3QUKA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
275
structure length
262
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 262
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qukA01
4ISVA 4XPGL 3DARA 2EE2A 4I18C 1RU9L 5BV7L 3F7YA 4HWUA 1L0XA 3BN3B 4OF8A 2R1WB 2EZ0D 3C6LA 3CXHJ 3P9MB 4F2MB 2ZSWB 3TA3B 3LSOB 1JPTL 1Q72L 3Q1SH 5F9JA 1M6OA 4JPKL 4M7ZB 3E3QC 2XZAH 3P30L 4HK3N 2MKLC 4QHNA 2KH2B 3V4VH 4DKAA 3CFCL 1P53A 5JR1L 3FMGH 4K3JL 1X5KA 1ZWIB 3GSVB 4M5YH 3B9EA 3SCMC 4M7KH 4K8RD 1SYSA 4WO4A 3R8BB 5IVXE 5C0RH 3LKOB 1NANH 1KLFA 2ED7A 4TQEL 3MLSH 1GHFH 3REVB 4Z5RA 3BUYB 4R4BA 1EERB 4PJIF 4U6TA 1HSAA 3VRLE 4BZ2L 1JN6A 1GRWA 1ZHBA 3NA9H 4X98A 5I19L 2GJ6A 3DX8B 2A73B 5B22A 2AXFA 3IFOA 5CS7A 1LE9A 3SE4A 5IMMA 4IRJB 4P2YA 5C1MB 1MCOL 3MRDB 1JV5A 1MAMH 2R69H 4NNXA 2FBOJ 3MV8E 2PW2A 5KTEL 1A6AB 1CGXA 4F8TA 3DHMA 2ITDA 2HT3C 3I50L 4S1QH 1JZ5A 2JJWA 3DX7A 3PQYD 3BFOA 2K9UA 4ZFOB 4OLUL 3QT2A 5I16B 5ICYA 4PJCA 2HFGH 3KPSD 2OYPA 4AM0B 3EW3B 4DCQA 1H9VA 3VRJA 3KNBA 5GS3A 2XXMB 4E42A 1S7SA 2Z31C 1AO7A 3NPZB 4YWGL 2OJEB 5C8JB 3MBXL 3PWLB 1QR1B 5GRJH 2R4RH 1N0XH 2QR0A 1XGRB 3FZUC 1AJ7L 3V7MA 4WW2B 12E8L 2GK2A 5D93B 4DN3L 5IVNA 1CF8L 2BSSB 5LXGL 1KIQB 2DI7A 3MREA 3DI2B 3ULUC 2DJUA 1Z9SA 2DTSA 1QSZA 1QVOB 1CL7L 1WISA 1BJ1J 3AXLA 5KVGL 3W82A 4OKVA 4JRXD 1D5ZA 2YWZA 4TTDC 3TIDB 5HHMA 5DJZB 5C6WH 3OKOB 5ID0A 1DE4B 3DSNA 4P23D 1DQDH 1KN4H 3GSNB 5JZ7C 1RZIB 1Z5LB 4XMKH 2PYEE 4ZUTA 2ZNXA 3KLAB 5C09D 5ACZA 4YHZH 3BKCH 1M7IA 1UA6H 1RIVH 2QADD 4UBDD 3BH9B 2XZZA 1JTOA 3WO4C 1F5WA 1NH6A 4PJHE 1NGPH 1UH4A 3WFDL 2HKFH 1TJIL 4NIKB 2ED8A 2CRMA 1VKXA 3PQYB 1NAKH 5INCB 5BS0D 3SGKC 2E7LA 3F7VB 3SDAC 4KVCL 3KPSB 1ZTXH 1YDPA 2R23B 5MI0B 5TF0A 5FYKH 4MVBC 5FUZL 4YXHL 1G7IA 5DJAB 1XIWC 3NFNB 3PXJA 4U1JA 3OJVC 1WZLA 3BGFB 3SPVB 1UWEH 3D69B 3QNXB 2W65B 1ACYH 2OI9B 5IF0A 3KYMB 4HIHA 4NQCD 1NCWL 1UWGL 2FDBP 1BD2D 3B3IA 4MQTB 3OB8A 1AKJD 1IAKA 1V3LA 3X11B 1OARH 3RWJA 4YZFE 5IJKC 4H1LG 4PGDA 3H2WA 3T1FB 3MRJA 4MNQD 3SE8L 4G6MH 4IRSA 4JRXB 1IAIL 4J4PA 2ZP0T 3KPOA 4JDVA 1AGDA 5FO8B 4K9EC 1KLGB 3ULUF 2ESVD 4MWFA 3P77B 4X6DB 2X7LB 2X44D 4N8VG 3VFNB 1XCTA 4RFNB 4Z7VE 5T1MA 4KKAC 2VKWA 4POZD 5HHVL 2YXFA 4TSBL 1QSFB 1JFQL 4QRSB 1HZHL 4PR5B 2O5XH 1QLFB 3GSXB 3FAXA 2F58H 4APQA 4HJ0D 2YBRB 5C09B 5DZNA 1JNJA 3OKKB 3QXTA 3C6LD 3FT2A 2QADB 2UVFA 3FQRB 3MGAA 3QEUB 4NQSB 1D6EB 3NZHL 4FS0A 4YPJA 5CP3H 3PHQA 5EN2A 2DD8H 4R0LA 1V7ML 1ZHKB 4ZYKA 4RAVA 1I4FB 2H2PC 1PQZB 5EBLB 1K5NB 4HPOH 1CE1L 1BF8A 5CJOL 5BS0B 3TV3L 2YD3A 3CFJA 4NWUH 5FXCH 2KQMA 1LD9B 5EU6A 1AXSA 1PJ9A 2EXYC 4O58L 1JNLL 3HRZA 4WO4D 5IG7B 3U0WL 5JO5B 4HLZG 5C07E 4DZ8A 1TQCB 1NDMB 2DWEB 4NQCB 1NLBL 1PEWA 3UROR 5JIKA 3ARPA 1K3ZA 1BD2B 1T21B 2AJVH 4QTHA 4PJGA 1UXSA 5BQ7B 3MBEA 5FUCC 2C3XA 1AKJB 3VI3F 4PRAB 2FX7H 5D6CA 1IGFH 5IMOB 3EJYD 4NYLB 4MNQB 2GJ6D 2NY5H 1PG7H 4RAHA 2XT1B 1FCCA 2ZSVB 4JZNA 4NKMB 3P73A 5JXAH 3OKDB 4P5MA 2ESVB 1IILE 3RY4A 5FF6B 5DFVC 5D70H 3NAAH 4J8RB 3EGSB 3QCVH 2Z35A 5BVJA 1M7DA 1A7RH 1BZQK 3TCLA 4ISVB 2Y1VA 3O9WA 3W5MA 3F7YB 4JFZH 1DQQB 2VL4A 3C6LB 4XH2A 2CQVA 3UPCA 1F58H 1WZ1H 2V9RA 1AO7D 2AK4E 3BKMH 1MWAA 2OL3A 1JPGA 4NHCL 4PV9A 5DVKA 5F9JB 1M6OB 5LAXA 2IQ9H 3QDME 4F58L 4DAGL 4I77L 1I1AA 4HKXA 3UXFA 4QHNB 4YC2B 1BFVL 1JPFA 4QNPF 3S4SG 4Z7WF 1TITA 3LRHA 4KI5F 1NGQL 3DHJA 1FVEA 1SYSB 3ELAT 4WO4B 5GZND 3UYRH 7CGTA 4KI1A 4Z7UE 5SWQA 3QUYA 1EZVX 3VDCA 1YY9D 1TENA 4WUKL 4Z5RB 5HHMD 3T8XA 5B3NA 5F7EH 1UCBL 4XCCH 5I1KL 2BJMH 4OCSH 4R4BB 3MACH 2WZPD 5DZLA 1IAIM 1HSAB 5E8NA 3OF6A 1JN6B 1IEBA 1NC4D 1ZHBB 4X98B 2GJ6B 1OWWA 4Q9BA 2AXFB 5E2JA 3OX8A 3PJSA 3EO0A 4JHZA 1LE9B 1CDIA 5IMMB 3O6KL 1JV5B 4NNXB 2PW2B 4MMXC 1JPST 2ITDB 4C55A 4NC1E 1G6RL 1MCNA 1EEYA 4JO2H 4J3VA 5GSRB 2EYRA 2NY6D 3DX7B 3T2QA 4Z9KB 4RIRA 4X6CE 5ICYB 4PJCB 2WBJA 3FN0H 3WKNA 3WMSA 4W4OC 4DCQB 1PZ5A 3KNBB 3VRJB 2UYLA 3K4DA 1S7SB 4KRPD 1MCRA 3SE9L 4E42B 1ODAA 2CLVA 1AO7B 5E5RB 4BK4A 4ZTOL 1EBAA 1M1SA 3ARDA 2H8PA 1E4XH 4LSPH 3KLHD 3O2DL 1MCJA 1Q8MA 2QR0B 3T08A 1PKQA 3K4ZA 5EA0H 4FQPA 2Y6SD 4L8SA 3SGKA 4HV8A 4NM4H 3HC4L 4XNZB 5JA9A 2N7AA 3UMTA 3MREB 1KGCD 1G7PA 1H3GA 2ADFL 1KTLA 2VLRA 3TPUA 4NZUH 3X13A 1YJDL 5J89A 3AXLB 2LABA 4IRSD 1ES0A 4OJFL 4OKVB 1NPUA 3CC5A 5GS2D 1D5ZB 2ZCHH 4J4PD 1FVDA 5HHMB 2P8MA 5E94A 1ZAGA 1WICA 1WBZA 3SDYL 3MLZL 1QFUL 1CXLA 2NYYC 4BYHA 1EAPA 4Y8DC 1DBMH 3GO1L 4RA0C 4ZUTB 3C6SA 3O3DA 3CLEL 3O6MH 4FQCH 5H8DA 4APQD 2RAMA 5AAWA 5ACZB 3QCTL 2BXZA 1M7IB 5ALCH 1K3IA 1H8SA 3MNVA 4HUVA 1O7VA 5GS0L 5E99L 3SKOA 4X5XA 3TESA 1UWXK 1IKNC 3MUZ1 4H88L 1KOAA 2NY6B 1VKXB 4S0SD 2Y72A 3VD3A 1YDPB 2ZUYA 2AEQH 4KHXH 3QA3A 4KRPB 5EU6D 4XWGL 5C92A 5IFHH 1YEFH 1G7IB 2AABH 2D7NA 3HI6H 2X1XR 4U1JB 3MLXL 3CU1A 3WIHL 3VW3H 4O2EA 5IBLD 3TFKC 2E9BA 2X4NA 4RFOH 4RQQA 1AHWA 3H0TA 4Z7WA 4NQVA 2VDQL 4F7EA 3BO8A 5IF0B 4HIHB 5FAAA 4MHHI 5BO1H 3B3IB 3EFFB 3BGMA 3MJ9L 3MBED 2DQUH 1J5OH 3FONA 1Q9KA 1IAKB 4QHKI 3RWJB 3IJSA 2H1PH 3HNSL 5I15H 2DI9A 3BDYL 3SCMD 2H9GA 3G6DL 3MRJB 3LDBB 4KTYA 3MUGA 4IRSB 1QBML 4P5TC 1VHPA 3UJIL 3TH4T 3KPOB 4AEIH 4JDVB 1AGDB 1U9KA 1MIEL 4H5SA 5IT2H 4LSTL 4MWFB 4NO2A 1MCWM 4KKCD 1XCTB 4FQQA 1P5VA 5T1MB 3MO1A 3V0AC 4DW2L 3OPZL 5E8OA 3X14A 3QAZB 5IB4A 1F97A 3O9WD 2E9WA 4Q7DA 5MENE 4APQB 5IB1A 2NTFA 3MZGB 3VXUE 3FT2B 3KYAA 2OK0H 4HKBB 1P9MA 3JV6A 3GSOA 3IAPA 5HHQA 1FSKB 2DQFA 5ENWA 3PHQB 2EH8L 1SEQH 1MI5A 4R0LB 5EN2B 4ZYKB 4RAVB 4UAOB 4HUNB 2HT3D 3PWPA 1CFSA 1I1AD 4S1SL 5T33H 3SKNA 1CDGA 3LVEA 5D1ZC 3CFJB 3NACH 1VGEL 5DI8B 1T66D 4QHUA 5EU6B 1AXSB 4YDKH 3G04A 5D7IF 3HRZB 4FXLA 4OZFA 3VXRA 25C8L 4B53A 4P2RE 3MLYH 1IE5A 3QUYD 2VC2H 4TPRL 3NMEA 4DZ8B 4NKOA 3CPLA 3OB0H 5DC9B 4QTHB 3C5SA 4PJGB 1UXSB 3MBEB 1WITA 1UKSA 3OF6D 1J18A 5D6CB 1FC2D 3KHQA 2NR6C 3ULUD 3VFTA 4GFTB 1SMAA 5IUSA 4YQXL 5H37H 4JZNB 3P73B 3IDJA 1KJMA 4P5MB 1AGFA 4YHLL 3PWJA 1CI5A 4MJ5B 2Z35B 3GBMH 5BVJB 1M7DB 4OF5A 1N6QL 1YEHL 4EDWL 3TCLB 5FCUL 5CILH 2JJTC 5C6PB 3O9WB 5JZ7D 5EU7E 2WBJD 4G8GA 1NEZG 4UT7L 3A0OA 5FHAL 5GRZA 4XH2B 3VFRA 5I1IL 3VFSA 1JYXA 3MFFA 3ARDD 4KUZL 3QSKB 1MWAB 5F7HA 2OL3B 4YO0A 1JPGB 4PV9B 3WXVH 4YLQT 4C59B 5LAXB 1NUFA 1XF5A 1HIML 1I1AB 3A6CH 4HKXB 2QBWA 2OJZH 1JPFB 3WKMH 1TXKA 1YA5A 2X4PA 1BJMA 4MHHG 2CUHA 2VLRD 4U7KA 1FVEB 1TIUA 5F89A 5SWQB 3QUYB 5CSZA 1QPXA 3FO9A 4KJQD 3IVKA 5GHWL 4Q9QL 3T8XB 4L5FL 3K1DA 5ADPH 1KJ3H 5F88A 1EHLL 2NY4C 1KXQE 4YX2H 3N85L 3N06B 1RULL 5E8NB 4KGJA 5GJTH 2BSED 2EDRA 2HN7A 2AQ1A 1IEBB 3UYOD 4P9HH 3OX8B 3MLUL 3PJSB 3EO0B 1HQ4A 5HYJE 2XTLA 5C9KA 5HVWA 4UIMA 3KPRE 3B9DA 5JPNA 3RDTC 32C2A 1RZJH 15C8H 2FECL 1JZ6A 1EEYB 1OP5K 43C9A 3UBXG 2EYRB 4RIRB 2RFXA 4HFUH 2GY5A 2WBJB 4DKEH 3FQWA 4M1GH 1PZ5B 2BFVL 4M6NH 2J4WL 2UYLB 3AS0A 3EOYG 4BELD 2CLVB 1BZ9A 2JJSC 3ARDB 1HHHA 2BCKA 3BRDA 2H8PB 2HTKD 5FGRA 1CL7I 1D9KA 1CD9B 2BVQA 3UX9B 1PKQB 3U4EA 5L7XH 4KI5D 2DYPA 5D7IA 3DV4A 4AJ0A 3MJ8A 3GBLA 4L8SB 5IW3A 3V0WH 4U31A 4HV8B 3B9VA 1YY8A 3ARQA 2VDNH 3JZ7A 4I2XA 2BY1A 1KTLB 2VLRB 1JMZA 3TPUB 4DWHA 3X13B 3RWIA 2NLJB 2FH8A 1ES0B 1VFOA 3TFKA 2W59A 3M17A 3CC5B 3FKUS 1I7ZA 4LGPB 4X4MA 3TIEA 1FVDB 1K4CA 2BZDA 2P8MB 5E94B 4A2LA 4PLKC 3AB0C 1WBZB 2FNBA 3GNML 4M5ZL 3B5GA 1EAPB 3JVGA 3VGFA 4JHAH 4OCMC 3VXQA 3C6SB 4DVRL 3L5HA 2HH0H 2PXYC 1XR9A 4O5LH 3NCBB 4RX4A 2A6JA 3MNVB 5FGSA 5E2WL 4HUVB 5DFVD 5IVOA 1MHPH 3SKOB 2V5TA 1JMXA 5GPRA 2VE6A 3PWPD 2AJSL 1CLOH 5IJVA 2UVEA 3RKPA 5T1LA 3UTPD 5IBUB 1JGUH 1HNGA 3T2NH 5J8OA 3QA3B 2DOCA 5E6ZA 2E7CA 4ODSH 4QHKJ 3VXRD 4O2EB 3QIUC 4RQQB 1AHWB 2JKXA 2MCG1 4FQLH 3H0TB 4Z7WB 4NQVB 1W0WA 3FL7A 2GEEA 3BO8B 4X7SL 1FGNH 1IAII 5AYQA 5TE6L 4FQ1L 3L3KA 4P3DA 1KC5H 2HVKA 1T6VN 3BGMB 3NCEB 5F93C 3FONB 1Q9KB 2EC9U 1UM5L 4UIKL 5F1OB 1BAFH 3IJSB 1DBAL 3ECBB 1BX2A 4LARL 1O7SA 2H9GB 3UO1L 2SEBA 3ILPB 1PEZA 2FEDC 2AK1L 3BYYA 3H42L 2GAZA 3WFBH 3EYUL 1FDLH 4H5SB 1E0OB 3LKRA 3NCFB 3O4OC 2XRAH 4NO2B 1AGEA 3OKMA 5AZ2H 1RURL 4FQQB 5J6HB 4F7CA 3X17A 3MO1B 4MJIE 1PSKL 4KK8D 3E1F1 5E8OB 1FV1A 1QPPA 3S3PA 3X14B 1RUQH 3WDJA 1HHIA 3WJLC 5L2KD 4HPYH 1MFNA 2LU3A 2OR7A 3J8F7 5IB4B 3HE7A 4OLWL 4P0DA 5CJQL 3BD5A 4G8GD 5IB1B 2DM3A 3AMLA 1KCSH 3EYSL 3JV6B 4LHUA 5T3XH 5E8PA 5EORH 5HHQB 3Q0HA 2DQFB 5ENWB 1MI5B 3I85A 3PWPB 1QFOA 1CFSB 5CGMA 1ZKAA 4KGLA 2VXVL 3SKNB 1X5AA 4EN3A 1CFVL 3ZT7A 1WF5A 2L7UA 2ZPKH 5I1GL 2R2BB 4KJYA 4QHUB 3G04B 2N1KA 1YYML 4OZFB 3VXRB 4W70A 2XZCL 2D03L 1QKZH 2D7OA 4I3RL 4QXUH 1IL1A 2VQTA 2NY1D 4NKOB 4HUXA 3CPLB 2LV4A 5E2VL 1T80A 3P0YH 2HRPH 3LS4L 4BSWA 3FN9A 3IKKA 4JQXA 2OBGA 5GRWA 5BVPH 1IGJA 4Z7NF 1QFHA 1XT5A 2CK0H 3VFTB 4PRNB 5F21B 2WP3O 3IDJB 1KXTB 4IIQA 1BEYL 1AGFB 4HZLA 1GPOH 1OSPH 1QFWI 3FT4A 5I1AA 5J12B 5FM8A 3VG0L 3PWJB 1I85A 4MA7H 2D7TL 2X1PA 3BIBX 2CGRL 2NY2C 3T0DA 3QUZB 4FXGA 3HC3L 1HNFA 1N5YH 3DETD 4FQ2L 4S11A 2Y25A 3H3KA 3ZYIA 3VFRB 1IGCH 2HKHL 3VFSB 3MFFB 1S7RA 2B2XH 4IRZH 1Q0YL 4YO0B 1D9KD 5DLML 3NZ8A 3WNOA 3IXAA 1XF5B 3PL6A 5HI3C 2DYPD 5K9JH 4YPGA 3LB6C 1SJHA 4TVSa 2X4PB 5T5NF 4LMQI 4OGAC 1XGYL 4TULL 4PB0H 3TM6A 4M9PA 5F89B 2AEIT 2LFGA 3T0EC 4C56A 3TFKD 5CSZB 2VWEE 3FO9B 3IVKB 1KSRA 2NY1B 2X1OA 1L0YA 4LIQH 1JYVA 1U36A 5F88B 3GJFH 2J8UF 4OFIA 5DUPH 3LZFL 4PJEF 1A6WH 3PQYE 2DICA 2V5SA 2HN7B 3MRGA 4NN7C 4OSUH 5HHOA 2X1WL 3BWAA 4LPTA 1QO3A 3KPSE 3WN5C 3ARSA 2J5LB 2M26A 4TSAL 1DN2A 4JFXA 2EE6A 5MERA 3S4SA 1HQ4B 1CDCA 3QNYA 4JG1H 3L7EB 2VDLH 4UIMB 4RX4D 2HVJA 3AGVA 3BPOC 5JPNB 1WWBX 32C2B 4PBVC 1UB5A 3NIDE 2VN7A 4JZJC 2DN7A 2NTSP 2V17L 43C9B 1IBGL 3U2SA 2RFXB 5T1LD 5CJXC 3L1OL 4FQXC 4FFYL 2NY5C 1U8LA 2LU7A 5F1NA 5L2JA 1KCVH 2X5PA 5KW9L 4R8WH 4OTXL 5IV2A 2UZIH 2DBLL 4RMSA 1BZ9B 4JRXE 1HHHB 2BCKB 4NP4H 4WY7L 3QNZA 1N2RA 1EVTC 1WWAX 4BQ6A 2E3VA 1D9KB 4X6DE 3T65A 2BVQB 3EO9H 5IW1A 1DL7H 4L1HA 1F11A 2DYPB 5D7IB 1YPZF 4K07A 3DV4B 3OJDA 3MJ8B 3ARRA 5FECA 1YY8B 1QHPA 2YXMA 4LQFH 4YAQA 4I2XB 1HKFA 4Z7QE 1JHKL 3C09B 4WCYL 3S36L 5C09E 3LQMA 5T3ZL 3RWIB 3DUUA 1KPRA 3M17B 1X4ZA 1NLDL 4ZNEE 3TIEB 4OZGA 3RUGF 1EH9A 1K4CB 5TE4H 5KS9F 2NZ9C 3AFLA 5ITBL 2VZ1A 1FZKA 3OWEA 1A6VL 5BS0E 4JPVL 1PFCA 4N68A 4TVPD 2A9NL 2B7DT 2W9EL 3VXQB 2HLAA 2NR6D 3HE7D 1JWUA 2ZKHL 3EO1A 1R0AH 4CKVX 4C54A 3TF7C 1XR9B 1J1OH 3JTSA 5SX5H 4J6RH 4DN4L 4NNYA 1KTKE 1QLEL 3OAUL 4KJPC 4LHUD 5T1DH 2A6JB 1MSPA 4WENB 4UNTA 5GS1C 5GGRA 2PTVA 1NMAL 1EZVY 4NQCE 2A1WH 2APVA 3CSGA 1BD2E 2W9LA 5DK0A 2VE6B 4MA8L 1ZLSH 3HRPA 4XBEH 4NZRL 5IJVB 4E5XA 5T1LB 2B20A 3IDYB 4EN3D 1XF2A 1DQMH 2IBBA 3KS0J 4G7VH 5EZIH 4M1DL 3ARGC 4MNQE 4P9MH 5EIQA 1FPTL 2DM2A 4YIQA 3WIIL 4M6ML 3NCCB 1FCGA 4JG0H 4HSQA 1QTYT 1MEXH 2ESVE 3FO0H 4LAQL 1II4E 1W0WB 4HIXL 5HPMA 2XG5A 1GAFH 2APWA 3A6OA 3L3KB 3B2UC 2EYSA 4MNHA 1L7IL 4XNXH 4QRPA 5FGBC 4Q6IC 3C08H 2CUIA 1BX2B 2SEBB 4M03A 1A47A 4D9RD 1QSVA 2J8UA 2GAZB 1P4LA 3MV7A 3ZSSA 2DQHL 4Y4KB 3LKRB 3R06A 8CGTA 1AGEB 3OKMB 2FHFA 4JANA 4GW4A 5BMFH 4F7CB 3MA9L 3S34L 1FV1B 2A0LD 1HHIB 1VFUA 4LPVA 4BFEA 3RHWK 4LLMA 5AD0A 2Z91A 3HE7B 4G3YL 4Y5VC 3OKEA 3S8WA 2L4OA 5J3HC 1T1YA 4H1LB 5E8PB 5A43C 1S5HA 3CVIL 1EXUA 3VG9C 2JB5H 3RDTD 2B1AL 3LEVL 5TPWH 3T09A 4DGIH 4CVUA 5JHDA 2J8OA 4LPYA 2YS4A 3D85A 4YHKL 5F71A 5J11B 3PL6D 2VYRE 3WUWA 2BP3A 3H9ZA 2QQNH 3OKLA 4EN3B 1IC4L 1UACL 3DYMA 4YHMH 4ESKA 4ZFOL 4KJYB 4LCCC 2PKDA 2GJ6E 3I75A 1AE6H 4GMSL 5ACLA 5J06A 2APFA 1JHLH 3VMPA 2ADIA 1YPZA 4C56D 4D9QD 1YEKH 1IL1B 2JELH 2VLJB 3WLWD 3G9AB 4HUXB 4HLJA 4DEPC 4TSCH 4GS7B 1NKRA 5E1HB 4BSWB 1F3DJ 4M62H 2IMNA 3RWFA 3HMXL 5DA4A 4X83A 4PJAF 1QRKA 5HHOD 4YXKH 5B3JF 1IGJB 2HWZL 1LK3H 2RGSA 3PDOA 3L6FA 5KS9A 1S3KL 4K8RL 3WFEH 1I7RA 5DGRA 1MLBA 4IIQB 1AO7E 5CP3A 2EDTA 2C7UA 4TUKH 4HZLB 3QRFM 4PLKD 4R2GC 4DUXA 1RZKL 3FT4B 3GI8H 5I1AB 2FL5A 4M6AA 5A3IC 3GM8A 2C4FU 4Z95H 4FXGB 5FOJA 5MHSE 3V6FA 4XPFL 2IQAA 3GSNL 4P4KA 3RGHA 4G9DA 1AQKH 1S7RB 3QEGH 4FTVA 4JM2C 1LNUA 3PGFL 4V2CB 4LCWA 5HHME 2H2SC 2VDML 1KEML 3BJLA 3NZ8B 4FNLL 3IXAB 3DYOA 3PL6B 1C08A 3NPSB 2WQRA 5D7KD 2VQ1A 3OZ9H 4YPGB 3GKWH 1SJHB 5I8KL 3TT3L 3AY4A 1L4IA 2R9HD 5I1HH 2XKNA 3THML 4LSUH 5I1CL 4QGTA 4C56B 1UH3A 5T1KA 3W11C 1FAIH 2FX9H 3EYVA 1ZANL 1LO2L 2VKXA 1MJUH 5LCVL 1J7VR 3GSQA 4ODHL 1MOEA 3H8NA 3MRGB 5HHOB 4K55A 2E7LE 3BWAB 1QO3B 3HFML 2FECI 1I7UA 1YC7A 2EICA 3AREC 4JFXB 4ZS6D 3I3BA 4GKSA 2HJFA 4U7MA 5MERB 3S4SB 2YA2A 4NN6C 1GGCH 4DK3A 3QNYB 2E9JA 4X9GA 1KB9J 1INDL 2HVJB 5DUMH 3DLQR 2A6DB 1C1EL 4MA1C 4YJZL 1UB5B 2CXGA 4XPAH 4GKZA 5FA3A 5GISL 3I9GL 4FQJH 3U2SB 1UJTA 3KYKH 3U7WH 4CAGA 2H6PA 1T03H 1X5JA 2ENSA 1KGCE 3U0TA 5L2JB 1U8LB 5F1NB 1R3HA 1SJVA 1CFQA 3UTQA 3VXTA 3MMEA 5IV2B 4KTEL 1ZGLP 3QNZB 1N2RB 3LQZA 4RMUA 4A2MA 4PUBH 5ALBL 3T65B 2BY0A 4CGTA 5IW1B 4NKIH 4WWID 5DGQA 1F11B 3ROOA 1RIHH 5HY9A 4JM2F 3OJDB 5FECB 4ZG1A 1RK1A 4PS4L 4QRPD 1LDPL 4YAQB 1B2WL 1A7QH 5IROA 1INEL 1XMWA 4M6OH 3UBXA 3DUUB 1KPRB 1F90L 3WE6A 3MV7D 2JJUA 4OZGB 3FO2A 5DR5H 4PJBF 5HYQA 1RJLA 3RY5A 1A6TA 4ONFL 2E9IA 1EGJA 1ZVHA 4FFZH 1FZKB 1RI8A 4Q6IA 4XZUA 2HLAB 1JWUB 4ZS7L 3EO1B 5EU6E 1MNUL 3JTSB 4FZEH 4S1RL 3QDGD 2YD7A 3DX9B 5BOPA 5L9DH 4NNYB 4OI9A 4R6UA 4GG6A 4KTDH 3HMWL 3O2VH 1Q9WA 4A6YH 4D2NA 5A2LH 5IQ7L 5GGRB 1OP3H 5JHDD 4GRLA 3D85D 2GK0A 4PJGE 2NY2D 5DK0B 1F4WH 1ZT4A 4E5XB 5ECJE 1XF2B 4JDTH 5D5MA 1RJYA 5JDJA 4F80A 3HNVL 5JIHA 1DQLL 4YIQB 4X7CC 4IHOB 4K7PL 4HC1H 4XC3L 1N26A 3DVNA 3FQTA 4P46C 5IEHA 5TDNA 2AQ2A 1B6DA 1RZJC 5HPMB 5HD8D 2J6EH 4YHYC 4XAWH 2B5IB 1FE8L 2EYSB 4MNHB 1SVZA 3W2DL 1IJ9A 4QRPB 3GJEA 4LCCA 1S5IL 4NC2B 5IQ9A 3VFWB 5DK3A 1YQVL 2VIRA 3QUKA 4Z78A 2J8UB 2ZUVA 1P4LB 3QXVA 2J7LA 3T1WA 4L4TA 1ZLWH 3R06B 3ARYA 1CLZL 4JANB 4GW4B 2KKQA 5F96H 1CDHA 1F4YL 2EIZA 2VDPH 3KPQA 4GSDH 3ZKXB 1WEJL 1HH6A 1A9EA 1BHGA 1UM4L 1BBDH 4LLMB 5AD0B 2Z91B 5I0ZA 1NSNH 1CXIA 1SBBA 4IJ3C 4NN5B 3BE1H 2F5BL 1VDGA 1T1YB 3KPLA 1MCSA 1A4JA 4FTVD 1S5HB 1T22A 4LCWD 4WI5A 1A5FH 1MCLA 5JHDB 2NY7L 1NKOA 3D85B 4HWEH 2NY2B 3KYOA 5D4QA 3V5KA 3WUWB 4WHDA 4IMKC 3OKLB 2QSTA 2QL1A 2WWMD 5H35A 3ULUE 4PJ9A 3I75B 3MODH 2FB4L 4OLYL 2IFGA 3IXTA 2ADIB 1YPZB 2HLFC 3NOIA 2Y36H 5T1KD 3JSSA 1U2HA 4KRLB 1T4KB 2YR3A 3ZYJA 3M45A 2NXYC 3QO0A 3RWFB 4YDIH 1BVLA 3HR6A 2BVPA 2XY2A 4IDJH 4PJBA 2B0SL 3VFPA 3PDOB 4JPWL 2H26A 3L6FB 5KS9B 4M8VA 3SDXA 1H3PL 1I7RB 1MLBB 4YK4B 2C7UB 4I13B 4XPGH 3W81A 1MJJA 2FL5B 5KG9A 2NZ9D 4EJ1C 5BV7H 1PKQE 4G6FD 1DBBH 3V6FB 1J0ZA 2IQAB 3EOTH 3AREA 2BHUA 1JPTH 1Q72H 4P4KB 2VLRE 4G9DB 3TPUE 1Q9OB 1KELH 2X2YA 4JPKH 4N90D 3P30H 4FTVB 3AM8C 1LNUB 3CFCH 4LCWB 4LFHG 1JJUA 5JR1H 1FRGL 1ONQA 4K3JH 4RGOL 1RVFL 1C08B 4KWUA 2VQ1B 2EDLA 3ALWA 2Q3ZA 4KROC 3RU8H 4TQEH 4AQ1B 5JHLL 3EDKA 5GGVH 2XKNB 4KFZC 2V5YA 5E7BA 2CJUH 4PRHA 5T1KB 4FABL 4BZ2H 1P4BL 1CICA 3EYVB 1P84K 1UZ8A 3SBWA 2IAMA 2R56H 3ZKND 5ICZA 2W38A 3GSQB 3D6GA 4QXTA 4XVUD 4WV1C 5EZOH 1I7UB 4KK5D 5CWSA 5BRZD 5KTEH 2HJFB 3KR3H 3ORJA 5FB8A 2NY3D 5KAQG 4X9FA 2HA1A 3RVVC 2J12B 2GIYA 4QNPE 1QLRA 1Z9MA 2AEPL 3P0VH 4Z7WE 3L3DA 4U0QB 2E6JA 5F9WB 4GKZB 4KI5E 1NDGA 5FA3B 4GRLD 4XTRC 4RMRA 3HI1A 2FGWL 4M02A 2H6PB 1WWCA 2OXHA 4YWGH 3ZTNL 1T6WA 4G43A 4TNVF 3ULVH 1R3HB 1CFQB 1AJ7H 1YEJL 3VXTB 3MMEB 3BKYL 4LLVA 5DD3L 4WRLA 4WEMB 3RVTC 3LQZB 1G0XA 1I1FA 1KEGH 3QPQD 4PJ5A 3V52L 3LMJH 4PJ7F 1OTTC 3P11L 2IWGA 3ROOB 1RZFH 2XA3A 3PP4L 5HY9B 1CL7H 1MCPL 1TPXC 1RK1B 2F53B 1LO3L 3VFUA 2I07A 1I8KA 4WFFD 4GBXC 1EO7A 3UBXB 4ZSOB 3QXWA 3CZFA 3WE6B 2OTPA 1RPQA 3FO2B 4Y7MA 4L4TD 1RJLB 3LD8C 5HYQB 5HYEA 1A6TB 1BREA 1IGML 4Y2OA 1VEOA 3STBA 2EDBA 3R4DA 5B38G 1T0MA 4DGYL 2EDEA 2G75A 3GMLA 2K7PA 2ZUSA 4UUJA 1H3TA 3UTPE 4ZPTA 1I3UA 4XZUB 4KKNA 3EJZC 1JWMA 1ERNA 1ZOXA 1E27A 5LBSL 3OXSA 3QWOA 3WFDH 3DO7A 2FJFA 4R4FL 2NY3B 1FZJA 4QHLB 4W6XB 2NQCA 3VXRE 4C4KO 3BZFA 4GG6B 1N7ML 3HUJF 1CD1A 1X5LA 1Q9WB 1NCBH 4R2GD 4WFEE 3GMPA 4KVCH 5FYJU 4OLZL 4JQIH 4GRLB 2GK0B 4YXHH 5I30L 2CIKA 1ZT4B 3BWUC 1L6XA 4U3HA 1ZEAL 5D5MB 4HG4K 3JWOH 2VLKA 5KZCB 1RJYB 3VMOA 4XCEA 4PJ9D 1UWGH 4Y8AA 4Z77A 4FFEX 4LCUA 1OY3B 3RGVC 3DVNB 3FQTB 4KU1A 5DQJA 3Q5TA 5IEHB 4HEPG 2EDQA 5TDNB 1F3JA 2W1NA 1MWAL 2OL3L 1BVKA 1UG9A 2YN5A 4P2QD 4XMPL 5FK9A 3SE8H 2HAZA 2OTUA 3DVFA 3SN6N 4R90L 1IAIH 5L2KE 3KS0H 4LDLB 3GJEB 4LCCB 1OAYL 4HT1L 5FYJL 2OXGA 4G8GE 3QRGL 2VR5A 2YSSA 3OR7A 1G9MH 5IQ9B 3QUKB 2VIRB 1NJ9A 2DTML 5ELIA 3D0VA 4L4TB 2AERT 3LPWA 4ZOAA 5HHVH 4TSBH 1Z2KA 5GSVA 4GO6B 4LAJH 1BQLL 2EIZB 3KPQB 1RUKL 3D1MC 4NJ9L 1HH6B 5FOBA 1A9EB 3WNMA 2YPLA 2CK2A 3NZHH 3ARED 2Y06L 1W2KT 3QUMH 2NMSA 1OB1A 3ULUL 4XI5C 4U1IA 1JWSB 1T3FA 1CE1H 3KPLB 1IGYB 1A4JB 4R2GB 4XPHH 1T22B 3MUJA 3TV3H 1BPVA 4U1MA 3BSZH 2C1PA 1D5XA 2R1XA 4ODTL 5HVHB 3FT3A 4V3EB 1SM3L 3KYOB 4O58H 3V5KB 1JNLH 1KG0A 3TPKA 3CGTA 4Q97A 2W91A 2XQYK 2V7NB 4PJ9B 4M8QA 3H3PL 3S9DB 4U1GB 1F8TL 3IXTB 4FFVC 3GK8L 1I9JL 4WTZA 1TQBC 4PRHD 2W0PA 2ICWA 1CICD 2IBGA 3IGAA 1CR9L 1JZ4A 2IAMD 3SGJA 4BSVA 1LHZA 4F3FA 3QO0B 4XNUL 4HS8L 4YNYA 3G9VA 4FP8L 1BVLB 2BVPB 1IFHL 4PJBB 3VFPB 1R3LA 2PYEA 2H26B 4DTGL 3SDXB 4DGVH 1A3RL 3FQUA 4GRWH 4JN2A 4BQ9A 5DJCA 2AAVA 1Y6KR 2XY1A 1U8QA 2VLLA 5SX4H 3VWKA 5DHVH 1MJJB 3RWHA 5TQ2L 4CBPA 5KG9B 1EVUA 1HDMA 3S36X 3LHPH 1F3DH 5D7IE 1BMGA 1S7UA 1W0VA 3AREB 5I2IA 5SWZA 4I2XE 4DKDC 4NHCH 4P59L 4X4ME 1A1NA 4P5KA 3BRFA 4U7SA 3MRQA 1ONQB 4PJ5D 4LASL 1FG9C 4IS6B 2YOCA 3DSFL 1MCIA 1I1CA 3BT2L 3TO4C 2WBWB 3KAAA 4OD2A 1D7FA 3MCLL 1UYWL 5JXEC 4WUKH 2IFFL 5EC2A 4H8WL 3BP6A 4HX1A 1LDSA 5HI4C 4G8IA 1IZJA 3MOAL 3TNMA 3O2WL 4PY7B 4PRHB 1KNOB 1XGTA 1CICB 3LRSA 2A83A 1UZ8B 1HYSD 2IAMB 2Q87A 1V5JA 5ICZB 2UZYB 4Z7VA 1WTLA 8FABA 4QXTB 2JF1A 1LK2A 2EDNA 4GBXA 1T20A 1G9NL 3QIWC 43CAA 3CK0L 5CWSB 2CKBA 4Q0XL 4WEUD 4QWWC 3OL2A 5FB8B 3ZYZA 4XP6H 4XXDA 2ARWA 1L7TL 1G6RH 3TBSA 5CEZH 3ZE1F 4JKMA 3Q3GA 1MRCL 3TBVA 3TNNA 4LLUA 1QLRB 3C60C 35C8H 3L3DB 2QQKH 1T5XB 2Q20A 3DMMA 1NDGB 4M43L 2ADJA 4G6AC 2C3WA 3HI1B 1NCDL 4ZTOH 2Q7NA 4UNVA 4C83A 4G43B 2VLKD 4L9LA 2MQ0A 3O2DH 1FP5A 4KPHH 2FSEB 5E08H 2Q8AL 1QZ1A 4LLVB 4LKCA 1I1FB 3GJFA 3HC4H 4MXQA 2WINA 4PJ5B 4RCAA 5J1AB 1U91A 2ADFH 1C8PA 5DFTA 3ARBC 4S1DC 3EYFA 3EUUA 3V8CA 3V95A 2H32A 2O5YL 3HE6A 1V3JA 4TVPE 1T83A 3UJJL 3VFUB 1NMCB 1E28A 2I07B 1I8KB 4IBLT 1I7TA 4OFDA 4XCFH 2XA8L 3SDYH 3CZFB 2Z4QA 1QFUH 2D0GA 5DMKA 3E2HA 2HTLD 3GO1H 3QFJA 2Q8BL 1T0MB 1TZIA 2G75B 3BP5A 3CLEH 3GMLB 4PLJC 4Z6AT 2FO1A 5MP6H 3QCTH 4UUJB 4X9IA 3C8KA 4GT7A 4ZPTB 1AR2A 3GSWA 1JWMB 2YPLD 4KVNL 3ZHDA 1E27B 3OXSB 1AY1L 3QWOB 3DO7B 2FJFB 4FZ8L 1FZJB 4UV4L 5GGSA 2A6IA 2WBKA 2E7MA 3BZFB 1OAQH 1CD1B 1Q9LA 1T89C 4XNYH 1OCWH 3GMPB 4CVWA 4ALAL 1WZKA 4L9DA 4XWGH 5CD3B 5IKCA 1BGXL 2CIKB 4HXAL 2WLZA 3MLXH 3WIHH 2P45B 4QLRA 1IC7H 1HINH 3ZTJG 4HH9A 1CU4H 2VLKB 4JFDA 4XCEB 4OLVH 4JFHD 4D9RE 2YD1A 4Z77B 5AUMA 3MLRL 3GMNA 5I74C 3U48A 2UUDH 4LCUB 2W92A 4LLDA 1F00I 1I3RA 2B4CL 1P7KA 5DQJB 1F3JB 4PREA 3HNSH 3WUZA 1P4IL 3BDYH 1BVKB 2E8YA 3G6DH 5FK9B 2OTUB 4I0KA 1QBMH 4NO0A 3R1GL 4N5EC 5C0AA 1DANU 1EHAA 4LSTH 4DQOL 4MQ7A 5FO7A 2YSSB 3OR7B 1FORL 1MJ7L 1BLNA 4JKPH 1NJ9B 5T3XD 4DW2H 3PHOA 3D0VB 3OPZH 3LEXA 4J23A 2X1QA 4HMCA 4OCRL 3VWKD 4AYFA 1UXWA 5GSVB 3UYPA 1CWVA 1IGIL 4Y0GA 4RISL 5FOBB 2IANE 3LEYL 2YPLB 5SWZD 3V6ZA 1OB1B 1KJ2A 4U1IB 5AG9A 3OBAA 4CMMA 3DUSB 1T3FB 5ILTL 1H5BA 4FXKA 4C56E 4S1SH 4D9QE 1G7JA 3EYOA 1CFBA 1X9QA 3WJJC 2GJJA 3TT1L 4U1MB 1VGEH 2VXUL 2C1PB 1D5XB 2R1XB 3FT3B 3K74B 2AXGA 1KG0B 25C8H 3VD5A 5CJ8A 1OLLA 4OGZA 3OG4B 5HHOE 1A64A 4TPRH 4N0YH 5SV4A 3ARUA 2R29L 4M8QB 4XVJL 3G6AA 4LEOB 4P48A 2NXZD 5L8JB 4FFWC 4XVTL 4I0PA 3BVNA 1DLHA 4YR6A 4O51A 5KSAA 2ICWB 3SDCA 1OTTD 3IGAB 1FYTA 3OQ3B 4U49A 4BSVB 1KB5H 5E2TH 4F3FB 2YMXL 4LSDA 4YNYB 4ZUVA 3K2MC 4JREC 4RBPH 5F7LB 3VGBA 1NMBL 5JXEA 4GBXD 3WBDA 4PG9A 3SJVA 1R3LB 3IFNL 2PYEB 2GFBA 3UTSE 4W6WB 1AC6A 1A3LH 3FRPA 4JM4L 3H7LA 1N6QH 1QRNA 3FQUB 4JN2B 4HK0A 5DJCB 1YEHH 4EDWH 3RVWC 3K4AA 2C3HA 1U8QB 2VLLB 3VWKB 1WZMA 3RWHB 1GGIL 3U9PL 3HLAA 1HDMB 4D0BA 4GUPA 4UT7H 1FGVL 1T2QL 3DMMD 4Y88A 5FHAH 3JWNC 1GIGH 5D7KE 4ORZC 1WTGT 1I8LC 2BRRL 4CMHB 5I1IH 1S7UB 1W0VB 5GRXG 1ZT1A 5I2IB 5SWZB 3DWTA 1X5IA 3FB7A 1QBLH 1WVZA 3BD4A 1IKFL 2F54A 4X7TA 1PW3A 1J88A 4BFIA 1HIMH 1T7YA 1U8HA 3OKNB 4AIZA 4MXWH 1A1NB 4P5KB 4OZGE 3C60A 2IG2H 4H0HB 1EA9C 4MXQD 3MRQB 2HT4C 3EAKA 3L3OA 1INQA 1R3IH 4Z7NE 3QG6A 4RRPA 4OD2B 5GHWH 1NCUA 4XNQA 5EC2B 3BP6B 3UP1A 5CIPA 4LK4A 4YDVA 2NXZB 1K8DB 4HX1B 1EHLH 4O4YH 4G8IB 2MHAA 3B5HA 3N85H 1F02I 3TNMB 1RULH 3TJHC 1XGTB 3LRSB 2DMCA 3RKDC 2A83B 1R5IA 3QFJD 5EFIA 4Z7VB 2AKRA 1TPXB 8FABB 1CT8A 4CN4A 1LK2B 5EOTA 1JF5A 4GBXB 4K7PX 1T20B 3I2CL 5FYLD 43CAB 5C0CA 1EO8L 2CKBB 2VRAA 4HUWB 4ZXBA 3ZDYF 3FN3A 5I73B 4S0TD 4XXDB 5CGYC 1ZLVH 1MCFA 3I6GA 3TBSB 3Q3GB 3TBVB 3TNNB 4N1HB 4KMLB 4LLUB 5EUOF 3ILQD 5I71C 3HI5H 3DMMB 4LNVA 2BFVH 5IK3A 2ADJB 2J4WH 2A77L 1X7QA 3K2UL 3P3YA 2D31A 3U7YH 1OSZA 4QRPE 5F8RC 2CLZA 3V4PH 4L9LB 2MPAH 4JFDD 4NC0B 4KQ4L 1JGVL 4R9HA 4WU7A 2GTZA 2J8UE 4Y2DA 1CLCA 3MV7E 1T89A 1ITCA 4XWOD 3GJFB 5CZXC 2WINB 5BV7C 1U91B 5CP7A 5C2BH 3EYFB 3QI9A 1PLGH 4NO0D 2H32B 4YUEL 3HE6B 5C0AD 1REIA 1E28B 1MFBH 3D25A 1I7TB 3V6OC 4LSRL 3RZCC 3CUPA 1N64H 3IKCA 4OQTH 3EDEA 1AIFA 5EU3A 3QDGE 3VXSA 3U82B 2Z4QB 4KJWC 4UZGA 4M5ZH 5DMKB 4X5LA 3L5JA 3HPJA 3F65A 3E2HB 3QFJB 5JUEL 1Q94A 4K9EH 5DK2A 1TZIB 4JR9L 5JHDE 3VWJA 4F7MA 4DVRH 5H94A 3WHXA 3LQAL 4LRIC 1TVBA 4WI8A 3C8KB 4PDCE 2AJXH 1NEUA 3GSWB 4R26L 1TETL 1J10A 5E2WH 3B9KA 3SGEH 1U6AL 4PJFF 1MPAH 2XNAA 2ZCLH 5HYIA 5GGSB 2A6IB 2EXWC 4YXLL 4J3UA 1YPZE 2AJSH 1Q9LB 3GM0A 2V9QA 2P8LA 4YDLC 1YNLL 1C5CL 3GHBL 4N0FA 5IKCB 3HTLX 3NH7H 1OW0C 1S9XA 4HAFA 3N9GH 2C4FT 5B38A 4HH9B 1LP9F 1MY5A 4JFDB 3RUGE 2GQHA 3VD9A 1RFDL 3HR5A 4L3CA 5KS9E 5TE6H 3DGGA 5AUMB 3GMNB 4LLDB 4I0PD 1I3RB 4FG6C 3F5WA 1FFOA 1P7KB 4NPYA 4PREB 2NY0C 3ABZA 3RBGA 1DBAH 5KSAD 5DJ0A 5I1EL 4CADA 3SDCD 3UO1H 4I3SH 1FYTD 4I5BA 1R5WA 4NO0B 3H42H 2R0WL 2PCPB 1ROWA 3BH8A 4N9GB 5C0AB 5AEAA 3ULVC 1NFDF 1FFPA 3NFPA 1YN6A 4XPTL 5JXED 4MQ7B 1T2XA 1T2JA 1CBVH 3SJVD 1RURH 2WUBL 1BLNB 5HI4D 1P84J 3RRQA 4A6YA 4AEFA 3PHOB 1AXIB 1QRND 3LEXB 4JQVC 4FTVE 5C6TL 3LY6A 4LCWE 3DROA 1UXWB 3BXNA 1WSST 4OLWH 4XRCA 5CJQH 2BOBA 1JIBA 1ZA6A 5E6IC 5JW4M 5D7SL 3RTQA 3EYSH 5HDBE 4GAJH 3V6ZB 5EUOA 1KJ2B 3W5NA 5E56A 4CMMB 5IGXL 5FHBL 2F54D 4HC1A 1H5BB 4PLNC 4FXKB 5C7XH 2W60A 2VXVH 5DJ6A 3I84A 1G7JB 3EYOB 1BIHA 3C60D 4JO3L 5FIEA 5I1GH 3RPKA 4WHYG 3C8DA 1CD0A 1K9TA 4H25A 2AXGB 4OF3A 3V4VL 5DJDA 2ILLA 1YYMH 2BSRA 5HVGB 3LPFA 2XZCH 2D03H 2EEAA 4I3RH 4M7KL 3S97C 3HN3A 3G6AB 2BMKB 5K9QI 1FHGA 5C0RL 2GSIA 3CX5K 1TMCA 1UVQA 3LS4H 3MLSL 1GHFL 4I0PB 5LWYL 4DUWA 3BVNB 1P1ZB 4PJDF 1DLHB 4YR6B 4O51B 5KSAB 2PW1A 5AG8A 3Q6GH 3SDCB 1ZLUH 1FYTB 1DBJL 2XQYG 1TLKA 1C7TA 1GZPA 1FNEA 3R8QA 4ZUVB 1U92A 2G60L 5AZEH 3VH8G 4PG9B 5C0CD 3SJVB 3VG0H 2GFBB 4ZXBD 1IAOA 3CAFA 5EZJA 3ULVF 3GB7A 2CGRH 1QRNB 4QTIL 4U6VL 4HK0B 3D2UA 4TUOA 3MFGB 2QHRL 3ARFA 3HC3H 3WFCL 1QR4A 3HLAB 1XZ0A 4D0BB 5CZVH 4GUPB 4FQ2H 4PJ8A 3GIZL 3BPNC 1DVFC 2X05A 3BN9D 1YEGL 4NGHL 2R0KL 3AAZB 5D7JC 1ZT1B 1ADQA 3FOMA 3FB7B 1B90A 5DLMH 2F54B 4BFIB 3E6FA 1U8HB 2JLLA 3NCYP 4AIZB 1TTGA 3ZE0E 1SHMA 4Y2DD 4LHJB 5F6IB 1U3HC 3DXAA 4NBZB 2XOTA 2MCPL 1HEZA 5J0BA 3L3OB 1GGBL 4BM7A 4XXCA 3N1MC 1INQB 4HG4J 5B3JE 1L9MA 2VITA 3QG6B 4HQQL 4YHOH 3QI9D 4CN6A 2ARJQ 4X9BA 4XNQB 5CIPB 5BRZE 4YDVB 4ODUA 4ZNCD 3CDYA 1Y18A 1HQRA 4L4JA 3LZFH 3VXSD 2XIDA 2MHAB 4RGMC 2G5RA 4GG6E 3MGTA 1IT9H 3MRKA 4XT1C 4QXGH 4Y4HA 1IAMA 1R5IB 1RJZA 3O6LL 3VWJD 4TSAH 5CJBA 4K2UL 5IP4A 3DVGA 2AKRB 1CLYL 4WDIA 1CT8B 2EDFA 2CO7B 5EOTB 4G80A 4XMKL 4F15B 5D5ME 5C0CB 4S10A 1YECH 4ZXBB 1PYWB 4GAGH 1GXEA 1FFRA 3B9KD 4YHZL 1BIIA 4NHUA 3BDBA 1M71A 5DD1H 3I6GB 4YBQD 3AROA 1NGPL 2BNQD 2R0LL 2HMIC 3L1OH 1JCKA 4FFYH 5IK3B 2I5YH 3R0MA 1X7QB 4EOWH 2D31B 2DBLH 3L3GA 3MRRA 4MQXD 1LGVA 1ZTXL 4WY7H 2CLZB 4WFFE 4WWKA 1F3RB 4Y5YC 5K93A 5AWNL 4GG8A 5DRWA 4TUJB 2GTZB 1E4WL 2I9LA 4Y2DB 4ZTPH 3L3JA 4KRMB 4L4TE 4TOYL 5DT1H 5K9QG 4C58B 5I8OL 1JHKH 2F5AL 4WCYH 5CP7B 2R4SL 4G59A 1AXTL 3S36H 4N8PA 3QI9B 5T3ZH 3RNQA 2E5EA 5HHNA 4FMFA 2FJHA 1L6ZA 1OVZA 4GRMA 3D25B 1MREL 4LU5H 3CUPB 4I1NB 4JE4B 5A2JH 4G6ML 3IKCB 5C0GA 1FO0A 4UOW1 4JFFA 4P4RA 3VXSB 4R97C 5FM5M 5ITBH 2OCFD 3HPJB 1K6QL 2A9NH 2IC2A 2GCYA 2W9EH 1Q94B 3VWJB 5DK2B 3FHQA 4F7MB 5D2NA 5EOCL 1YUHA 5H94B 3WHXB 1NCAL 1TVBB 4LKXA 4DN4H 2I26N 2O5XL 3BPLB 1PX3A 5CLTA 3OAUH 5FKAA 3RTQD 5EBWA 4YFEA 2BHYA 5FDYA 3B9KB 1VADA 2XNAB 4AH2A 4DFIA 5LGJA 3MCKA 3ZKQD 2W0FA 2DD8L 2P8LB 6CGTA 1I3GL 5IBUG 4P2QE 2QHLA 4LVNC 2XTJD 1S9XB 1FPTH 5EZLA 3WIIH 4M6MH 4RMWA 3VFGH 5B38B 4PJBE 4OV6F 3C5ZA 5ID1A 4HIXH 5IESL 4HWBA 3HR5B 4K71C 4OLEA 4L3CB 4EI5C 3DGGB 2FATL 4JO4H 5IB3A 4ZUUB 4PGBA 3BQUC 4ENEC 3F5WB 1FFOB 3L5WA 1L7IH 4NPYB 1OM3H 1U8PA 2HT4D 5I0DA 4GRWF 2RIKA 2AJVL 4CADB 1Q1JL 4I5BB 5J6GA 1R5WB 2BVTA 4K3DL 4D9LL 1O5DT 3BH8B 2FX7L 4V1DA 2DQHH 1FFPB 4YHIA 4EBQL 3NFPB 1YN6B 4LVOB 5IVXF 5C86A 4NOFA 4A6YB 3MA9H 2DRUA 4OIIL 5LQBL 1BOGA 2IALA 3S34H 5IFAL 3D2UD 5D70L 3DROB 3BXNB 3ARFD 3CFEA 2BX5A 4XRCB 2E6QA 1YJDC 2BOBB 3IU4L 1A7RL 4PJ8D 1OP9A 3VRLF 1ZA6B 4EI6A 4KMQA 3PWNA 4NNPL 4Z8FH 5EO1A 2MMXA 3RTQB 1QP1A 4ZOBA 1PKOA 5EUOB 2B1AH 1OTUC 3I3EA 3ZLQC 1F58L 4YHKH 1NGYA 1MFAH 2W60B 5TFSL 5DJ6B 3MPCA 4PRHE 1IC4H 3DXAD 2DIBA 1UACH 1JRHH 2IQ9L 5ADOL 4JCMA 4H25B 3TYGL 4HCRA 2XTJB 4GMSH 5DJDB 5C0FA 5KVDH 1MH5A 2BSRB 4LVHB 1D5MA 1BWWA 2IPKA 5GRVK 4OZFG 3EOAA 3ZE2F 5E0QA 5GS0C 4EVNB 1CGYA 3B2VH 4EQ3A 2GSIB 2J88H 1TMCB 3GSUA 1IMHC 4EQ2A 4JZOA 3CXDL 2D7QA 3NFSL 4G5ZH 1LILA 3HMXH 2PW1B 4XCCL 1AD0A 4Y4HD 5JORA 1WAAF 1A7PL 3HAEH 4R3SA 2DL2A 2HWZH 4X80L 5IWLC 1S3KH 1GZPB 1LQVA 1FNEB 3OG6B 1V05A 2YUXA 3QUMA 1U92B 3DRTA 4E9LA 3WYRA 3U4AA 2ATPB 2VDKL 5CINH 1RZKH 5D1XC 1IAOB 5E5MA 4BH8A 4WFGD 3U4BL 4S0UC 5EZJB 1WJ3A 1V7NL 2PO6A 4KJWD 2EKJA 1ZE3C 3D2UB 4TUOB 4LCIH 3TEUA 4XPFH 3ARFB 4HK3J 2K7QA 4PJ5E 1XZ0B 3GSNH 3TVMC 2RCSL 4PJ8B 5ESAA 1GC1L 2Y07H 1EGJL 5HGAA 4MB4A 1MJ8H 3TZVA 1E4JA 4YHNA 5CFHA 3ZDXF 4ZFZA 2BOCA 1XAUA 4ZFFA 1P6AB 3CLFL 3PGFH 4WWKD 4OM1H 5IR1A 3FOMB 2VLMD 3OXRA 3GRWA 4FNLH 3E6FB 2MFNA 1BECA 4NFBA 4H20L 3FB8A 1UJ3A 1E4XL 4LSPL 3DXAB 1A22B 1J9CT 5FFLA 5I8KH 1HEZB 3TT3H 5I6XB 4RGNC 2IPUK 4ZUWA 2VITB 3THMH 4PRIA 4NM4L 5I1CH 1BJ8A 3W0WA 1TJGL 2GY7B 1F13A 2W07A 4ODUB 1Y18B 1HQRB 1W8NA 4JFFD 4G42A 5LCVH 4XHJD 4PJXF 4ODHH 4CJ0A 3MGTB 3MRKB 2NY0D 4Y4HB 5IB5A 3O81A 3HFMH 1RJZB 1MQKL 3QUXA 3DVGB 1H15A 4WDIB 4MJIB 2DMBA 4PGEA 1DBML 2ZUTA 4G80B 2DJSA 3ULVD 2NW3A 3EYQC 2VLKE 1ETZA 3MOQA 1EAJA 3IF1A 3M8OL 3RA7L 3WNNA 4V2BA 4JGMA 4NHUB 3QFDA 4LLYA 3IDNA 3CFIC 1H8OA 2BVUA 1BFSA 4D0DA 1VPOH 5I9QC 4L1DA 4GH7B 3MRRB 3L3GB 3FTGA 4KTEH 2EIDA 4FHBD 4XP4H 3D39A 4WWKB 4MJ4A 3AUVA 3CVHH 1OD7A 1YEFL 3C5ZD 4GG8B 5DRWB 3HI6L 4Y16C 1NBVH 3DX6A 2I9LB 1B0RA 3L3JB 4PS4H 4KDVA 4O9HH 1LDPH 1B2WH 1INEH 3S98A 3CNKA 2LAAA 4LQ1A 2XPGA 5DYOA 2DQUL 3RNQB 4EUPA 1A7OL 2X4QA 5HHNB 2IF7A 2FJHB 4L4VA 3WEXB 4MCYA 2P44B 2H1PL 3O8XC 5I15L 4V1DD 2YPLE 1U93A 3TBWA 3O41A 4MAYC 4ONFH 1WAAA 1FO0B 1X6NA 4QRTA 4MD4A 4JFFB 5C0GB 4M3KB 4P4RB 1S8DB 4J12A 3BMVA 5IT2L 4UINL 2NY0B 3Q2CA 2GCYB 2Q6WA 1JUFA 4ZS7H 5BZWA 5D2NB 1YUHB 4ZAKC 1MNUH 1JGLL 4S1RH 2Z8RA 4LKXB 2D0HA 2FYYA 3NTCL 4WI3A 5FKAB 5EBWB 4YE4L 5IQ7H 1VADB 1FJ1A 4JFHE 4EDXA 4AH2B 4NC1C 5LGJB 1RJCA 1E6JL 3MCKB 4PGJA 3QIBA 2W0FB 2EDDA 4PGCA 1HKLH 2Z92A 3LS5L 4OCWH 3T2OA 3HNVH 3MGOA 3MRBA 2AP2A 1GL4B 5EZLB 1S7VA 1G7QA 1SJXA 4XC3H 1YNKH 4GMTH 4YDKL 5F9OH 1NC4A 2ZOLA 1NGZB 3C5ZB 3Q48A 5ID1B 4GAFB 1JTTA 4K7PY 3MLYL 4YBLC 1ORSA 5T3XE 2VC2L 5IB3B 1CFTA 5DWUH 5ACMA 1FE8H 4PGBB 3L5WB 3O3BA 3W2DH 5CD5D 1FNFA 1U8PB 1F2XK 1WV7T 1S5IH 5HGGS 3QXAA 5J6GB 1YQVH 2DQEH 4QRUA 4V1DB 4PJXA 4YHIB 1TDQA 5SWZE 5IHUL 5E4EB 4PG2C 4NRXA 4HUKB 3WV0A 1F4YH 1BOGB 2IALB 3RX5A 2PO6D 1WEJH 4P2OA 1XGUA 5TE7L 4MXVE 1UM4H 3C2SA 1KCRH 3CFEB 1V8HA 3WIHA 3MYZA 4EI6B 3TZVD 3PWNB 4UDTA 3TN0C 1E4KA 2F5BH 4D3CH 1Z3GL 2APBA 5EO1B 2AW2A 4WHTA 3F62A 2P24B 3FQXA 3QHFH 3BAEL 3DO3A 2OQJA 4TNWF 4LHUG 1SVCP 4G6KL 2NY7H 1Q0XL 3IB4A 5BXFA 1NGYB 1DR9A 3T3PF 2W0LA 1LMKA 4PJIA 2CIIA 3UDWA 4GQ9L 4NT6A 3MSPA 2HT2C 4HKZA 5C0FB 1MH5B 3ZKMC 4PRID 2ZOKA 4X6CF 1RMFL 5CHNA 5CBEA 1D5MB 2IPKB 4P23B 2PYFA 3W0WD 1RAMA 2R2HA 3EOAB 5B4MC 2O5ZH 4MDIA 4X7FC 5L88L 3MLPA 4NQTA 3GSUB 5B8CC 4Q9RL 4JZOB 4KKLD 2Q76A 5DD5L 5F70A 2MWCA 2FX8H 3RZWA 4J3OC 1AD0B 1EEZA 2ATKA 5JORB 4R3SB 4JPWH 2KBGA 4AIXA 3QUXD 4OUOA 3ZHKA 4OLXL 3QUMB 3DYPA 4P9HL 3B83A 3UZQA 4I18A 3K81A 5E5MB 5J13B 4BH8B 1KXVC 3INUL 4ONGH 4KKBC 1D5IL 2PO6B 3K0WA 2EH7L 1NC2A 3OB0K 5D72L 5LG1A 4BQCA 5A2FA 5ESAB 2YRZA 5HGAB 3U30C 3E3QA 3TZVB 4YHNB 4HFUL 2BOCB 2X9WA 3ARXA 4ZFFB 2MQCA 4DKEL 1MCKA 3D39D 2XWJA 3GDBA 4M6NL 5IR1B 5D1QC 3X3GH 3SCMA 3OXRB 1RVFH 3S96A 1MQ8A 4X6FA 4U6YA 1FZOA 3FB8B 1UJ3B 2FBJL 3VH8A 3OV6A 5DVMA 3HZVA 1RZ7H 3QFJE 4MJ2A 1KB5A 4ZUWB 5L0QB 4PRIB 3T0BA 3TH2T 3V0WL 4ZO8A 4L4VD 3O4LA 5ANMA 3C5JA 4MS8C 3W0WB 4KMTL 1PG7W 5FYLE 3O6FC 4FABH 4Y4FC 3STLA 3UTZA 3O3AA 4Y16A 5CEZD 4G42B 3RVXC 4LSVL 1QFWL 4U0RB 2LTQB 3B6SA 4ENED 4LBEA 4Q58C 4XMLL 5IB5B 4ODXA 3NABH 3QUXB 2M1KA 2NW2A 4PGEB 2ZG2A 4JHAL 1UQSA 5GS2H 2NW3B 5HBBA 2ERJC 5MHSD 3N1FC 5DMIH 2C1OA 1ETZB 4MAYA 2AEPH 3IF1B 1AFVH 1WC7A 4JFDE 3T77A 3B8SA 4D8PA 1T5WA 1DANT 4LLYB 2Z31A 4HUMB 3IDNB 4XVSH 1C12A 1ZT7A 2FGWH 1K8IA 3QIBD 5JW4Q 4D0DB 1F6AA 1KJVA 3ZTNH 1DBKL 5EU7C 5JOPD 4G8EA 4FQIL 5DS8A 4NDMA 1CLOL 1YEJH 5E4IA 2FHCA 3BKYH 1A6UH 3FTGB 5CCKL 5DD3H 5C0AE 3D39B 5D96B 1NAMA 3BP4A 3G08A 3V52H 2YPVL 4KQ3L 3DX6B 3IFOB 5H2BA 3GBNH 3PP4H 1B0RB 2DIAA 4FQLL 1QUNA 1MCBA 2JTDA 1MAKA 4FRWA 1FGNL 3SQBA 4WHYH 3U0PA 1JYNA 4XPBH 1FNGA 1J05A 2XPGB 5DYOB 4EUPB 2X4QB 4R7NA 4L4VB 1FNHA 4MCYB 1SQ2N 2FJGA 2XWBA 3MV9A 1U93B 3TBWB 2BVYA 3O41B 1IGMH 1WIOA 3U46A 2NZIA 1B6UA 3PWUA 5JPMA 2IH3A 4QRTB 3WFBL 3WD5L 2KQNA 4MD4B 4P2CG 4N8CH 4PB9L 4ZO9A 4URTB 4P2OD 5AZ2L 2Q6WB 2FH6A 1JUFB 4G6JL 5BZWB 5K33A 2NX5A 1VEMA 3J7HA 5LBSH 1UM6L 4JY5L 1RUQL 4R4FH 3U6RA 4OM0H 4NQEA 2FYYB 3ZSTA 1N7MH 5DMGC 3SDAA 4OZIF 1AGBA 1FJ1B 3QDJA 4MVBA 4OLZH 4EDXB 1T1WA 1KCSL 5HDQL 1XIWA 4QF1A 5EORL 3KJ4C 3QIBB 3RVUD 4PGCB 1FBIL 1ZEAH 1HOCA 2Z92B 2ZZUT 2FD6H 1JE6A 1FYTE 2MQ3A 3MGOB 3MRBB 1H3WM 5ID0B 3BIKA 2ZPKL 1S7VB 1OTSC 1G7QB 3GI9L 4OQTA 5IJKA 1NC4B 2ZOLB 2VXQH 3SJVE 2OL3H 4UILL 3T0VA 4XMPH 5AAMA 1ORSB 1QKZL 2LVCA 1QRNE 1CFTB 4KY1L 5T5NG 3O3BB 4UOJA 1OAYH 4NWTH 3SDDC 4RGND 5FYJH 4QHMA 3QRGH 3QXAB 3WLBA 4U4BA 3C87A 4ZOEA 1K4DA 2B1HL 1QFWM 4JN1H 4QRUB 3SOBL 5BVPL 2DTMH 4PJXB 2CK0L 1VFMA 4PD4K 4XB8A 5F7NC 2BVEA 3IDXL 4NRXB 2F54E 4M93C 1BQLH 2VO5A 4NJ9H 1SY6H 4P2OB 1XGUB 1FNSL 1NC2D 4TNVK 5HHXH 2DQCL 4UDTB 2DQJL 1N5YL 4WHTB 3ESVF 5GIRA 3FQXB 3T4YA 2OQJB 4M61A 4PGDB 2CKBL 5BXFB 4NOBA 4NCDA 1OAKH 3S6CA 4BFBD 1SM3H 2B2XL 4IRZL 4NBXB 2PN5A 4PJIB 2CIIB 2OP4L 4MJ6A 3RWCA 3WUWG 4NT6B 1MFEH 4HKZB 5K9JL 4IM8A 2ZOKB 4NUGL 4XB7A 5CHNB 3EIFA 5CBEB 3VXOA 3GK8H 3O4LD 3VD7A 2PYFB 4HJJH 4MDIB 5C0CE 5HDOA 3UZEA 1U42A 1A0QL 4Y16D 5HYSA 1CR9H 1D5BA 2CPCA 2Q76B 3QULA 3X12A 5KSVA 1P7QA 1AQDA 4HS8H 4FP8H 3UBXI 1EEZB 2ATKB 2EDHA 1IFHH 4RDQF 5J56B 4Q9CA 5BZDA 4DTGH 1GSMA 3TA3C 4UT6H 3P40A 1A3RH 4AEHL 3G6JF 1WUNT 4I18B 1I1RA 4MAYD 5C08A 4M7ZC 4CJ1A 4JG1L 4DZBA 4OFVA 2Z31D 2CRZA 1NC2B 4U2YA 3MXVH 1LEGA 2VQUA 4XNMA 5C0NC 3RAJL 1E4XI 3FZUD 1HILA 2AGJH 4OZIA 2EDJA 3UTOA 4UTBL 1N59A 4J3SA 1GYAA 2XWJB 2CDFA 1KCVL 4G7YH 5FYLL 4R8WL 3SCMB 2H3NA 3VGGA 4F9LC 3S96B 4LASH 4X6FB 4U6YB 3DSFH 3VXSE 1FZOB 4WFHD 1QOKA 5JW3H 4DKFH 3MX0A 4MAUL 3VH8B 3ZHLA 4TTDD 3EO9L 1S9WA 3S3SA 4Y89A 3HZVB 1UYWH 3UAJC 1KB5B 2IFFH 4H8WH 1Z6JT 4F57H 4PBWD 3PIQA 2VSCA 4IRJC 3O4LB 3MOAH 5ANMB 3C5JB 3NIGE 1OPGL 3O2WH 5L2KA 1AR1C 3MV9D 4NKQB 1YEEL 3STLB 5E8DL 3MR9A 3O3AB 3UTZB 3VCLA 3MYJA 2DLEA 3H9SA 3LRGA 5HXMA 2JE8A 4Z0XA 5IIEA 2IPUG 5GGTA 1LE5A 3B6SB 1HHGA 4LBEB 5F7FA 3BHBA 2BNQE 1EFQA 4N0CC 4ODXB 5LGKA 1G9NH 2BDNL 1SYVA 3C2AL 2YRPA 2NX5D 2NW2B 2R2EA 4J7RA 4NQED 1UQSB 5F9AC 4GKOA 1KF9B 1MRCH 3QQ9C 2C1OB 3SDAD 3UPAA 4MAYB 5J1TC 1WC7B 1QNZL 4XP1L 4W4OA 4XBGA 3T77B 4D8PB 4WW2C 1T5WB 4J6RL 2NPLX 3QDJD 4MVBD 4M43H 2F8OA 2Z31B 4WVRA 3RX7A 1XIWD 1C12B 1ZT7B 2BXYA 3B5TA 1K8IB 1NCDH 2ENYA 1IEHA 4ERSH 1F6AB 1KJVB 3GJFK 1XR8A 1U8NA 2A1WL 1OAZL 1ZXQA 4K8RC 4NDMB 1A21A 4WI6A 3VXNA 3TBTA 1NL0H 3A6BL 1DQML 1NAMB 1RZKC 4J3XA 4TN9A 1JGEA 4P9ML 2A74A 3BP4B 1X5FA 3G08B 3HHRB 5IBTL 1WIUA 1KJ2L 4KHTH 3WS6C 5B21A 4WIQA 5H2BB 5EOCJ 3FO0L 1F4HA 4MLIA 1JYWA 4HH8A 3UJJH 3SKJL 3U0PB 2H45A 1FNGB 1J05B 2HT2D 3HS0A 3LKQA 4LDEB 5C9JA 3ZKMD 1QBBA 4KKAD 4R7NB 2XA8H 1CVSC 2VWEC 1UGNA 4HIIA 4OZFH 2D0FA 5TJWK 1R24A 2FJGB 2XWBB 1A9BA 1CGTA 1CTOA 3MV9B 5JIPA 3U46B 5EUOE 3PWUB 2IH3B 4Q2ZA 3G5YA 5DJ8A 3HG1A 4IOFC 4X6EA 1RIUL 5BW7C 1I1YA 3WO4B 3F12A 1KULA 5BMFL 3G6JA 5MI0C 4KVNH 5CAYB 2NX5B 2H2PD 1AY1H 1P7HL 2ZCKH 3QHZL 2XTJE 1IKNA 4FZ8H 4AG4H 3U6RB 3RY6C 1IM9A 4NQEB 3BGFC 2Q1EA 3SDAB 4GAYA 1W8OA 2EE9A 2OI9C 1G7PB 3CSPA 4HIEA 3QDJB 2EXYD 3KPNA 4ZFGL 1T1WB 4ALAH 5D8JH 4WNQA 1XIWB 4JO1L 1BGXH 4OGXH 4DGIL 2FCBA 5TPWL 3DBXA 4WW2F 2OMNA 1HOCB 2RJMA 1N4XH 5EU5A 4CU7A 1RUAH 2OS7A 2A38A 3BIKB 3MLRH 4YHML 1RD6A 5CUSL 4BJLA 2YWYA 2J3SA 1QACA 2X4TA 3O3DB 4RFNC 1BJ1H 1Q38A 3MLVH 4P5TA 3IDMA 4M00A 3JTTA 2JELL 1P7QD 4RMQA 3BZ4A 1RHHA 3OTTA 3CMOL 4DQOH 5B39A 5DEZA 3FO1A 4QHMB 2YRLA 3WLBB 3S35L 3MLWL 1FORH 3PXHA 1CN4A 1K4DB 4X5XB 4OB5H 2QADC 4PY8I 4OCRH 3KLSA 3DUHA 5C08D 3WFEL 3ALXA 3BIAX 5J1SC 4RISH 2X4NB 3DXAE 4NM8L 3JWDL 1DSFL 5L8KB 2MTPA 4WFED 5DD0H 1CVRA 4F7EB 4Z95L 4KZEL 2A6KA 3QYCA 5ILTH 5GRYA 1F4XH 1J1PL 5D1ZA 2Z8SA 2VXSL 5GIRB 1FIGL 3T4YB 4M61B 1TQCC 3TT1H 1QSEA 2VXUH 1EJOL 3MUGB 5GGUA 5F6HI 5F8QC 4MJ6B 3RWCB 1YYLL 2YA0A 1NFDE 2YZ1A 4XVJH 2Y9RT 3MTRA 1DN0A 4XVTH 3VXOB 1QHOA 3BUYA 5I1HL 5D71H 3S88L 4LSUL 1ZGLM 5HYSB 2NTFB 2X41A 3ZZ1A 3H9SD 2IJ0C 4WFGE 1D5BB 1PVHA 4NHUE 3QULB 3X12B 5KSVB 1P7QB 4X6DF 2YMXH 1AQDB 2MNUA 3PG2A 1JPSH 3V2AR 3TYFA 3GSOB 1NMBH 1QD0A 4HJ0C 1CIUA 2X9YA 5BZDB 2I27N 1KN2L 3C6LC 4YBHA 3RFZC 4Z0BL 2JJTA 1VA9A 4ZD3L 3RNKA 1GGIH 5C08B 3U9PH 1IGTA 1RY7B 2VLME 2A2QT 1GGCL 1FGVH 1T2QH 5C71A 4DZBB 1U8IA 2X6MA 2BRRH 2XZQH 1LEGB 5DJXA 4XNMB 4HS3A 3D3VD 3PWVA 1OHQA 2VZVA 3P9LA 1HILB 2R1YA 1LO0H 3MNWA 5EWIL 4OZIB 3L95A 4WO4C 1IKFH 3C5SB 3SHSA 1UKQA 2QSCL 1HHKA 5DMGD 1JK8A 5KSUA 2QV2A 1FLRL 2CDFB 4PJDE 2H3NB 1LVEA 4JFFE 1KUMA 1DLFL 4ODBD 4PUBL 1KJMB 1OAXH 4NZTL 3HAEA 1S9WB 1CFNA 4JFEA 2W9DL 5D2NE 4ZO6A 1Z9OA 2KL6A 3PIQB 3SE4C 3NGBC 1HCVA 4JKLA 3C8HA 2V5MA 3UCRA 3ULVE 5L2KB 2NYYD 3MR9B 5DHXB 3VCLB 2BC4A 4G8GB 3MYJB 1VFAA 3CFDA 3H9SB 3HG1D 4Z0XB 5IIEB 1A6PA 5DR5L 3OJ2C 4POYA 1LE5B 4IEFB 1HHGB 3GGWA 3BHBB 4Y19A 4S2SA 1W72A 1JVKA 3I2CH 5I8EA 3RDTA 3SDDD 1EO8H 1MRDL 1SYVB 3KHOA 2I60L 2VUOA 3C9NA 1VESA 2VDRH 2R2EB 1IQWH 1IM9D 1U3YA 2IANA 1DFBL 4XBGB 1BQSA 1NFIA 1BQHA 5L9DL 2YD6A 2A77H 2JJSA 3K2UH 4A6YL 4CU8A 4XNZC 3U83A 2AJZA 4WI9A 1XR8B 1U8NB 2CKNA 3B4NA 5T3ZD 1S78C 5TH2A 5GZNC 4KQ4H 1JGVH 5F7KC 3WFZA 3VXNB 3TBTB 1DTUA 1YY9C 4V1DE 3IFPA 1JGEB 4H1LH 4BH7A 3ULSA 2A74B 1C16A 2ZUUA 2GYSA 1J1XL 4HC1L 4P5TD 2OZ4H 2WUCH 1WBYA 4YUEH 3EDFA 4PGZA 2AI0H 4JGUA 4LSRH 4XAWL 1F42A 3HS0B 3LKQB 1X5HA 4TTGA 5C9JB 2GHWB 4MB5A 4OD1L 2E7BA 2ICWI 1R24B 1A9BB 1RV6X 4NKDA 3GMOA 3WXWL 4X4YA 3FB6A 3FQWB 5JUEH 4Q2ZB 2PXYA 4JR9H 3G5YB 5DJ8B 3HG1B 3UTSA 4LEXH 4X6EB 3AMKA 2NY6C 4LPUA 3LQAH 1I1YB 4BFGA 1IVLA 3F12B 2E7LC 3WCYA 4R26H 3FFCA 3G6JB 4JGJA 5F96L 3U4EB 1U6AH 4MD0A 5A40E 1IM9B 4PJCF 1BBDL 3KG5A 4YXLH 3CVHA 3LN4A 3KLHC 4GAYB 5D1ZD 1YNLH 2VB5A 4HIEB 3GHBH 1C5CH 1QSED 3KPNB 4OKDA 3GKZA 4OD3L 4WNQB 2Y6SC 2Q86A 3QIUA 1I7ZB 4HLZH 4K3GA 4JVPA 4WTXA 3DBXB 5C0ND 3P2TA 5EOQL 3OMZA 5EU5B 3WSQL 3K8MA 4GKNA 4IRSC 4J4PC 2JCCF 2QLVB 3RIAF 2I24N 1ZHLA 1ADQL 3P4OA 5I1EH 5ETUA 5EB9A 2QQLL 3AC0A 3L9RA 2JJVA 4P5TB 2Y36L 3RX8A 3IDMB 1GOGA 2R0WH 3JTTB 2G5BA 4GW1A 1OP3K 3BW9A 3BZ4B 3HA0A 1RHHB 3QAZC 5FO9A 5KJRH 4XPTH 3GZKA 1EO5A 4APQC 5B39B 3FO1B 1JNNH 2WUBH 3PP3H 4YDIL 2BSTA 1ZS8A 1F2QA 4LRNL 3WJLA 2R0ZL 1FSKC 4IDLA 1JBJA 3STZA 4R0LC 4UAOC 4P49A 5ERWA 2DQIL 1HN1A 5CSGA 1EDQA 3CJJA 4WHCA 4N0CD 5D7SH 1T7VA 1DQQA 4LLAA 3A67H 1CZ8L 4AMKL 1M05A 1DBBL 2A6KB 4PRIE 4P3DB 5FHBH 5IGXH 2CSPA 5F6HJ 2HVKB 4O2FA 5IBLC 1J12A 5TF1L 5SWSA 3EOTL 5HI5C 5D1ZB 1LWRA 3W0WE 3QQ9D 4JO3H 1KELL 1QSEB 3GIVA 1KT2A 4GRWE 5JIIA 4JFQA 1BQUA 1UKTA 3MBEC 1ZLWK 4BKLA 5FDWA 5GGUB 5DEGA 2B8OT 4JRYA 4PJEA 1QYGL 2X4SA 4P3CH 3VDAA 4HBCL 5ITFA 4MMZC 1B0GA 2DQGL 5ESQA 1J0HA 2OX5A 4JFED 2NY4D 4JHWL 3RU8L 2CMRH 1DN0B 4LSQL 5LWYH 1P5UA 5GGVL 1A14H 1V3MA 4KKCC 4WTZG 3QXDA 2OMBA 2CJUL 5D7LA 5HJ3A 3O3EA 3WO3B 2F9BT 1DBJH 1UEYA 2ZUXA 3QDGA 4E0RA 2JIXA 1VCAA 4LHUB 1U8MA 3TYFB 4BA8A 4Y19D 3O9WC 2R56L 3X3FL 2G60H 3UC0L 1S9YA 2I9TA 3NCYS 2YC1A 4OT1L 2BERA 4WJ5A 4QTIH 4U6VH 2YHGA 5EZOL 4OCXH 3D39E 5J4MA 2QHRH 1S7TA 2IAND 3RNKB 1WCQA 3KR3L 3G5ZA 4OCLC 1IGTB 3WFCH 4L8CA 3QWQB 3GIZH 1DQTA 4IOFD 5E2UL 1I1AC 1FO0L 5GSRA 4LMQE 2VAJA 1U8IB 1JI2A 3P0VL 1YEGH 4NGHH 5DJXB 2R0KH 4HS3B 3PWVB 1T66C 3GHEL 3P9LB 2R1YB 3MNWB 3L95B 3ZE2E 1C5DA 2EIEA 4EXKA 4L4VE 3QUYC 4U3CA 1HHKB 2F74A 1JK8B 5KSUB 4JHBA 2GSGA 3ULVL 5DO2C 4JAMA 2MCPH 5DVOA 3RUGA 3P4MA 5EUKA 1T04A 1GGBH 3LIZL 4HWZA 5FGCB 1WAAE 5CEZE 1ZK9A 3AVEA 4QOKA 4HQQH 3T0EA 3QP3A 1KEGL 5GGRY 4O00A 4HXBL 3HAEB 2JCCA 3LMJL 4NQDA 4WEBL 1CFNB 4PJGF 1RZFL 3VE0A 4JFEB 5HHPA 2NY4B 5FM5O 1KBGL 3QZWG 4HFWA 2QSQA 4FA8A 1D3CA 3WN5A 3TJEH 4UMGA 3TCXA 2BC4B 3SY0A 1VFAB 3CFDB 3O6LH 2PXYD 4HWBL 4K2UH 3UTSD 1F6FB 5L8LB 1CLYH 3GGWB 1QSFD 4Y19B 3ZDXE 4S2SB 1W72B 2WBJC 5I1DA 3RDTB 5I8EB 4RWYL 5JOPE 3FFCD 4XP5H 4PD4J 5DRXA 4JZJA 3C9NB 3KLDA 3ARDC 4AENA 4HF5L 4QRQA 4B7IA 1DJSA 1H3XA 2IANB 5CJXA 4FQXA 4J1UA 2R0LH 1A4KA 2ARJA 1NFIB 4M7LL 1BQHB 1SEBA 3VGHA 3BZDA 1NCBL 3MOBL 4L8SC 2O61A 3QIUD 5KVMC 3MV11 2AJZB 3MXWL 4JQIL 3I6KA 5TH2B 5AWNH 4U1HA 3OAYH 4JFOA 4KXZI 1E4WH 4KJQC 3JWOL 5E6YA 2AEWA 3IFPB 4PJXE 1B4JL 4F37F 4BH7B 4TOYH 3ULSB 1TJHH 1C16B 1RUPH 5I8OH 2E8ZA 2F5AH 1B9ZA 2R4SH 2FEDD 1AXTH 3EFFA 2ICWJ 4ODWA 4BQBA 4LGRB 1WFUA 1WBYB 1DUYA 1EFXA 4AT6A 2UV3A 1MREH 3AB0B 4DOHB 3VI4F 4HCRL 1CQYA 3SQOH 2XV6B 4JEGB 3W9EA 4NKDB 4OUUA 1ZSDA 1K6QH 5JQHC 3GMOB 3D5OF 4X4YB 1G9ML 3FB6B 2PXYB 3TF7A 5EOCH 5GJSL 3UTSB 4X4XA 5FUOH 1NCAH 4UQ2A 4YGAB 1DP0A 4PJIE 2IGFL 2YUZA 4H8WC 5GS1A 3FFCB 1J8HA 5FV1L 4MD0B 1I9IL 4HKBA 3QDAA 1U3JA 2HTKC 5SWSD 1AHWC 3CVHB 3LN4B 3QUML 3ARGA 5EIIA 5DQDL 1I3GH 4KI5C 2BRQA 5GRUH 2Q86B 3QIUB 4MD5A 4XPHL 1G9NC 4JRYD 2D3VA 1IC1A 4P57A 3BSZL 1OAUL 4U1LA 5DI8A 3EDJA 4RGNE 4PJAA 5DVLA 3E6HA 5IESH 4GKNB 5C3TA 2FATH 4RFEA 2VUYA 4AIOA 2FRGP 5FGBA 3S37L 1EPFA 3JBG7 5FYKD 1ZHLB 3P4OB 5BRZA 5ETUB 5D7LD 3L9RB 4LP5A 3GRWL 1Q1JH 4BZ1H 4M9OA 4K3DH 2BNUA 4D9LH 2G5BB 2JIXD 4GW1B 4EIGB 5I18L 2OM5A 3BW9B 3O4OB 5FO9B 4X5WA 5I1LA 4EBQH 5KN5A 2DLFL 2FO4A 3QH3A 5J7CC 3E3QE 1OOAA 2BSTB 1P9MC 5LQBH 1ZS8B 4OIIH 5IFAH 4OF0A 3STZB 4MJ5A 4DGVL 3LKNA 4PTUA 5ERWB 5FEBA 3IU4H 1MFDL 4Y5VA 3DOSA 2IH1A 4AL8L 1M7XA 4OCYH 4NNPH 1VERA 4M48L 1BM3L 3WFHA 5LVEA 3MZTA 1PAMA 3LHPL 1O0VA 1M05B 1ND0A 5HI3D 4O2FB 3CX2A 5SWSB 3L7FA 3O4LE 5ANME 3LB6D 4MSWA 5TFSH 2ZUWA 4YHPA 1EJ6A 5ADOH 1S7WA 3GIVB 1KT2B 4HZAA 4JFQB 3TYGH 4OGAD 4WGVB 2XICA 4BKLB 4QOKD 5FDWB 3T0ED 5DEGB 2YKLL 3MV7B 4JRYB 4PYGA 4PJEB 2X4SB 5ITFB 3OHXA 4NQDD 4CNIA 1S78D 1TZGH 1B0GB 5ESQB 5I76A 5INDA 4WGWB 2BVOA 2ORBH 3CXDH 3MRHA 3NFSH 2BHZA 5J12C 1I9RL 3QXDB 5D7LB 5HJ3B 3O3EB 1A7PH 2APTA 3L5XL 1HHJA 1SY6A 4X80H 1N8ZA 3D87B 1TNMA 3QDGB 4KK8C 4E0RB 3OKEB 4OI7A 2JIXB 3QUZC 4HD9A 1KCLA 2AJUL 3M07A 1U8MB 2Y5TA 3MNZA 4PIRF 2APXA 1EXUB 2VDKH 1OT2A 1S9YB 3RQ3A 2I9TB 1MCEA 2WP3T 3SE3C 3SKMA 5JW4N 3NGBB 1PX4A 2YC1B 3U4BH 2AS5M 4WJ5B 2B4CC 2VXTH 3P0GB 1V7NH 2E27L 3FRPG 3T3PE 4XX1E 1S7TB 4LLWA 3UJTH 2V5RA 4FQXD 1MVFA 4QYOA 3G5ZB 4ZO7A 3IAGC 4L8CB 4XP6L 2RCSH 1GC1H 5A2KH 1EGJH 5CEZL 4WFHE 4JM2A 3HCVA 4NSKA 35C8L 2YD9A 1WT5C 1NGWA 2QQKL 4AY0A 2Z8VC 3CLFH 5ESVA 1JZ2A 1AI1H 1C5DB 4P2QA 1YQ2A 1J0KA 4ZMAT 2ZJSL 4H20H 1BFTA 2F74B 4YDJA 2GSGB 3MV9E 2NY1C 4JAMB 1EMTL 4KPHL 5E08L 3RUGB 3P4MB 5EUKB 3PNWA 1T04B 4HWZB 1X6LA 4JFYA 2ZG3A 5J57B 4PBXA 3GMMA 4QOKB 4F7TA 3T0EB 9CGTA 2JCCB 1EFXD 1TJGH 3QG7L 4NQDB 4RRPG 2J5LC 4KRNA 3VE0B 3NIFF 4PP2A 2NLJA 5HHPB 1RU9H 3QPXL 2NX5E 3RP1A 5DTFA 2P46B 3VD4A 1J8KA 4NQEE 4NN7B 4HFWB 2PR4L 3RWGA 3WN5B 4XCFL 3VRIA 3SY0B 1MQKH 3QDJE 1FFQA 4O02L 3BPOB 3ERYA 4KJPD 4HEME 3DETC 4K94L 3VI3E 5I1DB 2GITA 1J8HD 3CSYA 4KDTC 3M8OH 3RA7H 3JUZA 5DRXB 5MP6L 4JZJB 1ZVSA 1AH1A 4AENB 3V79C 4QRQB 4NZJA 3PUCA 4FQXB 4YGVA 2VABA 4J1UB 1D9KC 5DJYA 3GEWB 1A4KB 2ARJB 3ARGD 1XGQA 1SEBB 3S35X 1OAQL 3W39A 2O61B 4EXPX 4XNYL