3QUKA

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 altered peptide ligand (y4a)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
275
structure length
262
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNRTDSPKAHVTHHPREVTLRCWALGFYPADITLTWQGEEMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics.
pubmed doi rcsb
source organism Mus musculus
total genus 60
structure length 262
sequence length 275
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qukA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3qukA01
3PDOB 3TZVC 4HC1A 4X8XA 4ODSH 2E27L 2JCCE 1YNKH 4PRHA 3MOBL 5TDOA 1GGBL 3DVIA 4XCEB 1OF2A 1U3HB 3U6RB 1RUQL 3IXAA 5HHMA 1EUTA 3AAZA 2YUWA 3CC5B 2EDQA 4PRIE 3OG4B 1QKZH 3G6JF 4JFPB 5K9JL 2H32B 3X3GL 2OR7A 1AO7D 1U3ZA 4PRDA 3QFJA 4TULL 4O4YL 1UACL 4Z7NE 3UJTL 5F7LB 4PLOB 4KKBD 5DFVD 5FDYA 1OD7A 1SM3H 2OSLB 3F62A 1JGUH 4PFEA 4APQC 5DMJB 1TETH 4Y8DC 1N59B 3BXNA 5ESVB 5C0IA 5FYLE 3JXAA 1AGDA 1TVBB 4IMKA 3SDAC 2CO6B 35C8L 4HG4K 4MAYA 3A67H 1FFOB 3ZT7A 2A38A 4KJPC 5IBTL 1BBJA 2VDLL 2AEPL 5FA4B 3VFUA 1MLCB 3D3VB 4G6AD 3VFNA 1NDGA 2NYYD 3QIUB 1CFNA 4KVCL 4QHUA 4PJ8B 1L8JA 3P0YH 3QEQE 4H25B 4LLQA 3P2TA 4JN2B 3SCMA 3DTXB 3MZGB 5ISZA 1J0YA 5DA0B 1RFDL 1CQKA 1DQDH 1KJ2L 1RK1B 5DJ8B 5GGRY 5JDJA 5HI4C 1F3JA 1GGCL 3G9VA 3SPVB 3DX9B 2B4CH 1G1CA 2IPTL 3GMRA 1N3NA 1CFQB 4LKXB 4P57A 2X4UA 2P44B 4TNVF 2C3VB 5LG1A 5KZCD 4G5ZL 4G6KL 5TE4H 1XGRA 5LAXB 4CVZB 4M1GH 4PJAA 4Q9RL 4HUXA 4M6NL 1PZ5A 3GJFH 2IGFH 3IGAB 2ITDA 2PR4H 1BLNA 3WFEL 3BZFB 4GQPH 3RVVC 4P48A 4PRPB 4UB0H 1EEZB 4MWFA 4R3SA 3MRKB 1YMMB 1ZANH 3WFDL 2Y36H 4RMRA 4YFLF 1IAOA 1QRKA 2I9LB 1YNLL 1A6TB 1XGPB 5FIEA 4OT1L 5D7KD 3QQ4A 3BQUC 3GRWL 4O2FB 2VZ3A 3TJHC 5D93B 4ZOBA 1HDMA 1FYTB 1NUNB 3QDJE 2ADIB 4OUUA 2HAZA 3MGTA 4M6MH 3CX2A 1S7WB 3UTQB 4ZUVB 1H8OA 3NGBC 2G5BA 4PJHF 3ILPB 1ONQB 4JANB 5IVXE 3UPAA 1QSVA 3WJLC 4DN3L 5JPMA 2W92A 2LVEA 3BW9A 1YYLH 3MO1A 4NHUB 1LP9B 3V6FB 2F58H 5MENE 3B9EA 4F57H 4NQDD 4YPGB 1CDJA 1HIML 4UUJB 4AEFA 4MA1C 5MEOA 2VIRB 1W72B 3LEXA 3G08A 1CFVL 3FONB 1IL1A 1JGDA 4XPFH 2A9ML 4JDZB 4P3WA 3IDXH 4DEPB 1T2XA 2XZZA 1RV6X 3QUZB 4RFOH 4Q2ZB 1U8HA 3U4EB 4JKMA 1M71B 4FZ8L 5F9JA 4I9WE 1F6LL 2AV7A 4FNLH 2D0FA 1H3PL 4UV4H 4D0CA 3RRQA 3TJEH 1E4KC 2GT9B 3EJYD 5I1HH 1AQDB 3IDMA 2YPVL 1A6AA 1H3UA 1IAMA 1FO0B 1U8MB 2JCCF 4NNPH 3WFZA 3HKFA 4NUJB 2MCPL 1M7DA 3E3QA 1A9BA 2NY5L 4F9LA 4XMLH 3N9GH 3HI1B 3IFNL 2VDOL 3KPPA 2YKLL 3PJSA 4LCUB 4ALAH 5E0QA 4KXZH 2VLLB 4YDVB 3IB4A 4J4PA 4P46B 4XBPA 5D8JH 1IGYA 4Z7NF 4P2RB 3WS3B 1BVKA 5C08E 3GIZL 3O81A 3GHBH 3DYOA 2AJUH 4ETYA 4PGJA 1N5AA 2O61A 1CGSH 3WHE1 4JFFB 4D0DA 3SE3C 5DHXB 1QR1A 4U6XB 3CH1B 1DN0A 4J3XA 4QRRE 5HHOB 1ZA6A 1WBXA 2CXKA 4N9GA 3R06A 3Q48A 3D87B 4XMPH 4YK4C 1ZHNB 1KN2L 2QBWA 3GJFA 4G9FD 5F1KC 3X13B 4GBXA 4JGMA 1GOFA 3QUYC 4YDIL 3ERYA 2V17H 2OI9C 1PYWB 3TIEB 1NCWH 5GZOC 1JVKA 3CH8A 4TUJA 4M8QA 2FLRT 2DYPA 2H8PA 2J88L 3GO1H 1A7OH 3IJHB 2XFXA 3EJZD 1J86A 2E9IA 5BW7A 3MRQB 2DF3A 5TQ2L 3WD5H 3V0WH 3JTTB 2BRRL 3I2CL 5J7CC 3DRQB 4PP1C 4O9HH 1SHMA 2I27N 4F33B 4YHOH 3G5ZB 4ZPTA 4TN9A 4L3CA 2EIZB 1T5XA 3RGVB 1MCBA 1OB1B 3QT2A 3QULA 3GJEA 5FKAA 3BKJH 3U0PB 1I3RA 3V4VH 3TP4A 5JIHA 4PTUB 4E5XA 2E7HA 2X4QB 1Z9LA 3G5XB 4OCRH 1X3DA 4UNVA 3QJHB 3VRIB 1U8QA 1L0QA 2PNDA 1OGAE 1KC5L 2XIDA 1G9MC 4DGIL 1X5KA 2H1PL 5GSVA 4MNGE 3QO0B 4U1NA 1WWBX 2VR5A 1E4WL 4X99B 3L5WA 3MJ9L 1S5IH 4X5WA 1I9JL 3NFSL 4U6YB 2WWKT 4G8FA 2PETA 5FGCE 2EEBA 1P69B 5KSBE 4MCYB 4LVNC 1JWUA 4WFHE 4O2CA 1MVUA 1QFOA 4JRXD 5A2FA 5CZXC 1OY3B 1OAXL 1HYRC 4K8RD 3MLVL 4O58H 4Y16B 4AIOA 5CJ8A 4OBSA 1OWRM 1BX2A 1XZ0A 4HW6A 3O6LH 4KH2A 4M62L 1F6AA 4IBLT 5I1LB 3LKQA 2VDQH 4NWUL 2R4RH 3O4LA 3T2NL 5T1LA 2Q6WA 4KQ4H 4ZS6D 1GOHA 1YY9D 4PY7A 4F7PB 5B3NA 3RWFA 1DCLA 3IS0X 5F7EL 5DA4A 4PY8I 4D8PB 2NY0B 3HZYA 3PWJA 3S36H 1FGNH 4NO5A 3E0GA 3UP1A 1QNZH 2HMIC 3SDXA 1PSKL 4KU1A 3MNVB 4U1HA 1TENA 4OCLC 3S88L 1YEFH 3ECBB 3LH2L 1RJLA 1KIRB 2PO6D 1PEZA 4R2GC 5F9AC 1FDLL 2V6HA 1K4DB 1W72L 2O5XL 3SEPA 4XCNA 5J6GA 5HPMA 4NN6C 1C16B 5EO1B 3ZE2F 2RR3A 5HDOA 1QFUL 3EO1B 5CJ5A 1JZ4A 1AO7A 3JV4B 4R4NC 1IZJA 2LABA 5EZJA 1IZKA 2Z8VC 1AQKH 2X7LA 4G80B 5F6IB 3OAUH 2AI0H 1MCKA 5AZ2L 1E6OL 3L5HA 1CI5A 4JCLA 3GIVB 1T83C 4IMLB 3DV6B 4RGOL 2PYFB 1EIBA 1WBYA 2G2RB 4B41A 1MCRA 2WY3A 1CFBA 5BO1H 1M05A 2R9HD 3OHXB 5DWUH 3V0AC 1IVLA 1PBYA 3EDJA 5BZWB 1Y0LB 4LF3B 3S35X 4PP2A 1KNOA 3ARSA 3DVNA 4I0KA 5KVDL 4RNRA 3TPUB 2PW2A 1DUYA 1BM3L 3RVXD 3QUKA 3MCKB 1MCOH 3VI4E 3QUXC 3U7YH 3LQAL 3AY4A 4WDIA 4QRRD 3LSOA 2CK2A 1L6XA 3ZDYE 3MCLH 3UBXB 4FQXD 5E24E 4PP8C 1QPXA 3MYJB 5TQ0L 3AMKA 3UROR 5JTWA 3P0VH 4XHQA 2ZCHH 3EFFA 2BNQE 4ONFL 4IRSD 1YECH 4FFYH 1KLGB 1H3VA 5HYSB 4Z6AT 4PLJD 2A9NL 4HCRH 3HNVL 5I66B 2BNRA 4R0LC 3ZZ1A 2AEWA 3MV7E 4PYGA 4KUCF 4S1QH 3KR3H 5E6ID 2R15A 1HILA 1KIUA 2QLVB 1CGXA 4FXGA 2AXHA 3BPLB 4C83B 4OD3H 2CIKA 3GMQB 5B38G 5DR5H 5ITFA 1WT5C 3PUCA 2HRPH 5J9PA 5IG7B 1S7XB 5CSGA 4MS8C 2BERA 3BE1H 4KUCD 4P2CG 4PG2A 3TA3A 4OLUH 2GFBB 2QSQA 1JV5A 2Z8RA 2R29L 1A2YA 2VXUL 3NH7H 5EFIA 5HYJB 4UQ3A 1HNFA 1CDGA 1YN6B 3CDGB 3SDCB 5I18H 2D7QA 3UTSB 5HYFA 3DO7B 5GJSL 4KJQD 4IOFC 4X6CA 3VFRA 5KSBF 3AC0A 4JFQA 4OCSH 1S9YB 5IW1B 5GISL 5TE7L 2Z31C 3RVWC 1NFDA 3MRCB 1R0AH 5HHME 2QKIB 4XC1L 1B88A 2YUZA 4Y1AB 4MJIB 1X5HA 2DWEB 4R7NB 4E41B 4OZFB 3VXSA 3RUGA 4MDIA 5BOPA 2NXYD 2YRPA 3BUTA 2GJ6D 4OZHE 4BM7A 4RMSA 5JR1H 2PTTA 1Z3GL 3QCUL 4ORGA 5DI8A 3BT2H 2P8LA 2OR9L 4U0QB 4NKOB 2XKNB 5C0BA 4XP5L 3MXVH 5DJ2A 3SGDI 3GNML 3HUJB 5GIRB 4BQCA 1F4XL 5JHDD 1JPSH 3KS0J 4P23B 5EZOH 1X5GA 2D7TH 4I0CC 5EU4B 1TQBC 2XZQH 4PJXE 4I13B 2HWZL 3IDYC 4S1RL 3REVA 3S3PA 4WU5B 3FRUB 1UB6A 5E2WL 5B38A 4YQXL 1IGFH 2J8UF 2Y9RT 3I50H 4XNUH 5EOTB 5T1KD 3VG0H 1RU9L 4MXWL 1NAKH 1C5CL 1EEYA 4NO3A 5I1KH 3GMPB 3TFKD 3B5GA 5ISZE 5JOFA 3V7AE 1I8MA 4HWZA 2FHBA 4LHUB 2R2HB 4H20L 3BPCA 4NC1E 3UEZA 3KNBA 2BOBB 4UINL 1A4KB 4ODVH 2FR4B 3N50A 5LGJA 2SEBB 1KIQA 3EOTH 5JOEA 3JWDL 3FO1A 4U1GB 5JPNA 1R5VB 4I5BA 2X4PB 3D85A 4KPHH 4HCRA 5C0JA 2W0FB 3BDYH 1NGPL 3R0NA 1OP9A 5GGTL 3GSQB 4KMTH 3ULVE 4Q6IA 2ED9A 1QLEH 1INEH 2PXYD 5HDQL 2YZ1A 4EN3D 2MQ0A 5KSAB 3OKDB 4N8VB 3NCBB 3VFGH 1I4FA 4I1NB 5C0CD 1MHEA 1U3HC 1LO0L 4KZEH 4JY5H 1GHFH 2F9BT 3RPKA 1U8LB 5JLZA 3VI4F 2P8PA 4JPKL 3O6FA 4ZDHA 1OT1A 2ZG1A 3H3PL 1WVZA 2C1OA 2IQAA 5GGSB 3U9PH 5I1GL 4MLSA 1HI6B 4TSBH 1NANI 4UT6L 1YEDB 4NZRL 1UVQA 3M45A 1EFXD 4M3JA 5DEFB 2BXYA 1FAKT 3IYLW 2QR0A 4X6EA 4XI5D 1CFSA 4X6DA 1HKLH 1SY6L 1AE6L 5I8KL 4HFWA 1WUNT 3PGCA 1D5ZB 4P4RA 3DUSB 2ICWJ 4U2YA 5DDHA 5GS1B 1X5IA 3W5MA 1FVDB 2YBRB 1G7MB 4X4XB 2F19H 4JKLA 5D7LA 3S5LB 4UT9L 1S9VA 1I1AC 3L3OA 5JHLH 4G59A 5DYOA 2VXQH 2JELH 1BBDH 1RVFH 1PFCA 3QUMB 2D9QB 4HZLB 3QIUC 4Z95L 2HLFD 2X5PA 3H42L 5JIIA 4PJ8C 3HCVA 3OZ9H 5J57B 2A6JB 1NGQL 1EZVY 5F3BB 4JHAL 1K4CA 3OKLB 3E6FA 1J0HA 1DQQB 3V7MA 1BF8A 1LO3H 5DVMA 1UH3A 4MXQC 3MBED 2D31A 3KPRB 4AEIH 1RZ7L 4HJ0C 3RY4A 2FJFB 2VQ1A 2BVPA 4JRXA 4GXVL 4J3VA 1BZ7A 2ZKHH 3X17A 5T3ZE 5EOQL 3E3QE 5E8NB 3MRPB 2DTMH 2ZPKH 1WITA 1GRWA 4Z7VB 5KVGL 1A4JB 2W07A 3NZHL 2D7PA 1ND0A 3SGJC 2ARJB 4MB5A 4JO2L 4X4MA 1S5HB 5I1IH 1DDHA 4Y4HC 4OZHF 2C3XA 2EE3A 2OL3H 5IVOA 2EYRA 3TO4B 4JY4B 1IILE 4Q9CA 3TN0B 4S0UC 4G43B 3OR6A 1X4YA 4XZUB 5CKAA 1NJ9B 3VXTA 1OTUC 1S7TB 2HT2C 3GSNL 2ICEA 1E4XH 5K59E 3J8F7 1IKFH 2D03L 2Y06H 4PG9A 2YZ8A 3SDDD 2IH3A 4LDLB 1KBGH 1MCPL 4M6OL 1NGZB 1AGEB 4KRPD 4X7TB 5DJYA 2D7NA 2DQUL 5C0RL 5L8LB 4CMHB 4PJXF 5DT1H 3P73A 4HPYL 5T1DH 2ADGA 1KTDB 1AXSB 1Z6JT 4OFYD 4F7CB 3F6IA 4S2SA 4L4TD 1KXVC 1UEYA 3MUJA 1BD2D 3QAZC 4Z76A 1I7UB 3NIFE 4N0CC 1D5IH 4GRMB 4Y4KB 1IGIL 1UENA 3EYVA 4KDWA 4P4KA 3V6OC 4RWYL 4HH8A 5DMKB 3B3IB 2DDQH 5C0AD 2CDEA 4Y88A 5ERWA 4NQSB 1CLZH 3QPQC 2HJLA 4JM2D 4M7LL 1MRDL 4OLZH 3QUZC 3CLEL 1AXTL 3V0VA 5C6WH 5KTEL 3ARGD 4P2OB 2AJVL 5BZDB 5TGBA 5GSRB 3IDJA 3IFLL 3ULVF 3UJJL 5F6HI 3D18B 1A47A 5ENWB 2PCPA 1NCDL 1I85C 1Q8MA 1IQWH 3O6ML 4JFXB 4DUVA 4WWKA 3L3DA 3KYMB 4Y2DC 4MQXC 3T1FB 4XNQB 3ULVD 5EZLA 3UO1L 1P2CA 3ARFC 4YEFA 5HD8C 2WBJB 2C7UB 4G7VH 1NGYA 1AI1H 3MRBA 3O2WL 3D0LA 3TVMB 5IB4A 3BGFB 4K71B 4OD2B 4Y5YB 3PWVA 3N1PC 4LBEB 3LZFH 4LOUC 2D4FA 4YC2C 1FV1B 1O7SA 4LCCC 3DX7B 5T3XD 5GRUH 4PV8B 1T1ZA 3VDAA 4JKPL 4KHXL 5EB9A 4QRPB 4BUGA 3QI9B 4ZFFB 1IGCL 4U1IA 5KS9A 3EYQD 3ARQA 3AS3A 3D2UD 1EJOL 1PLGH 5I1EH 4ZXBD 5DJZA 3K8MA 4H1LB 5FM5M 3U46A 3ABZA 3T08A 5D6CA 1J10A 3L9RA 2X44D 5E6IA 3IVKA 2FO4B 4OAWA 3BGMA 5JUEH 4ACPA 3O3EA 3L5XH 5HGBA 4HS3B 2MHAA 2CSPA 1G7JB 4QF1A 4ZAKD 1TZHA 2XTJB 1JYXA 2OL3A 1JGLL 5EU7E 5IJKA 7FABL 2MKLC 2X70A 1UEMA 5T1MB 2ESVD 5AEAA 1DSFH 1RJYB 5HYIA 1KEGH 3V52H 3NABH 2OJZL 1ZA3B 2R23B 1RHHA 5SV3A 1A7RL 3O0RH 1KT2A 4NN5B 3SE8L 3SDXE 3ULUH 1MAKA 2P5EA 1JN6B 3W39B 4JQIL 4MD4A 2JIXB 3QUML 4HS8H 4IS6B 3U2SB 5DS8B 3WS6C 2I26N 5IFJB 3ZKXC 4R6UA 3V4UH 1IJ9A 1K8IB 2DS4A 4OI9A 1SEBB 4MMZC 4XCCL 1OOAA 3CXHJ 1SJVA 2XQBH 5IR1B 4LPCA 2YPLE 4WRLA 2FX8L 5AWNH 1MRCL 3IFPB 5C7XH 3IU4L 2AGJL 4WU7B 1KIPB 3FN0H 1KTRL 2GJ6A 4XGZA 1OSPL 4YZFE 5GS0L 5EO9A 1NCTA 1JFMA 2CK0L 1P7KA 4L8BA 5FYKU 1R3LA 1NLBH 1A22B 3GMNB 1RZKC 3DARA 5IGXH 5FCSH 1KEML 2H26B 3AS0A 3C5ZD 5LCVH 4JZNA 4F7TA 4QOKA 3MGOA 4L4VA 1OAYL 3I9GL 4FN0A 5IEHB 3KDMB 2MSPA 3CNKA 4MB4A 1UKSA 3QDMA 5K59F 3E8UL 5JZ7D 5HY9B 1E28B 2APFA 3B9KC 2OTUA 4U1SB 2B0SH 1UWXH 4WFFE 2R2EA 1WBZB 3FT3B 4KFZC 4N68A 4EZMA 4Y16C 1IGJB 5FFLA 3ZYJA 3P11H 2I60H 3K2UL 1R3IL 2F54B 3TFKA 3OKNA 4P5TD 3VA2C 1CN4A 3ORJA 3TBTB 3CCHA 1V3KA 3NBNA 1NH6A 4YWGL 1BEYH 4X5LA 4C54A 32C2B 4M1DL 3CVHB 3UBXI 3GFUA 1LEGA 1NCBL 4YHKH 4JZJC 5DGQA 4ELMF 5B4MC 3EYFB 1GIGH 5D1QC 5C09B 3UTTA 3JWOL 1LVEA 3FQTA 4NHCL 5CIPA 4OM0H 1RUML 2FX9H 5EPMA 2D7MA 5K9OA 1FYHB 4H8WC 4WO4C 4HBQA 5LQBH 2F53E 3C60D 1D9KA 3H3KA 3SKUD 1JUFA 4BH7B 3C6LB 3EAKA 1NCCH 3K8LA 1WIOA 5FO7B 1EBAA 3L95A 1F4WH 1FN4B 3QG7H 4GUPB 4NO0A 4UAOB 1T1WA 4K7FB 2DRUA 3D6GA 3MV11 1LO5B 4RMTA 4X0KB 4Y7MA 3VJ6B 5AZEL 5HBBA 2R1YA 3VWKA 1UYWL 1YC7A 1IARB 3HZMA 2G9HA 2DQDL 4FQ2L 1I1YA 4PRHB 1EFXA 2DIBA 1VA9A 3ARDB 5TFSH 5KVFL 3MV9A 1EXUB 4GW4B 3MLRL 3AAZB 5I6XB 4GG6F 2EC9U 3FQRA 3THMH 3MA9L 3VWJB 1NFDE 2GSGA 4PRDB 3QFJB 5E8PA 3ROOB 1FIEA 5EWIH 2I07B 3SKJH 4KAQL 3ULSA 1D5XA 1PVHA 2BVEA 1JCKA 4P3DB 5DJAA 3HRZB 4YXKH 3RUGE 2V5MA 3AROA 5ALCH 3H9SB 4L8CA 1I7RA 2XWJB 5CS7A 4WI9A 1AHWA 5C0IB 3M1BA 4JHWH 4HUMB 5E6YA 1YPZA 4FQHB 4GAGH 4BA8A 4W4OC 5GHWH 5C0BE 4UMGA 4BQ6A 2J1KA 4BSJA 3OXRB 4OQTL 3OV6A 1T4KA 3B8SA 3KXFA 1N8ZB 3VFUB 1UXWA 2WIMA 5L7XH 4RZCA 4AMKL 1HNGA 3BD3A 4ZNCD 1DLHB 5DFWH 3VFOA 5IMOA 4DGVH 3RWHB 5IB2A 3GI8L 3H9HB 3SCMB 4X9IA 3Q2CA 1K8DB 1KB5B 3U7WH 3L3KB 4B53A 4PGBB 3RWGA 3ZHDA 1DVFD 2LTQB 4U1MB 3HAEH 5E2UL 2Q8BL 4R26H 1L7TH 1J8KA 4MQ7A 4BZ1H 2HFGH 5DK0B 2VLKB 1J1XH 3WKML 2MQCA 1CT8A 5I73B 1WISA 5A2IH 4ZUWB 1W0WA 3C2SA 5I8EB 3BD4A 4KQ3H 2VE6A 2M8XA 4PB0L 5FXCH 3H0TB 4K07A 5E08H 4DAGL 4R90H 3LS5H 2YC1B 4PJAB 2E6QA 2DBLH 4F3FA 4V3DB 2RQ8A 1PZ5B 1HZHH 4JFEB 1BLNB 3SDCC 3WUWG 3KPOA 1QACA 2Z92A 1TMCB 3RWIA 5IMLB 3FRPG 1JTOA 1Y18B 3NN8B 4FQCL 3P4OA 1KJ3L 1YEIL 3NCCB 3WFCH 1HCVA 3UJIL 1DQLL 4JRYA 3N0PB 1T7ZA 1NBYA 3ES6B 3REWA 2Y07L 4LLAA 1MJ7H 1X44A 4NPYB 3HAEG 4Q9BA 4N1EA 4KDTC 1HDMB 2H2SC 3KPNB 4BSWA 4F7EB 5D7IB 2XQYG 1BFVH 4CDHA 2UWEF 3DMMC 5IHBA 4DKAA 4N5EC 5GZND 5D1ZC 4HUNB 3KLHC 4O02H 4X6DE 1XGYL 3BKCH 4HIEA 1QSFA 5C0AA 4U3HA 3BW9B 1XIWB 4CJ1A 1MFDH 4JY6A 5HHNA 1OLLA 4WEBH 1JZ5A 1DBAL 2EDBA 2FDBP 4J3WA 2Q7NA 5FHBL 1WZ1L 1RZ8A 4FZEL 1TJHH 1JGDB 2GK0A 3B83A 1Z2KA 3O2VL 1WGOA 1MAML 2NY2C 4MVBD 1RK0B 5FHAL 3U1SH 3S8WA 3CVHL 1B90A 2UUDK 4H0GA 3B2VL 1A1OA 1I9RH 4FABL 1CE1H 3QIBD 1NC2B 3CFIC 2AV7B 3VD7A 4Y5XA 2F74A 5BV7B 2XTLA 1BZ9B 1TZGL 4OCNC 1WC7A 2EDKA 4URTB 3P3YA 1XGUA 1MJ8H 3RZCD 4ZO8A 5IQ7H 3FRPA 2EZ0D 2IPKA 2VO5A 2AJZA 4JCMA 3NPSB 1UA6H 2EICA 2OMBA 4WW1B 1F90H 1YA5A 4FQLL 2E7CA 2APWA 3IDNB 1KENH 3U9UA 4LGRB 1FL6A 4KZDL 3JTSA 3GMLB 1BVKB 1J1OH 3HAEA 5HXMA 3T0ED 5KSAC 2XKSA 4NOFA 1JMXA 3WJJC 3CZJA 4QNPE 3C08L 1EUUA 2FX7H 3BPOB 4Y4FD 5ICYB 1G6VK 1N5AB 2ICWB 3AREB 3MRGB 3OMZA 4DN4L 2O61B 1MQ8A 43CAA 1LK3H 1RUKL 3IRPX 3WXVL 1F58L 1ZA6B 4JE4B 3V5HA 2R56L 3BD5A 3R06B 4N9GB 5D2LB 3X3FL 2DQFB 3TBSB 4NSKB 4ENED 4QHLA 3PG2A 1S7QA 4CNIB 4P5KA 3B2UC 4LSRH 4I3RL 5GRYA 4FS0A 4NP4H 1J5OL 5C0GA 1T3FA 1QSEA 2BVOA 2AABH 2QEJA 5GS1C 4TUJB 4M8QB 2FHFA 1HXMB 2YWZA 3UAJD 5IWLA 1JK8A 4OD1L 4Y5VB 3NA4A 3FFCB 1GGUA 5I1DB 1OAKH 4PJEF 3ELAT 1AD9A 2VXVL 3ZE1E 1B4JL 1F8TH 1U41A 2OP4H 4YHLL 1ZGLM 5D2NE 3QIWD 1HINL 4YHNB 3U0WH 1L9NA 4DTGL 1I1CA 4H26A 3RL2B 1MSPA 5JNYA 3C8DA 4GKNB 4CADA 3MV8D 1I9EA 3FO0L 4L3CB 1NBZA 5DD1H 5FYJH 2DICA 4YXLH 4ZS7H 4KI5E 1T5XB 1QBLH 4O51A 2EE6A 2NX5B 3KG5A 2R0ZL 4WTXA 5FKAB 4JR9L 2EC9T 4NQTA 3PWPA 2ED8A 3C5ZA 4IDJL 3BX7C 1A7PH 5ICXA 1LDPL 1CL7L 1T20A 1GSMA 2J12B 2KBGA 1RIHL 1KB5L 1JZ6A 3CUPB 3GEWB 1QSZA 2I5YH 4U1NB 4GRLC 1F97A 1QZ1A 2NY7L 3UPCA 1G9MH 2YXMA 5E2VH 3DXAA 2EDOA 5HVHB 5CBAA 4QRUB 4PS4H 4WUKH 1NSNL 5E7BA 4P9ML 2WANA 2HFTA 2W9EL 4ONGH 1AD0B 2DTSA 1EVTC 1FNEA 4IJ3B 1V3JA 2VABB 4O2CB 5I2IA 1MVUB 2DQHH 2ED7A 3QXUA 2GCYA 4ONHA 1ETZB 5C71A 1DBKH 3OGCB 1MELA 5TH2A 3ZDZE 3TO4C 1IKNC 2VXTH 3L6FA 1ZVSB 4MA7H 1AGBA 5KW9L 2WUCH 3MLWL 1I9IL 4OLVH 1KG0A 1SJEB 1KCVH 1W0VB 3GBMH 1CD0A 4W81A 2EDTA 3FTGA 3T0XA 3BIBX 3W5NA 1REIA 4Y19B 3O9WC 4LNRA 2FEDD 3O4LB 2FEEL 2HTKC 2WBKA 4I8DA 4PY7B 1CGYA 2VH5L 3S3JA 3HC4H 5IJVB 4FQQA 4FQ1L 4RWHA 5DJXA 4YAQB 4TNVK 3FQXB 2FRGP 4LSSH 5GGVH 5ABDE 2W60A 1RIVH 4C56D 1BIIA 1RSFA 1F4YL 4NO5B 5IVNA 4R4FH 2ILLA 2VR4A 2QQNH 5F9OL 2DI8A 4Y4KC 4OM1L 1INDL 4UTBL 1WWAX 2ZSVA 5IROA 5CINH 4OB5L 4XCNB 5J6GB 5HPMB 3VRLE 2P5EE 1WSST 3I75A 2HP4A 3HI6H 3PABA 4HF5L 5L6YL 3M8OH 1Q9WB 1T7XA 5A2JH 4WTWA 1AO7B 4YHIB 4KVNL 4P2OC 3DI3B 4E0RA 5INDA 2VQTA 2OI9A 2ZUQC 4PJGA 2QHRL 2V9RA 2FYYA 2X7LB 5FCUH 1RI8A 4YHPA 5F21B 3MOBH 3G6AA 1GGBH 3GB7A 3LKRA 2XV6B 3G6JB 3PWUB 4EI5A 3BYTA 3MACH 5F7YC 1HE7A 1BOYA 1NGWB 1RUQH 2FLBT 4WHDA 3AVEA 5GGQL 4K94C 3KYNA 3ZTJH 4W6YB 5K9JH 5E03A 1D3CA 3NFNA 2VZTA 4NKQB 1VFAB 1TFHA 3CLFL 2NW3B 4TULH 4O4YH 1UACH 4L4VE 2AXFB 4C59B 4CVXA 3BGFC 4PJFF 1JHTB 3LQZA 5HDBE 4OCMC 1S7SA 4Y5YC 3QDME 2PW2B 1MI5D 4D3CL 1I1RA 4MSWA 1G0XA 4D9QE 2XRAL 4M48L 1AIFB 2GJZA 3CFJA 2AJYL 2R8SL 5C0NC 3LIZH 3VFTB 4WDIB 3KLAA 3DYPA 5F9WB 1F4HA 2KZWA 2IMMA 3QI9C 4IDLA 3BVNA 3GGWB 4NRZB 2VDNL 2WV3A 1DVFA 3GBLA 1QG3A 2RAMA 5IBTH 5E1HB 4YO0B 2ADFH 2VDLH 2AEPH 5DHYB 5SWQA 1NDMA 3OAYK 3BEWA 5C1MB 4UIMB 3NACL 5D1XA 4XAWL 3STLA 4M7JH 3FT2B 5DJ0A 2BNRB 2Y5EA 3RKDC 3ZTJG 1S9WA 5DEZA 3WN5B 1QRNA 5KZCB 3ZL4H 5BS0A 3WEXB 1RFDH 4XXDA 3UTTE 3MFFB 5FGBA 4FXGB 3BP6A 2MPAL 4JHZA 2CIIB 1CZ8L 3AB0B 2DJSA 4XVUD 1DLFH 4JFDE 1MCFA 2XOTA 5J9PB 1YNTA 1JNLL 2CRYA 1RURL 2IEPA 2AV1A 5SX5K 4G5ZH 5EFIB 1A2YB 4MNQE 1T1XA 3P9MA 4M6NH 2OTWA 4PJ9A 3UYOD 2I9TA 5DJ6A 4WI8A 4L1HA 1NFIB 2OCFD 1KCRH 2R0LL 4X98A 4X6CB 3WFDH 2FZ3B 5DUPH 4OZIF 2QQKL 4JQXA 3ARBD 3MV9E 2BSED 4ZFOB 1GL4B 3ULUE 3R1GL 3VXSB 1HOCB 4HKJA 2GUOB 3GRWH 2D0GA 4NQDB 5JW4Q 2WWMC 4CU7A 3MOQA 4NWTL 3ZDXE 4NFBA 3VXUD 1FNFA 3SE4A 1BQHA 3TH4T 1BZQK 2PTTB 3WL9A 5DI8B 5LXGL 2LVCA 2E8YA 1GPOH 4FQIH 1AR1D 5DJ2B 1HXYA 4DN3H 4MJ2A 3TPKA 1YPZE 2FGWL 1MEXL 1MH5B 3HG1D 4POUB 5HHQA 5IIEA 2CKBH 1PG7L 3QIBA 5F89B 1CTNA 5ANMB 5HGDA 1HEZB 3KXFE 3MX0A 4PB9L 1JGVL 5IFAL 5IBUB 3PHQA 4HGWA 2BK8A 4HV8A 4JJHA 3VXMA 43C9A 4LLWA 4DZBB 2NXZC 1OP3K 1OCWL 3JZ7A 4CMMA 2R4SL 1R6VA 4WFED 5CILL 4M9PA 4JN1L 5D7JD 3O11A 5JOPD 2IF7A 4NQCA 2LU4A 5JOFB 4FZ8H 4ODWA 2IQ9L 2WINB 3QDGE 5MHSD 3SBWC 3L3JA 1H3PH 5FB8B 5D9SB 2BMKA 1CL7I 3QUXA 1EMTL 3WNLA 1H3WM 3QZWG 3QB7C 5LGJB 2CRZA 1WTGT 1X7QA 3MMEA 5DRWA 1G0YR 3ZKNC 3C6LC 3T3PE 4PTTB 1A21A 3D85B 3IFNH 4UAOC 1KCUL 2VDOH 5FUCE 2F8VA 4LQFL 1U6AH 4Q6IB 2V5SA 5DC4B 1EH9A 4G8EA 3VXOA 1KJ2A 1UXSA 3B6SA 2XWTB 1FJ1A 1I4FB 1WCQA 4G9FB 5GRWA 1EO5A 4KTDH 4EDWH 3GIZH 4R0LA 1MHEB 3I6LD 1HK6A 4R8WL 4NJAL 5JLZB 2OQJB 3EDFA 4WW2A 1ZWIA 2CUHA 2YSSB 1KCSL 3CK0L 2IFGA 2XPGB 1DBJL 2IQAB 1Y6MR 2C4FT 1XCTA 4HAGA 4U3CA 3MLZL 3RHWF 4CAGA 2ZJSL 1MFBH 2H32H 2QR0B 1A7BA 1CFSB 2UZXB 1MQKL 3F7VB 3X14B 4S11A 4YDIH 5DVNA 4AT6B 4P4RB 4N0FB 3W0WD 5IHZA 3BEVA 4IMKC 1Q94B 3SGDH 4OKVB 2BZDA 1QSFE 4MAYC 5BRZE 1QEWA 4WUUA 5F1SA 2BDNH 2RCSL 2Z0BA 4X7CC 2Z93A 3V5KB 3ZKMD 1HN1A 5D7LB 4OSUH 5IV2A 3HB3C 5IT2L 2GITA 4AEHH 4MDJA 3GRWA 2VL4A 4HK3N 4CGTA 4KGLA 4EOWL 5BXFA 3I2CH 4DVBA 2DKMA 4P2QA 4Q6YA 3RTQD 3QJFA 3QZWA 4IRZL 3VFMA 4MD0A 4K7PL 4PJDA 1OD9A 3RA7L 3SCMC 4P0DA 1I3UA 1TQCC 2V7NB 2CLRB 3D1MC 3PL6A 4BFIA 1JWMB 2HKHL 4NC1C 1GGIH 3EW3B 2NY4C 1FNGA 2OM5A 3QH3A 2VLJE 2ZUYA 3T0AA 3S97C 5MEQA 3QWOA 4LU5L 2VDMH 4JFDD 4X7EC 5E8OB 5IM7B 2H1PH 5L88L 2VQ1B 5DTFB 4JRXB 1BZ7B 3O45A 4OGXL 4XNZB 3BFOA 4XP4L 2NR6C 3MJ9H 1IEAA 3S98A 3N85L 4YR6B 4Q9QL 5BVJB 4OGYL 4HEME 4KJYA 1ND0B 4PJCA 5E9DD 5FGSA 3PQYA 4BELD 3KYAA 1DDHB 2YMXL 3C9NB 5I1JH 1XF5A 1WICA 3ZDXF 1T5WB 4KK5C 2VISA 1I7TA 5DRNA 4EBQL 1OAXH 1DE4A 2WIIB 4OZGE 4FA8A 3SQOL 2ICEB 3LHPL 2IANA 1A1MB 4ZFOL 4TUKH 2EH8L 4M62H 3EFDL 1YPZF 2Z8WC 2VITA 4PG9B 4PJ7A 4C56A 2IMNA 2IH3B 2ICWI 3MPCA 3LOWA 4BK5A 2ZOLA 3T2NH 5EU5A 2AK4D 4I4WB 4M5YH 4TUOA 3RVTC 4LARH 4I48A 2PO6B 2ADGB 5F7EH 1FE8L 5DO2C 1QSEE 1U8NB 3PDOA 3EDEA 2DMKA 3UPRB 4RGND 4YBQC 4FXKA 4U0RC 2R0KH 4XCEA 25C8H 4AM0B 1BP3B 4OCWL 3U6RA 1F2XK 3C8HA 3T8XA 1YMHB 4JFPA 1NLDH 3S88H 3HE6D 3LH2H 3TLRA 5EBGA 3ZTNL 2H32A 5C07D 1BREA 2CO7B 2GW5A 5KJRL 1H5BB 2HJLB 4TTDC 3UTPE 1FDLH 4U33A 1Q1JL 2J4WL 1W72H 1XCQA 3FQUB 5J12B 2OSLA 2N7AA 1IC4L 2V9TA 4NZJA 5TGBB 3PWPE 5BV7C 1N59A 1TVBA 1GC1L 5AZ2H 2B2XH 3L3DB 1MI5A 3E3QC 4LLDB 4F9LC 1FFOA 2ENYA 1MFNA 3CZFB 3KYOB 1YDPA 2EH7H 4YPJA 3T04D 4PPTA 1FO0H 2H3NB 1MLCA 3D3VA 4J4PC 4JGJA 3DXAE 3D0LB 4XPBL 4S1DD 5I0ZA 3NZ8B 4LASH 5FECA 4KI1A 3DTXA 5KVDH 1SEQL 4JPVH 4IRSB 5FEBA 3INUL 1BM3H 1OPGH 3CJJA 2J8HA 2VYRE 4UU9A 2BJML 3UYRL 5DJ8A 1S3KL 3LQAH 5KS9B 4HKZB 5C2BL 3MJ9A 3DX9A 5TQ0H 3PGDB 1VGEL 3ARTA 3U46B 4JO3L 1GOGA 3BO8B 1CFQA 4LKXA 4NT6A 5E6IB 4OAWB 5DMYA 3QO1B 4GBXC 4RGMC 4ONFH 3O3EB 2C3VA 4QF1B 1CVRA 5LAXA 4A2LA 4CVZA 2A9NH 4I2XA 4U49A 5BRZD 3RIAF 3SGJA 3BZFA 4PRPA 5I74B 2X70B 1IC5L 3TZVD 1EEZA 5E8DL 3P4MB 4LVHB 2OR8A 5EU6E 5BW7C 4BSVB 2AEQL 1XFPA 2DOCA 1T03H 2I9LA 1A6TA 2IBZY 5CEZD 1KT2B 1XGPA 5EOCH 5EA0L 4PUBH 1X6LA 4LSQH 1DL7L 3VI3F 3A0OA 1MFAL 1X5ZA 5KOVC 5JO5B 2R29H 2VLJD 2VXUH 3WSQL 4HWEH 4NZTL 1YQ2A 4APQD 3EO9L 1K5NB 3ILPA 1ONQA 3ARYA 4JANA 2GJ6B 4XGZB 4UDTB 1J8HD 3SKMA 4PJGE 4JDTL 4KGJA 3SDAD 3VXUA 1R3LB 4NHUA 3T2PA 5GISH 1D5MA 1N2RB 3V6FA 3QHZL 2KUTA 2O93L 2Y7QA 4YPGA 4F7TB 4JZNB 3T3ME 4UUJA 3MLSL 5HVHC 4QLRA 4LP5A 4XC1H 4LCWD 4K3DH 3SY0A 1W72A 4H5SB 1GZQB 1UWGL 4OZGF 1RZKH 5FYJE 3FONA 3UMTA 5JHDB 2BHUA 1IC7H 1LO4L 3HG1A 4K8RL 4JDZA 2WWKO 1SBSL 3WBDA 3NIDF 4IJ3C 4PYHA 3W11D 1C08B 2CH8A 5CD3B 1NMAL 2YXFA 3CPLB 1Z3GH 3QCUH 1DANT 4Q2ZA 3T4AB 1UB5B 4JB9H 3U4EA 1M71A 4NKDB 2R2EB 4WI7A 1AGCA 2KL6A 5T1KB 4XP5H 5HI4D 2GT9A 1UJ3B 2QSVA 5DXWA 5D4QA 1AGFA 1U8MA 4ZFZA 3EHBC 4GAJH 4GQ9L 2X4RA 4NUJA 2IC2A 4LKCA 1Q0YL 1YEJL 4U1JA 5HPOA 2J8UB 1QLFA 4LCUA 4J3UA 3MUHL 5GRJL 3V6ZA 4S1RH 3G04B 4YDVA 4LCIH 1ZTXL 5EU7C 5E2WH 1EGJL 4P46A 2GJJA 1G6RL 5EBLB 1RU9H 1T0NA 3F58L 4MXWH 4S0TD 2ZUTA 3RVVD 1WCBB 3FQTB 4XBEL 5CIPB 1KPVB 5BS0E 2BFVL 2AKRA 5K9OB 4H20H 4HT1H 2PXYB 4I3GA 2N56A 5E1AA 4EN3B 2ITCB 4JFFA 4UINH 4U6XA 5GS3A 5C0CB 3BISA 1DBBH 2EEAA 4H8WH 3D69A 3TJHD 2DLFL 1I1FA 1RQ5A 1BGXL 3GHEL 3OX8B 3X13A 1N64L 4FTVD 4G9DB 2R1YB 1A64A 4UV7L 5LWYH 2EXWC 4KKBC 4UQ2B 5HDQH 1EFXB 5DSCA 2HT3C 3TIEA 2Y25A 2X89D 4ZTOL 1MNUH 3Q6GL 2L7JA 1LE9B 1LO0H 1A3RL 4U05A 1FZMA 2JJTA 2WM0A 3FQRB 1AH1A 3MRQA 1IAKB 3DRTB 5JW5B 4JPKH 4YFLI 3RNKB 3JTTA 1C8PA 2MMXA 3DRQA 2X05A 3TIDB 3BKYH 3H3PH 3OKOA 1D5XB 3ULSB 3IF1B 5I1GH 2F5BL 3L1OL 4P5MB 3BP7B 1F6FB 3G5ZA 4F33A 1CWVA 3WHE0 4NZRH 4FG6C 3T1WA 1I7RB 1IM9D 1JJUA 4KK9C 2VZUA 1CU4L 1TPXB 3RGVA 4PGEB 2NYYC 1SY6H 1P4LB 3EJJX 1QHOA 4GG8B 1GXEA 3RTQA 4P9HL 3ME0A 1PX4A 4NC0B 2G5RA 2X4QA 4PJBF 3AY4C 3QJHA 1U8PB 4KUZL 1T4KB 4XPHL 3IJSB 4UT9H 4ZUSB 3R0MA 3C2AL 4BQ9A 5I76A 1XMWA 3TO2B 2YR3A 5E8EB 4OQ1A 2E6JA 3MBEB 3H9ZA 3KLSA 4U6YA 4WHYH 3PHSA 3VXME 4HEPG 1MCDA 1HCFX 3RWGB 4MD5A 2YA2A 1EJ6A 4BFBD 4DGYH 1NGQH 4KTEL 5EU6D 4GW1A 4MQ7B 4JHAH 1BVZA 2Y72A 3ILQC 4NQCE 4OLWH 3NA9L 1CT8B 5FA3A 1W0WB 4YXHL 2DQTL 1RZ7H 5CJBA 1YEKL 4PG2C 3TA3C 4YNYB 1LD9B 4OLYL 5EOQH 4HWUA 2JKXA 2A83A 3FB5B 5KVGH 2X10A 1MIML 1KXTB 3QUYD 1B3JA 4G7YL 4OCYH 3NZHH 4F7PA 1PQZB 4XBGB 2PYEA 3SDDB 3RWIB 4JO2H 5J1AA 2AJSL 3P9WB 3KVQA 1MY5A 5GZOD 4KRPB 5SWZD 4JFOB 4NCDA 1FP5A 2EIDA 1FNAA 1TJIL 5C3TA 3EDKA 3MNVA 5HYSG 1AC6A 4GJTB 4LPTA 4KROD 3ECBA 4L4TB 1KIRA 2A1WL 5DD0L 5E2JA 5GGTA 1BD2B 1T0MA 1CDIA 2OBGA 4DVRL 2XACC 1MCPH 4M6OH 3RPIB 3VFSB 3V4PL 1C16A 1VFBB 3LKSB 3EOYG 2DQUH 3EO1A 5C07A 5C0AB 4HPYH 3JV4A 4AL8L 4JY6B 4JM2B 1P84J 4H0IA 4P3CL 4HIXL 4G80A 1BJMA 4WUUE 3ARGB 2OZ4L 4WEMB 5CSBA 3GIVA 4IMLA 2DKSA 2GK0B 3IETB 3PWLA 2PYFA 1T1YB 3T65B 5K9KB 1DQJA 2G2RA 4RWYH 4NM4L 5BMFL 2R0WH 5C92A 4P2QE 1SY6A 1RHFA 3OHXA 4WI6A 4ETQB 1R3KB 3LDBB 4PJDE 5BZWA 5I8OH 1Y0LA 4LF3A 4QO1A 4PLKC 2AJ3A 2YUXA 1WAAF 4XWOD 4WFGD 3TPUA 5KTEH 4L3ED 3C6SB 2AJVH 5C0DB 1C12A 1KLFA 4UOJA 3MCKA 3WUWB 2WW8A 3NCEB 3WLWC 1XGUB 1WTLA 4OZFG 3SJVD 1ZSDA 2FO1A 2P48B 3O6MH 3IFOA 3MYJA 1CIDA 4TNWF 1ZVYA 2IPKB 2IADB 4BK4A 3BH9B 5F9DC 3MUGB 3OPZH 4PD4J 1ERNA 3RAJL 3UO1H 1RZFL 4Q6IC 1JPGB 4L9DA 3D2UB 4ZXBB 5HYSA 4GMSL 3TYFB 3TT1L 1H9VA 1YUHA 2DQIL 1T89C 3CFKB 3PQYE 2H45A 2CXGA 3OB0K 1LEIA 5IHLB 1MREL 43CAB 4JKPH 1HHHB 3N06B 1ZHKA 3O6FC 5CJQL 3EYOB 2X6MA 2HMID 1IGCH 4C83A 4BZ2L 4PJIF 5DRXB 1EJOH 3GMQA 2HKFL 2IANE 2ESVB 1CE6B 1NQBA 2W1NA 5F88B 5IG7A 1S7QB 4P5KB 4PJ7E 4R2GD 2L7UA 2W65A 2K3TA 1KTKE 5FOJA 1V7ML 2GFBA 3QG6A 1W8NA 1U92A 5LGHH 3ISWA 1CLOL 2BVOB 4JFYA 4LHUG 5HYJA 1BMGA 3HC3L 3VDCA 2DWDB 3CDGA 3UTSA 4R4ND 3RWDB 3DO7A 3OTTA 1JGLH 5IW3A 4FFEX 1CIUA 4XVTH 3MLUL 3QRFM 4GMTL 1RULH 2VDPL 4MB3A 4J8RA 5CBEB 3MOAH 2BVQA 3MRCA 1MHPL 3HE7D 1A7RH 4CADB 2QKIA 3SE8H 4MJIA 3O3DB 4R7NA 4OZFA 5DD3H 4RBPK 2J6EH 4LDOB 3QUMH 3LRHA 4HIJA 4N8VG 3BYYA 1A14H 5DQ9B 3C5ZB 4FHBD 4P2YA 4XCCH 5AYUL 3WXWL 2WSKA 1SYVB 5ICXB 2DQJL 4LCWA 5DQDL 4LPXA 3CFEB 3PDDA 4XNYL 3U82B 3WV0A 3VW3H 1NPUA 3IU4H 2AGJH 4NKOA 2KQMA 5GS0H 2E5EA 1G7QB 5F1IB 4G8GD 3FN3A 5GIRA 4NGHL 4XP6H 3OKMB 1KEMH 2VXSL 4P23A 4M61B 5CBAB 2W9LA 2XN9D 4AY0A 5EU4A 2MOVA 1OAYH 3I9GH 2VLRD 3D3VE 1MFEL 1R3HB 1MIEL 4P5TB 1OTSC 5I2IB 5EOTA 4JKKA 1JP5A 1KCLA 5TF1H 1KCGC 5TH2B 4KKLC 4S1SL 1KGCE 4XAKE 1OAQH 3L6FB 2WP3T 4LHUA 3QNYB 2R2HA 4YHMH 1JTPA 1Q9KB 2BHZA 5DHVA 3VXQB 1CG9A 2DQEH 2BOBA 4OF0A 2FR4A 3FTGB 2SEBA 2RGSA 3TNNB 2VKWA 3BWAB 3NPZB 4MS8D 4ELMB 1R5VA 4YWGH 2EO1A 3C60B 4IHOA 1XR9B 1NCBH 1QVOB 4OTXL 5DJXB 3GSQA 4N90E 2GAZB 1PKQB 4OF8A 1BFSA 2OS7A 2W60B 4QTHA 3B9AA 3JWOH 4N8VA 4IOFD 4PRPE 4QTIL 5K93A 1RUMH 4PRNB 4ODBD 1YMME 3MBXH 4RCAA 1MJJA 3BIAX 1CLCA 2ZSWB 3RVWD 4P4KC 4KI5C 5C0FA 3MRNB 3EYUH 1H5BC 1QQDA 2HG5B 3TV3L 3FB7A 5GGSA 3BN9C 1FHGA 1RUPL 2XZCL 3RU8L 3ZKQD 1YEDA 3E6HA 3GBNL 3PABB 5J12C 5DEFA 1QUNA 1QP1A 1XEDA 3KLDA 2R2BA 1FYTE 5INDB 4Z8FL 4RFNB 5F1NB 5H94B 4YHPB 3DUSA 3ULVL 3G6AB 4EI5B 1A6WL 4GG6B 4W6WB 1IM9A 1A8JH 5KVFH 3ZT6A 4WWKC 2YBRA 1G7MA 3P30L 3MLRH 3RVXC 1MUJB 4X4ZA 4NHUE 2C1PB 3KYNB 1LP9E 2KZ1B 1MFCL 3MA9H 3QUMA 1FC1A 4NZUL 4HZLA 5A1AA 2EKJA 3PV7A 5T3XL 3NTCH 3F12B 3LQZB 3KYKH 1OAZH 3QRGL 4GT7A 3U79A 3VFVB 3F7YA 4IM8A 4LGSB 4PJ7F 2Z35A 1SMOA 1FQ9C 3W9EA 1I8KB 1H3TA 3KLAB 1PDKA 3OKLA 1CDYA 4JJ5B 1DQQA 4RAHA 4X6BB 5MI0B 1IQDB 4ODSL 1DVFB 2ZUWA 3TH2T 2EYSB 3KPRA 4OQTH 3RWCB 4JREB 2AQ1A 4U7MA 5E6IC 2FJFA 4ZNEE 5CEYA 1NDMB 5DRZA 1KJMA 5DGRA 1OW0A 2FIKA 1QKZL 5E8NA 3BH8B 1ZGLP 3MRPA 4H1LH 3STLB 1J18A 2F8XC 1A4JA 3V8CA 1VADA 5SV4A 4ERSL 3GI8H 5I15H 3H8NA 1S9WB 5I8CA 1QRNB 5F7WC 5IJKC 3KPSD 2ARJA 5I74C 2FECI 4JO4L 4XXDB 2GY5A 1S5HA 4F15C 4P2RE 2HN7B 1P4IL 2GI7A 5E2UH 2Q8BH 2BSTB 1TETL 2LFGA 4HKXB 1U3HD 3WKMH 1UM6H 4N5UA 3TN0A 2AAVA 4G43A 4XZUA 1NJ9A 1S7TA 4TVPD 5TF0A 4JFFE 5AG9A 3A67L 3ROLB 2B5IB 4HULB 5HHOE 4Z9KB 2AV1B 4I77L 4J23A 1I8IB 1U9KA 2OLDA 1T1XB 1NGZA 1AGEA 4RX4D 4NJ9L 5E99H 5LJYH 2JB5H 3MLXL 4X7TA 5DJ6B 4QXGL 4OCXL 2WLYA 1D7FA 3PGFL 3K46A 3P0YL 1AXSA 1GCFA 2JJVA 3DURB 4JO1L 4QXUL 2UZIL 4FQCH 5EIIA 5EUOF 1KJ3H 1TJGH 1I1AD 1DQLH 4WTZG 2B8OT 4IEFB 2Y07H 3CSGA 1I7UA 1Z5LB 5I9QB 5E2TL 4NCC2 2UWEB 1XT5A 2B4CL 1M7XA 2DI7A 5DMKA 3B3IA 1T7YA 1LHZA 3ZYIA 2IH1B 4NQSA 4DKEH 4LQ1A 1XGYH 3GKWL 1HXYB 5BZDA 1M4KA 3Q1SL 2PR4L 5HHQB 5I1CH 1DBAH 2Q76A 4OF6A 5ENWA 3TFKC 3QIBB 1ZANL 4JFXA 5HGDB 3WIHH 5IEKA 3PHQB 5FHBH 1WZ1H 3D39E 4FZEH 4R97B 4HMCA 4XNQA 3RZCB 4AG4H 4KK6D 1P7QA 2R69H 2WBJA 2C7UA 2Q7YB 4KRMB 2Q8AL 1MAMH 1RZJC 3TVMA 3O11B 1NMCB 4M8VA 1A6VH 3CVHH 4G8IB 3BZDA 4LBEA 4FABH 4BUHA 4MA8L 4M6ML 4Y4HD 4FMKA 1KB9K 7CGTA 3L3JB 1FV1A 3BJ91 2BMKB 2NY6D 1TZGH 4OQTA 3WDIA 2ZOKB 2ORBL 3T0EB 4EN3C 4QRPA 1D9KC 3WNPA 1AY1H 1VERA 4OIIH 3UXFA 4ZFFA 1OTUD 2HT2D 1SJHB 4Y4FB 5KVEH 1K3ZA 4RISL 2F58L 4F57L 3S96B 1JNHB 4XNMB 3O3UN 5ECJE 3STZB 4XC3L 4S10A 2FO4A 1LP9F 4WTZA 4FFVD 3SHSA 1P84K 5DZLA 1CR9L 1G0DA 4KZDH 4HS3A 4XPFL 1G7JA 1KJ2B 5J89A 4Z7UA 1F42A 1AR2A 3IKCA 2APTA 4L8SB 4HC1H 4RFOL 3ULUC 5EH1A 4DN4H 1RJYA 3VGAB 4WW2B 5H2BB 4YIQA 1RUKH 4UV4L 1ZA3A 2R23A 1F58H 2H9GB 4N0CD 2R56H 3X3FH 5EO0B 1D5BB 3QEUB 3W39A 2VAAB 4YE4L 3VXRD 3U2SA 4IS6A 5DS8A 5IFJA 3QIWB 3QPQD 1TPXC 4KWUA 4HZAA 1AHWC 1K8IA 4I3RH 2HLFC 3HE7A 5L2KD 3NAAL 3MV8B 1K3IA 4R96A 5IR1A 3L7FB 2W0KA 4LRNH 9CGTA 4PJEB 4QRSA 1C1EL 1F02I 1QEWB 3VD9A 1CICD 4WU7A 1KIPA 2QTEA 4GS7C 4OJFL 4OD1H 1UQSA 3VXNB 2GITB 2VXVH 4PD4K 1B4JH 3GHBL 3GMNA 1ITCA 5GJTL 3TCLB 4YHLH 4Y2DD 1HINH 1DFBH 2EECA 2A73B 4MQXD 4DTGH 2XXCB 1C5BH 3QZWB 5HD8D 3ARFD 5IEHA 1ODAA 1ZLUK 3N1QC 2R0ZH 4JR9H 4XMPL 1E28A 4AIXA 2J7LA 5SWSD 4IDJH 3LD8B 3G9AB 1CD9B 1QA9B 3VA6A 1FNGB 5B39B 1ADQL 2FGZA 3QH3B 1CL7H 4HGMA 1IGTA 2VLRA 1IGMH 1RIHH 1KB5H 1KOAA 2V17L 5KAQG 1KSRA 1WBZA 1IGJA 1NUGA 3T0DA 3O45B 5FUCC 3PE9A 4CN1A 5HHOD 3GO1L 1A7OL 2NY7H 4HXAL 1IEAB 2F54A 1TVHB 4WI5A 4XXCA 3TBTA 4A2MA 1CS6A 12E8L 3WD5L 3V0WL 1IBGL 1L0YA 4P9MH 1GZPB 4XVSL 2Z91A 32C2A 3RI5F 3CVHA 3ALWA 4OFIA 4YBHA 4J1UB 3EYFA 3O2DL 4PJ5D 3O3BA 5C09A 1I7TB 3EOBA 1S7UA 1DE4B 3QWQB 3QXAB 5HTSA 3HI5L 1G7LB 2UY6A 4OCRL 4JM4H 4LSVL 4K55A 1KULA 1R24B 3MLWH 1EVUA 1I9IH 3CMGA 4O00A 1ZLSH 2AERT 5J11B 4C56B 2VITB 2JLLA 1CBVL 5A2KH 2AXGB 5FO7A 1FN4A 4GUPA 3S6CA 2FIRT 1S5IL 4TUOB 4LSTL 3ARWA 4JFHE 4FQ1H 3VJ6A 2ZWLT 2MJWA 2FJHB 2RJMA 2XXMB 5CKGA 4JM2C 5HYJE 5CFHA 3UTSE 4FXKB 3ARDA 1EXUA 1F4YH 5F93C 2P5WD 3T8XB 4GW4A 3D39D 2DQGH 3SO3B 4NQED 5F9OH 3QDAA 3MJ8B 2VDKH 3LQMA 2LAGB 3I3BA 1XGTA 4F2MA 5DFTA 4OM1H 1INDH 4GW5B 3VWJA 1YEHH 4O58L 3ROOA 1QR4A 2I07A 4Y1AE 4OB5H 4MJIE 3QHTC 1XCQB 4E41E 4Q58C 2DB8A 4P3DA 3HRZA 4HF5H 2E6PA 1VHPA 5L6YH 3MLYH 3B9VA 3B9KD 3H9SA 4N1CA 2R4RL 2XWJA 4N1HB 4KVNH 4Y5XC 4KQ4L 4QHKJ 4BQ8A 1A0QL 2FSEA 1YQVL 5IBLC 3GMMB 4NNXB 2JJUA 4FQHA 3O41A 3NIGE 2FL5B 2B1AL 1B6UA 1MI5B 3DSFL 3CVIL 3ZSTA 1YDPB 5BV7H 4M5ZL 3OXRA 1FVEB 1JRHL 5GGQH 4I18B 1XF2B 3HUJE 1N8ZA 4MJ5B 4HK0B 1FZOA 3OGOE 4KY1H 5T3ZH 1FGNL 2GQHA 3S36L 4PJFB 3CLFH 5GGRA 4MZ3A 4KKCC 4K3JH 5INCA 1DLHA 1FFQA 5D96B 4Z7WA 3RWHA 2EXYC 1CLYL 3H9HA 5FECB 5JMRA 3HR5A 5B4MD 3MQIA 5D1QD 5IW6A 1EHLL 2NW2B 1K8DA 1KB5A 2XT1B 4D3CH 3L3KA 4YFEA 1CFTB 4PGBA 4HH9B 4K3EH 4UU9B 4KV5E 2XRAH 4M48H 4U1MA 4HGKC 1A7QL 2R8SH 5IHUL 1R5WB 5DK0A 2VLKA 5C9JB 3CD4A 4WO4D 1A6UH 4ZUWA 3OAUL 4NT6B 1TNNA 5I8EA 4JLRB 5J4MA 3H0TA 2YC1A 1BF2A 4V1DD 4MAUL 4XAWH 3WKNA 4I2XB 4JFEA 1KTLA 3CX5J 5DLML 1NCUA 3IAGC 1EHAA 5JQ6H 5DWUL 4U31A 5IWLC 3QFDB 4ZO7A 1I75A 1TMCA 5HI5C 5IMLA 1D6EB 1Y18A 2YA0A 2KH2B 3NN8A 3WIIL 5FKPA 3E2HB 5DC0A 2MPAH 1ZLWK 1IFHH 5ETUA 5ID0B 3U7YL 1CZ8H 3ES6A 3MCLL 4NPYA 4LP4A 1JNLH 1TZIA 3ARBB 4OF7A 1IAIL 3KPNA 4KMLB 4F7EA 3C5ZC 4LVOC 5D7IA 5I1AA 4M7KH 4POYA 3OAZK 4FQJH 3P0GB 2WQRA 3RHWK 4FFYL 4N9OB 4OZIB 2AEIT 4PV9B 1SBBA 1YJDL 2B1HH 1QYGH 2FWOB 2R0LH 3SKMB 4YHYC 1FCCA 1XIWA 3VXUB 2LU7A 5IMMB 3IT8D 1RMFH 5I16B 1D5MB 3LAFA 2Y7QB 2QQKH 4RIRB 4WV1B 3RDTA 4LIQH 4S1QL 1R5IB 3SY0B 3R1GH 1ZT7B 5FK9B 4D0BB 2UUDH 3RJDA 3HG1B 3ZHLA 5ACLA 4XB8A 2HRPL 5B8CA 4NWTH 1FGVL 2KDGA 1RK0A 4NYLB 1XH3B 3FN9A 3BUYB 2DLGA 3BP5B 4OLUL 5ADPL 5LXGH 1DEDA 1AGCB 1NC2A 3OKYA 1LK2A 2BC4B 5ICZA 4V3EB 1BZ9A 4KK8C 5EDXA 2QADC 4Z7QE 3KJ4C 5D7JB 3O3AB 3G6DL 2FGWH 1MEXH 1XAUA 3C87A 1AGFB 4JG0L 3UZVB 4ZFZB 5DK2B 2C3HA 2X4RB 3MA7B 2HVKB 4LKCB 4OCSL 3T2QA 2RFXB 3KPRE 4U1JB 4PB9H 5IFAH 1QLFB 4YUEH 3V6ZB 4EXPX 3ARZA 5J56B 1OCWH 4WW1A 2RIKA 5ADOL 2R4SH 1T0NB 3IDNA 3QNZA 4Z7VE 3ET9F 4RRPG 5GS2H 3GMLA 4JN1H 5CZKA 4N8CL 4RDQF 4QRTA 2P8MB 2DD8L 4H0HB 2AKRB 4PRID 2IQ9H 1UM5H 5ICYA 2ICWA 5E1AB 3AREA 3MRGA 4YBLB 2E7LA 1KELH 1EMTH 1RZGB 5IROC 4AK1A 3IDIB 5DJCB 1PGRB 3BSZL 3A6CH 3QEHB 3D69B 5D2LA 2DQFA 1I1FB 5DMGC 3TBSA 4EQ3A 4C4KT 4NSKA 5EIVA 4XNXH 3DROB 1KCUH 2QL1A 4HMDA 1EX0A 1CXIA 2FB4L 5EZOL 3HUJF 4LQFH 2D7TL 4CNIA 1U0QA 3DMMD 3VGHA 2XKUA 4ZQKB 5FYLD 2XA3A 4YDLB 2PW1B 5CWSB 4N5ED 5D1ZD 6FABH 2WBWB 5T5NF 3KLHD 5DSCB 2CJUH 4ZD3H 5CLWA 5FO9B 1IGFL 3VXRA 4EI5C 1QLRA 3VG0L 2DM2A 1HXMA 1NAKL 3TM6A 4Y5VA 1HKFA 1FZMB 3FFCA 5I1DA 1Z9MA 4L8DA 5I1KL 3W0WB 4JKWA 3SKOB 4R8WH 1AXIB 4YGAB 4NJAH 5E6ZA 4KV5F 3HS0A 1KCSH 3CK0H 4YHNA 3OKOB 1CICA 1DBJH 4RMWA 4LPVA 2P45B 3QEQD 3RL2A 3MLZH 4ODVL 3DI2B 4GKNA 5CMAB 3ARPA 2ZJSH 3LKOA 1Q9OA 4TYUA 3EOTL 5I30H 3HNSH 2NY2D 1C5DA 1PY9A 2NX5A 1S7VB 3G5VA 2FBJL 2JK5B 5GPRA 2A6KA 3AS1A 3MJGX 4KPHL 3RTQB 1Q38A 4ZUUB 4WHTA 1FZJB 1QLEL 3CDFA 1INEL 2VLME 2YS4A 3CUPA 2RCSH 2X40A 4RRPA 1DVFC 5IF0B 3VFGL 5IT2H 3H6JA 3WO4B 5I76B 1B6DA 3UZQA 2YN5A 4WI2A 5TPWL 1F3RB 1CDCA 4PBXA 4KZEL 4JY5L 3I3DA 5CGYC 4JFDB 5D1XC 1T0PB 5ESQA 1Z0MA 3FZUC 4QRUA 3UX9B 4IRZH 3RA7H 4K7PH 2I25N 1KJVB 1AD0A 3U9PL 1FAIH 3LEVH 4MD5B 4CW1A 3PF2A 2VABA 2X9XA 4GW1B 3ZYZA 2HKHH 1ETZA 1HKLL 5FGBC 4L1DA 4PR5B 1P9MA 3OGCA 5BCAA 1U58A 5FA3B 5E9DB 3MLTB 4LU5H 3OF6A 1ZVSA 5IB3B 5IVXF 5L88H 4CU6A 4OGXH 1SJEA 4QWWC 1W0VA 4F37F 4XP4H 2B5IC 2F19L 3QDJD 2A83B 3N85H 4Y19A 4NRXB 2JELL 3EIFA 4OGYH 1CF8H 4PJ9C 4TVSa 3B2UD 4M7ZC 5IJVA 5F96H 1T2JA 2PYEB 5J1AB 3AM8A 3FL7A 2HFFA 4YAQA 1BVLB 5MEND 2YMXH 1FH5L 2K7PA 2ZCLL 4X80H 3FQXA 2APXA 2AK4B 3KPQB 4JQXC 2XTJE 1KPUA 4EBQH 2Y1VA 2NTFB 4HBCL 3SQOH 2NCMA 2A74A 2D3VA 2ZNXA 2XG5A 2YUVA 5DD6B 1LO3L 2FJGA 3BIKA 4Z7QF 4RGNB 1G7IB 2NPLX 3EFDH 1T0MB 2WLZA 1R3JB 3SE4C 3FCTB 2JF1A 3HE6B 4J12A 4I9WD 1Q9WA 2WZPD 5C07B 1P53A 2DTML 2ZPKL 4YHIA 1FE8H 1A6ZB 5HHXL 2VDRL 4Z7VF 3DETD 3LB6C 3G6JA 3PWUA 2EIEA 3QIBC 5I1IL 4GRLD 4OCWH 1NGWA 3PWLB 1MPAH 4X8JB 1DQJB 3IJYB 3VFWB 5IK3A 4EKXA 1VFAA 2W9DL 1NEUA 4ODXA 3QCVL 2EDYA 5FUZL 2NW3A 2DM7A 4G6JH 5JXED 5C08D 1IKFL 1Q1JH 2AXFA 5BJTB 4M93B 3TGXA 1JHTA 1NMCC 5C2UB 2AP2A 4R4BB 1IC4H 2AJ3B 1KBGL 1MRFL 1IAII 4U6HA 1C12B 4DZ8A 1AIFA 1EDQA 3T0EC 5DT1L 3VFTA 1ZSDB 3QSKB 5T1DL 5L8KB 2CRIA 1GC1H 3IFOB 3D5OF 3OAYH 3GGWA 4NRZA 4L9LA 2MTPA 4IOIA 5JW4N 2E9BA 4YO0A 3O9WD 2F54E 5I75C 4XTRC 2DN7A 2D2OA 4XB7A 5DHYA 3MSPA 3I6GB 2HTKD 3GKZA 5C86A 4UIMA 1ZHLB 1PJ9A 1YUHB 1BJ8A 3BOVA 2DDQL 3FT2A 5KN5B 1XF4B 2ZZUT 1PZUB 5CP3A 4KKNA 1SEQH 3WN5A 3UTZA 3HFMH 1LEIB 3QNXB 4X9HA 3WEXA 3NCYS 1VPOL 1I3VA 1X5AA 4V1DA 5C09E 3UYRH 4ZMAT 3MFFA 1ZHKB 3VGAC 4WW2C 5IBUG 4ORZC 5C2BH 1L9MA 3TZVB 2CR6A 2CIIA 5SX5H 1U91B 4Y4KD 2YOCA 1ED3B 4JO3H 2R2CA 1RUAL 4JZOB 1IQWL 4HFUL 3RY6A 4DOHB 2W65B 3T0VA 3QG6B 4K9EL 1U92B 2ATKB 4HS6B 3QPXL 4JFYB 5FOBA 5C6TL 1ES0B 2OXHA 1OGAD 4G7VL 1AI1L 2EDHA 1ORQB 1ZVHA 3Q6FB 1IC5H 1NFIA 3TT3L 5IESL 5E8DH 5DUBB 1BAFL 3HZKA 3MYZA 3K0WA 3GSNB 4PRHE 3ESUF 3ARVA 1MCIA 2FZ3A 4CBPA 4APQB 4J8RB 2AEQH 2IAMD 3L7EA 2BVQB 4ZFOA 1JI2A 1J8HB 1F4AA 4HLZG 3IDUA 5EA0H 3SDAB 1HOCA 2D9CA 2GUOA 4HIJB 1DL7H 4NQDA 5I1EL 3QFJE 4WFHD 3V6BR 2L4OA 4PJHA 4Q0XH 1MFAH 3PL6C 1ZHBB 4LCWB 5CLTA 1XF1A 3DX6B 3LV3B 2AK1L 3LEYL 3WSQH 4ZOEA 2H6PB 3H9SE 1AP2A 4L3AA 3DNKA 5C0ND 1FZKB 1CVSC 4JDTH 2O5YL 1CK0L 1P5UA 4WENB 4ZG1A 8FABA 5B21A 1MH5A 4EVNA 5T5FL 3OJDB 3QHZH 3ZKSD 1OP3H 5F89A 5ANMA 1KEGL 1HEZA 3CX5K 2NY3C 5HGHB 4LRIA 3NABL 4K23L 1JPFA 4DZBA 3BMWA 1SBSH 2FEDC 3RKDD 1NMBL 2XWBB 1T2QH 1NMAH 4R7DB 1NBVH 1UZ8A 4UDUA 1ZT1B 1K9TA 2WINA 1JNNL 1N4XH 5AWNL 2NY5C 2JCCA 3MODH 5DHVB 5FB8A 5D9SA 1CG9B 2XNAA 3FN0L 2E3VA 2VLKE 3RL1A 4XWGH 4OZ4A 4GQ9H 4PRIA 1NLBL 1Q0YH 4PTTA 1YEJH 1UZ6E 5IGXL 4IHOB 2EE2A 5LCVL 4NZDA 5GRJH 1QFHA 4G42A 5F7MC 4LDEB 3WYRA 1EGJH 4PJAE 4NFCA 1KPRB 5ELIA 2DL2A 3F58H 3DUUB 4UBDC 4JFEE 4L5FL 4QTHB 5KVMC 2XWTA 4G9FA 1T89A 2CDFA 1W2KT 4XBEH 2V2TB 4EXKA 4FTVB 1MJJB 2B0SL 2Z8SA 5FYKH 3M07A 4WCYH 2OQJA 1U8KB 5GXBB 5C0FB 2YSSA 1QQDB 4AZ8A 1ZT4A 3FB7B 2XPGA 5T33H 1DP0A 3ZDYF 3P11L 3T09A 3E6HB 2DLFH 2FCBA 2WWMD 1NEZB 3HMWL 1UGNA 3TNMB 5BVPL 2NQCA 3OB8A 2R2BB 1N64H 2ZG3A 3F7VA 1BEYL 5D7IE 3X14A 4AT6A 4DKFL 1U36A 4N0FA 2V5TA 4YHKL 4MA3A 1Q94A 2ZP0T 4OKVA 2X1PA 1IM9B 3Q6GH 4I3SH 5FV2A 3V5KA 3P9LB 5J3HC 2BNQD 1KFAL 1ZS8A 1UH2A 2X41A 4OM0L 4YJZL 3GMOA 4AQOA 3S4SG 5LQBL 1A3LH 2F5BH 5D96C 2NXZD 3P40A 3SN6N 2X9WA 4PJBB 4HG4J 3MV7D 1CU4H 3F7YB 4MXVE 2V7NA 2Z35B 3W9EB 2CLRA 1P5VA 1JWMA 1I8LA 3ARRA 4P9HH 1JZ2A 1EFQA 5DF0A 4KUZH 3V5DB 5E8OA 5IM7A 1RIUH 5EU6B 2G60L 2BCKA 3LPFA 3EGSB 5TFSL 5DTFA 5CEYB 3C2AH 5DRZB 1KJMB 3ZKND 2FIKB 3TF7A 4D94A 4RAUA 3FOLA 4GSDH 4XVUC 4YR6A 3THML 3CSYA 3IAQA 5BVJA 1VADB 5KANI 5I8CB 3DV4A 5KOMC 5CEZL 1S9KC 1DR9A 1LEKA 2Y6SD 1M7IB 4KTEH 3C9NA 3TC9A 1T5WA 1JF5A 3QUYB 2EEDA 5HHMD 3NA9H 5E5MA 3OKKA 2WIIA 4JHWL 3O6KL 2NMSA 5GGSY 2DQTH 5SWZB 5GHWL 3QCTL 1YEKH 3CFCH 5D93C 1A1MA 4GAYA 4OLYH 5D2LE 1X5YA 1EGJA 4EIGB 1J0KA 1PEWA 1G6RA 3JV6B 5L7XL 1P6FA 5IKCB 2V5RA 4KROB 3BZEB 4I4WA 1P1ZA 1MIMH 4LSUL 4G7YH 3O4OB 2PO6A 4LPYA 1CD8A 2CKNA 4LPUA 4D9RE 2AJSH 4EQ2A 1U8NA 3DLQR 4MAYD 3UPRA 5EIIB 3DJ9A 4J3OC 3HB3D 1FG9C 5EOCJ 4AM0A 3FFCE 1TJIH 4R26L 1L7TL 2OK0H 1YMHA 1B0GB 1OSZB 1YY8B 2DMBA 1VB9A 3FB6A 2A1WH 5DD0H 1H5BA 3TBYB 5DVOA 5TDPB 1MVFA 4DEPC 4DVRH 1BIHA 3FQUA 3V4PH 3K4ZA 4YDKH 5JIKA 5ISZD 2R1XB 4X7SL 1UZ6F 2NX5E 3CSBA 3SGKA 2NY4D 1HZHL 5JXEA 5C08A 5LGKA 4YX2L 1LQSR 4PJAF 4HIXH 1QBML 5D5MB 2Q76B 1V8HA 1OT2A 4OUOA 4LIQE 4L3EB 2OZ4H 4LLDA 5IEKB 1U8IB 3CZFA 3KYOA 1DQTA 3WFCL 1MCLA 5IQ9A 3RWJB 3SJVB 1P7QB 2H3NA 4QRRA 2F5AH 4FQXA 4P46C 2GK2A 3M17B 5HVWA 2E8ZA 1X5JA 1WZKA 3NZ8A 1J0ZA 2HT4C 3LKNB 3LQAC 2DLHA 1OM3H 3B9DA 1ROWA 1ZV5A 1RY7B 4IRSA 1RZJH 4KC3B 1CYGA 3U48A 5JDSB 4LPWA 5F7HA 4HX1B 4O02L 3NCFB 4KJWD 3S7GA 1CXLA 1FNHA 5CIPH 4XPTL 3LKPB 4HKZA 2UYLA 2DI9A 2Q86B 3PGDA 3W81A 1ORSB 5A16B 3BO8A 3QO1A 1WLHA 4X6FB 3VXPA 2EDRA 4Z0BL 4Y19E 1TJHL 3O4LE 4YDLC 2Q1EA 4C57C 2FATL 4GMSH 3K1DA 5F70A 4L29B 3RVTD 3T0WA 4Z7UB 3FFDA 3MNWB 2DQIH 3IKCB 4R2GB 1OP5K 5DO2D 5JA9A 2VN7A 5HGGS 3P4MA 2JJTC 4MXVF 1I9RL 4PJIB 1CE1L 1T22B 4BSVA 1BOGB 4YIQB 5IOPB 5CJQH 1GVIA 4LLUB 4CVUA 4MNGA 4HPOL 2HKFH 1MLBB 5H37G 5CCKH 4Z78B 4NUGL 5DZNA 2IAMA 3RGVC 3HE7B 3RTQC 4OIAA 1UA6L 1CLOH 1ZAGA 4R96B 5JO5A 2VSDA 4QRSB 5KSBA 3JSSA 5IFHH 1FRGH 1KENL 2HH0L 3OKEA 3STBA 1K5NA 1AO7E 1J12A 1J1OL 2G75A 4UDTA 1UQSB 5J1TC 4DFIA 4E42B 3MLUH 5T3ZD 4GMTH 2NY1B 3GZKA 1N2RA 2FX7L 2LQRA 3QXWA 3G6JE 1K2DB 2DJUA 2QQLL 5GQBA 3MRIA 4G8GB 1GZQA 4H5SA 3VH8G 4J4PD 5JHDA 4PGDB 2X1QA 1FIGL 2D7OA 3GI9L 1V05A 2XN9B 1IEBA 5AYUH 2Q20A 3WXWH 1C08A 2DQJH 5CD3A 2DL9A 2IFFH 1IGTB 2VLRB 4PREB 1L7IH 4XNYH 3CPLA 4TRPH 3T4AA 5H35A 1UB5A 1Q9LA 4NP4L 4NKDA 3ZE0E 2OZ4A 5CUSH 5T1KA 1KLUA 4MJ4A 3NCJL 2F15A 1UJ3A 1BHGA 4NGHH 5D6DA 4O5LL 4FQPA 1OAKL 4XMKL 2VXSH 2YD9A 1UH4A 3L5IA 1F8TL 4OF3A 2Z91B 3RNQA 3LRSB 4GBXD 2J8UA 5TDNB 3NIFF 3F65A 3K7UA 3MNZB 3G04A 1MFEH 1EEUA 1MIEH 4I0PD 5EBLA 4ZS7L 3O3BB 3FQWA 2DYPD 5D71L 2BNRE 3EOBB 4GRWB 1S7UB 1WCBA 2NY0C 4S1SH 1QO3B 1KPVA 1A7PL 3PXHA 3RIFK 1B0RB 1UWEL 1K6QH 3JWDC 2EDLA 2PXYA 5IB5A 5ACZA 4EN3A 3QP3A 5DUML 2YRLA 2ITCA 4RGNC 1RJZB 4RQQB 2I5YL 5MERB 5C0CA 4N8PA 2ERJB 3IXTB 3LMJL 3PHOA 1UCBH 5E2VL 3OX8A 4PS4L 4OLXL 1IE5A 4G9DA 4X7DC 4HUUB 4LLYB 5ESAB 4LSPH 1OVZA 4UQ2A 5D7KE 3VH8A 1DQML 3A6OA 4FFWD 2DLTA 4NKIL 5F6IC 3MXWL 1DEEA 1LE9A 2DQHL 4X6CE 1DBKL 3BP4A 1OARL 1VEMA 4B7LA 1XGTB 3W2DH 4F2MB 1N5YH 1IAKA 3DRTA 5JW5A 3RNKA 4MA7L 1E27B 3MCG1 4OV5B 4NQVA 1VKXB 5HJ3B 3TIDA 5HHPB 4BH8B 3IF1A 1RUPH 2XZCH 2NZ9C 3UCRA 2NTSP 3BP7A 3FO9B 4P5MA 3VXSE 1V7NL 3GBNH 1SVCP 4M93C 2JE8A 1XGQB 4NQDE 1JI1A 3C8KA 1VEOA 4M00A 4PGEA 1P4LA 1T7VA 3O8XD 2FSEB 4GG8A 1NAMB 3IDYB 3PWNB 4UILH 3O41B 5DVKA 4UZGA 3MR9B 4JG1L 1U8PA 4BYHA 3IJSA 3I84A 4ZUSA 1FZOB 3KWWA 3CXDH 1BWWA 5GGRB 3TO2A 3O4LD 5E8EA 5T1LD 4NZUH 5ANME 5CD5C 3MBEA 5INCB 4N0UB 5T3XH 4Z7WB 3N1FC 4ODUA 4JFZH 1DTUA 3SDXF 5CINL 3HR5B 3HC0A 3L3GB 1U93B 5IW6B 3V7AG 4MQTB 3FT4B 3M8OL 1VENA 5D72H 3BPLC 3HNTH 4UT7L 5E94B 3KPSB 1BQUA 5FCUL 2AVGA 2DM3A 5E56A 4YZFF 3NCYP 5FDWA 3MACL 4HUVB 4YNYA 1LD9A 5C0EB 2W91A 3DIFB 4YGVA 3QXVA 4JQVA 2CR3A 2YPLD 5C3LD 3FB5A 1KTLB 3PP3K 1JPST 4ERSH 4O2EB 1PQZA 2EXWD 4HKBB 4OZHA 3BRDA 2BSRA 1HYSC 4XBGA 3SDDA 2HT3D 4JO4H 3FOMB 4NQUA 4P59L 3DWTA 3MRLB 1P4IH 3CU7A 5FKPB 2ZUXA 4G9FE 3QEGL 4JFOA 5ETUB 2EDJA 5BQ7A 3EZJB 1JF1B 3LIZL 4QGYA 3JTCA 4OFYA 3ZE0F 2PN5A 1TZIB 4L4TA 4GKZB 4QHKI 1I1AB 4I77H 4QHMB 5I1AB 1BD2A 4FG6D 2LAAA 1JZ7A 2ADFL 5DMIL 4PJXA 2QV2A 3RPIA 4KK9D 4NJ9H 3VFSA 4XP9L 3UYPA 4JPIB 1VFBA 3LKSA 4WFFD 3MLXH 4QXGH 1HH6B 4W6XB 4X5XB 4OCXH 1B0WA 4OFDA 4M7JL 3PGFH 5EUOB 5EORL 3W11C 4JM2A 3C5JB 5I19L 4DW2H 4JO1H 4QXUH 2FD6H 3ZL4L 2UZIH 3RDTB 4P23C 3ARGA 5D7LE 3LS4L 3IETA 5E2TH 1T1YA 3T65A 5K9KA 4JDVA 3IDGB 1DLFL 3NMEA 5B8CB 1QFWM 2BNRD 4ETQA 1R3KA 5E00B 4XHJD 1II4E 1FLRL 1MOEA 2RBLA 1LK2B 3S37L 3GKWH 3C6SA 3BHBA 5ICZB 5C0DA 3Q1SH 2F53D 3ILQD 4HUWB 3BAEH 2HVJA 3WUWA 3Q0HA 4QXWA 2WP3O 3GSRB 1KCRL 3DVGB 1ZGLA 4Y4HB 5DUPL 4IIQA 3MRRB 3TA3D 2NY6B 4U1GC 4RAVB 2IADA 4X6CF 4JRXE 3WIFB 3BH9A 3ARXA 3MUGA 4XX1G 1OTTC 1PG7X 3KPMA 1HSAA 1V3LA 1JPGA 1F3DH 3QNZB 3D2UA 1NFDF 3OB0H 4JVPA 2Q8AH 4ZXBA 3TYFA 5TJWK 4QRTB 5HI3C 3J7HA 1BFOA 3CFKA 4NFDA 3RUGF 3RI5K 5ID1B 4X4ME 4MA8H 1FL5B 1FL3A 1GPOL 2ORBH 4FQIL 5I71B 4ZAKA 5MP6L 1HHHA 2YD5A 3EYOA 2YRZA 4M1CC 4M9OA 4NQXB 1YYMH 3VXSD 5DRXA 3EO0B 1N6QL 4RISH 2ESVA 3I85A 4GO6B 4WEUD 1CE6A 2CKBL 5F88A 1IM3A 4XC3H 3QAZB 4LEOA 4M02A 3HZVB 5KG9A 1Q72L 1CR9H 5D7SL 3VRJB 1Y6NR 2QSCH 5C0BD 2DWDA 3VXRB 1QLRB 4U7SA 3RWDA 4U1KB 2P49B 1NAML 4L8DB 5FYKE 3ZMRA 4JRWA 5L2KB 2HTLD 3GK8L 4YEEA 3HS0B 4RBPH 2CUMA 4KKAC 4NBYB 4J6RL 5CBEA 1CICB 1N0XL 2VKXA 1DZBA 2R1WA 3O3DA 3LKOB 1Q9OB 3X12B 1KV3A 4YE4H 4JPWH 1C5DB 3G5VB 4Y2DB 3ZE2E 2A6KB 5DQ9A 1RPQA 2MNUA 2PKDA 1AC0A 2AQ2A 5GS0C 3TBVA 1SYVA 3NAAH 1JWSB 4PLKD 3ARFB 1U6AL 3CFEA 4WHTB 3MUZ1 4XVJL 1C1EH 4NBXB 4OJFH 5SWSB 3WLWD 4EDWL 4KTDL 1G7QA 1S8DB 5F1IA 4YC2B 1YN7A 4HIIB 2BSSA 3OKMA 5GJTH 1OW0C 4LCCB 2LV4A 1FSKB 3D85D 5ESQB 4M61A 3HMXL 4M43L 3EOAA 5BOZG 4HK3J 5M95B 2DLEA 3ALXA 1MCHA 1LNUB 1MJUH 1R3HA 4P5TA 4CW1B 4TVPL 4ESKA 1MFBL 1QHPA 4Y0GA 4QXTA 4K7PX 1ADQH 3RZWA 2Q87A 1U58B 1URLA 3MJ7A 4JVUA 3TN0C 4X6DF 3QNYA 4DUWA 4I0PA 4ZODA 4PJ5B 3O6FD 1Q9KA 3SE9L 3VXQA 2J3SA 1VDGA 2NNAB 4M03A 2BDNL 2IALA 3KPLB 3CMOL 1CDHA 5KS9E 4HXAH 4OSUL 3CXHK 5FGRA 4AIZA 5EULV 3TNNA 3BWAA 2D4DA 4AEHL 3MRHB 4QRQB 12E8H 5JA8B 4QCIA 4ELMA 1IBGH 4HJJL 4XVSH 4GAFB 3GUTA 4KROC 3C60A 4FRWA 3JWOC 1XR9A 4CMHC 1QVOA 3O4OC 2APBA 1WIPA 2HFFB 3Q5YA 2GAZA 3O2DH 1PKQA 4UI2A 3ZKXB 4J3TA 3CFDB 1KPUB 1N7ML 4B0MM 2EDWA 5D7LD 1ZLVK 3HI5H 3WNOA 3TYGL 1GGIL 4PRNA 2A74B 4LSVH 5IMKB 5CJOH 4HHAB 2FJGB 3FQNA 2ZSWA 3BIKB 2P4AB 4MHHG 2VDML 1ACYH 1GAFL 5TE6H 2X1WL 4MX7B 1NL0H 3MRNA 2HG5A 1CBVH 2P5WB 4Z0XA 3X11B 2OX5A 3D39B 1T04B 4NQEB 3CDCA 4YFDB 4GLRI 4LSTH 3WE6B 2OTPA 1GH7A 5F1NA 2E27H 5H94A 5FF6A 4PGZA 2FNBA 4F9PA 3B9KB 4GG6A 3UZEA 2GJ6E 2ZNWA 4XWOC 3R8QA 5I1JL 5L9DL 3O8XA 4QNPF 1MUJA 4M3KB 1FFPB 4HLJA 4TQEL 4XPAL 2C1PA 2MWCA 5IK3B 3VD3A 4ODXB 2WBJC 3X3GH 5DK3A 3C5SB 3HA0A 4QOKE 1NCAL 3UJTH 4UIKL 3TVMC 3QDHA 3F12A 4TUKL 4K71C 3UC0L 5JHDE 5KSVB 1OTSD 4LLMB 4U6HB 2X4TA 3VFVA 4DZ8B 4KKLD 4M5YL 1A0QH 1I8KA 4LARL 1YQVH 4K2UL 4JZJB 4JJ5A 3I6KB 35C8H 4HWNA 4X6BA 5D1QB 3DOSA 2B1AH 3CSPA 1AFVL 1WEJL 3DSFH 1LE5B 1IQDA 3CVIH 2BP3A 4L9LB 4IOIB 4M5ZH 2EYSA 1JRHH 4RMVA 3RWCA 4HJGB 1FPTL 2R0KL 3ZE1F 4BQBA 25C8L 1IMHC 4TSAL 2EYTB 1H0DB 4WO4B 1S9XA 4XP1L 4KVCH 1NLDL 3BH8A 4BFEA 3I02A 2J8UE 4NDMB 3SDYL 1CLYH 2X09A 5F3HB 1ADQA 2XTJC 3H7BB 4OGAC 3UTZB 5A3IC 1EHLH 4KI5F 5FYKD 5FAAA 4N0YL 3VMOA 4V1DB 4WGWB 1KJ2H 2YPLA 2C3WA 2HN7A 3HPJA 1A7QH 3K81A 5IHUH 2BSTA 2QQQA 4HKXA 1GGYA 1GGCH 4TPRL 1F2QA 4NN5C 1F11B 1YEEL 4P4KD 2IPTH 4XCYB 4KI5D 3JVGA 1X6NA 3HHRB 1FFNB 2B2XL 3ROLA 1ZEAL 3BN9D 4ZSOB 2EH7L 5CHNB 5C0CE 4G6KH 3AU1B 5FOBB 1I8IA 3HE7C 4Q9RH 1FO0L 4MAUH 3O2DA 2CDGB 1T21A 3WFEH 5DLMH 5FUOL