3QUKA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
275
structure length
262
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
total genus 60
structure length 262
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qukA01
3MRQA 4UUJA 1YEEH 3EHBD 4GW1A 3CLEL 5DO2C 5F7KC 1FDLH 5KTEL 4LKCB 2FSEB 4JM4L 2YPKB 5HDQH 4OM1H 4JZJC 3GHBL 1MJJA 1T04A 2IAMB 5JHDA 1QRND 1JRHL 4DGIH 3I6KB 1YECH 5FYKD 4CW1A 1I7UA 1L9NA 3U0PB 2C4XA 1NGQL 1KN4H 2GY5A 3SEPA 5HHPA 4APQC 2W91A 1ZHKB 1C8PA 3CPLB 5FGSA 2P5WD 4XNMA 5D7KD 5GGRY 3WLWD 2DQUH 1I8MB 2OR9H 4NN6B 1BVKA 1DBAL 1WBXB 2O61B 1HE7A 1I8IA 3ESUF 1XMWA 3PHOA 5DD5H 4TULL 1WAAE 4RCAA 5HYSA 2F53E 1CT8B 2AJYL 3MRPB 4LF3B 4M43H 2NTSP 1B4JL 1A2YA 1WCQA 4NQUA 4L3CA 3HAEA 2WQRA 2UY6A 3GJFK 3IDJA 3KXFA 5E99H 5J0BA 1AJ7H 1GIGL 4J3WA 4P5TD 4XZUA 5HHMD 5CMAA 5C0RH 1GXEA 2HTLC 5KVEL 3QIUC 1YMHB 5IVXA 4FQCL 3WUWG 4EDXB 4LIQL 1N64L 5JQ6L 2AXHA 5HVHB 2CMRH 5LGHH 2BFVL 3JTTA 3CX5K 3MMEB 2G9HA 3MLXL 3OG4B 2BSSB 2RB8A 2VDRH 1NCBH 1BX2B 4M1CD 2VLME 3RQ3A 1VEMA 5IVZB 1X5LA 4P5TB 1LDPH 4AYFA 1WSST 4XAWL 4KUCD 5CZVH 1L7TH 5GS1C 3S88L 5E1HB 1KIRA 4S1DC 2YRLA 4TPRH 4DKFH 2JCCF 3Q6FA 1CICC 5C0BB 4PJ8C 5AYUL 3TA3A 4JN2A 1JZ2A 4YBQC 1AD0A 3OR6A 4N5EC 3I6KA 1KB9K 1XGYL 2VE6B 1LEGB 4YDVA 1O7SA 3CGTA 4KAQH 5JPMA 1ZHNA 3GBNH 2X4PA 1LO0H 1I85C 1PEZA 5IROC 2C3HA 4A6YL 5DI8B 2CLZB 3GI9H 4K7PH 4MJ5A 2MQ0A 2AJUL 4B50A 5E5UB 4PUBH 4NFBA 4HIEB 1BF2A 1QZ1A 5JOEA 1OGAB 4GW5B 1SYSB 3MLYH 2BVTA 4BUHA 3DX6B 2H1PH 4E42A 2Z8VC 2ID5A 3MJGX 4G6KH 1T2XA 1S7QA 1CDJA 4GRLC 3UPRB 3O8XB 5F9OH 3MCKA 1YEHH 2APFA 3MRDA 1OP3H 5BQ7A 3GBNL 2IADB 5JMRA 3HZVA 3L3OB 4K7FA 1X5AA 3D87B 4NHUA 3TO4C 2XNAA 4PJBA 2AJVH 3P0VH 4GRMB 1MPAL 2V17L 1R3KA 2PTVA 5F21B 3BKML 1ZA3A 5F7DB 4RRPG 2I07A 3GSQA 1M7XA 2GJ6D 4WUUB 4UILH 4P2OA 3FRPG 5DJYA 2FJFA 3QR2A 5TFSL 4PYHA 3WO4B 2C4FU 2WAHA 4GKZA 2VIRA 4HLZG 4HPOH 5C09A 2W0FA 2AXFA 4Q74A 2HAZA 2CO6B 2CDFB 4LDEB 5IW6B 5J13B 3WNLA 1U3HC 3HUJB 3PGDB 3F12A 3V0AC 1KEMH 1MIEL 4LVNB 4OZ4B 1CVSC 1FG2B 1BFTA 3OKYA 5AUMB 3WBDA 4HJ0C 5I75C 2NMSA 3T1FB 2CLRA 3TIDB 3V8CA 4ODBD 5FGBA 4F80A 5DJAB 4Q9CA 5I76A 1PZ5A 2QR0A 2N56A 3CFBB 3BZEA 2NY2B 2XFXB 3RGVD 3SN6N 1U8OA 5DRZB 8FABA 3C5ZA 2IH1B 3HI1B 5ESAA 4M43L 1P84K 1BQHG 1EGJA 4Z0BH 4PJGE 1EEUA 2VMFA 1RUPH 2VJXA 5K9QI 1JNLH 4P46B 1A3LL 2NY5H 1D9KB 5EOTA 4F37K 5CEZL 2VERN 3SE3A 1WFTA 3WIHA 1K6QH 2GW5A 5IFHH 3GMPB 2VZSA 3B3IB 3H9HB 2QHRH 3MCKB 5BRZB 3SJVA 3WO3B 1RZKL 4ZOBA 4YE4H 2X4UA 3F5WA 1KB9J 3DROA 3O6LL 4PR5A 3UTSE 4N1EA 3VXRD 4JFFD 4XNQA 4FQXA 4J3VA 5A2IH 3FO0H 1MF2H 2HH0L 4KGLA 4EVNA 2J6EH 3L3GA 4Y7MA 4D0DB 1MVUB 4DOHE 2V6HA 5JUEL 3A67H 4UIKH 3K0WA 1H5BA 5CFHA 4NBXB 1H15B 4CJ0A 2Z31B 3OKOA 3WSQL 5EDXA 5TQ2H 4FXKB 1OAYH 1MRFL 1U8QA 3GHEL 3FQNA 4QHMA 1HINH 2PKDA 3C5ZD 2H41A 4I18C 5D1XA 2NX5D 1EEQA 1AO7A 1IVLA 1FYTA 1R5WB 4KVCH 3BZFA 4RWYL 2A6JB 4G9FA 4BELD 1LO0L 1A02N 43C9B 4L4TE 3TJHC 3SCMC 2DWDA 3RWJA 3T1WA 2HH0H 1QFHA 2W9DH 3NCYS 3C2AL 5FA3B 3MX0A 1A22B 1ZLSH 3T3PE 3V5KB 2WWKT 3IF1B 1T2QL 3VH8B 1YC8A 2J2ZA 2PO6D 3GMOA 2A6KA 5M7QA 1QBBA 1U8PA 1VACA 2NLJA 4JFHE 4JFEB 4UB0H 4ZPTB 4CMMA 1TTFA 1EAJA 3LD8B 3ULUE 3GSWA 2HVKB 4R6UA 2OMBA 3IU3A 1U3HD 1KJ3L 1T03L 4X83A 1IMHC 4EUPA 1V3LA 3QDMB 5FGCB 4V3EB 1ZANH 4OLYH 1MRFH 5TE7H 3IS0X 5DEGA 1HCFX 3UC0L 1TCMA 5EBMB 3ISWA 5D7KE 1KIRB 3HMWL 3TNMB 1KJ2L 3NFNB 4YXKH 5IHUL 4M7LH 2QSTA 5KSAA 1NLBL 4U1LA 3LKRA 4XMKL 1MCDA 1X5FA 5IMKB 3BIKB 3ZT5A 4NWTH 2IQAA 4D0CA 5I18L 1CXIA 5JOPD 1BQHB 4PD4J 2AW2A 4P3DB 1FL5B 4H26A 1VADB 2YC1B 2QSCL 3LPWA 4Z7VB 5DVMA 5ANMB 4HPOL 3CJJA 5CZXC 4RMTA 2IBZY 1KIQB 1JPSL 1E0OB 1XGPA 3RWDB 5F96H 3SO3B 3VXUA 4ZNEA 3KJ6H 3VG9B 4WW1A 3IDIA 3IDMB 2Z8WC 1U8KB 4GRWB 3K8KA 2R1WA 1GGYA 4OGAC 5JDSA 3MO1A 5I18H 5F9AC 3FO1A 4Z7OE 1NGWB 4N0FA 3HE6C 3BD4A 5MHSE 1G9EA 1CFNA 3TV3L 3TJEL 5ADPL 1R3LA 5D8JH 3ZT6A 4BQ6A 1YNKH 3F58L 5DD6B 1HDMB 4BK5A 3OKNA 4PRIA 3U0TA 3MOQA 4PJCE 2NLJB 4CMMB 4LLVA 3D0VB 5C9KA 1Y6KR 1JGEA 2VH5L 3QUYC 3ZE0F 2NY0D 3EFFA 1T89C 4JAMB 4Y16C 5F6IC 3VXRB 1EZVX 5TE6L 1UM6L 1FFNB 5EZLA 2QHRL 3U0WH 4LEOA 2W9EL 5IR1A 4A6YB 2H6PA 2ADGB 5HHQB 1PD6A 1SJEB 5F8QC 4NSKB 4ZDHB 1I9EA 5L6YH 4MDJA 4PJFA 5DK2B 1BF8A 1HYSD 3VXMB 5ACLA 2B2XH 4M6NL 1MCPL 5HHNA 5GGQH 1QR1A 5TQ2L 3KJ4C 1KB5A 1IEBB 4OFPA 1HYRC 4MNQE 3QPXH 2D0FA 2OQJB 3GSUB 3VXTB 3VGBA 1OD9A 4LDLB 3U83A 4WI9A 5D4QA 4XCNB 2IWGA 1Q9LA 4WWKA 3ZYJA 3BYYA 3OX8A 3FN0H 3QIWB 4UU9B 5CEYB 4U1NA 1YEFL 3O9WD 3PDOB 2I5YH 3SDXA 2GKIA 2BY2A 4JFZL 4QTIH 4YQXL 3P4OA 2GSIA 1V3JA 1A4KB 1HKFA 3C9NA 3GJEA 3L3IA 1WVZA 1J0IA 1NSNH 2OR7A 1L7IH 3FAWA 1MFDH 5IJKA 3I9GL 2FD6L 4KV5F 1U41A 5J6HB 2OJZH 3QWQB 1RZGB 2DQFA 3G6AA 4PRPB 4PLKD 2EDHA 4L9LA 4U1SA 4HS3A 1FVDA 1C5DA 4DCQA 3IXAA 4YX2L 1U8NB 3TC9A 1CLOH 2XACC 1K9TA 2IBBA 2C3VB 3CSYA 4TUOB 5C07B 3U4AA 4PRNA 2NX5B 2AEQL 4UV4L 4JEGB 3CH8A 4OV6F 2FNBA 4UT6L 2N7BA 43C9A 5J1AB 4R7DB 1BD2A 3EZ8A 1IC1A 4OZFB 3WKMH 1BAFH 1BQLL 2GEEA 2P8LA 2NY7L 2JB6B 5EOTB 4PBWD 3JV6B 2Q7NA 4POZC 2HRPH 4ZOEA 1JPST 1U8QB 4NN7C 4QHMB 3REVA 4M6AA 3U46B 1JNNL 4ZFGL 2VNCA 4DUXA 3W9EB 5DJZA 2OMNA 1NMBL 3KPLA 3TWCL 4NRXA 3ZDYF 4RMRA 4HD9A 1JJUA 4LVOC 3D0LB 1YDPB 1NAKH 1X5GA 4FXLA 3BHBA 3G6JA 5KSUA 3KPPA 2J88H 3VI3F 3EOAA 4I0PC 2CRMA 3BGFC 3D9AL 4PJXF 1X5IA 1U8JA 4G7VH 2YHGA 3PJSA 1BBDH 2HT2D 3ARWA 4KPHH 4OZGA 4MAYD 4AG4H 1ZGLP 3L3JB 5C08E 4JJ5A 5ISZD 5F71A 1R3JA 4LCUB 4TNWF 4F3FB 4K55A 3AMKA 2HKFH 3B2UC 5H37H 1TNMA 4Y2DB 3H9SD 4ZUWA 2ZUTA 5EU4A 5EA0H 1CF8H 3RGVB 2NY2D 3QJFB 5FV2A 2B8OT 5D1QD 1QO3B 4OGZA 5J1AA 2AJZB 3QI9D 1IEBA 3QPQC 5CJ8A 2JELL 3CSBA 2ZP0T 5DSCA 2RFXB 1PKQE 2ICWI 1U95B 3G5XB 3O9WC 2VLRB 4CKVX 1FVDB 1T3FA 3CCHA 3BPCB 3C60C 4HH8A 3FONA 5GZNC 4ZS7H 3DETC 3H3PL 4PJIE 5TDNB 4RFOL 5EWIH 5FAAA 4NHUE 1FO0H 4XP6L 3GNML 3IETA 3ZKND 2IH3A 4CDGC 4HIHB 1RK0A 3RWIB 5IV2B 2FJGA 3BPOB 3DO7B 3OL2A 1G9MH 5D7IF 1J05A 4WI5A 3EFDL 4IBLT 2VLRE 2CXGA 1A4JA 1FJ1B 3VXUB 3FO1B 4Y4HB 1HEZB 1CBVH 2YXFA 3NFPA 4RFNC 2OTUA 1T04B 4PTTB 3HI6H 4G9FD 1QA9A 3V7AE 3WFCL 2FYYA 5T33L 5K9OB 2O5XH 1KXQE 1P7QD 2QSVA 3V5HA 4O51A 4XPGL 1VADA 4TNVK 2FHCA 3U79A 2VITA 2UZXB 4X8JB 2CDGB 4JFQB 2DM7A 3U48A 3NN8B 3L3KB 4LQFL 3JZ7A 4TRPL 2WLZA 1P4LA 1A7NL 5F6IB 1T7XA 2BERA 2XG4A 4F9PA 5FYJL 4MB4A 3ZTJG 3UP1A 5FYLH 4O4YH 3VXPB 5IBTH 3NAAH 2P8MB 4NO0B 1XZ0A 4I2XB 5DD0L 1PG7X 1T22B 3C8DA 1CR9L 3EO0A 4J6RH 4N8PA 2JJSC 3RVXC 2EC8A 4HFWB 4PBXA 2HP4A 5EUKB 1HZHL 3DVIA 3U9PL 4PJFB 5DK2A 4LU5L 4QHUA 1M05B 2W0PA 4ZO6A 4KKCC 1JNNH 3OF6A 3W5NA 4EQ3A 4TUKL 4XC1L 4HT1L 4U0RC 5SWSA 3CCHB 2CR6A 3SDAB 4QRQA 2Q8AL 2Y07L 3QI9B 4PJXE 5C0AE 4UBDC 3ILQC 2GHWB 4XHJC 3DOSA 4Y89A 4X5XB 1AH1A 1JVKA 4WDIA 5C0IA 5EC2B 3HMXA 2RGSA 4MA8L 3RZCD 4GG8A 1B0GB 1JPTL 1B9ZA 4G6JL 4ESKA 5HHVL 5LCVL 4G9DA 1JHLH 1MFEL 1WWWX 1IC5H 1AXTL 4QRRE 5J8OA 3RX7A 3O6ML 3R0NA 5I17B 2FH6A 3W0WA 4XMLH 2ED7A 4OLWL 4F58H 4OGXL 4K2UL 2AVGA 2FSEA 4L4JA 1A7RL 4GKNA 4TSCL 1DSFH 1O5DT 3BKYH 4M61A 1EFXA 3MV9A 5BVJB 5JHDB 4MCYB 4KI5E 5GRVK 3HPLA 1UM5H 1NEZB 4Z9KB 1M71A 4NQSB 4PP1D 1JYWA 2CIKB 3BJLA 5I9QB 2DQHL 2PW1A 2Z4QA 3VCLB 5HYJE 3MGAA 4MAUL 4MS8C 3H42L 1XGUA 3AGVA 4LIQH 5K9JL 5C0FB 1DCLA 1FYTE 4UT9H 4FRWA 5IB4B 1BVZA 1EX0A 5INCB 2VO5A 3IU4H 3L6FB 2HFFA 3T2PA 2CRYA 4OZHA 5K9OA 2BDNH 5DEGB 5LBSL 1T21A 5C0EB 2DTML 1I4FA 3U9UA 1JGUL 4PJAB 4KXZI 2AJ3A 3K80A 2BNRB 1FE8H 4UNTA 3KWWB 1NCNA 2A74B 4FP8H 4J3TA 2XZAH 4UOW0 3T0XA 2ITCA 5FHAL 3QFJB 1CLZL 3F12B 2E7LC 3SGJA 1AGEA 1QQDA 1KNOB 3H7LA 3KPPB 2AXFB 3OJDA 4XRCA 3FT4A 1KJVA 1ZWIB 1E4XH 4NGHL 4F37F 3LEVL 25C8H 1UYWH 1ZXQA 2DD8L 3BN9D 2PCPA 5ETUA 2ICCA 3QUZA 5E6YA 4JM4H 4ZUUA 2KQMA 3RNKA 3QPXL 4JLRA 4M1DH 3KPTA 5FO9B 2C7UB 5CP3H 3CLEH 3MRKA 1ZAGA 4YDJB 3LMJH 5FO8A 4NO2A 4I3RH 3OF6D 3MRHA 5DVKA 4ZO7A 1FNAA 3QDGB 4GW4B 4LLMA 4HUKB 2YUXA 1AP2B 3MRGB 3LCYA 1NGPH 2HFGH 2ED8A 2R0ZH 5DJ0A 4K3EL 1NMAL 1U3HB 4N5ED 1FZJB 4NNXB 1J1XH 2HT3C 4FFZH 5H37G 3VMNA 2NW2B 4S1SH 3PQYD 4IJ3C 1ZK9A 3KJ4B 3N85L 3S35H 1JPSH 4WHYG 4Z77A 1FORL 5J6GB 1INQB 1SYSA 5DQJB 3HKFA 4M03A 1GOFA 1NAMH 4ZUTB 3IJYB 4RGNB 5TFSH 1OAKH 1I9IH 3DX9A 5IOPA 3SKOA 2HFFB 2JKXA 3PWPA 4M3KB 4ODVL 5IW1A 1TZGL 3B8SA 3HE7C 5ENWA 1XF4B 3U30C 5EU4B 1E28A 5DJ8B 5LCVH 2Y5EA 3SDXF 4FN0A 1BWWA 1AXSA 3N1GC 5I66B 3PV6A 1INEH 3GRWA 4HS6B 3LRSB 2ZPKL 4LCCB 1KPRB 4YBLB 1KC5L 4QEGA 1C16A 1G7JB 1ZE3C 1R3KB 2P49B 1TJHH 3JTSA 4CNIB 3RI5K 3R8BB 5TE7L 4NUGL 3RY6C 1UACL 3HRZA 4G3YH 5BXFA 1QTYT 4FQHB 1AKJA 5J1SC 1P7KB 2ZOLA 1QR1B 1TZGH 1SBSL 4GSDL 1QSVA 1U8NA 3ARYA 5IFJA 3N9GH 2MNUA 4HIIB 5I1GL 4XP1L 4QHKI 1QNZL 5EU5B 2APVA 4JR9L 4X0KA 2OK0H 2OXGA 5TE6H 2VDNL 1DBJL 4AH2B 4J3SA 3WLWC 4WWKB 2VXVH 2OL3A 4UT7H 3K1KC 1ODAA 3C2SA 4U1KB 1NUGA 3MROA 3V0WL 5CSGA 5FM5M 1N4XH 3IGAB 4NKDB 4U1GC 1UM4L 2D0GA 2MHAB 3I84A 5SV4A 2G5BB 5FYLE 3T4YA 3MV9E 4HBQA 3O11B 3SDAC 5DMJB 4BZ2L 3H9SA 3VG0L 4GBXD 4GXVH 4PJ5B 4PJHA 1EHNA 4FABL 3TPKA 3KYOB 3B9AA 3K81A 3NTCH 1MQKL 3SDDD 1ONQA 4L9DA 1OAZH 3D1MC 3ULVH 2Y25A 4N0UA 2EYRA 3MBED 1M4KA 1PSKL 5E94B 5I17A 4CN4A 3RKDC 3U7WH 4WI4A 4Y5VB 2VN4A 3KPQB 5CLTA 4FNLL 4XP5L 3I6LE 1HHJB 2BNQE 3BZ4B 1KCLA 3JV4B 1PLGH 4P3CH 2UWEF 3CZFA 1MJ7L 2R29H 4HFUH 4NWUH 4Z7VE 1G7LB 2B39A 4O2CB 1D9KC 4X6EB 3SDCB 3HFMH 1HH9B 5CJXA 2VLKD 4BH8A 3EDDA 1A14H 2D0HA 5MI0C 1NFKA 2D9CA 3WD5L 1P9MA 1XGUB 2DIJA 4RRPA 3JWDL 3E2HB 3U4BL 1I9RH 1JYXA 1XAUA 1L7TL 2QHLA 4M61B 2R56H 3MV11 3I2CL 3VWKA 1N59B 1CE1H 3HPLB 5KJRL 2EIBA 4JFYA 3GI8L 5I1DA 5JIIA 4OKVB 5JR1L 1IGYA 4MJIB 1R5WA 2XYCA 3BKCL 1BZ7A 3FCTA 1JTOA 4N0CC 4Y4KB 5JA8B 2B2XL 5ID1B 2JIXB 3DNKA 5J89A 5KAQG 4PJCB 3ARRA 1A0QH 5C0CA 4YHNB 1MSPA 1P2CA 4Z7WE 2DQTL 4KI5C 3W0WE 1UKQA 5C8JB 3MRCA 2J1KA 3LSOB 1JWMB 4K8RH 3V4UL 2GTZB 5DMIH 4PLNC 4GG6E 3KNBB 2VZVA 4OQTH 3IFNH 3FT3A 3P4NA 3VGAC 1NCAH 2HJFA 3QQNA 1PY4A 4PV9A 4KWUA 5D96B 3THMH 5JW4M 1ZTXH 5CEXA 1YQVH 5D70L 1A3LH 4GAGL 1LEKA 1YJDL 2EE3A 4DWHA 5ICXB 4XZUB 2BJML 1A6WL 4K3GA 5F44A 2EC9U 2EO1A 1DEEA 3F65A 4F15C 3BRDA 4NO5B 4X6CB 3SDCA 4DFHA 2FO4A 1I1FB 4MAYC 1JN6B 5KN5B 4MXWL 1RFDH 3LQAH 4I0KA 2HT4C 3QEHA 3L5HA 1EBAA 4P59H 4TSAH 2LVEA 2DIAA 2UWEA 1VCAA 3LKSB 1TJGH 3KHOA 2IGFH 4Q6YA 1WJ3A 3GSRA 4OCWL 5E2WH 1KIQA 1Q38A 5SWSD 4EI6B 5E94A 2OP4H 1KFAL 4MA7L 5E5MA 3TN0C 1YY8A 5KVDL 1A6PA 4DJMA 1CGWA 4F58L 1KLGA 1S9VB 4MWFB 1OLLA 5T5NF 3VJ6A 4X9IA 2E27H 4F2MA 2DQEH 4WI6A 2IANA 1FH5L 3RUGE 5JPNB 1QSEB 3LZFH 3QWOB 4PGBA 3LN4A 3TNMA 3R1GL 3UBXI 1DEDA 1ZA3B 4GKOA 4WFHD 4O9HH 4OZGB 3SCMD 1NLDH 4CVWA 1UB5A 4RGOL 2X4TA 1H5BC 3QA3A 1GH7A 2NXYD 3MPCA 4TUJA 3N1FC 1LDPL 3H7BB 1N2RA 5HHOB 1H0DA 1OQOA 4JFDD 4BA8A 2R2HB 4YEEA 1AD9B 3O8XD 4FQPA 2VWEC 3W81A 3ROLB 3RRQA 3PP3K 4L4VB 5BMFH 3UPRA 2FX8L 4GUPA 4V2BA 3S3JA 4DTGH 4PJXA 2PO6C 4TN9A 3BH9B 3HE7A 3KPOB 1CE1L 5HYEA 2QL1A 3CXDH 4IDLA 2ICWB 4D94A 4JO1H 5DRWB 2X10A 2ATKB 4G80A 3Q6GL 3FONB 1S3KH 1TCRA 3TH2T 2LAAA 5IBTL 2X7LA 5AD0B 1IILE 3SJVB 5JHDE 3U1SH 4P2OB 3DUSA 3QXVA 4ZS7L 5B8CB 2OJEA 1TPXC 3SKMA 1BFVL 1YEFH 3FHAA 5EN2B 3ARQA 1OM3H 4JZNA 3HZYB 4RAHA 2DQJL 4C57C 5KZCB 2RQ8A 1T89A 4Y16A 1LP9B 1ZT7A 5HGAB 1KCUH 5FKPA 2Q8AH 1U8JB 4LLDB 4Y16D 3HMXH 4NM8L 5F3BB 4QWWC 3O41A 2Y5TB 3B9EA 1CU4L 4HCRH 3AMLA 1HXMB 3RTQA 4N5UA 5EUOB 3W11D 2X1WL 4KGJA 4WUUE 3P0YL 4OZIB 4M62H 4M7ZC 4JRXE 1A9EA 1S9YB 2YN3A 1GOHA 2MQCA 1MI5E 5GRWA 3ARFD 3R4DA 1SQ2N 4TSBH 1KF9B 2XN9A 4GAGH 4KHXH 5AG8A 1YEIH 1H3UA 5FIEA 3SY0A 1IGFH 5C2BL 4XPBL 4ZUUB 4L3ED 3OQ3B 1AHWC 3V52L 5D70H 3NPSB 4PYGA 4EEEA 1NFIA 1HHHA 2KZWA 3CFJA 3K46A 3SGKC 1MH5A 2XTJD 3P40A 2VLKA 2A77H 3ZKMD 2R2CA 4OI9A 3O8XA 5GJSH 2DM2A 1CGYA 2X7LB 5AD0A 4Z7QE 4G8FA 5GS3A 2FIKA 2BC4B 4X9FA 1J8HE 1XR9B 1PX3A 4PJIA 2RR3A 4FTVD 2ADIB 5BJTA 1QFUL 4LHUB 5B38B 3PG2A 1WTLA 5F88A 2BOCA 3WXWL 4Y16B 1KIUA 2P5WB 1FL3A 1EHXA 5E8DH 1VPOL 3ARFA 1M7DA 5AZ2L 3ZKQD 5HI4D 1WZLA 3HTLX 5IJKC 2XTLA 3G6AB 4OCSH 1MCWW 3O4OC 1U6AH 2VL4A 4M93C 1F4HA 4JDVB 3GMLA 1LE5A 1PFCA 2MOVA 3LZFL 3STZB 2R2HA 4OI7A 5LWYH 1LHZA 4OIAA 5BRZE 3K8MA 2IAMA 4OLVH 1BFOA 3EZJB 5KSAD 1I1AC 3IXTA 4QXTB 5C08A 3T2OA 4CVUA 3KPOA 4PB9L 3TNNA 4AIXA 1UXWA 3MNWA 5HHVH 3WFBL 5LGKA 4OD3H 3QCTL 3EO9L 3UAJC 4HUWA 3VA2C 3S34H 2JB5L 4PJFE 1T20B 5DFVC 3QDME 5ELIA 4XMPH 5FGCE 5E9DB 3ZE1F 4QRSB 3SE8L 3E8UL 5EUKA 4YHIA 1ZA6B 1TETH 3O45A 4MS8D 1HIMH 1CG9B 2AQ3A 5MHSD 5LXGH 3FT2A 5JXAH 4G8GD 4LSQH 2Q86A 4JHBA 5IQ7H 1G6VK 2PO6A 3BEWB 4U6HB 3PXHA 1F8TH 4KH2A 3H3KA 1RAMA 1NCCL 3Q3GB 4BSWA 4QY8A 2XWTB 4LPCA 2JJUA 2CH8A 4UV4H 2J4WH 5T1MB 3OPZH 1XIWB 2CIIA 4NQCA 1H3XA 3WN5C 1ZTXL 2ZUVA 2FX7L 1I7UB 1FC1A 4N8VB 4A6YH 1AE6L 4G9DB 2CK2A 2IJ0C 5JO5A 4HJGB 4IEFB 1FC2D 4ZAKB 4PRHA 4O4YL 5BOPA 5I1IL 2JB5H 3FB5A 3G04B 4LNVA 2LVCA 1IM9D 4OT1L 2YZ8A 3WIIL 2W65A 4N8CH 2AV1A 2OTUB 4IMKC 5D7LD 4NO3A 5EOQH 3VDAA 1ZGLM 4MNGA 2EZ0D 4XCYA 1K2DA 4QOKE 1IZKA 5EBWA 1XH3B 4QT5A 3MRPA 4LF3A 5DRXB 2FO4B 2A83A 2VDPL 4HIIA 3RPIA 4YK4B 3X3GL 2VSDA 5IK3A 3FJTA 4CVXA 2DQCH 1ZS8A 5JR1H 2IH3B 1OARH 1VFBB 3L3KA 4U2ZA 1NGWA 4N0FB 1T1XB 4KKBC 2XWBB 3BKJH 1S7UB 3ZDYE 1V7NL 4B53A 5HXMA 3WO4C 5HSFA 3LN5B 2VDLH 3P11H 1SM3L 4LLWA 3C09B 3UYRL 3RGHA 1OSPH 3NZHL 4X7TA 2DMBA 4FTVA 1UWGL 4YUEL 2WK2A 2OCFD 2Z0BA 5K33A 1XIWA 2DQEL 2HFEB 3MRIB 4ZD3L 1B88A 3MOAH 3V5KA 3EO1B 3WL9B 1JK8A 4ZODA 1MQ8A 2F9BT 4GMTL 5FYLD 2DQDH 1WC7B 3HNTH 3DXAD 5H94A 2AJYH 1KCVH 1J05B 2DYPB 3EHBC 2UV3A 3NGBB 1MRCH 4WW2F 4JR9H 3WFDL 3PHQB 5DUBA 5D7LB 1J0YA 4JPKH 4X6DF 2L4OA 1IGTA 3DRQA 5CJXC 5EIIB 4JY6A 4LGPB 4BFGA 5D9SA 4Y4KD 1IC5L 3T4AB 3GGWA 5ANME 1G6RL 1T20A 3O2DL 3WNPA 4NZUL 4R4BA 3V5DA 3SE9H 4X99A 4BZ2H 1GPOH 1L0YA 4MA3B 1AI1H 4CDHA 4U1MA 4UDUA 3UZEA 3NH7H 2YWZA 2CRIA 1B2WH 4RSVA 1UADC 1YEKH 1RIHH 3ZLQC 2XPGA 1INEL 3HB3D 4ZTPH 1Y6NR 2C7UA 1KEGL 4MLSA 1Q8MA 2GTWB 5D93B 1T03H 5DJXA 4G8GB 4WV1B 4W4OC 3QH3A 3LQMA 1WT5A 5GSRB 2H9GA 1PW3A 3NCJL 2CKNA 5E9DD 5DDHA 3TO4D 3JWDC 4XTRC 4FP8L 3R06B 2XNAB 5IROA 1H9VA 4PGEA 4W6XB 2FIKB 4PRPE 3WS6A 3DUUA 4HHAB 3P9MB 1MOEA 5J6HA 3AVEA 2NYYD 3MGTB 2XXMB 5GGRB 4ONFH 5E2TL 3UO1L 2Q3ZA 3PV6B 2XZQL 2X1PA 4KU1A 3R0MA 1XEDA 3O4LA 4J7RA 5ACZA 1AKJB 1ERNA 3BP4B 5IW6A 5C7XH 2ZUUA 5CD3B 1F4XL 4GG6A 1RZIB 3DX7A 1XF5B 3KJ6L 4NHCH 3VFPB 1QPPA 2ATPB 5JHLH 1U8HB 4G5ZH 25C8L 5CGYC 5I75B 1NSNL 2N4IA 2YPVL 1BM3H 3DTXB 2HFEA 4OBRA 4MLIA 3WIIH 4YDKH 4NZTL 3S35L 2PTTB 2DLFH 5IVNA 1IGMH 1CK0H 2XTJB 4XMLL 3VXMA 3IDYC 5AZEH 1PLGL 5KSUB 2AJSL 3BYTA 1AXTH 1X7QA 2UZIH 4YLQT 4F33A 2ZG1A 4JPIB 1IBGH 1AQKL 3DUUB 4HIEA 1Q1JL 2B1AH 3OHXB 4K94H 4M7JH 4JKPL 2C3XA 2EYTB 1MAMH 1B6UA 1FRGH 1I3RB 4FFYH 4Y19B 2VDKH 5D9SB 5DRWA 3JTTB 1QFOA 2F5BH 4HF5L 3BQUD 1AP2A 3CFKA 4M62L 4PRDB 4X7SL 2LV4A 1I3GL 4K23L 4IM8A 1WZ1H 3GFUA 3SKJH 4MVBC 5CEZE 4JM2F 3QWOA 2IALA 3OXSB 1OB1A 3OZ9L 1CXKA 4G6KL 4DGVL 3QIBB 1F13A 3HZVB 5MENB 2YPLD 3Q6FB 1X4YA 2GITB 5F7EL 2DOCA 2QTEA 1PEWA 2D2OA 4HJGA 3ULUC 5EORL 2V7HB 4RMQA 2EDOA 1QR4A 1CGSH 3ULUH 3GMMA 2D3VA 3L1OL 4PG2A 3V6ZB 4B7LA 3SGKA 1H8OA 3P9LA 1MRCL 2A77L 5I1GH 3MSPA 1DUZB 3FB8A 4XHQA 5GHWL 1LK2A 3FT4B 4P2OD 1YJDC 3QEQD 4GW4A 4LLMB 2EDYA 2R9HD 3MUGA 5HHPB 5DI8A 2GT9B 1NCUA 4HDIB 1ZS8B 2PYFB 3QSKB 4JLRB 1DVFA 4K71B 3ARTA 2VL5B 1KELH 1X4XA 5FECB 5CZXD 3C6LD 1S7TB 2IMNA 5JUEH 4K9EC 2RIKA 3MRIA 1HSBA 4JFPA 5E8DL 1KULA 5T5NG 1YN7B 1KEML 1TFHA 1CT8A 5JIHA 2VDRL 3BP5A 4NHUB 1MHPL 1G7IA 1S7UA 5EULV 1HILA 1FFRA 2WSKA 1DN2A 5L8JB 1VGKB 5AAWA 5TE4H 5IESL 3QFJD 4JRWA 4Y4KA 2F53D 1RJCA 4QRQB 3MODL 3D85A 3OXRB 4K3JH 2W9LA 4YDIL 4UQ3A 1KPVB 2HTKC 4PG2C 5D6DA 3RWHA 5DJ2B 2GTZA 2YD8A 2O5YL 3NCEB 2APBA 3QULA 3DXAA 3NA9L 4O2EB 2WBJD 3KDMB 1Y0LA 1FYHB 4L3AA 1T0PB 3O3UN 4U6VH 1TXKA 2ESVB 3T0WA 3UYRH 3WE6B 4HFUL 1MJ7H 1WIPA 1XCQB 2R29L 4IHOB 3MTRA 5IIEA 4LQFH 4Y5XC 3MXVH 3UBXA 2EKSA 3SGDI 2YUVA 2J4WL 3L5WB 5SWSB 4RFEB 5KSAC 3MR9B 2RAMA 4OGAD 1JRHI 2F53A 4LHUD 3SDDA 5DSCB 1UZ6F 1GCFA 3NIDE 1CTNA 1A47A 3ZO0A 4HWZA 2WUCL 4Y1AD 3QXTA 3S37X 4KROD 1NCTA 2ZJSH 3MLTA 4RX4A 1NDMA 2D31A 1D9KA 3PNWB 3QEGH 4KK8C 2WBWB 4MD4A 1MJ8L 4AQOA 1JF1A 4DGYL 4WFHE 5FECA 2R1YA 3NFPB 4B41A 1QYGL 4ZMAT 5CSZA 1IE5A 4I5BA 4X4ME 1ZV5A 1AHWA 4EI5A 1OVZA 2AEPH 5T1MA 2X4RA 2VDNH 1H15A 1G7HB 5JOFA 4D9RE 4YO0B 1MCFA 4WI2A 3QCVH 3F5WB 4PR5B 3D6GA 4D0DA 4MJ6B 1KG0B 1KOAA 1JFQH 1GZPB 4KK6C 3VGHA 1KACB 1CGSL 3ULUL 1VDGA 1U3JA 1N26A 3DVNA 1S7RB 4U6TA 1FYTB 3UBXB 4MB3A 3RWGB 4XVJL 4XWGH 5SX4H 5DFVD 4Q6IC 3BDYL 3CMOL 4LSUL 2DM3A 1UM5L 4LCWB 3G5VA 2AXJA 1FNGA 3I6GA 3T8XA 5GRXG 3ZHLA 3ZDXF 2ZKHH 2P8MA 1DP0A 1D6VH 4OZHF 2IPTH 4K8RD 2Q87A 1J12A 2QQLL 1DSFL 3K7UA 1BZ7B 4PJXB 4ODHH 5C0DA 1UJ3B 1HEZA 3LDBB 4Y4FA 1AGBB 2F19L 2CGRL 2E6JA 3C5SA 3MBEC 1N59A 4ELMA 1PDKA 4UDTB 5SWZD 3TCLB 4KQ3L 1Q0XH 3VI3E 1OAQL 1W0YT 3FRUA 1XF3B 4L4VD 5DJ8A 4Z0XA 2BY3A 3IDGB 1S8DB 3UTSA 1UACH 4DW2H 3ARDA 3LRSA 3EDKA 4X80L 3RU8L 5I1LA 2DLEA 5EU3A 2NY5C 1W8NA 1I7RA 1D5XB 5E2UL 2M26A 1CD1A 1JV5A 1YNLL 4XNYL 1B4RA 1XGQB 2VLLA 5KVEH 2F54E 1J5OL 5D2NE 1OTSC 1RUQH 3RVTD 1KCKA 1M7DB 3WN5A 4PRHE 2R0KH 2YA2A 3TIEA 3QUMA 5TPWL 1UZ6E 3RVUC 1I1AD 1C08A 1FPTH 3MJ9H 3CFDA 3ROOA 3C8KB 3OKDB 4H0IA 4EN3B 8FABB 3B2VL 1A1MB 1U58B 1S7SA 3IFPB 3JTSB 5JW5A 4PJGF 3OGCA 4RAVA 4PRAB 1G7QA 4PJGB 4A6YA 3HN3A 5L2KB 1AGCA 3V4UH 4N8CL 3RUGA 4C83A 4NKOB 2NCMA 3I6GB 1N2RB 2XQBH 4X6CA 2CO7B 4ZQKB 5GPRA 4PB0L 4JRYE 1XF4A 2ZUWA 1FNSL 3QZWB 4C58B 5C7XL 5TPWH 4YHPB 1IKNC 4HZAA 4YHYB 3CVIL 1MHCB 4GQ9H 4XCEB 3QRGL 5GZND 3TVMA 1IEHA 1IAMA 2YD9A 1FDLL 5KTEH 1E4KA 4XBPB 1KB5H 3SDCC 3VFMA 4YJZL 4MAYB 1OM3L 2AK1L 5HJ3A 1NFDF 1SY6A 1NJ9B 1FCCA 2X4OA 4ZYKA 4FFEX 4GKNB 3N50A 1A7PL 3O2DA 2VLJE 5GRUL 2O61A 3H6JA 4Z18A 1XF2B 4LDOB 5GS1B 1F97A 2G5RA 4JPWH 4MA1C 2YS4A 4XBEL 1I85A 1L8JA 5F96L 4F7MA 4L8CA 4I9WE 4IRJD 4YBHA 4M7ZB 1CD1B 5KVDH 5JIPA 4LARL 4PLKC 1KFAH 4MA7H 3DX7B 3HI5L 1ITCA 4GSDH 4ZPVA 4X6BB 1TJIL 3GKWL 3ULVD 5JW4N 1QLFB 1ULVA 4KK9D 3S98A 3FRUB 2FBJL 1AIFA 5D1XD 1T1YA 1JTPA 1FFPB 1CF8L 1W0VB 2VRAA 1BPVA 3RL2B 4LFHG 3S4SB 1XIWD 5D8JL 4I0PB 2WW8A 3IKKA 3VFGH 5I16A 3KWWA 2ADFL 1GIGH 3I3DA 1VPOH 2BCKA 1P2CB 1A64A 4FQJL 1WZKA 4TNVF 2BJMH 1JYNA 1UB6B 4M7KL 1J7VR 3OV6A 3BVNB 4LBEB 5L2JA 1NDMB 4ZAKA 2XT1B 2I9TB 1AFVH 3BGMB 4FQXD 1NC4A 4UIMA 2X1OA 4OD2B 5DYOA 4CW1B 2YUZA 1DBMH 4X5XA 1JUFA 1NMBH 4NKMB 3TWCH 4QT5B 2JIXA 1MCKA 4N0YH 2NY6D 4HKZB 1A7OL 3RVWC 3DMMB 4JO4L 4Z95H 4MJ2A 5E2WL 3C2AH 5IVXF 1P1ZB 4UNVA 3B2UD 1W2KT 5I1AA 4FQ2H 1TJGL 1ZVYA 5D72L 2VN7A 5JZ7D 5C3TA 4I2XA 1K8DA 2OZ4A 3X12A 4XWOC 1DEEB 5E70A 2J8UA 3L9RB 1S9WA 1IGCL 3EFFB 1JGDA 3VH8G 2EC9T 3F7QA 3QDJA 1A3RH 3FB6B 2DLTA 5E7BA 5E1AB 3PHOB 1VHPA 2JTDA 5GQBA 3VDCA 4DAGH 1I8MA 4M8VA 2W1NA 1EVTC 3O8XC 1INDH 4AT6A 4LLUB 4LCWA 3B9KD 2OTWA 1UC6A 1ITBB 1RD6A 4ZFFA 3ZDXE 4LKCA 2FECL 1MFBL 4P2QE 1L7IL 3V79C 3UJTL 3EDFA 3FQXB 1CFSA 1GZPA 1QFPA 5MEPA 1KENL 1FN4A 3IJSA 4XPHL 5HI4C 4EN3C 3LAFA 2X05A 3HAEH 1MAJA 4FFVD 5DK3A 4L8CB 1ZLWK 1GYAA 2FEDC 3IGAA 3T0EB 1IEAA 3RZWA 4BSWB 5DC4B 2X1QA 5CIPB 3K2UL 1PYWA 1F3RB 4KKAD 2JJTA 3IXTB 1N0LA 3B6SA 3FB8B 4L9LC 4Q9QL 5DJCB 1I8KB 43CAB 3LKPA 4KZDH 4XT1C 1DN0B 3TH4T 4MA8H 2NY3D 4LP4A 4BJLA 3HCVB 4HX1B 1K8IB 2V7NB 1OARL 5SWQB 5EO0A 1MVFA 3HS0B 2E7LE 4YHZH 4OQ1A 3MNVA 4O2CA 4X6EA 3B9KA 2W65B 3NIFF 5I1JL 4I18B 4RIRA 4RNRA 3DI2B 1AGDB 3PQYB 4NDMA 5EU7E 3VXRE 5I1EL 2D7QA 2A1WL 1PKQA 5FYJE 5T1LB 4XP4L 3RUGB 4C83B 4HGWB 1BJ1H 4QRPA 2YMXH 1WEJL 3LB6C 3QB7C 3PDGA 4QRPD 5F7MC 7FABL 1QLEL 3PIQA 3ARGD 3QUXB 1QFWH 5D2NC 1N6UA 1NANI 3QHZH 4M7KH 3ZHDA 5BCAA 1S7XB 3BP4A 4KDTC 2BMKA 4LLDA 1RSFA 3BO8A 1NH6A 3GMNB 2C1OA 3DO3A 3VGDA 4PJBB 1FVCA 4OCWH 5LXGL 3GSVA 4WFED 3RKPA 5IGXH 3BDYH 3FO0L 5FGBC 5EA0L 5D7SH 2IADA 1IT9L 3IAQA 1N5AA 1P69B 3B8YA 1PG7L 4YE4L 3ROLA 3VFTB 3LKQA 5HHOD 2NZ9C 5J56B 2VITB 4ZXBA 1QBMH 1PY9A 2VQ1B 4OKDA 4JVWA 4U7SA 4PFEA 2PF6A 5D2LA 4NO2B 1DBJH 2CKBA 2E8ZA 1OGAA 1N0XH 4Y4FD 3SGJC 1F3JB 4K9EH 1YEJL 4F7PA 3O3DA 3RGVA 3BW9B 5INDB 4YPGB 2XFXA 2NZ9D 2PYEB 1EEYB 3O9WA 4D9LL 2NW3B 1F6AA 3H9ZA 4XAWH 3STBA 2FH8A 2AGJH 4GLRI 2BOCB 2DF3A 4YK4C 3QUYB 3RPKA 4IOIA 4NQEE 4P5MB 4XXCC 2AV7B 3HE7D 2DQCL 3CFIC 5C09D 3TO2A 1JGVH 3AAZA 4NNYA 5T33H 2E9BA 5DRZA 4OIIL 3BH8A 2KDGA 5AEAA 5FF6B 5DUML 4Y2DD 3QXAB 2ZOKB 2F5AL 1S7RA 4JHWH 4H1LA 5E8EA 3E3QE 4WRLA 2HVJB 2DQIL 4ZTOH 2NY0C 1DBKH 4HXBL 1LILA 4YHLL 5D2LF 3WUZA 3G5VB 1EUUA 4BSVA 3FFDB 3GGWB 3OJ2C 5IBUG 4RMVA 5SWZE 3BMVA 4YDIH 4NBZB 3ZYZA 1JZ5A 1MUJA 3UZVB 2V5RA 1H8SA 3MRFA 2YPVH 1VB9A 5F9WC 1EDQA 2DMCA 3DVGA 5MI0B 3KYNA 3QQ9C 4ZFZA 5C0BE 1MNUL 1EO7A 1UWXH 2X4TB 2ORBL 3KPNB 3BT2H 1S7XA 2Z35B 4O02L 1NUNB 5ICYB 4OFIA 4OLEA 3LIZH 2F58L 2VXSL 2A6IB 5D93C 3UX9B 1ORSA 3LQZB 4RQQA 4D9QD 3WMSA 4P9HL 4U3HA 3SE9L 2D7PA 2VABA 5F7HA 2P7TA 1OP5K 2GSGA 4NQXA 1II4E 2YEZA 3SKNB 2GCYB 5CBAB 3WEXB 4RZCB 1FFNA 2GFBA 5JXED 1LWRA 2J12B 1T1ZA 4LCYA 2CDGA 1OTUD 5HHME 1TDQA 1P4IH 3OAYH 1F00I 1KCSH 1B90A 3L1OH 1FAKT 4PJCA 3S36X 4D9RD 1RMFL 4YWGL 1JHLL 1MFEH 2ITCB 3ALWA 3QIWC 4R4ND 4EI5B 4NSKA 3AS0A 4XCYB 4O2FB 5J9PB 5EORH 4F9PC 1FZMA 3VFOA 4D2NA 1NCBL 3FB6A 2C3GA 2APWA 3L3DB 3RTQD 4X4XB 5D6DC 5SWZA 2I26N 1MCEA 4CADB 3TH3T 1IZJA 4ALAL 4M6OL 3T0VA 4WO4B 3RWDA 4U1HA 5I73B 3NACL 1YYMH 3RDTD 4HULB 1JWUA 1J87A 3SDDB 3RWEA 1U91B 3QUXD 1DDHB 2OM5A 4YFLF 2DMKA 4QRPB 1D7FA 3PWUA 3EO1A 4H0HB 2HRLA 1YPZF 3DMMC 3ULVC 1C5BL 2XWBA 4OBSA 3UTQA 2Q8BH 2R2BB 3LEXB 4RZCA 5BO1H 1I9RL 3T77B 4K3JL 2HLAA 1HDMA 3DRTB 1WZMA 4PJ9D 4RMSA 4G7YL 4HC1L 2FX9L 5IESH 3MACL 1I9JL 4XCFH 5BS0B 2DWEA 4JY6B 5IMKA 3VFWB 4QXWA 4MNGB 1AO7D 4P9HC 4EIGB 5EO9B 1HN1A 1Q9KA 1D5MA 3HG1D 5DRXA 1HH6B 3H9SB 4N0CA 1H3VA 3BGMA 4XAKD 1I8IB 4OM0H 5DR5H 1P7KA 3MOBH 3BKCH 2JCCE 1IGIH 2EDLA 4ELME 4JANB 3PP4L 1GL4B 5EU7C 3N1QC 1KPVA 3RGVC 1FV1A 3BRFA 1JHKH 4PGDA 3QG7L 2DD8H 3JV5A 3GMLB 2CJUL 4KZEL 2VXUL 4WFGE 2PYED 1EVUA 2EIZB 1UH3A 3D3VD 3KPLB 4P4RB 4QHNB 2PR4H 4ZO9A 1G7LA 1MHHB 5LGJA 1ZSDA 5AYUH 1QYGH 3MUGB 4Y5YC 4LHUA 5B38A 5CBAA 1NC2A 1Q94B 1SBBA 3KS0H 4MXQA 1MCQA 4H1LG 3VD5A 4IOIB 3LV3B 2IAMC 3D39B 4ORGB 4PRAA 1GGCL 4LCIH 4NOBA 3H0TA 1BAFL 3GMPA 4PTTA 1RU9H 1R3JB 4LCUA 3IF1A 2NPLX 5E00B 2FJGB 4GLRH 3ULSA 4JFYB 5AAMA 5I1DB 1FNEA 5DJ0B 3RL1B 4DZ8B 3RA7H 4HH9A 2OX5A 1KTDA 4JM2A 3MRLB 32C2B 4R97C 3GI8H 5I0ZA 3KLDA 5EU6A 2Z91B 5B8CC 1QLRA 2F54B 4V1DD 1U93B 2Q76B 3VFMB 2AI0H 3CX5J 1I7RB 4NP4L 3SE3C 4AG4L 5AZEL 4PY7A 1UKTA 2NY6B 2E7LA 1EMTL 1CE6B 4Z7UA 3O3DB 4NRYA 2ZOKA 1BOGA 3SGDH 3C87A 2QADC 4FFWD 3IAPA 3TIEB 2LTQC 5GJSL 2GJ6A 4ZQKA 4JFED 3O0RL 3GSUA 2C4FT 1SBSH 3GUTA 3KPNA 5CHNB 5HI3D 4XBEH 3HNSH 1UQSA 1J0JA 3B83A 4RAVB 3AXLB 4XXCA 3BAEH 3ZZ1A 2GK0B 4JVUA 3PABB 1EZVY 5EIVA 5KANG 5JW4R 4I8DA 3D5OF 1A3RL 4E41B 3X13B 5D1QA 3U46A 1X44A 1QLFA 4MJIE 3VFVB 2GYSA 5ENWB 5EUOF 2IEPA 4NJ9L 4C56B 3AREC 5HHXL 4JM2C 3UJJL 4JO2H 4QOKA 3UAJD 5IEKA 5GZOD 4UQ2B 3N1PC 4KK5C 3T0ED 3ARBA 1DQTA 3BPOC 1WC7A 1HNFA 3KYKH 1TZIA 2PETA 2VDML 4H20L 4PS4H 4Y19A 2Q20A 3ARUA 3O4OB 1UCBH 2UZYB 4HS3B 2HFTA 5CGMA 5JXEA 5I8EB 3ZSTA 5EO0B 3QDJE 4N90D 3QIUB 1Y18B 1YPZA 3V5DB 2Z8RA 1UJ3C 1KLUB 4Y5YA 2E7CA 5JOPE 4OZFA 3P2TA 3B9KB 4N8VG 1FIGL 2W0FB 4RGNE 4PG9B 4XI5C 5DHYA 4WFFD 1UJTA 5LBSH 4GRLB 4YAQA 5JHLL 1FVEA 1Z9SA 4JKLA 3UJJH 4V3DB 1NFIB 4C56D 3W9EA 1DL7H 3ARBD 3WFEH 3MV8E 4TUJB 4DK3A 5T1DL 1BZ9A 4U7MA 3BZDA 4LIQE 1JHKL 2BHUA 3L95A 1NEZA 4MD0B 3UTZA 3BUTA 4M1GH 1E27B 1DQQB 5FHBL 5CIPH 5I6XC 3VFNB 5DD1L 1S9VA 3CH1A 3ULUD 2BNQA 2IH1A 1NFDE 5F9DC 4GUPB 3KLHD 4RWHA 3TVMC 3F7PC 3LS5H 5C0FA 4CU6A 5SX5H 1DFBL 4PJCF 4PJ9B 5HHMA 1W0WB 1EH9A 3U30B 3N06B 2Q7YB 1IAIH 1KTLA 4DFIA 5TDOB 3CK0L 1N5AB 1UB5B 1GGUA 1OTTD 3CLFH 4ZSOB 4JQIH 5IB3A 3TBTB 4IRZH 5JW3H 5GSVB 5GXBB 4LL9A 2GJ6B 5ID1A 1A4KA 3MNZB 3C08L 3P11L 5DJDB 3W5MA 1TQCB 3HPJA 5HHQA 1YA5A 1U8IA 1DQMH 4OZGE 1SVZA 2D7TL 1YYLH 1U6AL 3UYPA 2YWYA 2R4SH 3O3EA 4AENB 1ZWIA 1REIA 5IG7B 3VWKB 2ICWJ 5A1AA 1AR1D 4JG0H 1RUML 4P59L 1X4ZA 3MCLH 2OL3L 4FG6C 4L4VE 1IT9H 4DW2L 1UXSB 3BQUA 4DGIL 1UVQB 4RA0C 4EI5D 2R2BA 2A9NH 3KPSE 3CDYA 4NQDA 3U36A 4M5ZL 3GHBH 1LQVA 5GRYA 5ESVA 5ABDE 1ED3B 5IFHL 1SJVA 2HYMA 3BGAA 3QCTH 1RMFH 4YWGH 4WEBH 1JFQL 5DJ6A 5C70A 2E5EA 3DX6A 1S5HB 5A2KH 1WBYB 5HGBB 3KLHC 1RIVH 2YK1L 4JY5L 1ND0B 3MC0A 4LK4A 4LHQB 4RX4D 4WJ5A 4XXDA 5TQ0L 3MRCB 4UI2A 1I1FA 5C0IB 3BSZL 4MJIA 2JK5B 5DD5L 3V7AG 1XCTB 1PQZA 4J2XA 5FYJH 5DMGD 1JHTB 5I74C 4AJ0A 4LSTL 1ZVHA 2A6DA 3U2SA 3SBWC 4NJ9H 4XVUC 2BVQA 5ADOL 2W60A 5F9OL 2YPKA 2BZDA 3D3VE 4HCRA 1MFAL 1OL0A 3LKRB 1JL8A 5K9QG 4Z7VA 3IKCA 2B0SH 4M6MH 4N68A 3IAGC 3HZKB 3GSOA 3QFDB 1ZEAH 1CFQA 4J4PA 1T1XA 1CL7I 1Z5LB 5L2KD 1RZFL 2E6PA 3W0WB 5DQ9A 1P9MC 4X0KB 4JREC 3RL2A 3GMMB 3KPMB 4F7TB 2Y06H 1MCIA 2VL5A 1A1OA 1ED3A 5E6ID 3IDMA 4PJ9A 3Q6GH 4M9OA 1BGXH 1QVOA 1HHGA 4K3DH 1KENH 2IMMA 2XA8L 1FLRH 1XR9A 4PJDF 4JPWL 5DHVH 3I85A 1A6AB 1AIFB 3G6JB 2BP3A 4WHCA 5GIRB 5E9DA 4ZSOA 4DKEL 3JUZA 3WCYA 3IETB 3IDJB 5F88B 1MFBH 3E6HB 2QSQA 4YBLC 1NCWH 1T0NB 1IKFH 4PJIB 3C6LA 3CVHA 1SVCP 5I30H 4XTRD 4P23D 4HK0A 5I8KH 3FQWB 2E7BA 3FFCD 2OSLB 4NFDA 4I13B 1OW0A 3MLYL 4PRHD 4LOUC 4M4RA 5C86A 2OLDA 3TO2B 2V5MA 3HRZB 4ONOA 1JMZA 3U9PH 2VLJA 5KJRH 1OGTB 2GJZA 2R1XA 4QRPE 3CDFA 4BYHA 5DJ2A 3FOLB 2FWOA 1S78C 2R0LH 4LNRA 1EPFA 4XWOD 4X9GA 2VUYA 4EN3A 4JQIL 1BECA 2MSPA 5MERB 1P4LB 4TVPH 4HUWB 4ELKB 5EBLB 2ATPA 3BW9A 1Z2KA 3QHFL 7FABH 1WFNA 3H8NA 4BSVB 4NKDA 4EOWL 3BEVA 3RZCA 2DTMH 3V95A 5HYSG 1F6AB 1JPFA 1DBML 1DE4B 5E2JA 5IEHB 2B1HH 5DMKB 2NX5A 4DUVA 3SDXB 4BZ1L 3HLAA 3QUKB 4X5WB 3NA4A 3OZ9H 4JZOA 4NQEB 3F58H 4PJGA 1ES0A 1OGAD 3MQIA 5I6XB 2MWCA 1IAII 2NYYC 4UT6H 5C08D 4YFEA 4QRRA 4ZFOA 5EZJA 1CDBA 3BP6A 3MRMB 4JQVA 5DQDL 3RIFK 5GGUB 5B39B 5F1NA 1F45A 1KNOA 3ARGB 5F1OB 5C0AD 3V8OA 1HSAB 3AS3A 1Y18A 1YPZB 4XVSH 4Y5VC 1XF2A 4GAYB 1LVEA 2X09A 4P4KD 5AYQA 4WNQB 5T1LD 1SJHB 2Q8BL 1UWEH 1C5DB 1SYVA 4KJPD 4DCQB 4LCCA 3GKWH 1GJIA 3EDEA 5C0AA 5IMLA 4XC3L 5TDPB 5L2KE 1F58H 3AREB 1E6OH 1TQBC 1R0AH 1YMME 5EZOH 1OT1A 3DLQR 4JFOA 1KCVL 1QLRB 2F54A 2X6MA 3EIFA 1CICA 3L5IA 3Q1SL 5FM8A 3MV7E 2P46B 3AROA 4X7CC 1MCOH 3D18B 4Y2DA 5DA4A 5GIRA 1ZVSA 4NPYA 4HGWA 2CDFA 3HI1A 5ESAB 1KIPB 2R15A 1T0NA 2V5YA 3PIQB 4G5ZL 4JPIA 1KJ2H 2H1PL 3TFKA 5J6GA 4OLXH 1AGBA 3EOBA 2ADGA 2XN9D 2ESVD 3LN5A 5GRJL 1S7WB 3BEVB 2MMXA 1NDGB 1MFCH 5F1NB 5F7DA 4GQPH 5E56A 4CJ1A 4I1NB 2VDQH 2WBJB 4PY8I 1W72L 4JPVL 3WJJC 3TLRA 5IWLA 2DJSA 2AERT 2XI9A 1WTGT 4R7NA 1MCLA 4J6RL 3TYFB 5HY9B 1IGFL 4HS6A 3ARDB 2NY1B 5B3JF 1J0HA 5CEXB 1T21B 1LD9B 2YD1A 1I8LC 1UT9A 3RBSA 1KTKE 4YHKL 3BMWA 4MQXD 5DUBB 2EXWC 3OMZA 1WWCA 1FZOB 2OS7A 1YZZA 4PJ8B 3QZWG 2WUCH 3FRPA 1WZ1L 2V9QA 1JHTA 2V2WA 2ZJSL 5CP7A 5J7CC 2YBRB 1QRNB 2Y4SA 5HVFB 1IAIM 2ZCLH 4RISL 2ZCKH 1P6FA 2FB4L 3BT2L 4OLZL 3BE1H 2NNAA 1FSKB 2ESVA 2QQKH 4M7LT 1JWUB 5LGHL 4QGYA 1YEEL 4K8RC 2AKRB 2V9TA 1TLKA 4UINL 5CUSL 1MCNA 3SPVB 4LLUA 4X6DA 3K2UH 1IGIL 2KKQA 3MYZA 1S9WB 2JF1A 5ALBH 3W11C 4YDJA 4MB5A 4YXLL 5IKCA 2HN7A 1RUAL 3FZUC 4P2RD 4U05A 3VD9A 3U0WL 2BSSA 4D3CH 2P47B 3HR6A 1TMCA 4JPKL 4TPRL 3PWPE 2IANB 2ZUXA 4RDQF 1FN4B 3IJSB 1MCRA 3UTTA 3TA3D 5IJVA 1A7QH 2X1XR 3PWJA 5DMGC 2LU3A 2DQUL 4QY8B 4LGRB 4Q7DA 1YMMA 1P1ZA 3S8WA 5FYJD 5IVXE 4CL7A 1O7VA 1B0WA 1QSFB 5CD5C 3MV8D 1RQ5A 1K8DB 2MCG1 5L8KB 2R4RL 5KSBB 2E9JA 2BVOB 1TVBA 3G6JF 1D5MB 1NC4D 2X4RB 3DHJA 1K4DA 4U6YB 1T83A 4JRYD 1A9BA 3C8HA 4O9HL 3MJ9A 4ZG1A 2R56L 1A6VH 3BGFB 4LASH 2B4CL 4JFQA 2NY4B 5CJ5A 5D7LA 3RA7L 1PAMA 4ZOCA 4K3DL 2AV1B 1JZ3A 4PJBF 3GBML 2D4FA 4KKNA 2W07A 2XRAL 5FYKU 1EEZB 1OAUH 5E8PA 1QFUH 3A6CL 4PP2A 3VXPA 5KVMC 2YRPA 3Q1SH 5IMMB 2FCBA 1E4XL 4NGHH 3SDAA 3QISA 2D7OA 4OF0A 4TTGA 4BUGA 2X4NB 5TQ0H 3LPFA 4JQXA 3JWNC 2ARJQ 1QD0A 4HKJA 4QXUH 4HIJB 1WBZB 1TVDA 2VH5H 4K8RL 1DTUA 1FFPA 3ALXA 4PJIF 5BV7C 1XGTB 4WHDA 3JVGC 5C6PB 2P5WA 3IYLW 1F4YH 3GBLA 5TGBB 4O58L 1OTTC 4LASL 1NCDL 4D8PA 1HSBB 2VB5A 2AXGA 3EKCA 2VDQL 4L1HA 1P5VA 3GZKA 2VABB 1IL1B 2HTLD 4W70A 5CP3A 4HQQL 1B0GA 4PJHF 2VAJA 3VD3A 2K1MA 2IFFH 4YZFE 1EJOH 5A40E 5JXAL 2DI9A 2VZTA 2YD7A 3DMMD 3TFKC 4LSRH 3OKMB 2DQGL 3E8UH 2AKRA 3H9YA 1IM9B 4KC3B 1LK2B 4WHYH 4NJAL 3O3EB 3X12B 4QTHA 4OV5B 4MD5A 3FN9A 4YDKL 4WI7A 1CR9H 3BPCA 4FQXB 1IAIL 3WHXA 1HHIA 6FABH 3IFLL 3CNKA 1VFAB 2XZAL 1QFWM 1QPXA 1FLRL 4LPYA 4CBPA 4WI3A 3PWVA 4HJ0D 3NOIA 3X13A 4XBGA 1KIPA 3QRFM 1HH9A 4L5FL 1VKXB 2PCPB 4NRZB 3S36L 3ZKSD 2C1PA 4C56A 4I0PD 2F5BL 3KR3H 2DQIH 3ZL4L 1KC5H 4CU8A 1UQSB 4Z7WB 4HQQH 4JHWL 3BDBA 1YEGH 4G6MH 3ARGA 4Q97A 1RURH 1RULL 3G5YA 2X4UB 3DUSB 1CS6A 3CD4A 1KN2H 3HHRB 3MZTA 3VXME 4HXAL 1CVRA 1ONQB 2WBJA 3NACH 4F7EB 3RVXD 2H3NB 2BSRB 5FGRA 5IEKB 1VEPA 6FABL 4PJAA 3AU1A 1TPXB 1ZT4A 1KLUA 1KJ2B 5F3HA 4P5MA 1WISA 4PRIE 1Z6JT 5E99L 2DYPD 5F9JA 3PGFH 4XBPA 4KHTH 4IIQB 3VXNB 5FA4B 1I3RA 3D39D 4EI5C 2E7MA 2X2YA 4AL8L 4Q6IB 2NTFB 3T0AA 3O6MH 1FVEB 2DBLL 2J8HA 12E8H 1U36A 2HWZL 5FO8B 3TBVA 3X14A 1XF1A 4L4VA 4PRNB 3G6DL 4YPGA 1INDL 2B4CC 5IM7A 2EEBA 4GG6B 4HEME 1J9CT 2B7DT 4HWUA 4LNRB 3F6IA 3MA9L 1G7QB 2DQFB 5C0ND 1JWSA 5I1KH 4U3XA 3TP4A 1G0XA 3MRHB 3MOBL 2H8PA 1U3HA 4MNQB 4LLQB 3EAKA 3G5YB 4QLRA 3MJ7A 1IL1A 1TQBB 4ZUSB 5A43C 3D2UD 3GM8A 3O6LH 2MQ3A 5IB1B 2QQNL 4PUBL 4DEPB 2FGZA 4MD4B 4OCRL 1KTDB 4JM2B 3GI9L 4MQSB 5F97E 5DD0H 5HVGB 4XP1H 3UCRA 4HKXB 1CLYH 1WV7T 35C8H 4OFKA 2Z91A 5D7JC 1L4IA 1G7HA 1M6OA 3DX9B 2QEJA 4ODHL 5IOPB 5EU6D 2J7LA 3E6FA 4Z7QF 3V4VH 1IGML 1FNEB 1EXUA 1J1PH 3U4EB 2OZ4L 4LPVA 2YD4A 5IMOB 2I5YL 4MA3A 3D48R 2X4QB 1N7ML 3VMPA 2CK0H 2J3SA 5A16A 4HWEH 4FQLL 5I0DA 1LE9A 3LN4B 1FNGB 1T7VA 1MRDL 3HZMB 4E0RA 4XVTH 3LOWA 2HJKA 2GJJA 1CE6A 2A9MH 4L4TA 4Z7OF 3U6RB 3L7EA 2UY7A 2PXYA 3OAZK 4LEXL 1KJ3H 1VA9A 3SJVD 1ACYH 4P9MH 4ODSL 3ETBF 4YDVB 3MJ8A 5EB9A 3QFDA 4X98B 1N6QL 1TQCC 3MMEA 3OGOE 2PXYD 4OGXH 1LGVA 2EH8H 5D1ZA 1FAIL 3CK0H 4AM0B 5FM5O 2HJLB 1YMMB 3BH9A 3NCMA 5HD8D 4P5TA 4HV8B 2FHBA 3K8LA 1OSPL 3NZHH 4RGMB 3KXFD 5B22A 3SGEI 3W9DB 2XA3A 2CJUH 1BX2A 2GUOA 4U1GB 2DJ4A 3C09C 1T66C 1R3IL 1CFBA 1S7QB 1T1WB 2D7MA 2FECI 1A6AA 4R96A 4OGYH 5EUOE 3RJQB 1IGYB 5ACMA 1RVFL 2B5IB 2JK5A 5KG9A 1T4KA 4RISH 1FJ1A 3FB5B 3G04A 3SHSA 5TGBA 5E7FA 1YNTA 4MDIA 4OAWB 3KPQA 3TPUB 5JO5B 2XIDA 2ERJB 3TESA 4XC1H 5F7NC 2XN9E 4JDTH 1IAOB 2R39A 3VXUE 4ZNEE 3IKCB 2E9WA 2CRZA 5HI3C 5GGQL 3TGXA 1BD2E 1ZHNB 3ECBA 4P23B 1GPOL 2W0KA 5E1AA 4M5YL 1SEBA 4QHLA 3U7YH 4U6XB 3PWUB 2YBRA 1F11B 3CFCL 3FAXA 4JANA 5I2IA 4L3EB 4R26L 1G7PB 2IFGA 3WE6A 3IJHB 3Q48A 1M05A 4LCCC 1FE8L 4BQ9A 3EYFA 5EZOL 4BFEA 4HAFA 5HPMA 1RIUL 2P8PB 4CVXB 4YIQA 1RUKH 5BS0E 4WU7B 3L5WA 2Z35A 4OZFG 3MYJA 3WNKA 1S5IL 4G8EA 3PL6D 1CLCA 3IDNB 4QF1B 1XZ0B 5DZOA 4ZPTA 2W59A 5DUMH 5KS9B 4HUUB 1BZ9B 5C09E 4Y1AB 4L3EE 1BQSA 3QWRA 1T1WA 3M1BA 3VI4E 5GISL 1RHHB 5HDLA 1MEXL 1EMTH 2X44D 4NQDB 3U36B 5E08H 2GFBB 1GHFH 5GRVL 1G9NC 4X8JA 3QIBA 4H88L 4YXHH 5TF0A 3OBAA 4TOYL 1C5CL 4ZYKB 4R0LB 4HLJA 1KGCE 1A5FL 3MRNA 4MAYA 4ONGL 5EU6E 1LO3H 3PWNB 3GSNL 4G43A 2OZ4H 4L4TB 2WIMA 4WGWB 4Q9BA 3AM8C 2XZQH 3S36H 1KSRA 1BWMA 3T0EC 5HYQB 4M4PA 1CZ8H 3V0VB 2BRQA 3HE6B 2ZUYA 4OD1H 4U1HB 4QHKJ 4C55A 4UZGA 1W8OA 1C7TA 2FDBP 2AS5M 3S3SA 4I0PA 1DUZA 1C12A 5AWNL 3OKOB 4NN6C 1KBGH 4PDCE 3A6OA 2VLRA 5BW7A 4EJ1C 1AE6H 1IC7H 2BOBA 4MJID 3RWFA 2QLVB 2WUBH 1IQDA 3EYQC 4JDZA 1JWSB 4P46A 4JO3L 4KRLB 5I8OL 2AK4E 3GUTB 1FGNH 1OB1B 1T3FB 1FRGL 1OSZA 5CWSB 3MXVL 2GITA 2A0LD 2C5DC 3AREA 2VSCA 4OGYL 5I1HL 1GGCH 5K59F 4OCLC 5IHZB 4I48B 2AJXH 4DN3L 4QO1A 1SYVB 1H5BB 3QZWA 5I1EH 4YH6A 5EBGA 4U0RB 1A4JB 4XP4H 4AY0A 3IFLH 4KRPC 4NZDA 1A6TA 1EFXD 3ZTNL 3TT1L 5DHXB 2VKXA 1NPUA 4OTXH 4JZNB 3QEGL 1ZT1A 5BZWB 4OF8A 5BOZG 4MNHA 4GXUN 4XNUH 2AABH 4ZS6C 3IRZA 3VGEA 3IFOB 1ZT7B 5HGAA 3X3FH 1RK1A 3LIZL 5FO9A 1PKOA 4BM7A 1CL7L 1UKSA 4KY1H 4R90H 3DTXA 3QQ3A 3HA0A 2V9RA 1JZ6A 4PRPA 1WCBB 1OAZL 3E3QC 3ULVL 2E3VA 2Z92A 2P4AB 3D18A 1T7YA 5F93C 4P57A 1DLHB 2FRGP 2APXA 4S1RL 3HNVL 5IB2A 4XNYH 5IHBA 1BREA 4ZS6D 5ADOH 4PGEB 1S9YA 4IOFD 2NY3B 5BQ7B 5B8CA 5BW7C 1AR1C 4W6YB 2VAAA 5GGTL 3GK8H 1MLCA 5E4EB 5D7LE 4G7VL 4LVOB 4MXQD 1SEQH 3EYUH 4KHTL 5IHZA 4HUNB 5D1ZD 3LRHA 1OPGL 2H32H 4F9LC 1PZ5B 2QR0B 3CFBA 3GJFH 5DMKA 4TVPD 3QEHB 1X9QA 3OJDB 4XRCB 4E41E 2BVYA 1G9NL 2VLJB 4HMCA 3CDGB 5E00A 2QJDA 4WTWA 5EN2A 3BHBB 3MV8A 1H3WM 2VIRB 5DZNA 1K85A 2NY4D 4I5BB 1C16B 3ZKNC 2BMKB 2IPTL 3S4SG 3KYKL 2ZUQB 4PRID 3GIVB 5DVNA 3PHQA 5I1CH 1J0ZA 4Z7UB 3JTCA 3GSQB 5FCUL 5FDYA 1KLGB 3VXNA 2KZ1B 3RAJL 2CDEA 3HAEG 5FEBA 3S9DB 3T8XB 4Z76B 1VKXA 3LHPL 3O6FC 1U8OB 4R4NC 1AGDA 3QJHB 5I2IB 3D85D 4UB0L 1F3DJ 2G75A 5CWSA 4ETYA 2FD6H 2HT4D 2IPKB 4KV5E 1WWAX 4Z5RB 4QHLB 5E2VH 4P23C 3H7BA 3K4ZA 1RVFH 2KL6A 4N9OB 5FK9A 3CU7A 5JXEC 4JN1H 1DQJA 4PP2B 2VXQH 1AD9A 1F2QA 1ZLSL 4QCIB 3WXVH 1GZQB 4APQD 3C5JA 3ILQD 5DMYA 3CZJA 4DN4L 2GIYA 3QUXA 4GMSH 4CGTA 2GAZA 2Q86B 3PL6A 4ODTH 1MJ8H 3DRQB 5IVXB 1JBJA 2YZ1A 1CXFA 4NHCL 1FPTL 4M7LL 3P73A 3OR7B 5E8OB 2VXUH 3DRTA 4ZUVA 1T0MA 2XZCH 3ULVE 4G43B 1YY8B 3LEYH 3QG7H 1U8PB 1VACB 4JFEA 1NCCH 4OLZH 5BS0A 4ODWB 4HUVA 3MRNB 1WF5A 5KSVB 3VJ6B 3RKDD 3HZKA 5MEQA 4G6AC 4P48A 1FNSH 4W81A 5IMMA 4J12A 5HGDB 1QUNA 2UZIL 1MLBB 2EDBA 5C1MB 5CKAA 5K9JH 2ZNXA 4KQ4L 1A2YB 1VFOA 4WWKD 4HKJB 4NUJA 3O45B 2CUMA 4DKEH 3CC5B 2VR5A 2H45A 2NY1D 4OQTA 2YPLA 3DPBA 3JV4A 3BIKA 4LHJB 4PTUA 3K1DA 1EO5A 2EIDA 4M1CC 4OZHB 1G84A 3ZKXC 1E6OL 2NX5E 3L7FB 3BP5B 4OKVA 5F6HI 1NKRA 5HYIA 3RX5A 3QDJD 4N90E 2NY4C 4D9QE 4JFDA 4Y0GA 3DV4B 4PS4L 2AQ1A 3QXDA 2NY1C 3MR9A 4X5LA 3QDMA 4HBCH 3RHWF 1JPTH 3D3VB 3OAUH 4UQ3B 1M6OB 5FA3A 3NH7L 5JNYA 2DDQH 1T7ZA 3RFZC 3T0EE 4FTVB 2HN7B 4B7IA 1L6XA 3MRJA 4G8IB 4Y5XA 4GFTB 4HV8A 5H2BB 5DURB 4ACPA 2BVEA 3KDMA 1MIEH 1NGXA 3WJLC 3CVHL 3VWJA 1GGBH 5CINH 2DN7A 3L5XH 4W6WB 4H25B 1IJ9A 5HJ3B 1U8IB 5F7FA 4LLAA 1NL0L 3GDBA 1NBYB 4LMQE 5KVGH 4QRRD 2NXZB 2WMPA 1MUJB 4XI5D 3L7EB 1S5IH 3MV7D 1FBIH 2JCCA 3KPSB 2ESVE 4N0CD 4D0BA 3KYNB 5ICYA 3GBMH 4GKSA 4FQJH 3IU4L 1OAUL 4UV7L 5CKGA 1EBPA 4JO2L 4XVSL 2LFGA 5E5RB 1ZEAL 2VUOA 1IC4H 5ANMA 4AH2A 1AQDB 1PZUB 1CDHA 1FG9C 5HHXH 2C3WA 5KVFL 2P7TB 3FB7B 3IRPX 4NQED 4PJEE 2EYTA 3TNNB 4YXKL 4TRPH 3CUPB 4Q0XH 3TPUE 3VRLF 1OHQA 2FGWH 4LRIC 3T1FA 2MCPH 2IG2L 5IW1B 2QQQA 4OCMC 4OIIH 4JO4H 4JY4A 4NQXB 1R24A 4U1KA 1R5VB 4WO4D 3T2NH 2I9TA 2FL5A 5FKAA 3O2VH 3E2HC 3OAZH 1F90L 1RV6X 3X3FL 2NY3C 1ZKAA 4S2SA 5BJTB 3FO2B 3ZMRA 4S11A 4AEIL 4F7MB 2H3NA 2COQA 5DT1L 3WHE0 5LKNA 1IBGL 2LTQB 3WS6C 5ID0A 4X6FB 3QDAA 3T3PF 1XGQA 3ZE2F 3W39B 3P9MA 3T4YB 1X5XA 3LH2L 4NZRH 3KXFE 1OW0C 5GRJH 3TVMD 4PJ5A 5CGTA 3GJFB 2EIEA 3SOBH 5JLZA 2DKMA 3ZE0E 2ZUQC 3CXDL 5GRUH 2AK1H 4WU5B 3TBSA 4ZUWB 2ICEA 2X70B 4NBYB 4DGVH 1G1YA 1BFOB 4BFIB 2J5LB 2A6JA 4G9FB 4LAJH 2ILLA 5T5FH 1EJ6A 1IGJA 1KXTB 1DFBH 3QUKA 1DLFH 3F7VB 1FP5A 3MJ7B 4JGMA 4PJBE 1C08B 5C0CE 1RZGA 1RJZB 4Q9RH 3GMRB 1T5WA 5KBNC 2XPGB 4FXKA 1F4XH 1A1MA 1U58A 4KK5D 5D7SL 4ZUSA 2FATH 1FYTD 4XPFL 2VZ1A 4RGNC 5F7LB 5L2KA 1J11A 3QG6A 1VGEL 4OM1L 4KPHL 5JW5B 3RWFB 4WEMB 1CD8A 1RIUH 4NQCE 2P42B 1MCSA 3FZUD 4N9GB 4K9EL 3NIDF 3HUJF 4PB9H 5C0JA 3CX2A 4NKQB 2JJSA 1XR8A 3GSNA 1OSZB 3C6SA 4POYA 1UWXK 1I8KA 43CAA 3BPNC 4I4WA 1XGRB 2OSLA 5FO7B 2Q6WB 2FATL 3FHQA 1T2JA 3JSSA 1HK6A 1QSZA 3H9SE 2Y72A 1MELA 2CKBL 3A67L 4P4RA 1U2HA 1U92A 1I3VA 2LU7A 3OKDA 4QHNA 3HS0A 3GB7B 1NBQA 2WINB 5FOBA 4FXGA 5DURD 3ULVF 2FWOB 3OGCB 1IGTB 1IM9A 2IBGA 1U93A 5BZWA 3FTGA 3ERYA 4NIKB 2BY0A 1CQKA 5D72H 4KQ3H 5B4MD 4OV5A 5I1KL 4WHTB 3FQTA 4DN4H 4ELKA 1D5BA 1UM4H 1ZGLB 4YNYB 1UZ8B 5IK3B 1FZKB 3F7RA 1IGJB 5DD3L 3QFJE 5GHWH 4Z78A 2YD3A 3NCYP 4PJEA 5EPMA 3VRLE 1JCKA 3FQWA 4PV8B 5CIPA 2EDFA 2OXHA 3OKEB 4BKLA 4HJJL 3TN0B 1F90H 4NN5C 9CGTA 3VFSB 4HUVB 3C5SB 2I25N 1N7MH 5IBUB 3MFGB 3TCLA 2CK0L 2NXYB 4P3DA 3GMQA 2ZSWA 3RI5F 4LAQL 5DUPL 3MUY1 3QNYB 2DRUA 3UC0H 5C0CD 2WP3O 3KYAA 3BWAB 3HMWH 4Y2DC 4X4MA 1JGLH 3VWKC 2P8PA 2ITDA 4F15B 3EOTL 4HZLA 2K3TA 2XWJA 1MFNA 4K94C 1CDUA 1A9BB 1UXSA 3Q5OA 4JZJA 4LKXB 1QSEA 3MO1B 4IOFC 1Z0NA 4H25A 5INCA 4Y1AA 4APQB 4Y8DC 1AQDA 2OP4L 3QEQB 2V5TA 2I27N 3ZTNH 1Z5LA 3IDNA 4QF1A 5F7YC 3QQ4B 1OOAA 1FV1B 3VCLA 3OWEA 2EKSB 3OKKB 1DVFB 2P48B 2D9QB 2IFFL 3DBXB 4P2QD 3RUGF 3C60B 2P24A 2R8SL 4YHIB 2FO1A 4LQ1A 4YX2H 4I3RL 1V8HA 5HY9A 5EO9A 3STZA 4ZTPL 2P5EE 1EA9C 4UMGA 2EYRB 4UIKL 5KW9L 2VDPH 2FJHB 4O5LH 1FBIL 4X9BA 1CXLA 1YQVL 3NFNA 4YC2B 1N4XL 4L29A 4ODXA 5C0RL 4QRUA 3X17A 3TM6A 5EBMA 4PJHE 4G42B 5IFAL 1WIOA 3QAZB 4EUPB 2P5EB 4RFEA 4F7CB 1FGVL 3GMQB 3QDJB 2F74B 2NY0B 3U4EA 4I0CC 4OF3A 3S37L 5C92A 2DI8A 3F6LA 2VLJD 1N5YH 3QNYA 1A7RH 4TSCH 3TBWB 3DGCR 3C5ZC 4GAJH 2CUHA 1QG3A 1KPRA 5JDJA 2P5ED 5JA9A 4Z0BL 3OG6B 4U4BA 4PV8A 1UENA 1JNLL 2V2WB 4F8TA 3HI6L 2R0KL 3EYOB 1ZHLA 4KKCD 4BKLB 4AEHL 5BXFB 2LU4A 3VXSD 1MFAH 4V2CB 4ZFOL 2HVKA 4G8FB 4POZD 4R7NB 4KDTA 3RAJH 4OZIF 1OP9A 1JNJA 4PRPD 5I76B 2GAZB 1Z3GH 3V4PL 5C0GB 3MFFA 2BNQB 1RJLA 1W0VA 3JWDH 4TOYH 3S96B 2IALB 3OXSA 1RI8A 5J3HC 5I66A 1FL3B 1HQRB 2EH7H 4R2GD 5M95B 4FZEH 4PREA 3MREA 1DQDH 5J4MA 4GAJL 4MQTB 2OYPA 3DYPA 4UAOB 4RAUB 4WUKH 1OF2A 3MODH 1GGIH 2OI9B 1A6UH 1S78D 5DGQA 1FNLA 2HT2C 4HC1A 4K71C 4NKIH 2X89A 2LQRA 4YGVA 5C0JB 3TO4B 1MCWM 1YEIL 2EECA 1WCBA 5HGHA 3ARPA 15C8H 1QO3A 2XICA 2F54D 4V1DB 3SCMA 5I1IH 2WP3T 4IIQA 4OZ4A 2XKNA 3G9AB 4R2GB 1F4AA 2G2RB 3NTCL 1I3GH 1Z3GL 1WFUA 5DHVA 1JF5A 3UTOA 5I8EA 2BNQD 2PXYC 1NC2D 3OJMB 2DL9A 1MREL 5DJZB 2QBWA 3FTGB 3MBXL 2R0WH 1HI6A 3QG6B 4LPTA 1RUQL 4KI5D 5FCUH 3X3GH 1UJ3A 1VESA 4QWWD 5ETUB 5FOJA 4MXVE 1F3JA 4L5FH 3IDGA 4NKIL 5F9WB 3QUYA 4MZ2A 3DJ9A 1Q9LB 1NAML 2DQJH 2G5BA 5KOVC 3EBAA 4FQQB 3MRBA 1XF3A 5D5MB 3MROB 5LAXA 2V5SA 3MA7A 2NW3A 5BZDB 4HGMA 1KB5B 2VLLB 4ZD3H 4S0UC 1UWGH 3RVWD 1U42A 5T1KA 1X5JA 5FM4A 1RURL 4XP9H 4Y5YB 4U1MB 1HWGB 3O2WH 5D5ME 3KLAB 3MREB 3HC4H 2NXYC 2CKBB 1EO8H 3IB4A 2XKNB 3HC0B 4X6FA 3MLWH 2ZKHL 1Q1JH 1T66D 4M93B 3HNVH 4D0BB 1QQDB 4MDJB 5DJXB 2XOTA 1RU9L 4YXHL 1HHKB 3G08B 5JHDD 1NMCB 4NT6B 2AGJL 5BS0D 3WHXB 5KANI 4H1LH 5LJYH 3VXSA 4TYUA 2BSTB 3V0WH 3WXWH 3WFHB 1FGVH 2CMRL 4XAKE 4PPTA 2DS4A 2G2RA 3ARED 4JG1L 2EXYD 3U7AA 1H3PH 2O5YH 3PHSA 1DVFD 4XCNA 1Q0XL 1HQRA 3IXAB 2R69H 4NRZA 1F2XK 1NGYB 3OX8B 3QIWA 2Q3AA 4OCYH 3DV6A 2Y1VA 4OCXL 3E6HA 3H3PH 4N5EA 3QEQA 6CGTA 1LNUA 1DE4A 5IEHA 3GHEH 1JN6A 5KN5A 5EOCJ 4FA8A 5JOFB 2YA1A 1NQBA 3ARXA 1WQVT 3RDTB 1VSCA 2XKUA 3DYOA 4M5YH 4MJ6A 1KT2A 3D39A 1JWMA 1T5XA 1A6VL 1GC1C 2OBGA 4L29B 5CSZB 4NO3B 5DJ6B 5T3XE 4YHNA 5C0CB 5DS8A 2L7UA 2FJHA 4DZBA 4NUJB 1KBGL 2FGWL 4XXDB 5EBWB 1BIIA 1IC7L 5SWQA 5HGDA 1D6EA 5GS0H 1KELL 3LDBC 1I9JH 3VXQB 3BAEL 5GS0C 4PRBA 2BVOA 2ADJA 4YHOL 3U2SB 4X7FC 1I9IL 3VWJB 3T65A 4X7DC 3FL7A 5CILH 3ARDC 4R4BB 2FBOJ 4DN3H 1N6VA 1ZHBA 3F7YA 2BVQB 3OKKA 2QADB 5ICXA 5J12C 3MV01 4CVZA 4DVRH 1U8KA 3QAZC 2NR6C 2XTJE 3H0TB 4AENA 3LS4L 3VFUA 3GSNH 3CLFL 1S5HA 4JJHA 1OCWH 1VFMA 5A2FA 1A5FH 4ONGH 5L0QB 5CJBA 1HWHB 2Y36H 2G9HB 2WIIA 4IS6B 3K4DA 4LSSL 1HYSC 4WFEE 5DUPH 1UZ8A 3VXOB 5HPMB 3NFSH 4HDIA 3MLRL 4L4TD 3B9KC 1VGKA 1KB5L 3FT2B 2Y07H 1A0QL 5BMFL 4YHZL 3L3HB 4BSJA 3ZT7A 1W72B 3X11B 1V3MA 4GQ9L 5DRNA 2ZSVA 3B4NA 4Q9RL 2R4SL 1YN7A 1I7TA 4L8SB 4JRXB 1BFSA 2W60B 2EDRA 1RJYA 3P9LB 4NC1E 4JAMA 2A73B 4NNPL 2WV3A 2XZCL 1SEBB 2E8YA 4Y4FC 1HOCB 3T77A 1DL7L 3WFZA 1I75A 2F19H 4L1DA 4Y4HA 1CFVL 5D7IB 3NN8A 4IJ3B 4K3EH 4UILL 3ZHKA 3EYUL 5D2NA 1QBLL 1GC1L 3LKNA 2Z31A 5ICZB 3W0WD 4EDWL 2EE9A 4YUEH 1CI5A 4HGKC 2Y6SD 4YAQB 3U7YL 1AGFB 1AY1L 5L9DL 2D03L 2NXZD 3JWOL 4R4FL 4KJWD 1SM3H 2BHZA 3U6RA 5TDNA 3D2UA 3T3ME 3TA3C 2H8PB 4MNQA 4YEFA 1NAKL 5E8NB 3JXAA 3ABZA 3REWA 4JM2D 5D7IE 4E0RB 3ME0A 5KSBF 4B5EA 5E4EC 1JGDB 1RK0B 3RWIA 4OZIE 1LNUB 4AIZA 1R3HB 2K9UA 4U6HA 5ITBL 3KPRA 3SDAD 1PG7H 5CD5D 2YSSB 3PGCB 8CGTA 1AR2A 4LVHC 4X98A 3RIAK 1UEMA 1YUHB 1FQ9C 5HHMB 3SY0B 1MIMH 1T5WB 2W38A 4IRJC 4KTYA 4Q58C 3VFUB 1P4BL 3ZE2E 2HKFL 3G9VA 5IHLB 3VH8A 4DZBB 1RUKL 4ZUVB 1FIEA 3EO9H 4L8DA 3B2VH 1D3CA 5FUCE 5CAYB 1D6EB 1LO5B 1ORQA 4KRNA 1YN6A 1A14L 2CR3A 4FQ2L 2DIBA 2NZIA 4OCXH 2EDXA 1J1OH 2MJWA 5ESQA 3BWAA 3DVFA 4CU7A 1VGEH 1NL0H 5F3BA 4KZEH 2VZOA 3IJYA 2P5WE 2BDNL 1YMMD 2XY2A 5F72S 1F3DH 1PG7W 5TDOA 2EYSA 4H20H 1EERB 2DTSA 5FXCH 1LQSR 1NBZA 5E6ZA 4UTAL 4KKLD 1JTTA 3SE4C 2V7HA 5AUMA 4NM4H 4ERSH 1M7IA 1QRNE 2CLVA 4WNQA 4NYLB 3O4LD 1EUTA 1G6RA 1R5IB 5EFIA 3DWTA 2FZ3B 5I8KL 1P7QA 3TBVB 2F15A 2BHYA 5IGXL 2C1PB 5FCSH 2DB8A 4H0GA 4Y4KC 4F57H 5C6WH 3VXUD 4AEFA 1X5KA 1LP9F 4FQIH 4I3SH 3JWOC 3ARVA 2RCSH 1ORSB 2H2PD 3LQZA 5LQBH 3B43A 1CFTB 1CZ8L 3FQUB 2E9IA 3RP1A 4NQDE 2FLBT 4I48A 3WDIA 3O3BA 3BIBX 3O81A 3SDYL 4OFYA 4F8QA 1YEJH 4XPHH 2O5ZL 4AEIH 3KPSD 4H5SA 3QIWD 1Q72L 5E03A 5EU6B 4XNQB 3QUXC 3UJTH 4KJWC 5CSBA 5C0GA 4RMUA 3DSNA 5KOMC 4QRRB 2A74A 1G7JA 4EVNB