 1K6QH 4D3CH 5C86A 5J6GB 2HMIC 2XV6B 2EC9T 5JQHC 5L88L 3WUWA 2XQBH 4X8JA 4NFBA 5I1CH 3D5OF 3CLFH 1UM5L 2XT1B 3DV4A 1F6FB 2Z93B 5T5FH 2R69H 3U4BH 2QQQA 4BKLB 1CDCA 1FLRH 4JHZA 5IJKC 5HGAB 2OJZH 4UV7H 5EORH 3ZKXB 5A2JH 2GYSA 1F4HA 4HZLA 4CU7A 3E8UH 1OP3H 3V8CA 3L3IB 3F12A 3EUUA 2AXGA 2X4OB 2Z9TA 3RY4A 3UTTE 4JJ5A 1UA6H 2NW3A 5BZDA 4N68A 3KPRA 5H8DA 4HKJB 4N0CD 4GMSH 2BFVL 4OCYL 1EXUA 1QLEH 5C0GA 3UJIH 2DIBA 4CBPA 5F97E 4KUCF 2EDHA 2O5YL 3K8MA 2MPAL 4MLIA 1CF8L 4K9EC 4KROC 4HPOL 4P2RB 4R0LA 2V2XB 3QNXA 1G7MB 3QQ9C 1EK3A 2X4RA 1AGBB 2ICWB 4XX1G 2NY6B 2XWTA 2NZ9D 5DJDB 4NYLA 2Y4SA 3MV7D 2AXFA 1AFVL 1DBAL 2KKQA 3OKYA 3KLSA 2FH6A 3THML 3QJFB 3ZMRA 1FNEA 2IMNA 5CD3B 3S36X 1OB1A 3OB0K 3QDJB 5MERB 4CVZB 3I9GL 4TULL 1J1OH 1ZHLA 1ITBB 1KGCE 5JHLL 4OQ1A 4YGVA 5EU7E 1IKFH 4JFEE 5DO2C 3ZTJG 1A22B 2PXYA 5C08D 3VDBA 3MRGB 1RFDH 5GSVA 4H5SA 3EDKA 5C0JA 4NSKA 4QRUA 3MRPB 4NQEA 4IRJA 3QSKB 4JPKL 3MNVB 4OV5A 1J0HA 2FO4A 1AXTL 1KB9K 1YEDA 1CFSA 1GC1C 1XIWD 2HFEB 5IBTL 4NKQB 1N0XH 3MLRH 2J8UA 2R0ZL 4QF1A 4BZ2L 5TH2B 4MAUL 1HHKB 4MNGB 2R2BB 4QHLA 4BM7A 1NFDE 1KXVC 1HDMB 4XHJD 3H42L 3C2SA 4X4YB 3NAAL 4Y16A 1T5XB 2OI9B 4K3HA 4X6BB 3UJTL 3V8OA 2Z8WC 3DJ9A