3QUKA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
275
structure length
262
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 60
structure length 262
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qukA01
5F89B 1JNJA 4HBCL 5EU6E 4LGSB 4NRYB 1OGAE 4KVCH 1J11A 3GKWL 3QDGB 1MAMH 3STZB 3VFUA 1NGYA 3P0VH 3FCTA 3BWAA 5HYJB 4O2FB 4RWYL 3AU1B 2K3TA 4YO0B 5IB3A 2ZSVB 4BQ6A 2R8SL 4U6VL 3BGMB 3ZDYE 2HFFB 5FGCE 2CGRH 4CBPA 3QRFM 3RIAK 3MBEC 4Z7UA 5F7NC 4NDMA 5L0QC 1RMFH 2RJMA 3CFEA 3CXDH 4QLRA 2QR0A 4U6HB 3WN5C 3OXRB 4YDKL 3PP3H 1FNLA 3AS1A 3C8KB 1WAAA 2HVKB 3PDGA 1CYGA 2R4RL 3VFMA 3KPPB 4JO3H 2FEDD 4HXAL 5CZKA 2AV1B 4XMPL 4W4OC 1W0WB 4PJFB 4LLVB 4K8RD 5D7JB 5IJVA 1U36A 3T0AA 4HGWB 1CFQA 4NT6B 4Y4KC 1CDCA 4XVUD 1T1ZB 4IOFC 3HS0B 1RUKL 3REVA 2ICCA 4XP5L 4RX4A 5CZXD 5F70A 3GK8L 2AKRA 2E7MA 2FNBA 3SKOA 5JOFB 3SHSA 4GMTL 1Z9LA 4HAFA 2IAMC 2ID5A 3KHOA 2R0KH 2KKQA 3SGKA 2H9GB 2F8VA 1UM5H 4P3DB 1F4WH 1S7WB 4LP4A 5E4EC 1QPPA 1BEYL 3HNVL 3IJYA 1JZ4A 5K9KA 3SKJL 4WI4A 2FHFA 3WS6C 5A43C 3OJDA 5K9QG 4JANA 2ICWJ 4PP1C 5I15H 4UOW0 4EVNA 3O3BB 3E2HB 4OZFB 3MJ9L 4LU5L 2YRLA 1KJ2L 1FE8L 4X6DE 1ZA3A 4Y5XA 4G5ZH 5JA9A 3OGOE 3UTZB 5HYJE 4LVEA 4PG2C 3PWPE 3TT3L 1K4DB 1K85A 1TJGL 1FSKB 4QXUL 3O8XB 1GGBL 3VH8B 2ZKHH 5C0FB 1XGYH 1KXVC 1P7QD 3JV6A 1WQVT 1NEZG 4Z7NE 3OXSB 3IDMB 4QF1A 1I1YB 4XPHL 1NDMA 2YUWA 5I19H 4J3OC 4HIIB 3I6LE 3NZ8B 3GSUA 5F3BB 3GSUB 3T3MF 5FV2A 5F3BA 4PY8I 1Q9WA 2VLRE 3U0PB 4YBLB 4R2GD 2AI0H 5KANI 2CKNA 3QAZB 1JNHB 1H3WM 3DX9A 1GZQB 5I66A 2CUHA 1FDLH 1FNHA 1T5WA 3H3PH 1IAKA 1CQKA 4Z95H 4WEMB 2NXZC 3RQ3A 1ZWIB 3FQNB 3DECA 2EYTB 1RHHB 1I3VA 1URLA 1Y6KR 5DFVC 5F7KC 2LVEA 3O45A 4RA3A 3X12A 5IJKA 1DZBA 3DIFB 5KVDL 3P4LA 1ZA3B 1NCBH 4Y5XB 4P2OC 1SY6L 3KVQA 3KPSB 4ODVH 1F3DH 1HSBA 3D2UA 4KRLB 2NLJA 2NY0C 4LASL 3RNKB 1HXYA 3PXHA 4V2CB 1UM4H 3WDIA 3PWLB 4OIBA 3SDDC 2ESVE 2JB5H 3FB6B 3JWOC 3L5XH 3MV01 3LPGA 5DVOA 1QLEL 2CLVA 2JLLA 3H6JA 3QUMH 3I3DA 4P3DA 4E5XA 3FB5B 4OIIH 1BZQK 4IMKA 4ODWA 1IT9H 1D6VH 3GSRA 4I18C 3GBML 1BM3H 1H3GA 3CIQA 4XH2A 1MCWW 4R7DA 2VH5H 2YSSB 4OZFA 4FRWA 4EI5B 3QSKB 5ADPH 3TPUA 1NCAH 1G7MB 4XI5C 2CDGA 1RK0A 3P4MB 5GS2D 2C26A 5TFSH 5L2JA 4MAUH 4F33B 4P4KC 4KWUA 1MAML 4ZOCA 5IESL 2KBGA 43CAA 5IW6A 1GGCL 5D7SH 4PLKD 5DA4A 3AFLA 4NWUL 5AZEH 3O6LL 4TPRL 5ADOH 3IFLL 4MS8D 4YEEA 4D9QE 4KJQD 5I75B 4XCEB 3ULVF 2B5IC 1PQZA 1I3UA 4PTTB 4OFDA 4NKOA 3REVB 2VL5B 1IRAY 4MS8A 3KYMA 3U30B 3INUL 3K80A 4BFIB 3ARDA 2YXMA 4V1DB 4PJHA 3MLUH 43C9A 8FABB 1XEDA 3QIUD 4RQQA 3ILPA 1J0ZA 1GGBH 1MREL 4D8PB 1FFQA 1YY8B 5I8CB 4ORZC 4N1CA 3BZDA 4C56E 1B6DA 2GITA 3K74B 2VC2L 4X7SH 3HE7C 4R6UA 5EOTA 4MXQA 3KPTA 1EMTH 5HY9B 3HC3H 5CSZB 4YHKH 2R0KL 1HZHL 3SN6N 1A14H 4Z77B 4Z77A 1FYTB 3MUJA 5E2VL 1Z0NA 2FGWL 5IHBA 3MCLL 1QR1B 2QBWA 1TMCB 3OKLA 3BH9B 2XN9E 4JQXC 5DK3A 2QSVA 2Q87A 4AM0B 4LNRB 2PXYD 4IRJB 1MAJA 2UVFA 2D03H 1T6VN 5TF1L 2MQCA 3CDCA 4EDXB 3BD5A 3NFPA 1FQ9C 4IM8A 1XF1A 4XTRD 1LQVA 1FCGA 1CD8A 4MSWA 2P24A 3VGAB 3G5VB 2NY3C 4G8IB 4YNYA 4J7RA 1N26A 2XTJD 43C9B 2AK4E 4PBVC 3IDGA 5EU4A 3G6JB 4QXUH 2XFXA 3PWVB 1XIWD 4LF3A 3GGWB 3A6BL 1A2YA 1NJ9B 1UJTA 2YUZA 5KTEL 4M61A 3MNVB 3O4LA 1XR8A 2WSKA 4P2QA 4WCYL 5I19L 2Q8AL 3OF6D 1BD2D 3T2QA 2IBGA 3U4EA 1I8LA 4Y4HD 1M05B 3BRFA 5IB1A 2V2XB 2HT3C 5K9JH 3VGDA 2ED8A 4Z6AT 1VA9A 2VZOA 4X7TB 1ZHNA 3KPLA 3CFDB 3EBAA 3U1SL 1RUQH 5FDWA 2DLFH 3T0DA 3EFFB 2AQ3A 3SGKC 4LVOC 1Q1JH 5CWSA 4OFKA 3QWQB 4QF1B 3PGFL 4S1RH 4GMSH 2BNRD 3TPKA 1U8JB 3LS5L 3IFLH 4L9LA 1AKJA 2AABL 2UZYB 2ZCKH 1JNLL 1IGTA 1U92A 2HN7A 2VOTA 3RL2B 1F6AB 3INUH 3A6CH 5IEKB 1BVZA 1MCNA 3MODH 1NMCB 3HAEH 4PS4L 3VXTA 1A7PH 5CJOL 1FH5L 1CD1A 4NOBA 1VADA 3W39B 3G5XA 1OHQA 2HN7B 4Z7VE 4HUUB 3S3JA 3GIVA 4DAGH 1UGNA 1U8NB 3U82B 4P9HH 5ESVB 4HIJA 1NCAL 1MFBH 2AQ1A 3EIFA 3W82A 4Z0BL 3O0RH 1CD1B 1WFTA 5E99L 3ZKMC 4ELME 1QSVA 1MI5A 4LCCB 4PJ9B 4WFEE 3GI8H 4PJCA 1BWMA 1GCFA 3N85L 2X7LA 2YRPA 4CW1B 4OAWA 3WBDA 4HH9B 5HVWA 5ELIA 4FQ1H 1TJHL 3V4VL 1HHIB 4NWUH 3PL6A 5E6ZA 4HMDA 4NM4L 5BOZG 4HHAB 2VLJA 4ZMAT 2JF1A 3MRRB 1UQSB 3D18A 3X3FL 4HK0B 3LQAC 3DROA 3LQMA 4YLQT 1UZ8B 1MCLA 2CLZB 4UV4L 4HPYH 5FO9A 4WW1A 3MRJA 1CQYA 1JHLL 1NFIB 3P9MA 4UT6L 4XB8A 1I1RA 5HYSB 1ZLWH 4MQ7A 1YPZB 2VXTH 5MEQB 3RTQB 3HR5B 4O2CB 4HDIB 5JW4Q 1TETH 2OSLB 4QRTB 1TNMA 1IAIM 2VC2H 5FYKD 3IKKA 2OR9L 4ZFGL 3K2MC 4X83A 4XCFH 3D69B 1QSFD 2V5RA 3LCYA 4NHCH 4OZIF 4WNQB 4GXVL 5JXEC 4WFHD 4MD4A 1S7WA 2XZCL 4LPCA 1AE6L 4HX1B 3SJVE 4JFHE 4LEXH 5EU6B 3QEGH 4MVBA 4EN3C 3FHAA 4NJAL 3RZCD 4TOYH 4PJ5E 5E8PA 4M93C 3QIWB 3SY0A 5IKCB 1WF5A 3VXMB 3TVMB 1KPRA 4OUOA 1NBQA 3C6LB 3GBNL 2NX5D 3JV5A 1IGFL 4OD2B 1KCSH 1DVFC 1EJOH 3BP6B 4M43L 4PJ8A 1E6JH 4U1NB 2FWOA 1EA9C 5F9WC 5F89A 5DO2C 4DCQB 4GRMA 1FG2B 4QYOA 1LP9F 3KPRE 5FYJD 1KIRB 3ESUF 2FIKB 3QEQE 3P73A 4JHAL 4N90E 2H6PA 3HZMA 4Y8AA 3VD9A 3LKPA 1CLYH 4AY0A 4EI5C 2DTSA 5JQ6L 4N5ED 5IBUG 1ZGLB 5DJ6A 4MS8C 5D2NC 2H3NB 4G42B 3FT2A 4M8QA 4NQVA 4KZEH 1RVFL 4OF8A 2GTWB 2E9WA 2GTWA 5CSZA 3DUHA 4F3FA 3O6KL 4U0RC 4X99A 3VXRD 4ZUTB 2BVOB 5J1SC 1T1XA 1FVEA 4PJ7F 2X41A 1XIWB 3QUXD 3SQOL 3IETA 2DJSA 5E99H 1OAYL 4R7NA 1SEBA 4KAQH 1R24B 2EEDA 3CFBB 3RDTD 2F54D 4BM7A 4OD2A 4XAWL 4MJ4A 5D2NB 4LGPB 1N59A 3EYQD 3QQ4A 4PJGF 2H8PA 5GS0H 2IAND 2EDOA 2FX7L 3HPLB 1NMAL 2NQCA 2AABH 4ODXA 4HFWA 1NGWB 4GXUM 4TQEH 3H0TA 4KK5D 3EO9H 1ORQA 4DW2L 4HJ0C 4XCNB 5D7IA 5I1KL 4JFZH 2Z35B 5ALCH 4Z7OE 4PS4H 2IADA 2BMKA 1A7PL 5CJOH 3SDAA 5A16B 5FYKH 1UVQA 5F7HA 3CLEH 4X7DC 2C9AA 5T1LA 1N0XH 1YNTB 1MHPH 2GYSA 4KUZH 5D72L 1XCQA 1A9BB 1KLFA 3IFOA 5D70L 5IKCA 2D7PA 5BQ7B 2XA3A 3OPZH 1ZKAA 1DQDL 4HV8A 5CSBA 4JRWA 5BV7C 5AUMA 3VGHA 3L7EB 2XZCH 1GGTA 3PABB 2X40A 1QACA 1S7XA 3BIAX 4IRZL 4GG8B 2GK0B 3MR9A 4J3XA 3SOBH 4JRYE 2IMMA 3NPZB 2Y72A 3HI6L 1DQTA 3FOLB 2IPUG 5IB5B 4R8WL 4G3YL 3Q6FB 4WV1C 1DSFH 4PJ8D 2BVQB 1Q9WB 5T1KD 1CXKA 5ALBL 2HKHH 3O41A 3OAYH 4BJLA 1OPGH 2W0FA 5AZ2L 4IS6B 1J12A 1MWAH 4KJWD 4UV4H 5IMOA 1A4KB 4P57B 1FZOA 4LSVL 1I7UB 3DMMB 4XBEH 5I8KL 3ZHKA 4FQXB 4ZNCD 1QFOA 5CD5D 1OAZH 1RJZA 3KS0J 4FP8L 4NKMB 1WEJL 3VXUE 1U8NA 2A6DB 2NXYB 4MD5B 4JE4B 4N0UB 5D5MB 5GGQL 3ULUH 1F3RB 3N9GH 4NRZA 1A4KA 5IM7B 4QRPA 2FH6A 3LKQB 3GMOB 3MV7A 3DX8B 3DBXA 3QG6A 5D2LE 3QG6B 4ODUB 1WSST 2OP4H 4OSUH 1HEZA 1AE6H 1L7IL 3MV7D 4JDZB 5DHYA 3GUTB 2HJKA 3LKNB 1RSFA 3RPIB 3DXAA 1F00I 5EBMA 3CU1A 2BNQB 3P4NB 4JFQB 2O61A 5IWLA 1FL5B 3GSVB 5FYKU 5D1ZB 3CFKB 3ZMRA 3PV7A 5FK9B 3O4LD 4G8GD 1KCVL 5JNYA 5EIIA 3GSXB 3GJFA 3EYQC 4JR9L 4RWHA 3PIQB 5DJDB 1KLUA 3D39B 5ESQA 4CUCA 1T83C 1XCQB 3IFOB 1WFNA 3UJIH 3L3GA 4Z0XA 4K7FB 4QRSB 3O6FC 3V6FB 4HIHA 4WU7A 5IVXB 1MFNA 4HKXB 3NCJH 4M7JH 1ZT4A 4A6YB 1KLGA 5J6HA 2ADJB 4UNUA 3IKCA 4WO4A 5IHLB 3RY6C 4ZO8A 4XBGB 3V4UL 5DD1L 2HYMA 3UO1L 5B8CC 4PJAF 5EORH 1R3KA 1I3GH 4JG1L 3U0WL 1ZEAH 2ZPKH 1QSEB 4X6FA 3ELAT 1NFDA 3VRIB 4RAVA 1J1PH 5IQ9A 4PJCE 2UWEF 3MV9B 3U46A 3HI6H 1LP9B 3KPQB 4J23A 3WSQH 1IM3A 1QFWI 2HG5A 2FX7H 3AREA 3M07A 1G6VK 2SEBA 4P5TD 5HYSG 2BXZA 4XNXL 1S9XB 4TQEL 2N56A 4LQFL 1OPGL 3RZCC 4DW2H 4LCIL 4N1HB 2E5EA 3N1MC 5E1AB 1OQXA 2VO5A 3C6LA 4NFBA 4NKDA 4PRBB 4QEGA 3U83A 4XP6H 3QUYD 1OTTD 5ALCL 4OZIA 5FYKL 4PPTA 5JDSB 1DUZA 2EH8L 4APQA 2AK1L 2NY5L 1JPSH 1MCQA 4UINL 4LSSL 2DYPD 1TENA 1G6RB 2WBJA 3LEXA 4YHNA 4KXZI 5TQ0L 3V5KB 3UJJH 4PLOB 4RAVB 1LO3H 2OJEA 4I18B 4BUGA 5IMMB 1ND0A 3DO7B 1GC1C 4JN1H 1G7MA 1U8KA 1K2DA 1CIUA 4JY4A 4PGJA 4FQHA 2PW1B 3PHSA 2M8XA 3TV3L 1NH6A 2NW2B 2PCPA 1EEZA 5JHLH 3TYGL 2J6EA 3BEWB 4LOUD 3KJ4B 4JKKA 1ZTXH 2I5YH 3MOBH 3OKEB 1AGEB 2FZ3B 3HCVB 2NY2B 5DRXA 4B50A 3WMSA 2HKHL 4CMMB 1KULA 4PJ9C 1KJVA 4I1NB 3RWJA 4MB5A 1ZS8B 1MWAL 1WCBA 5T1KA 5FYKE 4K2UL 2HMIC 2M26A 4TULH 4NN7C 4LSVH 1GGIL 1FNAA 1F4XH 1ZLUH 5ID0A 1OAZL 4GH7B 4U1GB 3WLBB 4YIQA 1RJYB 4P2QE 2DI9A 4WW1B 2HKFL 3FB7A 4CNIA 2XPGB 1KPUA 4C83B 4DKDC 2IAMD 1K8IA 1MCHA 3DETC 5C6TL 3O4OB 5FGRA 4M7JL 5CLWA 3CSGA 3MYJB 1CGXA 1DANU 1JGLL 3V6FA 3RZWA 3U9UB 1KJ2B 3VWJD 1UYWH 4R4ND 1AGDB 3MO1B 3OJVC 4FQXC 2YXFA 3U0WH 5T3XE 4O02L 5C8JB 1JHKL 5E0QA 1P69B 3HHRB 4X5WA 1KGCE 4I0KA 4F15C 2RB8A 4V1DE 2FCBA 5DHVA 3TBTB 1RUPH 4NQCE 4ZUVA 4F15B 3ULVC 4N8CL 5EZLA 4WTZA 5EO1B 6FABH 2H2SD 3C60C 4P5KB 3WYRA 1WZ1L 5EB9A 2JK5B 4LPUA 1AXTH 3G08A 2VLJB 1JGDA 3ULUE 3L1OH 4PJFF 3G04B 4GG6A 4ZDHB 1IGML 3QWOA 3ARTA 4GJTB 3FO0H 3GHEL 2Q86A 1JFMA 3U0PA 5CIPH 5LKNA 3QO1B 2NZ9C 4H25A 1PY9A 2FGZA 2Y36H 3SGDH 2D31B 1RPQA 5FA4B 3ZKXC 2X70A 4FZ8H 5JUEL 1CXFA 4ZDHA 1I1YA 3ZLQC 3O3AA 4XWOC 1KTDA 3V4UH 1WZKA 1CFNB 2N7AA 3GI9L 4PJDA 4EEEA 1ZE3C 4YBLC 4R90L 4KJQC 3AY4A 4WVRA 4JG1H 4DFIA 3MCKB 2WINA 5C0BA 2JELL 3HA0A 4D2NA 5HGBA 3SKJH 5GJTL 3LKSA 3MJ6A 4KI5C 3L5JA 5FEBA 3CU7A 5C0RH 2BNQD 3IDGB 5HGAB 3OJMB 3ZE0E 1D9KB 2DB8A 2P5EA 2OXGA 5IHZB 3CX5J 3U48A 4LSPL 4YHML 1NCWL 4QHUB 2LAAA 3QIBD 3FFCA 4FQLL 1JPGB 2OJZH 3PHOA 2OL3L 1CDGA 3BIBX 3KXFD 2M1KA 1EEZB 5A2KH 2HFEB 1BFOA 3U7YH 3S5LA 3MA7A 1LE5B 1K3IA 2VABA 15C8L 2XFXB 5GJSH 3FTGA 4XPHH 3TJEL 3S34H 1Y0LA 4HCRA 4KZDL 3G6DL 4ETQA 2KPNA 1QRND 3T65A 4RGNE 3HS0A 4EBQL 2CKBL 4M7ZC 2DBJA 2EDJA 2OL3B 5GRVL 5A2JH 1KB5B 3RDTA 1XMWA 2Q7NA 3TZVB 2XWTA 4MSWB 4DVBB 2IADB 5ESAB 1AD9A 2FYYA 4BKLA 3R0MA 4MA3A 1V5JA 1GOHA 3TA3A 5BVPL 4YHIB 1CXHA 4JKPH 3BP7B 3MXWL 1S7UB 1J0YA 1OLLA 3FB7B 4K3JH 3GSWA 4L8BA 3MRHA 5FHBH 1EFQA 2VE6B 3WFDL 5C09D 1IGCL 3MJ8A 2OR7A 4NYLA 2ICES 3IDUA 4XHQA 1IC1A 3Q48A 2VISB 1I7TA 4L8BB 3HG1E 1H8OA 5HVGB 5H2BB 4CMHB 2BFVL 1G9ML 1RK1A 4TULL 3RHWF 3ILQC 4Z8FH 2VAJA 4WTXA 4QYOB 5I1GL 3GHEH 1MJUL 2FX9L 1I7TB 1NAMA 4PJHB 4XXCC 3PGCA 1KIQA 2W0PA 3EYVB 4GQ9L 5B21A 2WWKT 2DQCH 4YXKL 3D39E 5IB3B 5CEZD 2IAMB 4PTTA 5FHAH 2ZUYA 5JUEH 5HYJA 3NGBB 3F7YB 4LMQE 2VXQL 4OI7A 4Z7NF 1D3CA 3EO1A 5ADPL 3UZVB 4B0MM 2AXFA 4NM8L 4J3SA 3FO9B 4XCYA 3TCLB 4NZRH 4PP8C 4F2MA 4XRCB 5HGDA 3KPOB 1EK3A 4L4TB 4OCNC 1S5HA 4DZBA 4PRHA 3TBSA 1CDUA 1W72B 3DRQB 4XGZA 5DJ8B 4OZ4B 5HDBF 3BVNA 3WIFA 3IDJA 3BOVA 1ZHBB 1G84A 2R2BA 3SDCB 3THMH 2A77H 6FABL 2DDQH 4F7MB 3VH8G 4XBGA 4R3SA 1IQWH 2EDEA 4JM2C 4OKVA 4OLVL 5F6IB 1NLDL 5CCKH 3OHXB 3D48R 4FQIL 1DFBL 1QYGH 5HHXL 3FO0L 4LHUA 5ICZB 1LP9E 1AP2B 4G8GA 1G9NH 4OM0H 2XQBH 1OAKH 2Q8BL 3PWJA 1X44A 4S1DD 2APBA 1MOEA 5L8LB 2VN4A 4LRIA 1NGXB 4PTUB 3O11A 2JE8A 3WE6B 2HRLA 4QHNB 4MDJB 1T3FB 1TVBB 1KJMB 1TDQA 2IFGA 5T3XH 3H9ZA 1OB1A 1QRNA 1C12A 2ZUXA 1NLBL 2AK4D 1I9RH 4GLRI 2C3VB 2CIIA 2ERJB 3QHZL 5IFHH 4WWKB 3FJTA 4X6CB 4QGYA 4YAQA 2GSGA 4JQVC 3ROLA 1L9MA 3OKYA 1OTTC 3OL2A 5EDXA 2E9IA 1UZ8A 3SKNA 5A1AA 3V52H 1EXUB 4DKEL 2ZCLL 3LH2L 1A7QL 5E6ID 4TSCH 1IGCH 1OTSD 3QHTC 3QXVA 3OKNA 1A6TB 2WWMC 3P9WB 3T77B 3R1GL 1MFDL 1V7NH 5HHPB 4P4KB 2FD6H 2J1KA 2IJ0C 1G9MH 1MCKA 1JFQL 4R0LC 4PGDA 1VERA 3ILQD 3KDMA 4NN7B 4C56D 2WIIB 1WGOA 4RRPG 2WIIA 5BRZE 1TQBB 1YDPB 5IFAL 1LEGA 3WNLA 2YPKA 5IVXE 5F7EH 5EO0A 4RMSA 3SDDD 5JXEA 5DC9B 3FO2B 1I1AD 3JZ7A 1XR9A 2CKBH 4PB9L 1HNGA 2IC2A 1OGAA 3AS2A 2Q7YA 3DURB 5D2NE 3ABZA 4KXZH 2VXQH 1UJ3B 4AIZB 4WUKL 3GMLA 1MCRA 1T1WB 3DYMA 4K8RC 4N8VB 3UTSA 2DQIL 1A5FH 4P99A 2DYPA 4UDUA 1JWMA 5J11C 3I84A 4L9DA 4FMFA 1Q1JL 4RWYH 4XWOD 5HSFA 2MCPL 3VXPB 3FMGH 4NKQB 4MQXC 4LKXB 4ZO9A 5B3JF 1OTUD 3O4LB 3CFEB 1A7NL 5D71H 4G80B 4I0PC 3HPLA 3UTPD 5DMKB 1VB9A 4JHWH 4I5BB 2D7TL 2QQLH 4W81A 3MFFB 5BW7C 2GAZB 3QIWD 1FG9C 3JUYA 4QXTB 1R3JB 1YNTA 3V5DB 4PYGA 4AK1A 4L8SB 3BSZL 5DJXA 5L6YH 5DJ8A 4Z78B 3DURA 1I9JH 4Z7QF 3RWJB 1IC7H 4UT7L 2VIRA 4EIZC 3IETB 1QBLH 3QDGD 1S7VB 1Q9KB 2JB6B 4O4YH 3PABA 5DD5H 1DUZB 2R23A 4EN3A 4UTAH 2EXWD 4HWEL 5IVNA 5JTWA 3BPOB 2VDPL 4ERSL 5EA0L 2P8LB 4GMTH 2Y1VA 4JREB 1EO7A 2VERN 4IRSC 1KCUL 1ZHBA 4PRBA 1Q9LB 3AU1A 1SVCP 4U6YA 1BFTA 2AV7B 4HKJA 1DUYA 1NUFA 3HNVH 5HY9A 5L2KA 2KZWA 1FFPA 3MV8E 4G9FD 5D7LE 3HZMB 4OLYL 4L4TD 1W72L 3LV3A 1CG9B 3CSYA 4KTEL 1NEZB 3MV9A 1ACZA 3BUYB 4QOKB 2CKBB 1I1FA 2LTQC 5T3ZD 4EI6B 4HPOH 2LU7A 1DP0A 5INCA 4GW4B 1S7RB 4PJEF 4BFIA 4M6AA 5D2LB 5HHXH 3L7FB 3FQRB 4ALAH 3HC4H 1JYNA 2OK0H 1PQZB 4I2XB 4RFNB 1RJLA 5I8EA 3QQ9C 1ZT7B 1H5BA 4WW2B 4YEFA 4HKXA 1ETZA 2A83A 3QA3A 1RIHH 2GJ6B 3DNKA 1W0VA 3NCEB 3OGCB 4LOUC 5T33L 5LAXB 1MCJA 3QHZH 3WD5H 2W65A 3MC0A 1RIUL 3WV0A 2V2WB 3ZE2E 4HWNA 4GRWH 4QTIH 1BOGB 1KIUA 3NZHH 2AEQH 4JN2B 4Y4FD 2PN5A 2CK2A 3WXVL 1TZIB 3CNKA 3S35X 2NY0B 4LQ1A 3OKDA 3KPMA 5DS8A 4PJBA 2Y6SC 4Y5YA 4GKSA 1DBKH 3CFKA 4NQCB 1G7HA 5FOBB 1ES0A 2BY2A 3O2WL 4NKIH 2WWKO 3R1GH 5KSAC 3PWLA 1FIEA 4HZLB 4HC1A 3BZEB 2VZ1A 3UPCA 2Z8WC 5KN5A 1CD9B 2J3SA 5DJYB 5ID1A 3UTTD 3HMXH 3QO0B 5F9WB 5B3NA 5J9PA 5I1HH 5SWQA 1U8LA 5FK9A 3F8UB 4ODSH 2X9WA 4FQQB 4IOFD 3O45B 1EEUA 4GBXA 4HWBA 2BDNL 3MYZA 3IYLW 1AXIB 4OQTA 5A2IH 1BGXH 3DX6A 2A73B 4JFEE 3BZFA 3SQOH 2QKIB 4LCYA 5GGTA 2ZUWA 1CK0H 4C56A 4LLUB 2NLJB 4KHXL 1QFUH 3LHPL 3P77B 1W8OA 2DWEA 4PP2B 5IB4A 1JNNL 3MQIA 4UIKH 1MRDH 3RWGA 5B3JE 1N0LA 1UWEH 4RDQF 2W0KA 1JF1B 3MRCB 4NO5B 1RJCA 3O6LH 1W72H 3SBWA 5CBAB 5CS7A 5BJTB 1V3MA 1AH1A 1J0JA 1IGYB 4G6MH 4LKCB 4X98B 1A7NH 1Q94A 3MRHB 3BO8B 3V95A 5C08A 4UV7L 4HUWB 3ARDD 4L29A 5DQDH 1V7ML 2XT1B 3GKZA 1SM3H 2X4SB 3TYFB 4DN3H 5IMOB 3MLSL 5E5UB 5FECA 4K3GA 3H7BB 5ETUA 4H20H 4LVNB 1IQDA 3JVGC 3QCTL 1R0AL 1I85A 4NNPL 3CLEL 4WFFE 1M4KA 2BVQA 1OAQL 1KC5H 1T7YA 2OR8A 3VXRA 3LB6C 5D72H 3WO4C 3RVVD 2PR4L 2EIZB 2VDQH 1YA5A 2EEAA 1QQDA 1L8JA 2Q76B 1CE6B 3F7PC 3HC3L 4ZFZB 4LLMA 1IC4L 5CGMA 3OHXA 2FECI 2VR9A 5GSVB 3RJDA 4YFLI 2FBOJ 2O5YL 1BVKA 1OW0A 3LVEA 3WNKA 5T3ZE 4L3EB 4GFTB 3TFKD 4X5WB 3ECBB 4C58B 4OLYH 3RTQD 5GGTL 5JHDE 3EOTL 4FN0A 1MVUB 4F9PC 1T2JA 1CICD 4OJFL 4KMTH 3LKSB 1IEBB 5DUMH 1U92B 5T1MB 3KPOA 1FGVL 5BV7H 4ZODA 2LV4A 4Y88A 4P46C 1XH3B 3HG1B 1EO8L 1OF2B 1T04B 2A0LD 2YBRB 4LPVA 3KJ4C 3KPMB 4OGAC 1QQDB 2WANA 3MNVA 1TXKA 2Y5TB 2VQ1B 2AJYL 3MBXL 4GAYB 4FQHB 1SEQH 2NY7L 3MRLA 1FZKA 1MNUH 2YD9A 3EYVA 2R1YB 5IB4B 3MLZH 4JO2L 3I2CH 1M05A 4FQ2H 5MI0B 3EYFB 4MJ2A 4E0RA 2X4QB 3Q6GL 3G9VA 5I1LB 1KBGL 4NO0D 1KCRH 5DRXB 1S7QA 4CVZB 3MOQA 3HLAB 3RVWD 4ZSOB 5F44A 3PWNB 3WUZA 1XF4A 1CG9A 4Y19A 4HIEB 4DCQA 1AC6A 5EO1A 5B39A 1CL7H 2IANE 4P4RA 1QFUL 1BQHG 1YNKL 4F9LA 4LFHD 2WMPA 2ZZUT 4MDIA 1QFWL 4WWKC 4C55A 4YO0A 3HPJA 5ITBL 2QADB 2H3NA 4NQVB 4AMKH 3TO4A 1A1NA 5GGVY 5IW3A 2I60H 3MRKA 2C3GA 3B6SB 1WLHA 2SEBB 3BE1L 3WNOA 2ED9A 2H6PB 2ZUVA 3T0EA 4HLJA 3TCXA 1T4KA 1BOYA 4KHTL 2XXMB 3A6CL 5CIPB 3MODL 7FABL 5IVOA 3RFZC 1OWRM 3CVIH 5I1HL 1UXSB 3EJZC 4R96B 2HJFA 4M6OH 3OKOB 3V4PL 4KMQA 4S0UC 1K4CB 3V8CA 7CGTA 4GRWE 5HPMA 3HRZB 5KOMC 4MNQE 4ZYKB 1BGXL 1FVCB 1MWAB 2RBLA 1D5BB 4OUUB 3HG1D 3MLYH 1ZHKB 1B3JA 4N5EA 5ILTL 3RGVC 1INEL 4ODHH 4OF7A 1WCQA 4WNQA 5J89A 5LGHL 3QBTB 3GI8L 4IMLB 1YEEH 3KXFA 4NQCA 2P8MA 3C60A 3FB8B 3RVTD 5C0IA 2YZ1A 2UYLA 4ELMB 1UKTA 1KELH 4H0GA 3NABH 2FO1A 4JZOB 3D2UB 1ZAGA 4BUHA 2Z8RA 2F74B 5DRZA 5JO5B 3TPUB 2OCFD 4MCYA 5EH1A 3SDDA 2GT9B 3KPSE 4NOFA 3HUJE 4XP4L 5ESQB 4NN6C 1NFIA 1WV7T 3P9MB 1A0QH 1EHLL 1WWBX 4Y4FA 3MRDA 4KKNA 5ERWB 4BZ2H 1T21A 4FOMA 1CFVL 2JCCE 5D1ZA 1GIGH 5E08H 1LO4H 1HYSD 3QUMB 4DUWA 2APXA 5D6CB 1DBBH 3H9HA 5GRYA 1IAII 4ELKB 5IMKA 5HHVH 1EBPA 5HHNB 1EIBA 1DVFD 3DRTB 4OZGE 5C0CE 4JPVL 5GS1B 1U8QA 4NBXB 4O5LL 3AY4C 3S88H 4P2CG 2BVTA 3GO1L 1LEKB 1YUHA 4K8RH 4WUUD 5DQ9B 3U4BH 3Q6GH 3HPJB 4Q6IC 3HMXA 4ZXBA 3BP4B 3AUVA 4YX2L 1F6AA 3HN3A 2GJZB 1NCUA 2O5YH 2Q6WA 2BCKA 3G08B 1UG9A 5LQBL 4PD4J 5C0EB 5KG9A 5MP6H 2BHZA 5TH2A 2PYED 3GBNH 3SKNB 4BFBD 3NCFB 5DSCB 4N0CD 3W39A 3UTZA 1LP9A 1IGFH 3VG9C 1HE7A 1J8KA 1SJEB 4JZJC 4OLUL 4GAJH 4G7YL 1Y18B 3GJFK 3DX8A 5DK2A 3KPSA 2R1YA 1I9IL 1WT5A 3FN3A 1RHFA 4JHAH 3K7UA 1OAUL 1BPVA 2LAGB 1F4YH 4ZFOB 4QTHA 3C5ZA 1RJZB 4RIRA 4PR5A 4U1KA 3T3ME 3EHBC 4Y16D 3IDXL 2EDDA 1C08B 4LKXA 4MXQC 4JFOB 1EUUA 1AIFB 2ICEA 3VXSE 4LAQH 3VW3H 2B0SH 5AYQA 4X6CA 1I7RA 2O5XH 5T3ZH 5DVKA 5F3HA 1I8MB 3B2VL 3QUKA 5KBNC 1WZLA 1GL4B 1OB1B 1QRNB 2YS4A 1WFOA 1R3JA 4JRXE 4NFDA 1KCRL 5JO5A 5C07B 5DTFA 1U8OA 1JMXA 4POUB 4QRUA 1Z3GH 3WIFB 3L3OA 1UJ3A 4ODHL 4OZGB 1EGJH 4HUXB 5C0CB 1CL7L 3SE8L 1PG7X 1BQHB 1ZOXA 4Z7WF 2J2ZA 1KN2H 5LCVH 1RUPL 4L8CA 4UB0H 5FCUL 3FONA 5GS0L 1P6FA 4P2RA 3EYUL 1ORQB 1MCPH 3OX8B 1T66D 4U1SA 1N6VA 4KFZC 2PW1A 2EZ0C 1RMFL 5CHNB 3NIDE 3MNWB 4YDKH 5EU5A 1OAXL 5E9DE 3GEWB 5A16A 1F13A 4XMPH 3EAKA 3GSQB 4NRYA 2YN5A 4OLWL 2OQJA 4M6OL 5JLZB 1U8IA 3ZYJA 3MLVL 2F19H 4TSBL 1S78D 2X4OB 5FYJU 5I74C 4WUUA 2V17H 3WO4B 2GJ6E 4XP5H 5FO7B 3VWJA 5GHWL 4J4PA 4R90H 2YC1A 2DQFA 3BFOA 5E2TH 3QXAA 5D2NA 2BOCA 2NXZD 3VDCA 4NWTL 5LGHH 1UB5A 4YQXL 2P44B 4O2FA 1T0NA 2XTJC 2FATL 3BPCB 4QXGL 4YXHH 3FT3B 4MB4A 5DJAA 3EDJA 5BRZA 2R0WH 1NAKL 4Y2DA 4XZUA 1D9KD 1FN4A 1NCDH 3RVTC 2QR0B 3U4AA 1NFDB 3ILPB 4OLUH 3K8MA 5AZ2H 4ZUWA 5GGSA 2XZZA 4FQLH 3EYSL 4NGHL 4IHOA 4YAQB 4DVRL 4O51A 5IEHA 1O0VA 1W0YT 1I9IH 5F6HJ 3KYMB 3DI3B 5DJZA 5E08L 3QQ3B 1LO4L 5EC2A 3MXVL 4X0KA 1MQKL 4XPBL 1TJGH 1XGRB 4FTVB 5BQ7A 1DBBL 3TJEH 2CK0H 5DJCA 4KZDH 2ZNWA 3G6DH 1OVZA 1MI5D 3UX9B 3N9GL 4EBQH 5C0IB 4JPVH 3QRGL 3WIHH 5ACZA 4Z7VB 4HGKC 3VW3L 3LD8C 1NEUA 3GO1H 5B38B 4LVHB 2J8OA 2BSTB 4POZC 5T3ZL 3K2UH 3ZTJH 2NY2C 2DRUA 5SWZB 4IOIA 3N06B 1PKQB 3RGVB 2IH1A 4E9LA 1MCSA 4EI5D 1J5OL 3AVEA 2DBLH 3ULUD 3L3KA 3L3GB 3OKDB 4Z0XB 1T89A 4B41A 4QRRB 2YUXA 5BS0A 4O2CA 5KSAD 1B6UA 1FDLL 5BS0B 1Z9OA 5GS3A 3GSXA 4XPTL 5E2UH 3VI4E 3RX5A 2EC9U 4BFGA 3O3UN 4C57C 4KI5F 3TC9A 5C3LD 1TTFA 3X11B 5KVDH 4GG6E 2NY4C 3QEUA 5FCSH 3V6BR 5I1JL 4X7EC 1MCPL 1MIEH 5CJXA 1KB5H 2VDOH 1P4LB 1XGUA 3QUXC 2P5WE 1G6RL 3HLAA 1MHHB 4JRYD 1U8MA 4LRIC 1CFSA 1IZKA 4MA8H 1HHGB 3O8XD 2CO7B 4V1DD 2VISA 2HH0H 3MV7B 1S9WA 1UB5B 1X7QA 4LIQH 1BIIA 3NVQA 4JGMA 4Q0XH 2HT2D 3QHFH 3MRIA 3ZTNH 1WBYA 2UZXB 3S97C 4L29B 4XVJH 4RZCB 3WJJC 1JZ3A 1A3RH 2HAZA 2HFGH 2V17L 4F7CB 1JGEB 4M4RA 5AAWA 1PG7W 4ZD3H 1RU9H 2A6JA 2FEEL 5LXGH 1A6UL 5KS9A 1YZZA 1ZEAL 2BSSA 4HF5H 5D96C 4D9LL 2XNAA 5TFSL 1WK0A 1DVFA 3DYPA 2JJTA 4Q6IA 5ANME 3QO1A 1TVDA 3VCLB 2P8PB 1YEKH 5F8QC 2IPTH 4PJ7A 2VITA 5FCUH 4MA7L 2A77L 1AO7B 2VAAA 4RBPH 1QVOA 4XNXH 5JPNA 1S7UA 2NYYD 2R0ZH 3K46A 2QLVB 4DGIL 1OGTB 3RAJH 1OT2A 3TBYA 2PKDA 4OCRH 4I2XE 5J6GB 4ZAKB 4TYUA 5CEZH 5IWLC 1I1AC 1OAKL 2Q8BH 3MLUL 2MFNA 3CMOL 2VAAB 4QHLB 4F58H 4KJYB 4NCDA 1RUAH 3WDJA 3UPRB 5C07A 4RGMB 4X8JB 3CH1A 1P1ZB 4XNQB 1EHXA 1CFQB 3L5WB 1BZ9B 1N5YL 3QEQA 2ITCB 5SV4A 4GKSB 2ICEB 3LPWA 4CDHA 1A14L 4L8SC 3GSOA 2G2RA 2DAVA 3BEWA 3MCLH 2ZCLH 1X5JA 5FDWB 4XVSL 2BRRH 3KPRD 4XNQA 2NR6D 1MLCA 1U2HA 3T0BA 3NGBC 2HFFA 4PRPB 4Q9RL 3E3QC 1NAKH 4CADB 1J1OH 4LVNC 2IGFH 4CKVX 5DEZA 5IHUH 4QCIB 1NDGB 1U93B 3SJVA 3M17B 1V7NL 1KF9B 4M6NH 3OAZH 2IQ9H 1C1EL 3V5KA 2VWEC 5TGBB 1BBDL 1J18A 3K1DA 3QA3B 4ONHB 1Z9MA 3VFMB 2OI9C 3ISWA 2DQTL 4WFGE 1C5DB 1U91A 5HTSA 3UDWC 2GFBB 1H5BC 2I24N 3M1BB 4PJIE 5FGSA 3HE7A 4RMQA 5IFAH 1NJ9A 1RZIA 2OZ4L 3X11A 4WFGD 2HRPH 4WI2A 1MSPA 1VADB 3EJYD 3ZKNC 4P5TA 2PO6C 1BQSA 4P4KA 3BEVB 3F7VB 1ZHLB 2M2DA 5L9DH 3WFHA 1SJHA 1JGLH 2HFGL 3TVMC 2EDFA 3DGGB 4X5XA 1AGDA 2DQHH 5I1IH 1S8DB 1A1MA 1J5OH 4G6AC 4YDJA 3RU8H 5K9JL 3A67H 1J7VR 3RY5A 5F7DB 3BT2L 1EXUA 4OV6F 4Z7UF 1HILB 3S9DB 2IBZY 2EKSB 1CTNA 3SDAD 3GB7A 2G5BB 4MA7H 3PGFH 4NNXB 4S1RL 1X7QB 3TT1H 5D1QB 2Z8VC 4NO2B 5DR5H 1MHEA 4PJGB 1AC0A 5EBWA 1B0RB 5I1AB 4DZ8B 2F5AH 1NGZA 1RAMA 4PJXB 3ARZA 1MFEH 3KYOA 3IXTB 3B83A 3FB8A 3MX0A 3PJSB 4NJ9L 3Q5YA 2X4RB 4Z7VA 2R2HA 1JCKA 4O9HL 2C3XA 2Y36L 1MELA 4LCWB 2NPLX 3LMJH 3HRPA 2LQRA 5DD5L 1FH5H 3QHFL 3NMEA 3UBXI 5EA0H 4N90D 1A6ZA 1H15B 4JDTL 5I74B 4HUNB 3JTTB 4NO3B 1N6QL 1Z2KA 3CVHH 5D2LA 5HPMB 5J6HB 3UTSD 3VJ6B 4AJ0A 3BMWA 3SE4C 4X6DB 1NFKA 5EIVA 1NKRA 4G8IA 3O0RL 2OZ4A 3G5VA 25C8L 1R3LA 4NQSA 3GSVA 5IVXA 1UQSA 3D18B 2XKNA 1TTGA 3RKDC 5E2JA 1ZT1A 2V5MA 2D7MA 1XIWC 3QDJD 3EOBB 1AQKL 3UTOA 3LRHA 4E42B 2QJDA 4FQ1L 3V4VH 3CMGA 1DL7L 1VACB 3GMLB 4OCWH 3D2UD 3MUGA 4LSPH 1D5XA 5DFVD 3ZDZE 2EEBA 1T03H 1NCWH 4R7DB 3JVGA 1KEMH 4DGIH 4LIQE 2DQFB 4TVPH 5JW4N 3EDEA 4OCRL 1CF8L 4LNVA 4ZFFA 2PYEE 3HC4L 3SCMA 4U1SB 3CMOH 1QKZL 3BHBB 2BXYA 5GJSL 1FL3A 2XQYG 3PNWA 3RGHA 1YYLH 3L3HB 5GIRA 2OXHA 2MQ0A 5M7QA 4YFDB 1FBIH 4FXKB 3B3IB 1TETL 2WUBL 3GSNH 1M6OA 4V3EB 1MPAL 2EC9T 5TQ2L 1LD9A 5JA8B 1ITCA 3I3BA 1UWXK 1QRNE 2F53D 3AM8C 3LSOB 4K3EL 5CD3B 2FBJL 1A6TA 3I3EA 3VRLF 5BVPH 4N0UA 5D5MA 2VE6A 4YDIH 4AL8H 3LQZA 2EO9A 3VWJB 3C6LD 5FHBL 3G9AB 4JM4L 2ESVB 5I66B 1T22A 4ZS7H 2WUCL 4WI9A 3V8OA 4I9WD 5JOEA 3VRIA 2WBKA 2MKLC 1J1OL 5CEZE 4NKIL 3QG7H 4CU6A 4EOWH 4IRSB 4XP1H 2XQYK 5AYUH 4H88H 1PZUB 3WL9A 3TZVA 4A2LA 1FZKB 1BBDH 5EBLB 2A2QT 4ISVA 4YHPB 4HW6A 2E9BA 3QUZC 5DK2B 5CHNA 2H2PD 3TLRA 3IDMA 1UH3A 1MJUH 1A4JB 3C09C 2G2RB 3X3GH 3F6LA 4OLZL 2DLHA 3VGGA 2DQCL 2NZ9D 3ULVD 4PJIF 3VXME 4DFHA 5KZCB 3ULSA 2ITCA 3ERYA 2W91A 4OV5A 2I26N 3OR7B 4JM2D 4PJHE 3GGWA 1VFMA 4DKFL 3X13B 1OD7A 3I75A 1RUMH 3QPXH 5INDB 3TPUE 2V5TA 4TUJB 3LHPH 3WFBL 1T7ZA 3LS4L 4MLSA 2A9NL 3CFBA 3OR7A 5JQHC 2OLDA 3HUJB 5IQ7L 3OSKA 5DZOA 5ACMA 3IDIB 3MSPA 3IS0X 5DR5L 4HFWB 3BH9A 3D9AH 4Z7WA 2PXYA 1A8JH 5J57B 1DBML 4X99B 3RNQB 4JFHD 1FZOB 5GS0C 1L7TL 5TJWK 3KLHC 1DLHA 4H20L 1NGQH 4LBEA 1G9NL 4U3XA 2XQBL 2XOTA 4JFZL 3ZTJG 1VACA 4RMRA 1T3FA 1TVBA 3UCRA 3E8UH 3LMJL 1ZVSB 4BZ1H 4NRZB 4WHCA 2AVGA 5FIEA 4RFEB 1RY7B 2ZUQC 5C92A 3OXSA 3HZYB 2VDQL 3U36B 3WKNA 2ESVA 5D1QC 3BQUD 1GAFL 4FQXA 4U7KA 1C5CL 2E6JA 5KG9B 4UT9L 4X98A 1YMHB 1JUFA 3PV6A 3L5IA 3OKMB 4K3EH 1DQJB 4OCYL 4NYLB 2ORBL 2YA2A 5DDHB 4BSJA 2FL5B 4K94H 2IQAB 3MGOA 1L0XA 4YDIL 3A6OA 4DKEH 5GS1C 4MA1B 3BWAB 3QUYA 4QHKJ 3SOBL 4OZHF 4YXLH 3VA2C 2V7HB 1RFDH 2IPKA 4G3YH 1IARB 3V0AC 1GRWA 5MENE 3IVKB 2J8UE 3KR3H 5HPOA 5C9KA 5IF0A 2PW2B 3L3DA 1UM6H 4S1QL 3BW9B 4ZUUB 4CVWA 1Z0MA 4Q9BA 4HV8B 1BVLB 4F80A 1FVCA 2QSCH 2DL2A 3MRFB 1QKZH 1WTGT 3VDBA 3OZ9H 4JG0L 2P46B 3EDKA 3W0WD 3QDHA 2HLFC 5C0BD 3X3GL 3J8F7 2F15A 5DT1H 1LGVA 5I1EL 4U6XA 5SWSA 5F96H 4JO2H 1UACH 4NIKB 4Y5XC 3RGVA 2X89A 3KYKL 4NQCD 5BZDA 4K3HA 2UWEB 5I18L 3H3KA 4IOSD 2ITDB 5HHMA 5HYFA 1M7IA 2Y06H 1MCOL 2W9EH 4F7EB 2K7QA 1RUML 1U95B 2ICWB 4UQ2B 1A5FL 5SWSB 3ZT5A 1ZHKA 4HJ0D 3LRSA 3RL1B 3EYFA 4G9FE 5D7LD 1T0NB 1A6ZB 1H15A 5HYJD 3H7LA 4JM4H 4TVPE 5I73C 4MHHG 4QWWC 3W9EA 4GAYA 2DIAA 2P42B 4WDIA 3JWOH 2I60L 4HK0A 4JHWL 2EYRA 4UOW1 4XPGL 5E9DB 4NQTA 4RDQG 4HS6B 5IBTL 5C0DB 5F97E 2X4TA 3S36H 5LBSL 3DMMD 1RJLB 4FQCL 1KJ3L 5D7JD 3WEXB 4JCLA 1I9JL 3HI5H 4ONGH 3QJHB 4UT7H 1KB5A 3RDTB 3TO4B 1BD2E 1UA6L 4WJ5B 1ZHLA 2FL5A 4NCC1 2YC1B 1KPRB 4HAGA 2AJXL 3V7AG 5FFLA 3PG2A 5E8DL 5HVHB 2VDRL 1DLFH 3L3JA 2VDPH 4ERSH 4JZNB 3PV6B 2JJUA 4Y19D 3JXAA 1HHHA 4BZYA 4UT9H 1A7RH 4NQDD 4LRNH 1FG2A 1TCRA 5GPRA 1I8IB 5KW9H 2X05A 3GRWL 3EFFA 1T0PB 3W2DH 1H0DB 1NGPL 5C0AB 2HT3D 2B39A 4YPGA 3NABL 1AQDA 3O3EB 2CRIA 1YEGH 5KSUA 4YHLL 4LDOB 8CGTA 3VI4F 1DDHB 3FQWB 2WP3O 4HQQH 2OTUB 3RWHB 1EHLH 1JPFA 3M8OH 2XTJB 4L1HA 4BZ2L 5EZIL 3V6OA 1CFVH 1XCTA 2FHCA 4UDTA 2DQGL 5FGBA 4P2QB 4TTDC 4L3AA 2O5ZH 1NGQL 5FUCE 2HTLD 1JWMB 2QSCL 1AXSB 4QO1A 3OZ9L 2GKIA 1P1ZA 4IRJC 4BZ1L 4NN5C 3KLHD 2J4WL 1RIHL 1TIUA 1P2CB 2V6HA 3ARBD 3VE0B 1KFAH 2CRMA 2NTFB 3GSOB 4Z76A 4R2GB 5H37G 2RCSL 4P46B 5E00A 2BVEA 2W9EL 2Y06L 4HJJH 4JO4H 1JWSB 1Q0XH 2Z31C 5B39G 4LPTA 1FL3B 2OTUA 4FFVC 4YJZL 3ORJA 1T1YB 4LF3B 3S98A 4H8WC 1BZ7A 2VL4A 3ES6B 4JB9L 5JPMA 3MZTA 2CQVA 4JM2A 3TYGH 4CL7A 1ONQA 2YKLL 4FFYH 3CCHB 4P23A 2NY3B 2YA1A 1IEAA 3LKOB 4TN9A 5AG8A 5IEKA 1NGYB 1VEMA 2VZSA 3QP3A 4XPGH 4NO0B 1RZ8A 4P23D 1AHWB 4PGEB 4OLXL 5DSCA 5TH2B 2AJVH 3SO3C 3L3HA 5GIRB 5IIEB 4FQCH 2DQEH 4AEIL 3RIFK 3EW3B 4WHDA 1F4XL 4EDWH 4O2EB 4HGMA 4ZFFB 5MEOB 2B0SL 1A7OH 4J3TA 1BOGA 5DQ9A 4RMWA 3HB3C 3VXOA 1MJ8L 3AREB 4MDJA 5KSBE 1FC2D 3EGSB 4IJ3C 4FNLL 5KVFH 3VWKD 3DVFA 4I4WA 1FYHB 2ZOKA 1F3DJ 1XGUB 1B4JH 4E41D 4JAMA 1JHKH 1KN2L 1OD9A 1R3LB 2XRAH 2A6KB 1UWEL 2DM2A 5FGCB 4JLRA 4ODTL 4UB0L 1YJDH 1ZT7A 3MNZA 2EE3A 1RJYA 3UTSE 4YGVA 4G6ML 5D7IF 3T4AA 4JM2F 1Z5LB 5JXED 5F7LB 4JY4B 3IKCB 2GW5A 3GB7B 1K4CA 1AXTL 2W65B 1ZSDB 1SM3L 2B1HL 4KK6C 4PG9A 4JVWA 4DZBB 4I18A 3DX7B 4HIXL 3QCUL 2EDHA 1BQUA 4UAOB 3CJJA 3KYOB 5DJAB 5BRZB 3F7RA 1KC5L 1UZ6E 2F19L 4AEHH 4OKVB 2XG5A 3SDCD 4I3SH 4EXKA 4M48H 2ZUQB 1IFHL 1GPOL 1J0IA 4XH2B 1IC4H 3DXAD 3HAEA 3FQTB 4LCCC 4BQCA 4XGZB 4YGVB 5GRUL 3NH7L 1MY7A 3BKYL 1CLZH 3FB5A 3W2DL 5LAXA 4JY6B 2OYPA 4JRYA 2PNDA 3GMNA 5J13C 2UZIH 5CZVL 3EOTH 3QNXB 4FFZL 3OR6B 5JDSA 4UOJA 2UV3A 4PG9B 4YHLH 3SE9L 4JDZA 5DHYB 5I9QC 3GUTA 1BLNB 1T6WA 2D3VA 2PYFB 2CR3A 4NQDB 2J12B 3IJHB 5GRJL 4PGCB 1KCKA 1M7XA 1EO8H 4OM1L 3BH8B 2MPAL 3ARGA 1EX0A 4I5BA 2O5ZL 3VGEA 3WJJA 2Y25A 3LDBB 3PL6C 1EVUA 2BSRA 3HE7B 3SBWC 1CVRA 3KPRB 5L8KB 3U36A 4YHIA 3O2VL 5L2KD 2NY7H 5EU7E 5I8CA 4Y1AD 3QI9D 2GCYA 4FQ2L 4QRQB 4WI3A 1AHWA 3DSFL 5EU3A 4ZOAA 5GSRB 1G9EA 4JZJB 2JJTC 1TZGL 3ARDB 2HP4A 5EOQL 4HKJB 2AV7A 2ZG1A 3FFDB 4GBXD 4Y2OA 3FRPG 4TNWF 3E2HA 3NA9L 4D0DA 4IDLA 4YDVB 3I75B 4HBCH 5IT2H 5HYQB 5F1IB 3U6RA 4WO4D 4K3JL 1Q9OB 4LCUB 5JNYB 1OY3B 5J6GA 4OV5B 5IGXL 3WFDH 2DWDA 2LABA 3REWA 4LEOB 2D0FA 3L5WA 4KROC 2IANB 1MVFA 1A9EA 4Y5VA 4W6WB 2Q76A 1T2QH 1J0HA 1KB5L 4CU8A 3ZKND 3ULVE 4HH8A 4E41B 1EHAA 4LP5A 4NZTL 2EECA 3WKMH 2PO6A 3D39A 3FTGB 4KUCD 3VCLA 2DQEL 3TESA 4Z7QE 3Q1SH 4M9OA 4MQ7B 1KB9K 3N1QC 4LIQL 4ZAKA 1QSEE 2F58H 5C0BB 2WINB 4PJ8C 4QRQA 4ODWB 4GRWF 1X5AA 1I8LC 3VXSD 1DQLL 2OS7A 4XVJL 5L88L 4V3DB 2XWBB 4UDUB 3LQZB 3WFEL 3PQYD 4PJ5D 4X9BA 3VDAA 3JSSA 2QSQA 3MJ7B 2WP3T 2D31A 1FYTD 5MENA 3U2SA 2BVPA 2R15A 1MF2H 3UPRA 4D94A 5IOPB 2NY0D 1KXTB 4X6BB 1IAIH 3OF6A 1QRKA 3TNMB 5D7JA 3VD7A 4P2OD 4ZNEE 1MFCH 5HI3D 3FOLA 4XMKL 2FO4B 2AGJL 3MUY1 3MRPA 5DUBA 2W60B 4NN5B 2R1XB 3O3AB 3QEUB 1KJ2H 3QIBA 2GY5A 2CLRA 3CK0L 5BJTA 1K4DA 1MJ7L 1IQWL 3ARGB 5DHVB 2AXJA 5BVJB 5CCKL 4P9MH 2ATPB 4PDCE 1KOAA 2ZKHL 1ZGLA 3B9KA 3F65A 1PZ5B 2FB4L 3HTLX 4ZS6C 5EUKA 2DLGA 1ACYH 2D9QB 2P8MB 3C60B 3B3IA 4L4TA 1QTYT 4I3SL 3IJYB 3I02A 3JV6B 1P9MC 1TJIL 5EZLB 3ARFA 4JRXA 1D5ZB 1K6QL 2W0LA 4XCYB 2FR4B 3IU4L 3QISA 1FFOB 2AI0L 3AMLA 1KPUB 3TP4A 2LE9A 3RWCB 5TF0A 2VDLL 3QB7C 1OOAA 4U1LB 5IT2L 2BRRL 5FB8A 4Z95L 5ABDE 2V7NA 1ZXQA 5DJZB 4FZEH 4XHJC 2HJFB 4FFZH 2C4XA 3LH2H 3IFPB 1R3IH 3RI5F 4CN1A 3WDHA 1NGXA 5I76A 1MJJA 1PEZA 5KVGH 4PJDE 3VWKC 1RURL 4ZUSB 5GRJH 4M6NL 2J8UF 1T20B 1PG7L 1T20A 3RVWC 1G0XA 4NQSB 3P30H 1FVEB 4LHUB 1QD0A 1CFTB 1JN6A 4M6ML 4NC0B 5DC0A 4X6CE 1OCWH 3ZE0F 4H5SB 2L4OA 3WKML 1JWUA 3GSNB 1EFXA 4JVPA 1ZLSL 2NW2A 1Z5LA 5J12C 3RY4A 4WFFD 4F8QA 2FJFA 5F7EL 4KV5E 4MJ5A 1SY6A 5L9DL 1M7IB 2CLZA 1W72A 3DRQA 4HK3J 5IMMA 1S5HB 1JYVA 4M5YH 2G60H 3RA7H 5IK3B 5EOQH 3HFML 3TBWB 4GW1A 4Q58C 2G9HB 5CSGA 4UIMA 4L1DA 5ACZB 1LWRA 2OM5A 3STLA 4K9EH 4ZPTA 4L4VB 4F9PA 4P3WA 4XC1H 1YC7A 3SE8H 4DVBA 1MWAA 2RIKA 4I3RH 2DICA 1G7IB 4KJPD 4LCCA 5LCVL 1RQ5A 4W4OA 3JBG7 1IAIL 1IKNC 4GSDH 1AGFA 4GW5B 2MCPH 2YWZA 3FMGL 2AQ2A 1RV6X 3EYUH 3NACH 1UXWB 5GRWA 4U2YA 2YBRA 1A3LL 2DJ4A 3OG6B 1JPGA 1FN4B 3LEYH 4KJWC 3MCG1 3HZYA 4NNYA 1ZK9A 2QADC 3L5XL 1PZ5A 2QHRH 2Z9TA 4WU5A 3EDDA 1NC2D 3WUWA 2B4CH 2ENYA 3GMQA 4JVUA 4HWZB 1I9EA 3K4DA 4LCWD 5HJ3A 1T83A 4P5TB 1ACYL 4M7KH 3RTQA 2FLRT 4JDTH 4CMHC 3S5LB 2AK4A 4PIRF 5EZJA 4Y19B 3WFEH 5DJ2A 5H94A 3GMPB 3MRPB 4Y1AA 3ESVF 2KL6A 2R69H 3UZEA 1SYSB 3CZFB 3I50L 1MF2L 2FSEA 1AJ7L 4PR5B 4U1KB 3ZDXF 4QTHB 4RIRB 5ACLA 1PJ9A 2E7LC 1J05A 3ULVH 4FQJH 3MFGB 5C1MB 1NL0L 3BZ4B 5B4MD 4NZJA 5HDBE 2O93L 1HHIA 4FZEL 1RZ7L 3P11L 3BMVA 3NCYP 1MVUA 4V2BA 3WCYA 3SKMA 1I8MA 5FECB 4APQD 1FPTL 3LZFH 5CP3H 3R8BB 5DQJB 1P84K 1PG7H 1M7DB 1MEXL 4PBXA 5EOCL 3STBA 5HI4C 1CVSC 1F4AA 2AXGB 2H32A 3W11C 1OCWL 1M71B 3MLRL 3RUGA 1D5ZA 2J88L 2ERJC 5KS9F 4YC2C 3DHJA 4OZIE 2CK0L 4JPKL 3Q3GB 1P7HL 2X70B 3A6BH 4MAYB 5SWSE 2XN9A 3LDBC 1YQ2A 4KKAC 4OT1H 1T7WA 2VLRD 1ADQH 1HXYB 2NY6D 1KACB 5BO1H 4X7SL 1KLUB 4JFXB 3RWIB 4QHLA 1RZKL 3WIHA 3T77A 3CDGB 3R06B 2FBJH 1LDSA 2CRYA 5AG9A 3T0EE 5GS1A 3P4OB 3RA7L 5K9OA 12E8L 2DBLL 3FQUB 3KWWB 3WD5L 4FXKA 2P4AB 4RFOL 4RNRB 2YPKB 2P49B 4I0PA 4MNQA 5H8DA 4FFEX 5CJ8A 4PGDB 2EYRB 4JO1L 3U1SH 1GHFL 5H35A 5C09B 2UY6A 4M1DL 4OGYH 1NUGA 5DI8A 2GSGB 4CNIB 4JJHA 5CBAA 4K23H 1X5XA 2XWJA 5HHOB 5KVGL 4XP1L 5ID1B 2P8PA 4OB5H 4GMSL 2BVPB 3P77A 4X5LA 1HH6A 3KLAB 4M6MH 2VSDA 1FC1A 2X4SA 3TYFA 1U95A 2ICWA 4OD1H 5DWUH 3E6HB 3EOBA 4JFED 4WTZG 4DJMA 1Y6NR 2A73A 1VFBA 4OF6A 4TUOA 3VI3F 3SDXF 4L3CA 4U1HB 3PNWB 1CDHA 5ERWA 5JMRA 2AAVA 3KNBB 4HJGA 2E7BA 4DQOL 1HWHB 3OQ3B 1TZIA 3RZCA 2QQNL 3EFDH 2W0FB 1HKLH 2GJ6D 5EOCJ 3DI2B 3LN4A 1A3RL 4N0CA 5HBBA 3CSBA 2V2WA 2YOCA 5C8JA 3MRMA 4QHMA 3LKRB 4F7TA 3BN3B 1AR1D 4PTUA 1PVHA 5C0AD 1JN6B 4Y4HA 1CK0L 3QEHB 3VXRE 4B7IA 3P0VL 5I76B 3C9NB 2K7PA 3B5GA 1IILE 3TCLA 2IPTL 3UC0L 1JNNH 3EOAA 5IQ7H 3DXAE 4I2XA 1G0DA 1RZ7H 5SWQB 3NACL 3LS5H 4G8EA 1S3KH 2VLME 3JWDC 4JFFD 3WLBA 4G6KH 4AIXA 1ADQA 3BXNA 2KUTA 2R0ZL 2GT9A 3BD3A 3CXDL 5DDHA 2EKSA 4D0BB 2W59A 5DQDL 5EOCH 2H41A 4HPYL 3D85B 5DMIH 5FYJE 5C08D 3SE3C 1AO7E 5CEZL 3TN0A 1EGJA 4YK4C 4GOSA 4YBQD 1JHLH 1IGJA 1NEZA 4Y2DD 4GAGL 1G7JB 4HKBA 1G7HB 2B4CL 4JPKH 2VLKB 1W0WA 2YPLD 4MNHA 5IJVB 2AV1A 4GT7A 3DX7A 3GM8A 5BRZD 1D9KC 5SX5H 1UZ6F 4RAHA 5CJXC 1IBGL 5FO8A 2Q1EA 3OBAA 2AS5M 1NBYA 5DFWH 4NO3A 4XVUC 4PY8J 1ED3B 2COQA 5CINL 2YR3A 4Z0BH 4KK9D 12E8H 1CGTA 3GNMH 1HCFX 3RNQA 4I0CC 3O2DH 4P4RB 1SEBB 4XVSH 3TNNB 4JAMB 5A2FA 1JK8A 1JK8B 4OCXH 2X6MA 3UTTA 1H5BB 1X4ZA 4NM4H 3PWPA 3BPCA 1UT9A 5FGBC 4M00A 3MJ9H 4LU5H 2F53E 3QWRA 1FFPB 2ADIB 3S35L 4HG4J 1C1EH 1HQ4A 1MEXH 3LIZH 3MFFA 2FEEI 2BOCB 3WFHB 2A38A 4AQ1B 4UT6H 1N5AA 2VQ1A 3BUYA 1XGYL 4U7SA 1IVLA 3NIFF 4BQBA 5EUOF 3VXNA 1U2CA 4MNQB 3P73B 4RA0C 3NTCH 2I07B 3KPNB 2EYSB 5H37H 1RZKH 3ZYIA 3PHQB 2QEJA 1GC1L 3UTSB 5DVMA 3P2TA 4P23B 1R6VA 4YWGL 2NZIA 3VMOA 2V5SA 5E5MB 1ZA6B 5JHDD 2JJWA 1OGAD 4WIQA 3QEGL 3OJDB 4P23C 3QDJE 5HGBB 1A9EB 4Q2ZA 1KTKE 4Y5VB 2FJHB 1FL5A 4MYWB 4AZ8A 3PHOB 1FVDA 3T4YB 1IC5H 3B9KD 3JWOL 5CGYC 4Q9QH 3NBNA 1NCBL 1MRFH 5J3HC 5F7YC 5HDLA 1X3DA 1SY6H 1N7ML 1JNHA 1AD0A 4KQ3L 4L8SA 4J8RA 5D8JL 4OTXL 2WZPD 1RZFH 1HSBB 1H3UA 4NP4H 4MA1C 1U3JA 4ZSOE 4PRNB 5D1XC 2ZSWA 1QLEH 4O9HH 4HGWA 1MI5B 4FFWD 4Z9KB 3ALPA 4GAGH 2EE2A 3NIGE 1JIBA 1YEFL 4U1IB 1DLFL 1G9NC 1AIFA 5GQBA 2VQTA 3GHBL 1NSNH 3W11D 1G7LA 1T89C 1HQRA 4NDMB 1NUNB 3DX9B 4I0PB 1AR2A 3K0WA 5EIQA 4U1JB 3DOSA 4P0DA 1F3JA 4CVXB 1KXQE 3WXWH 2CIIB 2VXSL 3JTSA 2VXVL 5IV2A 2E3VA 1R5WA 4MAUL 2C1OA 3MV9E 3D3VD 4NQDA 2GQHA 3G6JE 5DJYA 1UKQA 3MV8A 4HEME 4UILL 1YEEL 4GG6F 4K07A 3ARWA 2XNAB 5C86A 1PEWA 3BJ91 3QDAA 3VFGL 4TPRH 4KPHL 1KT2B 4JDVA 2A6DA 4GRWB 1LVEA 1REIA 3TIDA 3KDMB 4PLJD 1SBBA 3L3JB 3SCMB 2IBZX 2HLAB 1NKOA 1I7UA 3DMMA 4P2RE 3QWRD 4POZD 4GUPB 4MJIB 2X42A 1BJ8A 3VA6A 2C1PA 1A6VL 5C0JA 1PD6A 1JRHH 1AI1L 4X6CF 1QO3A 5HHVL 4ORGA 4ZTOH 3ULUL 1MPAH 5CILH 3RRQA 3UYRH 2EDKA 5D5MF 1QSFE 3N1GC 3C6SB 3BZFB 3BWUC 3U4BL 4OZHB 1JTPA 3MRIB 3QQNA 2HFTA 1Q0XL 4YWGH 4PJBF 1L7IH 1A7BA 3C08H 4AL8L 4Q2ZB 5HYIA 2JCCB 1S7TB 4JFPB 3ZKSD 5GGUA 3U7WL 5JDJA 1T80A 3IDNB 4R3SB 1Q0YH 2H8PB 3TF7C 2YK1L 5DD3L 5KVEL 4U33A 2D7QA 1BFVL 4U1LA 2O26U 3HKFA 4R8WH 3NFSH 1AQDB 4O51B 4UQ2A 2DLTA 5FYJH 5TF1H 1CFTA 4R96A 4PGBA 4YDLB 4HZLA 4R7NB 2PW2A 3S35H 5KSVA 3V0WL 5FA3A 3KPNA 3C8KA 4ZG1A 1UB6A 5I1CH 2ZJSL 5AWNH 3DLQR 4JFEB 4ONOA 2IPKB 4M61B 4A2MA 3WO3B 2QQKL 1A02N 1WIOA 1YEJH 1E27B 3EO1B 5I17A 4ODXB 3G6JA 3BGMA 4PREB 2WM0A 2BC4B 4MX7B 1XGRA 3T1FB 5EBGA 5GGQH 3WN5A 4MXWH 1JGUL 1JJUA 4WCYH 4NC2B 4K7PH 1A1OB 2Q8AH 4KQ4L 3OKMA 1CBVH 1N8ZB 3D25A 3LEXB 4YHNB 4ENED 5LVEA 1FHGA 2R23B 4JDVB 4FNLH 4WI8A 3HZKB 1H3PH 3RWDB 4YHYB 3HZKA 1KNOB 5I8OL 3CUPA 2X4TB 4BK4A 1TNNA 2C3HA 4LSRL 3RBSA 4NO0A 5IK3A 1I3GL 5ICYB 3WFBH 3QDME 2RHEA 5H2BA 2E8ZA 5CP3A 3FOMA 3AB0B 4PJ7E 3S36X 3I6GA 3JV0A 2ARJQ 5I30L 5D1ZC 1BD2A 5T3XD 3QXAB 4NQUA 3MJ8B 2GUOA 2X10A 2CSPA 1S9XA 2VLMD 4JFFE 3PGCB 4CVXA 1J1XL 5B39B 1JYXA 5FM8A 5KS9E 1O5DT 5KJRH 2XG4A 4WUUB 4QHUA 1S7QB 1UWGL 1J8HE 5E8NB 1NMCC 1FO0H 43CAB 5ISZB 1A6VH 4LFHG 1VHPA 1QFHA 2AJ3A 2E8YA 3CDYA 1K8DB 4MMZC 5SX4H 4N8VA 4H8WL 2EH8H 2CDGB 2PF6A 2AK1H 2XACC 4GRLC 1JZ5A 4MHHI 1Y0LB 4WRLA 5J12B 1NSNL 3WS3A 1B0GB 4XCEA 3C5SB 4XNUL 2Q7YB 2Y5TA 3OAUL 1H8NA 3ZE2F 3UO1H 4RSVA 1CFNA 1DEDA 4PJDB 5TE6L 3BJLA 4ZFOL 4OCYH 5IMLA 2FR4A 3BP5B 1CLZL 3L3DB 4JFOA 2ORBH 3P0GB 4JFQA 4N9OB 4MA3B 4XNZC 2NNAA 3C9NA 4Y5VC 2BY1A 2X2YA 4NWTH 4MGXA 1BAFH 5D2LF 1J1PL 3V2AR 2YK1H 5DD3H 1IEBA 1YJDC 5DMJB 1RFDL 3C5ZD 4OGZA 5HGAA 4OAWB 2A6IA 2DMBA 2J8HA 2X7LB 4NQEE 4QT5A 4CW1A 2I27N 1XGPB 3EUUA 1MLBA 3VFPA 2AEWA 4AYFA 3ARED 4PJGE 2BNRA 1FFOA 5F3HB 2MPAH 1IGTB 1F3JB 1NPUA 1JUFB 3ARFB 5MHSE 4PRAA 1CU4L 5D6DC 4JJ5B 4XVTL 2FO4A 3C2AL 3DYOA 2E27L 4HUXA 4TVSa 1NBZB 3LN5B 2NY5H 4UINH 5F96L 2NMSA 4N0FA 5MHSD 1LO0L 5JW3L 5FA4A 1S9VA 4UZGA 1A22B 1HH6B 3KLAA 3QRGH 3WIHL 4ZFGH 2HJLB 2ADIA 3JTSB 4PRHD 3ARBA 1TVHA 3WS6A 1MCOH 3DUSA 5D7JC 1P53A 3NA9H 3LY6A 5CBEA 1MCDA 3RVVC 5TE7H 1NBZA 5DF0A 2WK2A 4XC3L 2OTPA 3C08L 5DI8B 2UWEE 4L9LB 4NJAH 3SO3B 3RIFF 3RWEA 4JCMA 5JHLL 2X1OA 5IGXH 3P9LA 1DANT 4WY7H 2GJZA 2YPLA 5DURB 4N8VG 3SCMC 3PWVA 1K9TA 4HIIA 3FFCD 5IBTH 4XBPA 2EIDA 4NZTH 2V2XA 3S36L 4N0FB 1N3NB 3MUGB 3W9DA 2ADGA 3HC0B 4KRPC 2ITDA 1JHTA 3OB0K 5EN2A 2ZUUA 4GG8A 4HC1L 5E6IA 4ONFL 5C0FA 5BZDB 4ELKA 5J06A 4PJXF 5C0EA 4P5MB 3SPVA 5I16A 5IB2B 2ZG2A 1OM3L 3T8XA 1QHPA 1FLTX 2W1NA 5IP4A 1AGCA 4J1UB 2PETA 4JFDB 4K7PL 2R39A 4HUMB 1VDGA 3T2OA 1WAAF 3S37H 2GIYA 3ROOA 1CBVL 5J1AA 1LNUA 1LO2L 5E5MA 4LSQL 4ISVB 5J8OA 2VLJE 2HTLC 4Z7WE 5DGQA 2BMKB 2D7OA 2ZCHL 4P2QD 4F2MB 2X4NB 3ZDZF 2A6KA 4KKBD 1NGPH 3BISA 2ESVD 4CMMA 2YD3A 4R4BB 1FFNA 4EJ1C 2A83B 1I3RB 1P7QA 1QG3A 2VB5A 4OZIB 3O6MH 4I4WB 2XPGA 3WJLC 4WHYG 3DETD 5IVZA 5C0BE 4YDVA 1D5BA 1MJ7H 2L7JA 2YUVA 4U3HA 4ZYKA 3EO9L 2DJUA 4HLZH 2ZSVA 2I9LA 3DVGA 5J7CC 5CZXC 3JUZA 4FFVD 3BVNB 4HJGB 3ULUC 1FO0L 2NY5C 3IJHA 1CU4H 4R26H 1QNZL 3X14B 4Y2DB 3PJSA 5FUZL 4XNYL 2E27H 2J4WH 2Z93A 3B8YA 5I1DB 3IJSA 5KSAA 1G7JA 1LO0H 3FZUC 4HKBB 4MNHB 1JE6A 2XYCA 4HWBL 5D70H 3KYAA 5E94A 1R5VB 3OPZL 3DGGA 4X5XB 5EG6C 1A6AA 4W68A 5DK0B 2RCSH 2X89D 5HD8C 3T65B 1I4FA 1ED3A 5C08E 5TE7L 3VD5A 5C09E 1N4XL 2Y5EA 3IDYB 4EI6A 4MMXC 3FCTB 3W0WA 1HILA 4GBXC 3DARA 1GGYA 5E94B 4BA8A 1U58A 3OV6A 4JB9H 2HFEA 4BFEA 1F02I 3IDYC 4XPFH 3ZKXB 2WLZA 1G1CA 1IKFL 4JEGB 3RY6A 3SPVB 3VFRA 1RURH 3QNYB 4GO6B 3QI9B 1SBSL 4PJXE 3M17A 1MHCA 1OW0C 3P30L 4H1LH 4XT1C 3PQYB 1PSKL 3SCMD 3UYOD 3JWDH 4OLXH 5EU5B 3MLWL 4NC1E 1FFRA 1W2KT 3W81A 1CGVA 1KIPA 4GKNA 4JFDA 4FP8H 1JRHI 1WEJH 5C2BL 1I7RB 3I85A 1KCLA 3GSWB 3C5JA 1B2WH 2DQDL 3GFUA 4P46A 5HHQB 2IPUK 1FFNB 3NIFE 4HCRL 2WBWB 4KGLA 4R4BA 1C08A 5FHAL 3HR6A 4K7PY 1EO5A 3DXAB 3HFMH 5DYOA 4HEPG 1MJJB 4PY7A 4YUEH 3IRZA 4OSUL 1OTSC 3ARYA 1BJMA 3LKRA 4F7TB 5KVFL 4PRIE 4XC3H 5JORA 1TZHA 2ENSA 3GKWH 2WLYA 3VRLE 3TA3D 4I8DA 4EUPH 5F1NA 2YSSA 3VFNA 6CGTA 3F12B 5DJ0A 4ODTH 4KDTA 5D93C 3MA9L 3GSRB 4TUOB 2FH8A 2O61B 5I6XB 1CICC 1IAKB 5JOPD 4ZFZA 1JTOA 1F4HA 1T0MB 1DCLA 1ZLVH 3QZWB 2AJSL 4GRLB 3CH1B 3UJIL 2P47B 2UUDH 3BAEH 5JW5B 2FECL 5KSUB 2HVJA 1NLDH 2OI9B 3SDXB 3GIZL 5L8JB 1N6UA 4FQIH 4C4KO 4PJ7B 2Q20A 1NMBH 3O6FD 1MLBB 2FX9H 1PW3A 4KUCF 3KJ6L 4Q6IB 3BEVA 3F7VA 1CWVA 4GQ9H 4OBSA 5D96B 1DQML 4JM2B 2E7CA 3QCVL 1H8SA 3K8KA 5F93C 4MAYA 3P9LB 3S37L 3MBEB 5GRVK 4HS6A 3ZYZA 1JF5A 1MCCA 4GBXB 2LU3A 2H9GA 4I0PD 3MLXH 5IFHL 5DD1H 1Q94B 5E70A 1OTUC 1JMZA 3Q2CA 1HEZB 3TGXA 3I50H 4PP1D 3F12A 5DJ0B 4HK3N 1R3HA 3ULVL 1DBAL 4J3VA 4G8FB 3V52L 3PWUB 4J4PD 3QIUC 3BPLB 3ZDXE 3VFVA 2NY4D 1S5IH 2UZIL 5CZVH 1AQKH 4XNMA 2A6JB 1RZJH 1CE1H 3QWOB 35C8L 1PGRB 1T0MA 4I77H 5M95B 3SJVD 1G9MC 1FE8H 1MH5B 4WFHE 1X4XA 3SGJA 4CJ0A 3BIKB 3O8XA 3VH8A 3BUTA 3NIGF 2MCG1 3AB0C 1KEML 4TVPL 2J5LB 2YHGA 3SKOB 5JOFA 5BZWB 3MLWH 1IAMA 2LTQB 5DZNA 4RGND 1BBJB 2ZSWB 1S9WB 1QNZH 2EIBA 4KK9C 1NC4D 2DQJL 4F57L 4MWFA 4J3WA 4WGVB 1YYLL 1FO0B 5EU4B 3Q6FA 2A6IB 1WZMA 1BJ1H 2ARJA 3ARRA 5DYOB 5TQ2H 5LGJA 3UTQA 4NNYB 1I8IA 1I9RL 4KDVA 2NNAB 4YUEL 1T4KB 4UQ3A 5I8EB 5IW1A 1D5IL 5FM5O 1B0RA 5EBWB 4M03A 1WBXA 1A1NB 3TV3H 5C07E 4JPWL 1TPXC 2R2BB 3SDCA 1F6LL 2WIMA 1IKFH 2YD8A 3MA9H 4ZS7L 4N5EC 3VFUB 2OMBA 3TH2T 4GLRH 5B22A 4ZO7A 5D71L 3IGAA 1X5IA 4LASH 1HIMH 4IRJA 4K2UH 1UM4L 3K3QA 1JFQH 4PJBB 4Y5YB 5J4MA 1YN6A 4ZOEA 5EUKB 2VDNH 2A1WL 1GGIH 3Q1SL 4D8PA 1E6OL 1IC7L 1FL6B 2EDQA 1P4BH 4U6YB 1BQLL 1WTLA 2HKFH 3CSPA 4WJ5A 1DQMH 1HKLL 3SY0B 4L5FL 1WUNT 3QCVH 2P8LA 4Y4FC 2A0LC 5EOTB 4PGCA 1FIGL 4P4KD 4DKFH 5E24E 3MLXL 3LQAH 2RFXA 5JOPE 3OR6A 1P4LA 1OP3H 4ZOBA 3RP1A 1ROWA 2VZUA 3VGBA 1QSEA 3LEVH 4X6FB 3QPQC 5F8RC 4BSWB 3G5YB 3ZKQD 3VRJB 4TTDD 4PRPA 1X6NA 1MFCL 4M1CD 2NXYC 1J9CT 5EO9A 2C1PB 1BP3B 3NCMA 5C0JB 3O9WC 5EC1B 2VR5A 4Z7WB 3GSNA 1UJ3C 4AT6B 1WZ1H 4MJIE 3CK0H 5FKPB 1YN6B 1HI6B 2CDFB 4GRLD 4M62H 3BAEL 2D0HA 3TA3B 2BRQA 1JZ8A 1KIRA 3EOAB 4JFEA 3GIZH 4LAJH 3CFJA 4P5MA 5I16B 5IB2A 3ZKMD 3AM8A 1QFWM 1FV1A 3C09B 4X8JA 4Z5RB 3RPIA 4F57H 1CXIA 3E8UL 4KV5F 1QBAA 4BSVB 2EXWC 3PWUA 4CU7A 5E03A 4HWEH 1A6WL 3X13A 4D0CA 3MRFA 5IJKC 5MEQA 5E8EB 1GAFH 3H7BA 4YHKL 5FF6A 4RX4D 1KSRA 1AGCB 1QR4A 4J1UA 3X12B 5E2VH 2VDLH 2BHUA 3KNBA 3O2DL 3VXPA 3VWKB 5EBMB 2XZQH 1TQCC 1VPOL 3CFCH 3D69A 3FB6A 4EXPX 4X4XB 4K94L 1NCCL 3P3YA 5IHZA 2PXYC 3MGAA 5BW7A 1VENA 4MAYD 4OCXL 2HT2C 3I6KB 5DD6A 3RNKA 2D03L 3MRCA 4NO5A 1ZVSA 4QHMB 1KUMA 2V9TA 3ARBB 5F7UA 5IUSA 1D5MA 1U8PB 3CVHB 1YY9D 2BNUA 3BKCH 4XWGL 1QHOA 1J10A 2AJZA 32C2B 1FGNL 1UM6L 4QNPF 1HIML 2QQQA 3I6KA 4JKWA 4GG6B 1A47A 1T5XB 2OTWB 3WLWD 3L3IA 3MRRA 15C8H 2A1WH 2DLEA 2DQJH 4PRAB 3MBEA 3D0LB 3UP1A 3NTCL 1ODAA 3S34L 3TO4D 4HUUA 32C2A 1TVHB 2X4PA 1RZ8B 5MENB 2VZ3A 2DL9A 1S9VB 1INQB 5I18H 4G43A 2DI7A 1YEIL 4Y4KA 4L8DA 1P7KB 2I25N 5FUOL 4QY8A 3RJQB 4HIJB 5E7FA 3NZHL 5HHNA 2GK2A 4Y4KD 1S7XB 4P5KA 1U9KA 5DUPH 1IGIH 2HWZH 3FQUA 4UIKL 3L95A 2EDXA 4U6VH 4LCWE 1QSZA 2BNRB 3AS3A 1M7DA 1MRFL 1VESA 2AJZB 3O2WH 5KSBA 1YNLL 2C3VA 2EDWA 1YEDB 1L4IA 5FAAA 1JNLH 2ZCKL 3BKJL 4OZ4A 5ISZD 1N59B 5JORB 2GHWB 2R4RH 3U0TA 5FKAA 2XN9B 3QFDB 3QDGE 3MLSH 4IRSA 1PLGL 1PBYA 2GCYB 4OFYA 3CZFA 1M71A 5FYLH 4P2OA 3T1WA 4AM0A 3VWKA 3IXTA 3KS0H 4KKCD 4L5FH 4ODSL 3SDYH 3GHBH 5DJ2B 3E2HC 3N50A 1CT8B 3B2UD 4GKNB 3MRBA 1B0GA 2EC8A 3CFDA 5HI4D 1I8KA 3UTPE 1GOFA 2CDEA 3FFCE 3MLTA 4R0LA 1TZHB 2F9BT 4FA8A 1S7SB 5I0ZA 2VXVH 1CXEA 3F62A 4JPIB 2I9TA 2J7LA 2P45B 1AJ7H 3LEVL 2JJSC 3KXFB 1VPOH 3CFCL 2VDML 3UBXG 5B8CB 4LLWA 2OX5A 3VXSA 1GOGA 5JIIA 2R8SH 3CX2A 2H1PH 3QNXA 1XR8B 4PJIA 4S1SL 2IMNA 4PRDB 3VXQA 4OJFH 3GJFH 3HI1A 3THML 1FPTH 5C6PB 4KC3B 3ZZ1A 2C3WA 2Z0BA 5EULV 5D93B 2J88H 4OCSH 3VXUB 1Z6JT 2P24B 4M7LL 2Q3ZA 4U05A 1T66C 1M6OB 2A9MH 5I9QB 3VFRB 4E42A 2YD5A 2G9HA 5TE4L 2DF3A 2ZUSA 3V6OE 1OWWA 1A6WH 3ZL4L 4AEEA 3VMNA 3BQUA 2VNCA 2I9TB 2FJFB 1ONQB 4DK6A 4RFOH 1WFUA 1UM5L 3V5DA 1YEIH 2GAZA 2CMRH 1E4KC 5DK0A 1X5KA 4MCYB 3SDDB 1P4IH 2MMXA 1NCCH 4PJAB 3RTQC 3VGFA 4UUJB 2BK8A 2HMID 5GGTH 4PRDA 3VXQB 2GITB 4LLYB 5BCAA 3FFCB 1Q9KA 2JB6A 2VYRE 1QFWH 1I3RA 1P7QB 1CTOA 5DUML 2X1WL 4P2OB 5EN2B 1SJXA 1UKSA 5DO2D 2YA0A 4XAKD 2NY6B 2VLRB 3PP3K 3ARGD 5I73B 3BKCL 4XWGH 2ZJSH 1IEHA 1IJ9A 5AWNL 1B9ZA 1E4XI 4OD1L 5DWUL 2JCCF 2B2XL 1GVIA 4NHUE 1GZPB 3MLTB 4R0LB 5I2IA 2WBJC 5JQ6H 1LILA 1U8HB 4LDLB 3FT4A 5DMKA 3U79A 4JFDE 1PFCA 3GJEA 4KJYA 4KZEL 1JWUB 4HSQA 4DQOH 5MEOA 4KROB 1IT9L 4BK5A 1IM9A 5C09A 3EFDL 3MOAH 3MLZL 2YZ8A 1LEIB 3V79C 2X4NA 3IVKA 2E7LE 3MMEB 4HUVA 3B2UC 5I8OH 3QEHA 1D6EB 5FUCC 3KGRA 1PYWB 4QOKE 1DN0B 3G5XB 4HS8L 2ARJB 4POYA 4RFNC 2DMCA 4MZ3A 2Y6SD 4AIZA 1INEH 1YEDA 5L7XH 3MUZ1 1CLCA 1B4JL 5ETUB 3UC0H 3ARQA 1NC2B 1NCNA 1OLZA 3KPSD 3EYOB 5JIPA 1DQJA 1JI1A 1Y6MR 2CUIA 3MRJB 5ITBH 2XICA 1LO5A 5D6DA 2B5IB 1VSCA 3ETBF 4APQC 2OTWA 2D4FA 1T5WB 4XP4H 2EDLA 2F54E 5DMIL 4QGTA 5F7WC 4Y4KB 3CD4A 4Z76B 2NTFA 2JKXA 4PLJC 3WHE1 1V3KA 5M94B 1HHKA 1PLGH 3CCHA 2DWEB 4PP2A 1U8PA 3CVHA 3CVIL 3VXMD 4PGZA 4OIIL 3CGTA 4PD4K 2X1QA 1CDYA 3V4PH 2VZVA 4LSDA 2H2PC 3R4DA 4O4YL 1MFAH 3UDWA 4NKMA 4N0YL 1MHHA 1GSMA 3H9HB 1CR9L 4M48L 1OSPH 1NANI 3MLYL 3RGVD 2EZ0D 4JFFB 1XH3A 3HG1A 4KTYA 3D87B 4G7VH 3TO4C 1BIIB 1F45A 1NC2A 3BKYH 3MACH 1P4IL 3BN9C 3T0EC 4FHBD 3S4SB 4JHZA 3WE6A 4C56B 3WIIH 4EN3D 4KTEH 1UVQB 5ALBH 3SE9H 5JW5A 1QPXA 1TLKA 4PJCF 3DX6B 3P40A 4G7YH 4GAJL 4KY1L 4W6XB 5FYLE 4NUJA 2BZDA 3OKEA 5GSVA 3C5JB 5T5FL 1T7XA 2DWDB 5ENWB 1LHZA 4OCSL 2NY1D 4W70A 3R8QA 5C0CD 1MREH 5HI5C 1DBJH 3VFPB 4PRIB 1KYOJ 1NFDF 2DQUL 5FOJA 3IDXH 2VQUA 4D0DB 2BSED 1EMTL 5GSRA 4DTGL 2OP4L 2FSEB 3B9VA 5CEXA 2GJ6A 4Y0GA 4LNRA 1RIUH 4RGMC 1Z3GL 4PJ9D 4U6HA 4U6TA 3PUCA 4N5UA 4RZCA 3VXUA 3IU3B 2PCPB 1RUQL 2YEZA 4PV8A 4K3DL 1ZGLM 1QR1A 5ID0B 1FSKC 4H1LB 2DLFL 2IAMA 5I2IB 5I6XC 3T1FA 1MCBA 1J87A