3P77A

Crystal structures of the chicken yf1*7.1 molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
274
structure length
272
Chain Sequence
FGSHSLRYFLTGMTDPGPGMPRFVIVGYVDDKIFGTYNSKSRTAQPIVEMLPQEDQEHWDTQTQKAQGGERDFDWNLNRLPERYNKGSHTMQMMFGCDILEDGSIRGYDQYAFDGRDFLAFDMDTMTFTAADPVAEITKRRWETEGTYAERWKHELGTVCVQNLRRYLEHGKAALKRRVQPEVRVWGKEADGILTLSCHAHGFYPRPITISWMKDGMVRDQETRWGGIVPNSDGTYHASAAIDVLPEDGDKYWCRVEHASLPQPGLFSWEPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MHC Rfp-Y class I alpha chain
publication title Structure of a Classical MHC Class I Molecule That Binds "Non-Classical" Ligands.
pubmed doi rcsb
source organism Gallus gallus
total genus 66
structure length 272
sequence length 274
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3p77A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3p77A01
4LSSL 2YBRA 2CLRA 2I25N 1UC6A 3TIDB 5E6IB 5FO7B 1F2QA 1ZHLB 5E4IA 3WFBH 2CK2A 1I7ZA 4AT6A 4M6MH 2PTTA 4Q6IC 4G7YL 3F5WB 3S35X 4U6VH 1GGUA 2YPKB 4KDTA 3VWKD 2NLJB 1CFSA 4ZAKD 1DSFH 4BM7A 4F7TB 3ARFC 2W0PA 5DRXB 1ZVSB 4U1IB 2XN9B 5BV7C 2WLZA 2HJFB 1AY1L 4XCCH 2VLJD 2PYEB 5E8PA 4RGNB 2WK2A 4HHAA 3OKDB 2ARJQ 2GKIA 4HULB 1QNZL 2EDRA 2XPGB 4KZDH 3D39D 2J8UE 3WHXA 4M48L 3BP7B 4FMKA 3B9AA 4MX7A 3BVNB 4ODWA 1PAMA 4KUCD 5EIVA 1NJ9A 2EDQA 1BQHG 1IEAA 5T5NF 4PJXF 5DJXB 4NKDB 3FT4B 1G9MC 4OCYH 3MUGB 4WU5A 1OHQA 4Y2DD 3RGVD 1QFWL 4PJDB 3I3BA 4PLOB 3RWJB 5HYSG 2JKXA 5DQJB 3SDDD 3VGFA 4DUWA 2H9GA 1I7TB 3QXAA 4S2SA 1AKJB 5F3BB 2QHRL 3AY4A 3MLYH 1RHHA 3GMRB 2ITCB 2NY5H 1U8LB 4S1DC 4QHKJ 3ROOA 2P5ED 4YXLL 5T1KD 4NQED 3RGVC 3BH8B 3IDYC 3NIGE 5F6IC 4NYLB 3MPCA 3EBAA 3MRCB 1OGAE 3C6SA 1DBBL 3KPPA 5MI0B 1T66C 5JMRA 1CGUA 3SDDC 3S36X 4RA3A 1YMMA 1M1SA 4NWUH 4OD1L 1Y18B 4PGDB 4XPAH 3CFJB 3X14B 1Z6JT 3HG1D 3OL2A 3HR5A 1A6WH 1A6TA 4HS8H 3VFPB 5GRJL 3IDXH 4ZD3L 3TBTB 4PJCE 2DQUL 3PQYD 5JOFA 4O58H 3D48R 2JF1A 3MACL 1PYWB 1I7ZB 1H15A 1IARB 1WCBA 5DK0A 1HEZA 5GGSB 1I85C 3CMGA 1D5XA 3V4VL 2G2RB 4IDLA 1AGFB 4ODXA 3GSNH 3VMPA 2DM7A 3N50A 5I1JH 3AU1B 5EZIH 2UWEE 3KPSB 4XVSH 2R69L 3MV7D 3MLPA 1NH6A 1UT9A 3RBSA 3DRQA 4JN2A 4N0CA 2UV3A 4PS4H 5D2LB 3U82B 5GRVK 3NPSB 3UBXI 3K2UH 1KGCD 4XRCA 2MSPA 2GW5A 2D0HA 4HHAB 4X5XB 3ALXA 3QJFB 5L7XH 3L9RA 4S1RH 2OCFD 3ZE2E 3LKSB 4JM4H 1FVCA 3ALPA 3PG2A 5GSRA 4G7VL 1NAML 4KXZH 3FO0L 3LSOA 5IVZA 1IEAB 4JFED 5F88A 4BSVA 3AREB 4OZFG 4PY8J 2AK4A 4TOYH 5IKCB 2E27L 3MA9L 4LF3B 3IAGC 3WV0A 1R0AL 3O2VL 1NCDH 3QXAB 4PJFE 1WT5C 1TQCC 2WIIA 1DZBA 3HE7A 4NP4L 1NGPL 3MREB 4Y4FB 1GYAA 4AQ1B 5B39B 4S1SL 5DYOB 1R3JA 2PYEE 2ATPB 3EDJA 4I3RL 5J11B 4GG6E 3QIWD 3QPQD 3TFKC 3V8OA 4ZFFB 2X7LA 3DBXB 2NY5C 4K9EH 1YMMB 1GGCL 1RSFA 3BQUA 1T04B 5EU6A 4KVCL 4UBDC 2HH0H 1GXEA 3C9NA 3L6FA 3VXRB 4DOHE 2FYYB 2DDQL 4QHLB 3KG5A 3DHJA 1V3MA 2OR7A 3TT3H 4Y1AE 4NN6C 3JWOL 3MNZB 4W4OC 5IBTL 2I9LA 5A2IH 2LU7A 1IKFH 1QA9A 4P5MA 4Z8FH 3LS4H 4XNUL 5C0BB 1PX3A 4TUKL 2APWA 5K9JL 1A6UL 5CMAA 4ODXB 1QFOA 3PWLA 3FT2B 1D9KA 3QSKB 5B22A 1M71B 2ZJSH 3ARUA 3QXVA 3EYUH 4FXKA 4HUXB 4OCXH 4FFVC 5I1LB 3DRQB 4JN2B 4XP5H 1ED3A 1OGTB 3BGMB 4XI5C 1W0YT 1N64L 3UEZA 1NGQL 2DIAA 4XRCB 3QDJA 1AR1D 3DHMA 4FQJH 5IEKB 5FCSH 1E6OH 2FWOB 4GW5A 5BOZG 4KJPD 4LCCA 3BI9X 1FVCB 4U6YA 5HGDA 3VRLE 3QPXH 4LSTL 3JUYA 4MD0A 1SY6L 3NPZB 3ARGC 4Y5XB 3PGFL 4OUUA 2C9AA 3MOQA 1KCUL 1OOAA 2OBGA 4Y16D 3W9DA 2ADFH 5CZVL 1KJMA 4DVBA 2MHAB 5HHXH 1HE7A 1VACB 1AR1C 3DV4A 2AK4B 1P5UA 1XGRB 1CFTA 1QR1A 1NANH 1S7WA 2DI7A 4BA8A 4KWUA 4YHPA 2X4UA 4KJPC 4MHHG 3UTSD 3PL6B 3UJIL 5CILL 1IM3B 3FO9A 1MCHA 4GXUM 4J8RA 3SQOH 4NT6A 2WIIB 5D70L 1U8OB 3C09B 1AXTH 1NCUA 3EOTH 1TCMA 4QHKI 2XZQL 4QTHB 1E27B 1J0JA 5JW4M 1RZJH 4O5LL 1I9JL 2OK0L 5CD3A 3S3SA 3CZFA 3OG6B 1RZKC 1DQTA 4OCSL 3BQUB 3GI9L 5EU6B 2I24N 4ZXBA 5IWLA 2NXZD 2O26U 3O9WA 5DHXB 4K7FA 5C0IA 3C9NB 3L6FB 3RIFK 3ARDB 3KS0J 4PB0L 1Y0LA 3B5TA 2CK0L 4G3YH 2I26N 1MWAH 1IC4H 1X4XA 4TVPE 1BJ1H 1QSEA 5FKPA 1RU9H 1MI5B 4LCUA 1HXMA 1PSKH 4NZDA 3VFVA 3WD5L 4MAYA 4P5MB 5F1KC 3SPVA 2HVKB 4UIKH 4PLKD 2VTFA 4OT1L 5T3ZH 3WFCH 5IK3B 3UC0H 1I8LA 2AGJH 1F6AA 1Q94A 1D9KB 5JIIA 2ZKHH 1I3RA 4P2CG 1G6RL 1RUQH 5ADPL 3QO1B 4FQXA 1MRFH 5DUMH 1EPFA 4NIKB 4P9ML 5HGBB 1IC1A 4FP8H 4N5UA 2BXZA 3FL7A 4PLKC 3MTRA 4OZHA 1J9CT 3HI6H 3ZT7A 4GW5B 1KJVB 2NY2C 4LCCB 2AP2A 1RUKL 1TZIB 4G9FE 4TUJA 3TO2A 3TIEB 1HILA 3DUUA 1MCDA 3NOIA 3K1DA 4UAOC 1NBVH 3REVA 3NZ8A 1IGFL 1FL5B 5GGQL 1A2YB 3DV4B 1FPTH 4PY8I 5FGRA 5HBBA 5CKGA 1YECL 1F4YL 3KXFB 2EYSB 3AXLB 5E1HB 5I30H 1AE6L 3P0VH 2PNDA 1FC2D 4HWUA 4TULL 5TDPA 1B2WL 4Z76A 1MIEL 2HJKB 2AQ1A 3CX5K 3HR6A 4XBEH 3WN5B 4PJDF 4J3TA 3CFDA 2R8SH 1HWHB 3P4NA 3GB7B 1NDMB 1K4DB 3LRSA 4WU7A 4E41E 1ZLVH 5DZOA 5I8EA 4YC2C 3NIFE 5T5FL 1QOKA 4FZ8H 5CD3B 3MLWH 3A67H 3T1FA 2V2TA 4U1KA 2CUHA 5LCVL 1UH2A 5GS3A 4JHAL 4ZXBB 1S7UB 3MGTB 3IETA 3O9WB 2NPLX 1FO0A 4JRYA 1JGLL 4GQ9L 4H8WL 2GCYA 3LPFA 4AYFA 5DWUH 3FOMA 4HKZB 3VDBA 4TSBL 1GC1H 3NN8A 1RZJC 1V05A 1IT9H 1FFOA 1D5MA 3IAPA 3PGDA 3KPRE 3DYMA 5CJOH 3X3FL 5JOEA 2WUBL 3REWA 3VFVB 4MAYB 1AGCB 2PETA 2V5MA 1J86A 4JHZA 4ZNEA 1IGJA 2AJZB 5FV2A 1CL7I 5ESAB 3W0WA 1T0PB 4G6JL 4PJEB 1Q94B 3LS5L 1CDGA 1OP5H 4X7TA 1I3RB 2KDGA 4OUOA 3OKOB 3VFOA 2WWKO 5AG8A 1TVDA 1P7QD 4FQXB 4IHOA 4ZFZB 1NAMB 3MRQA 3TN0A 3AB0C 3VG0L 2Q3AA 4EN3C 3QHZL 4U1NA 4OZIA 4I2XA 1A5FH 2B5IC 1R3LB 4OKVA 4GS7C 2D7NA 3GSOA 2P24A 5I19L 3RDTA 2IH3A 1NC2D 5D2LF 3DUUB 5FO8A 4DFIA 1ADQA 3H9SD 4OGAD 4B53A 3RTQA 3O2DA 1I1YA 3GJFA 3NZ8B 3VA6A 2IH1A 1T7XA 5DS8B 2DKSA 3QIBD 4TRPH 4CDHA 1UM6H 4J12A 1MI5E 4POZD 1F6LL 3AUVA 3QUKA 4NO5A 1BGXH 1BOYA 2XWJA 2VN7A 2ADJB 2ZUTA 1UB6A 1F58H 4QRRD 1BF2A 3V5KA 1HXYA 2Q76A 2FECI 1BD2E 1YMHB 1JN6B 3JXAA 2Q86B 1OVZA 2APXA 3IS1X 4P46D 4OGAC 3SE8L 4Z76B 3BIBX 2BSTA 5I8CB 3JV0A 1N5AB 3CK0L 4HIJB 5C0AD 2Y7QA 3OKKA 1HH6B 2EDLA 4KROD 3R8QA 1E0OB 3O6FA 2QLVB 3LRSB 4WU7B 5I8EB 1D5IL 3HKFA 4TUOB 4AIXA 1T4KA 5E7FA 4U1KB 1BQHA 3ZYJA 2JIXA 2BY0A 5F1IB 3U0PB 3QUYB 4D0CA 3HC4H 3TP4A 4NC1E 2A2QT 2DWEA 5TFSH 2FGWL 2HFEA 3G9AB 3FFCD 1E4XI 5D8JL 3OKEB 1S5IH 1TDQA 1CGVA 3FOLB 3RWIA 1JF1A 3BW9A 4ZFOL 5KSAD 1N6QL 5FYLD 5HYSA 1NUNB 4KROC 1JK8A 1H3WM 4F7PB 3GKZA 5JXED 2AXHA 3SCMD 1G6RA 4XCNA 1OARL 2Z0BA 2Y4SA 5C1MB 5KVDL 1DBJH 2A0LD 1NUFA 1TJGL 3L5WB 1IGJB 3BPOB 5CUSL 3PHQB 1WWWX 5EU3A 1KEMH 3PDGA 4LLWA 3W0WB 7CGTA 4X9FA 4X7TB 3CFEA 4OZ4A 2CO7B 4NCC2 1D5ZB 3VFOB 2GEEA 1XT5A 3JVGC 4IHOB 4ORGA 2I27N 4DGIH 4NRZB 1UH3A 3SCMC 4PLNC 3UBXA 5GHWL 4PRHE 3DNKA 2FLBT 3IRPX 3OHXA 4QO1A 1KTLB 5SWSA 4WHCA 1P4BH 4M7LT 5EPMB 4C59B 2B1AL 4JAMB 3A6CL 4G9DA 5E8EA 3TJEL 2P5WD 4M1GH 4MJIE 2R0KL 1ZHKA 3GJFB 4JR9L 1NSNH 2ESVE 5CCKL 4JFXB 2QL1A 5IVXE 1MNUL 2YN5A 5ITFA 3QFJB 3SO3B 1T20B 1AI1H 3V7AE 4NGHL 1HOCB 5IB5B 5GQBA 1HCVA 1MRCH 2M8XA 3PP3H 4RAUA 5CJXA 5ENWB 4JFDE 2HKHL 2CKBA 9CGTA 4JB9L 1UM5H 2ZCKH 1FRGL 4RMVA 2P8PA 5A2KH 2VDPL 3QEHA 2MMXA 1U3HA 1FL3A 4YHZL 2I07A 1XMWA 4AEIL 5GJSL 5JW4R 2VXUH 4NPYA 2JIXB 4D0CB 1BMGA 3O6LL 2DWEB 2VH5H 4P3CL 4X4YA 1YY8A 4Z7UE 4PGZA 2HT2C 4OZFA 5ALCH 3QO0B 5HHMD 3HNSL 3U9PL 1KCVH 2NX5A 1B90A 2FL5B 3NA9L 3ZKXC 4JFHD 4AG4H 5HYQA 2VITB 1ZTXH 3QHTC 5SWZD 1G6RB 3OR7A 4XCNB 3P0YL 1HSAA 4HH9B 5D2NC 5I1IH 1AGDB 3T0EA 4N0YH 3QUXA 1TPXC 1ZGLP 2GI7A 4Y89A 4XVTH 2VAAA 3PWPE 2E7HA 3I02B 2DLIA 1IVLA 3A6BH 4LVEA 1KC5H 4BH8A 4IIQC 2R4RL 1QLEH 3MNWB 5FO9B 4XMLH 3EUUA 1X4ZA 5EC2B 1YA5A 2GUOA 3KPMA 5TE4L 3N0PB 3UBXB 4C83B 1CL7L 1RULH 3DRTB 4R0LA 2WBJD 4M61A 1T1WB 3QDGE 2ZG1A 3WJJC 5DXWA 5DR5L 1WZ1H 3SGKA 1AFVH 3H7BB 3S34L 4KUZH 2C7UB 4G9DB 2OQJB 5CSZB 5E8EB 4FFYH 5JXAH 5I8KL 4ENED 5FA4B 3DXAB 5H35A 4R4NC 1ZHKB 1NLBH 5IHZA 4OIBA 4NKQB 5EBLA 4ZG1A 5JPMB 3KDMA 3FHAA 3V8CA 3MV9B 5CGYD 2VLKD 5ITFB 1D5BA 2Z8RA 2WBJC 2EC9T 3O8XB 1QFUL 1A0QH 2RJMA 5EZOH 1CFBA 3KR3H 4IRJD 3BD5A 4D9RE 4ONFH 4HUWA 1LO4L 4LLMA 1X5LA 5FYKL 3WFEH 4PJ8B 5EZJA 4G42B 1X4YA 2P8PB 3VXSE 5ITBH 1N2RB 1JRHI 4WWKB 3VFTA 1WF5A 4DUXA 5CGYC 4DQOL 2I07B 3K2MC 5I15H 2FECL 4BUHA 3C5SA 1CE1H 3F7YA 4H20L 3IKCB 3PGCB 4NQDB 3ARBD 4PJIE 1EHLL 5TE7H 5C0DA 4GAYB 3N1QC 4WCYL 4XCEB 3QQ3A 5D6DA 1LDPH 1YY8B 1T83C 4X4YB 5DC9B 3O4OC 2AAVA 3QEQD 3QRFM 1BM3L 5AYUL 5SV3A 3H3KA 3Q5OA 1G7IA 5T1DH 4J23A 5HYQB 1J1XL 2DQIH 5CJQH 3D6GA 4KXZI 1FNEB 2IPKA 1I9EA 1KEGL 3T0EB 1TQBC 3ARBC 1WICA 1E4XL 1MCKA 3QWOB 1REIA 4Q7DA 1DQDL 5H2BA 3RKDD 4FTVD 5F96L 1VCAA 2NR6C 2X4RB 1Y6KR 2A6JB 3D2UD 3B5GA 4L8BA 3SJVE 4HPYH 4KPHH 3T0XA 5F7YC 1L9MA 3LIZL 4X6DB 3ZDXF 4BH8B 2XQBL 3L3IA 4W6WB 5E9DE 4C58B 5TH2A 2GT9A 3OBAA 2WWMD 1H3VA 4HKJB 2MCPH 2BZDA 3KPMB 3OF6D 5C07D 1EEUA 4PRAA 5C2BH 4FQPA 4FQHA 3GI8L 3FKUS 4JQVC 4N0FA 3RKDC 2IEPA 2UZIH 2QR0A 2DTSA 2MKLC 5CFHA 4HFWA 1JZ2A 1MCFA 1FHGA 4GXVL 3H0TA 1YEFL 3QUZA 1ZSDA 2EXYC 2R1WA 3HPLA 3VGAC 3WS3A 3NCCB 2HVJB 3KDMB 3C60B 4OZHF 4APQB 4NNPH 1DVFB 3D5OF 3TBSB 1P53A 1WFNA 2J6EH 2ADGA 1VFMA 3B3IB 2A77H 4LCWE 5JHDB 1I8MB 1MCNA 5JHLL 1L4IA 1H0DB 1FFNA 3BT2L 2JJTA 2XG5A 4HUVB 3X3GH 5AZ2L 3BGFC 2K7QA 1OM3H 4YDJB 3HAEB 4EKXA 3P4OA 2FNBA 4MS8D 4BZYA 3O11A 4L8SC 5EOTA 3U30C 5EZJB 5LQBH 1NMCC 4NM4L 2ZUXA 4ONGH 1J8HD 5MENE 3VFTB 4HMCA 4GH7B 4EDWL 4Z77A 4KK8D 3UPAA 2QQKH 4BQ9A 4ZFOB 25C8H 3C5SB 3F7YB 3K1KC 4HIEA 5EULV 2FJGB 4QOKE 1X5XA 4M6ML 5KVFL 2H26B 3QQ3B 3G04B 4U6VL 3NFNB 2H3NA 5IW6B 4ZS6D 1E6JL 4RNRB 4O02L 4PRPA 1IC5H 2FATH 4KTEH 3L95A 2MFNA 1WBXB 1DSFL 2Z4QB 4P9HC 3NACH 1OAZH 3I50H 2FZ3A 2BSSA 4DZ8A 1MJ8H 1MVFA 2R1XA 3NCEB 4LNRB 5H2BB 1X44A 2NY0C 1T2JA 1RURH 4NQSA 1OGAA 1QVOB 1Q9OB 5FA3A 4KZDL 1DQLH 1U8MA 3GFUA 4ZS6C 2MPAH 1UEYA 5JDSA 1F45A 2X9WA 5TH2B 4OJFH 3VD4A 1OW0A 5EFIA 1R3KB 2WSKA 4OCYL 4YJZL 1BFSA 1P7HL 4UIMA 3ZTNH 2BVOB 4XPGH 4PJCA 4N0FB 3RA7H 1DANU 1H5BB 4LFHG 3LQAC 1NFDE 2YKLH 1KJ3H 5CWSA 2IANA 4N90E 2IF7A 2CRYA 4P5TA 5J89A 3MLYL 3HE6C 5ETUA 3WSQH 3H0TB 5F7UA 3QUZB 3V7AG 5M7QA 2NY5L 4OZIF 2GJJA 3DO3A 3W81A 1SYSB 4Y4KA 4F7EA 3DECA 2UZXB 4M5YH 5EO9A 2ADGB 2P46B 4GKOA 2BK8A 4IM8A 5DGRA 4P2RE 3A6OA 4NWUL 4PJ5D 4L9LA 3ULVH 2W60B 5DD3H 4GMTH 3FQXB 3JSSA 1A6WL 4LAQH 3MRLA 3VXTB 4HS8L 4LK4A 2H6PA 3IDXL 5D1XC 1A1MA 1YEDB 1T1YA 3GSRA 1ND0B 4OFPA 1X3DA 3WKMH 1TTFA 4XP1L 4KK6D 1S8DB 4QRPD 5TDNA 2Y06L 4FQ2H 4DN4L 1F4WL 1JRHL 1AXSB 1KTDA 3BP5B 4PJFA 5I1JL 2GAZA 5EZIL 3VFNB 2JLLA 3SDYH 3KPOA 4LASH 3L95B 4NQCD 4LQFL 1OAYH 4MWFB 4PS4L 4FQ1H 1GH7A 2FCBA 3QT2A 3WLBA 1IE5A 2DKMA 3CC5A 3VXUD 4DZ8B 1G9EA 5F3HA 2R1XB 3V6BR 1JWMB 4H26A 5BZWB 5L7XL 4X9IA 4S1RL 2C3HA 1JHKH 4FQQA 3BX7C 5DRZA 4JM4L 5D5ME 4PJHE 3C8DA 3CVHL 2EYTB 3D25A 3HCVA 4X7CC 4EUPG 4Y19E 3OR6A 2V5SA 3SDAB 2BOBB 3CU7A 5F9OH 4RZCA 4ZQKA 4PTUA 4MNHB 5EFIB 1LEGA 5F21B 4JREC 4W6YB 3ZDZE 5ISZE 4Y1AA 5J6GB 2RFXA 1VEOA 5JNYB 1CXHA 4TOYL 2AQ2A 3EOAB 2YD9A 5IW1A 2WP3O 5KG9A 1QFPA 1RHFA 4XPTH 3B2UD 4WFFD 5HSFA 2R1YB 1R5WB 4RIRB 5J57B 1NCDL 4P5TB 2XIDA 3G08A 4M6NL 4HKXA 5F7NC 4L3CA 2F54D 4M7LH 2XNAB 5I1GH 4YPGB 1NGWA 2LAGB 2B20A 1I1AA 3SY0B 3AGVA 1EVUA 2PCPA 3ZKNC 2HFTA 5ERWB 1Q1JH 5F7KC 4NZTH 3I6GA 1TZHB 2O5ZH 2XFXA 4N9GA 4K9EL 3ARQA 3O4LA 1JWUA 3IAQA 4QRTB 4DZBA 4LCYB 2UYLA 3ZL4L 4EVNB 1OF2A 2HH0L 4JM2A 5E8DH 5DUPH 3K4DA 4HCRH 5IJKC 2EXWC 5E2TH 5C09B 3QDHA 4CVXA 3TT3L 4V1DB 4P2QE 4XCFH 3SE3A 5J8OA 1EFXD 5J9PA 2DQHH 5IM7A 3GSRB 1IFHH 1IKFL 1JNJA 1QEWB 1GGBH 4Z8FL 4OD3H 3L7FA 2MKWA 4F37K 1QBBA 3LDBC 4LLUA 4XGZB 4EOWH 1CDBA 2YD2A 3UJTH 1DBKH 1KTDB 1FNFA 1F02I 2GAZB 1FSKB 1QHPA 1VHPA 3KPOB 5GS2D 4I18C 2ZJSL 4HGKC 4OCXL 1OP3H 3EYUL 4OCWH 5E8OB 1RUAL 1L7TH 4XP5L 1UJ3A 3L3OB 5EBMA 3Q6GH 4V2CB 5GS1A 4EBQH 1DEEA 3WLBB 5I6XB 1E4KC 4YNYB 3T3PE 4WV1A 2FJHA 4XTRC 1UWXK 2ORBH 4FQJL 4W4NA 1JZ3A 4JZNA 5DRZB 1T1XA 2OSLA 4FG6D 3D25B 3QPXL 3OR6B 1EJ6A 3DYPA 3RWEA 4PGEB 2C4FU 5DJYA 4M7KH 5ESQB 5HHXL 1ITCA 4JRXE 4NN5B 5HYJE 3MJ8A 4WTXA 5I18L 1MIMH 5IW1B 5SX5H 5CD5D 1JPFB 4X6DF 3C5JB 4CW1B 3FB7B 2Z92B 4E5XB 1G7LB 3HB3C 3VDAA 3DVGA 3JTCA 3SQOL 4ODTH 3N1FC 5AWNL 4Q58C 3O41B 1AXTL 2ERJC 1AO7D 3EOTL 2Q7YA 2VLMD 3BZFB 1JHLH 1NGZA 1S7SA 3X17A 5CD5C 5D7IE 2OTWA 4OGXH 4NO0A 5CHNB 4WI5A 3HLAB 1P84K 1CFQA 1S9YB 4JFFD 3HA0A 3U9UA 4DZBB 4ETYA 4JM2B 1ZT4B 3DX6B 1Z5LB 3TZVC 2HN7A 4YBLC 2CSPA 5IROC 1J1OH 4UV4H 4G3YL 5EO1A 1MWAL 1IC4L 1QSFD 2O5XH 4TYUA 1RU9L 5IM7B 1EGJA 4PJ9D 5KN5A 2DQJH 5IQ9A 4UIKL 3ES6A 1ZHBA 2PTUA 5C08A 1B0RA 4LLUB 3WFCL 1UZ8B 1G7JA 4GKNB 3HNVH 3MUZ1 3UC0L 3UTTA 2AGJL 5AUMB 4H1LH 4ZOAA 1KYOJ 2CRIA 4KKBC 4RGOL 4YE4L 3EZ8A 3RI5F 1MUJB 3CVHA 1MRFL 5DUML 4WGVB 1FIGL 4FP8L 3T4AA 2MQ0A 1A1NB 3HZKA 3FQTA 5IBUG 4PJ9C 1S7TA 2X4TA 4LKCA 4KRMB 1JZ8A 3FB5A 5IB1B 3B9KD 3HI6L 4G8GB 5T3XE 3S4SA 4QRQA 1T1XB 5D1ZA 2OSLB 3L5HA 1JGDB 3CD4A 3DX8A 4JO1L 5HDOA 3RVWD 4F9PC 3G5XB 4L8DA 4LLYA 3I6KA 2VKWA 5KVGH 4CRPA 3CFKB 3RWEB 2DYPA 5C09E 4D3CH 4IRSC 1A9BA 5FHBL 4HG4K 3KPRA 4X4XA 2R0ZH 4I8DA 4I77H 4KMTH 4L4VD 1FPTL 3B9KC 5IIEB 3FZUD 2ZZUT 2DLFL 3PNWA 2X9XA 3H3PL 5D7LB 4ZSOA 1A4JB 3D18A 2R23B 5I30L 4Z7OF 3P0VL 4RAVB 1AR2A 3BIKA 1ZLWH 2VLJE 3TGXA 3HC3H 4XBEL 5L2KE 3FTGB 1PEZA 1G6VK 2D31A 4WFHE 4XH2A 3BUYA 3QUMH 4QCIB 1CTNA 4DJMA 4BQBA 4ZUUA 1DL7H 5CBEA 1EXUB 5DJDA 3D39E 1S7SB 4MSWB 1F3DJ 5IVNA 4KJQD 2F15A 4XP9H 2BSRA 3CXDH 2XZAL 3FZUC 3MLWL 2V7HB 3BOVA 3A67L 4FZ8L 2OYPA 1MCQA 3I2CL 1CFQB 5KSVA 1N4XH 3LKPB 4YQXH 1JYXA 3OKNA 4OAWB 4ELKA 4XWGL 5DHVH 5DWUL 5EUOE 5FYJD 1LK2B 3EYVB 4R4FH 1GC1L 3MBEB 5DD6A 1F4HA 5AZEL 5F70A 1K3IA 1IT9L 4YHIB 5CJOL 3P3YA 4NKMA 4KJQC 3N06B 5IQ9B 3WFZA 3PJSA 3ES6B 5C08B 4D0BA 4YIQB 4Z0BL 3IVKA 5TDOB 3UTTB 2P5EE 1BD2A 5LWYH 4NQEE 3D3VA 3NIDE 5D7JD 3T77A 4P4KB 4FABH 4DN3H 3TA3A 4X83A 4D9LL 3CVHB 1NGYB 1ZWIA 3HZKB 1JGEA 4G6KH 3EOBB 4JEGB 4LKCB 1A5FL 4OF3A 4KTDH 2C26A 3S4SB 4QRQB 1VFAB 5CGTA 4Y4HA 2DTMH 4GXUN 5D7JC 2HFGH 3MRFB 2EIBA 3IFNH 1LK3H 3DGCR 3Q6FA 1VADA 3QBTB 4KTYA 4TRPL 2YZ8A 3PWVA 3U36A 1QRND 1KN4L 1BGXL 5D6CA 1ZVYA 3MV7E 3PNWB 3KYOA 4ZSOB 1RIVH 4MVBD 5BXFA 3D18B 1C16B 3G6AB 1IEBA 3B6SB 3MLSH 3BIKB 3SKNA 2DQCH 3P9WB 5JMOC 4AMKH 2BNUA 4YHOH 4LDLB 4XH2B 4NZUH 3AS3A 3OAZH 4OM1H 5DJDB 5GZNC 3ZKMC 1I3GH 2SEBA 4WHYG 3D69A 5DSCA 4PRHA 4GLRH 5EUKA 1BECA 2AXGB 3U4EA 1OSPL 4N8CH 4JFEE 2F8VA 4NRXB 3HC4L 4PRNA 4E0RA 5TFSL 3WL9B 4ELKB 1UA6H 1B4JL 1S5IL 4K07A 2VL5B 1MFNA 2GJ6A 4JQXA 2YD5A 3U7YL 2XQYG 3WNKA 1P9MC 3GMOA 1IKNA 2ESVA 5IVXA 2CR3A 3C5ZA 2NY2B 3CFIC 3OAUH 4OIIH 1OT1A 3LQZA 4M02A 3GGWA 2X05A 4I0PC 1QRKA 4D0BB 1I9RL 3E3QC 1DN0A 4P23B 1KEML 2Y5EA 4F9LA 3JTSB 4RMUA 4JFDA 4MCYA 3T77B 5LGJA 3UTPD 3SDXB 4ONHB 1LDSA 2BOCA 2FH8A 3TA3B 1C08A 1DLFH 2BJMH 4X8XA 4MZ3A 1HZHH 4DGIL 5BS0D 1QACA 3RU8L 1FVDA 3BP6A 5GZOD 1KENH 3DVNB 2WLYA 3HI1B 4PJFF 4HC1A 2IFGA 4JDZA 2QQLH 4JFYA 1P4BL 3C2SA 1CXFA 4CVWA 2CRZA 1G7PA 5ILTH 1A7PH 3MA7B 4ZS7H 3WHE1 3CLEH 3KLAA 4M1GL 3I6LE 2ZUUA 4QRUB 4NHUB 1VADB 2AEPH 4HUUB 1IGTA 3ZO0A 3GK8H 5DF0A 5A2FA 1MHHA 2D7PA 3ZHDA 4GW1A 1AI1L 3RVXC 3TLRA 3KYOB 1YQVL 2Y36H 3RWDB 5KVEH 2EDBA 1A02N 1MRCL 2CDGB 3PWPA 3LKNA 1Z9OA 3SKNB 2BNUB 1UM5L 4HLZG 4R3SA 3TYGL 1K4CA 3R0NA 2G5BB 4XC3L 5FV1L 2W59A 4J1UB 1QLRA 1R3HB 1YJDH 2BNQB 2SEBB 4OLZH 2QKIB 2MCG1 5EUKB 4EUPA 5E56A 4MXVE 1MWAB 3MUHL 2VXUL 3RUGB 3EJJX 2XWTA 1JIBA 3QDGA 3OPZH 3WNOA 1WZKA 4X6CA 4E0RB 1RZ8B 2NY1D 2V7NB 1V3LA 2Z31A 5F7DB 3PWNB 4D0DB 5ALCL 3AB0B 4FRWA 1T3FB 2GJ6B 3BWAA 1KCVL 3WDIA 1OLLA 1CICD 2OZ4A 4LEXL 1ZK9A 4ZDHA 1JTOA 3GMOB 1MCIA 5BRZB 4JCMA 1ZTXL 5JO5A 3UTSE 1INDH 3VRLF 4N0YL 2IAMD 4JM2F 3TF7C 2PW1B 4OFIA 1JPSL 2NY1C 1OQOA 4P2YA 3UTZA 3ME0A 3A6BL 4WGWB 3CXHK 2YPLA 1KC5L 5LGJB 2BOCB 4H25A 3UXFA 1CICC 3DROB 3IJHB 1QLEL 2OL3L 3VXSA 2BHUA 5DVKA 4XMLL 4HGWB 1RPQA 4Y5YC 1J0HA 5CINH 5DD5H 4NOFA 3RNQA 1FVDB 3LKRB 1FYTB 3IFLH 4Z7VE 3TCLA 4M00A 3BN9C 5EU7C 2XACC 1FG9C 1TJIL 3WBDA 4RWYH 2IAMC 5J1AB 3G9VA 5FIEA 4KMLB 3EDDA 5GGSY 5HHNB 1JYWA 1L0QA 2L0DA 2E7BA 5ACMA 4KUZL 3MX0A 2Y72A 4FFYL 1QR4A 4HDIB 4HIIA 4DKFH 1UCBH 3T3ME 5JXAL 1OT2A 1NLBL 3ETBF 1P2CA 4JZJC 4I9WE 4DAGH 3LKOA 4MXQD 1FZOB 3VXMA 4LHUD 3K0WA 2OI9C 1WC7A 4MNGE 4GW1B 1Q9KA 4K3GA 1A0QL 2DLEA 4R8WH 1UKQA 4G8EA 3MOBL 4BFEA 1P4LA 4RRPG 3SJVA 1BIIA 5C0GA 5CLTA 5DK2B 4X5WB 1C5BH 4ONFL 1CD9B 4JO3H 1FZKB 1FDLH 2X40A 2XTJC 3SDXE 2YPVH 5ITBL 3TBYA 5DJ6A 4QYOA 1QLRB 4MXQC 3KJ6H 2WP3T 4PD4K 3UPRB 5D1QA 4EUPB 3U7WH 2IFFL 3AS1A 4JFPB 4FXGB 5E4EB 1S9XA 1KPVB 4C56E 3WFDL 2QQNH 3ARTA 2DS4A 2DQEL 2XXMB 4NQVA 1LDPL 2VLLB 2JCCA 3VFSA 1I7RB 2PW2B 1YJDC 4OZGB 4QXGH 4TTDD 5I1AA 4QNPF 2XKNA 4JVUA 1CG9B 3OJ2C 5T1DL 1IAIH 4R2GB 5GPRA 1FAKT 5CJQL 3K3QA 1NCWH 1G9NH 4PREB 1OWRM 1N59B 1I1RA 5FECB 4LCWA 1J87A 4KQ3H 4L3EA 3DMMC 3GMPA 3CVIH 4J6RH 4HPYL 4QGYA 5E95B 3U46B 3ZT5A 3UTZB 4GRWE 4KPHL 4GMSL 1MJJA 2HP4A 2VZ3A 1NMBH 4X8JB 4ZO6A 2YPLB 4P2OB 1BAFH 1CQYA 3D1MC 1FNSH 3BZEB 3GSWA 4LIQE 1M05B 3RY6A 2H2PD 1PW3A 4RBPK 1P1ZA 3RNQB 1BBJA 1HINH 5B8CC 4DFHA 4CMHC 1Z9SA 3GZKA 3SKOA 1IGYB 3TCLB 5C2BL 3IFOA 1CF8L 1B6UA 3NA4A 4O51A 5IR1A 1JCKA 3ARZA 5L9DH 1U91B 3EYQD 4HS6A 3FRUA 5E6ID 2BP3A 1TETH 4NNXA 2CIIB 4HIIB 5T3ZE 4RMTA 1OB1A 4A2LA 2PXYA 3PV7A 2H2PC 1X5IA 4MJ6A 3UYOD 5HVWA 4IMLB 2PO6B 3VXMB 2V5TA 2J6EL 1DQJA 1WWBX 2Q20A 4WO4C 5JLZA 4YHLL 2BNRE 2J88H 4Q9RH 1YY9C 3UO1H 1P4LB 3F12A 1BIIB 3X3GL 3TO4B 3EYQC 2HKFH 1MFCH 5HDBF 3OJDB 2PYED 2EICA 4UDUA 3RFZC 5LQBL 3R8BB 1UZ6F 4KHTH 3EIFA 3KPNB 4WHTA 4Q97A 4F2MA 4ONGL 3STZA 3AC0A 5DJ6B 3OX8A 5E99H 5JIHA 5D1QB 2V9RA 25C8L 1WBZA 1KV3A 2E7CA 3H9SE 4JFOA 1PG7H 1AIFB 4JPKH 4LGSB 2NZ9D 2ICWJ 1NFDA 4X6BB 3S7GA 2JCCB 2A1WH 4RGNC 3SE9H 2DQGH 2OP4H 4F8QA 2RAMA 3JBG7 5I1AB 1IC5L 2FATL 4KTEL 5CP7A 4ELMB 4QXTA 1V7NL 4I3GA 3GJEB 4TSAL 2FR4A 1AKJD 1VGKB 1OAZL 1BQLH 3EO0A 2OL3A 1MJ8L 3HPJB 1RURL 4L3EB 1ERNA 1MPAH 4OFYA 3X13A 1MJJB 3VCLA 3WE6B 1DQLL 1QHOA 3FQRA 1J7VR 2MPAL 3K81A 3QWRA 2YEZB 1G9NC 4HWZB 4OJFL 5IT2H 1L8JA 3G5ZA 5L8LB 2AV1A 4GRLA 3IFOB 4XPGL 4O9HH 4XBGB 1JTTA 4YBQD 4KZEH 1IGCH 3RA7L 4G5ZL 4O51B 5CEZH 2BRRH 2YKLL 5FYLE 3CGTA 3LKQA 3WIHA 3KWWB 4HS6B 1U3YA 3PWJB 5MI0C 3WSQL 2E6QA 3K46A 3VXOA 1Q9LB 3MRHA 4OTXH 2GY7B 3L3HB 3UX9B 1DLHB 4QHMB 1BZ9A 1YPZB 5DJZA 3G5VA 4CADB 1KSRA 4R6UA 3KPSD 1UACH 4QF1B 5GXBB 4PBVC 4XAKD 4YBQC 1MREH 1XIWB 1AXIB 2QHLA 3P4MA 3CFBA 1LE5A 4HMEA 2X4OA 5D5MA 3T2PA 4PJHA 4U1SA 4UDUB 3IU3A 1YEEH 3PABB 3ULVL 5JUEH 3LEVH 4FMFA 2E6PA 4Y19A 1ONQA 2MQ3A 5DD3L 4NOBA 4GMTL 4F2MB 1TQBB 4LAQL 5ANMB 1KULA 3BKJL 4KDTC 4HBQA 5GGVL 4XZUB 5ISZA 1WBZB 4JFOB 1MVUB 4BQ6A 3QDMA 3WKML 3BPLC 5TGBB 3P77B 4TVPD 3KYNA 1V8HA 4FQ2L 3ARED 1XR8A 3F65A 3JV6B 1Z3GL 2CGRH 4LASL 4HEPG 1G0DA 4JGJA 1RUPH 2PYFA 3IXTA 4Q0XL 3RUGF 1AGEB 5K9KA 4KKLC 3QCTH 4O2EA 3H9HB 2OL3B 1TCRA 4EZMA 1TVHA 3CSYA 4XBPB 3QRGH 5F7LB 5GS0D 3QI9B 4LRIC 4Y4FD 5F7MC 1JHKL 1BPVA 4PYGA 3AREC 3VCLB 4GKZA 1I7UA 5IVXF 1OAKH 5LBSH 1EVTC 3WXVH 5D2NE 1GHFH 3ESUF 3T8XA 5F9OL 5T1LD 2AV1B 2V2XA 4JCLA 4CL7A 2PR4H 4PRDA 1BZ7A 2BVEA 3VXRD 3GM0A 4AM0B 5CEZD 2FSEA 1KB5A 5GS0C 4J4PA 5HHME 2RHEA 4TQEH 4Y4FC 4KK5C 4XPTL 4BSWA 2HA1A 1JF5A 4NFCA 5C6TH 1OTSD 5C0CB 5SWZE 5J11C 4YGVA 4JJ5B 1MFEH 5C0BD 4LSDA 3MFFA 3MRHB 1TMCA 4BFIB 1ZA6B 2FHCA 4M7LL 4F7CA 2KZ1B 5I1GL 3MRKB 1CXIA 2JE8A 4LBEA 2H8PA 1CN4A 1AY1H 2ZWLT 2KPNA 3UCRA 2F5AL 3DIFA 3TVMA 4NZTL 2O5ZL 2X4OB 1OTSC 3EHBC 4E41D 4U1SB 3RY4A 4WDIB 32C2A 1WAAA 1RJZA 3HRZA 3W9EB 3MZGB 3TC9A 5E2TL 4K7PL 3IDUA 4LP5A 4XCFL 3R1GL 1QKZH 3DVFA 4JRXA 2DQHL 3ROLB 5J7CC 1IFHL 2HJLB 4X7FC 3QDMB 1U8PB 1GGBL 3U4BH 5BJTA 4WENB 4WI4A 2OR9H 1ZGLA 4ZUSB 2IC2A 3UJTL 1DBKL 1F00I 5I2IA 2VLKE 4N1CA 1NC4D 2GIYA 4L8CB 5F44A 2AV7A 5DI8B 3NCYP 1KCGC 4OCWL 3PL6D 4N0UB 1HQRB 5C86A 1CTOA 4EBQL 2A9NH 4O2EB 3BJ91 3VH8G 4X6CF 4GJTB 1TCRB 3CSYB 2DIBA 4CN6A 3DVIA 2ORBL 5D7IA 1ORQA 3CMOH 1DBBH 2FHBA 3HE6B 1RZGB 3RWHA 2RGSA 3VJ6A 5EOCH 1I7UB 5E0QA 2Q8BH 3ZTJG 1NFIA 1S7RB 3PL6C 3EYOA 2ZOKB 5EU6D 3F7PC 5GRJH 1WBYA 5HYEA 4M7KL 4C54A 2W65A 4ZD3H 3ARDD 4M8QA 3KPLA 2DLHA 1MIML 4YBHA 3QEQE 1DR9A 5J3HD 3G6JE 5BOPA 1MI5D 4ISVA 4GLRI 1NEZG 3DTXA 2KL6A 4C55A 5A43C 2IWGA 1MOEA 2Y23A 3BSZH 3BQUC 4FTVE 4CMMB 4LBEB 4P99A 5ACZA 4OFVA 3OJMB 1MSPA 4Q6IA 1RUMH 3C8HA 4BKLA 1FNGA 1XZ0A 3BAEH 4M5ZH 3KLHC 4MNQB 4OGXL 3ULUH 4YLQT 4BFBD 4ZOCA 2VR4A 1I9IL 1G7MA 1T7YA 3RP1A 4HJGB 1S9VA 5AAWA 3CH1A 1YN6B 4B50A 1QLFA 2IPUK 3MCKB 1Q9WB 3U1SH 3U2SB 1X5ZA 1QSZA 5FOBB 5KBNC 4WFED 1EHAA 1FGVH 1J1OL 1RK1A 5IMKA 4UV4L 1X6LA 3X12A 1D9KC 1FJ1B 1Q0YH 3MZTA 2HTKD 3OWEA 3S37X 3QCUH 2VMFA 5K9QG 4MDIA 1DP0A 3WIIH 1T22A 3VWKA 5BJTB 3BRFA 3KPQA 1ZXQA 1ULVA 2COQA 4U3XA 4MLSA 4ZAKA 5HHOB 1MCCA 5C0CE 1R0AH 5HI5D 3QZWB 3VI3E 2W1NA 1BOGA 1JVKA 3W2DH 3KXFD 1KLUA 4LCCC 4WW2B 2IMMA 4CJ1A 5D9SA 3IU4L 3MNVA 3UZVB 8FABA 3QH3A 4S1SH 3D39A 3MFGB 4Y2OA 1OTTD 2JCCF 1Q38A 1G7HB 1ORQB 4HWBA 1J8HE 2B4CH 5HHPB 2M2DA 4JY6B 2EH7H 15C8H 2ZCLH 3BKYH 4KVCH 4Y2DA 3RGVA 5EUOA 5KVGL 3MRPB 3WJLA 1SEQL 4DCQB 1FL6A 4JANB 4D3CL 2FIKB 1WBYB 1JTPA 1M7DB 3MGOA 3SDDA 2R0ZL 4I77L 4KMTL 3KPLB 1OTTC 4Z7WB 3WN5C 3H8NA 4X5LA 4MJID 5E03A 4YHNA 1FO0H 3VD5A 3MRNA 4OSUL 1ZT7A 4F33B 1T0MB 2DWDA 4NO2A 3DTXB 2P5EA 5T1KA 4NQEA 1TIUA 43C9A 1NGXB 4X6EB 3HC3L 2OTUA 3RZCB 1U41A 1NBYA 4ZXBC 5DUBA 1E4WL 2EYRA 3BO8A 3VXNB 3O9WC 4N8VG 1OSZB 4M1CC 4XXDA 5I17A 3VMOA 4BKLB 1RJYA 5FF6B 4XP9L 3ZE1E 2X42A 4XC1H 2QEJA 3HG1A 1N4XL 1G7MB 3OB0H 4YQXL 4MAYC 1I4FA 1YPZF 4LSTH 1FNHA 3C8KA 2JELL 3PQYA 1RJLA 1RK1B 5IMKB 4R4FL 3RIAF 1I8LC 2FO1A 3O3EB 4OLXH 1JWSB 4XNYH 4ODUB 1FFPA 1VGEH 2EO9A 5EOQH 4FQXC 3VWKB 1ADQH 3IFPB 2DB8A 3MV7A 5HD8D 4ZAKB 3O2DH 5SWQB 1NCAH 4KJWC 3GJFH 5FUZH 5LWYL 1HHHA 5GGTA 2FEEI 2AJSL 4ETQA 1UXSB 4CVZB 4DN3L 1KPUA 5F8QC 3RPKA 1PKQB 4IOSD 3MNVB 4U6HB 4G6KL 1CVSC 4LRNL 2AERT 4PJ5E 4R4BB 2E9JA 4KTDL 5HD8C 1FV1A 4JFEA 3GI9H 3QA3B 2DTML 1UKTA 2CPCA 4Y2DB 2OJEA 2HFGL 3RRQA 3P9MB 3IFNL 3QUYD 1LK3L 4EIGB 3CJJA 4XNXH 3OXRA 1HKLH 3ARWA 3MGOB 5K9OB 2GSIA 1XCTA 5GSVB 4XNZB 4JE4B 3TBVB 1GZPB 3OV6A 4TNWF 3WUZA 4NQCE 1EEYB 3TZVB 3MRRB 1E28A 3RWCA 4MDJA 4NSKB 5A3ID 3AROA 3P9LA 5T1KB 4RFEB 2DQCL 2QSTA 5E8NA 3ET9F 4AMKL 2GTZA 1G6RH 3JWOC 3QUYC 4YHOL 1IAOA 1NBYB 5ADPH 5J06A 3MJ7B 3QIWA 4PJGA 4OM1L 3W0WD 4PBWD 3F62A 4XXDB 3V52L 4L4TB 3F7VB 3RPIB 3L3KB 2D0FA 4P3DB 2H45A 2VNCA 2ARJA 4JFZH 1CDCA 3DYOA 4MQ7A 3P73A 3VRJA 4N8CL 3TYFA 2IG2H 2E9WA 1I4FB 1UA6L 5IG7B 3C8KB 1CE6B 2NMSA 3BPOC 3LOWA 4LLQB 5KS9E 2NNAA 4MJ2A 4WFFE 4LKXB 3BZ4A 2A74A 3OAUL 1EO7A 3D0VB 5D5MF 2GITB 3TN0C 3JV4B 1F4YH 5E2VL 2UVFA 3D0LA 3TNMA 1P69B 2KKQA 5LVEA 4AEFA 3QFJD 1IZJA 1AE6H 1HHHB 1QO3B 3WNLA 4A6YA 4IRSB 1GZQA 4ETQB 1U95A 1KPUB 2BJML 3U0TA 4R97B 5JTWA 2ENSA 2P45B 4E42A 2VXSH 4N1HB 5IJVB 3RTQC 1L0XA 4ERSH 4V2BA 5MEPB 1KENL 5EBGA 3V6OA 3FB6A 2LVEA 5E9DD 3E8UH 1MCRA 2CKBH 1FV1B 3FONA 2VQUA 3GMLA 2QQLL 3MV11 4Y16A 4JHAH 5C3LD 4MMZC 5ILTL 3SO3C 3CPLA 4ZS7L 3V0VA 1IM9B 3MYJA 3CLEL 4RDQF 5IB2A 4LL9A 1KB9K 1XCQA 4TSBH 4DK3A 4AENA 2AEPL 1NUGA 3QG6A 3GK8L 1MHEB 4MXWL 3UTSA 1Q0XH 2FEDC 2GSIB 3SDCB 1MCPL 5T33H 2WUBH 2JTDA 1JHTA 2AXJA 4OZFH 3O6FC 2Y36L 5KVEL 1E28B 3LMJH 2EDEA 2UZYB 3CAFA 2RQ8A 3P9LB 5CEYA 2Q6WA 3TT1L 1R3IL 3MLXH 1JI2A 1EERB 1IGMH 1FORL 2GTZB 1IAOB 2YC1A 4AEHL 4ALAH 4PGJA 5HPOA 1TZGH 3QIWB 1N7MH 5DRNB 2B0SH 2EIZA 3QHZH 4OLZL 3J7HA 1XF2B 4MQ7B 1JGUH 3P73B 4GBXB 1DE4A 5MEND 3TYFB 1VSCA 5HI4D 5I19H 1L9NA 3BHBA 4UILL 5DMYA 4QOKD 2VE6B 2DLGA 3T3PF 5IQ7H 5HJ3B 1FC1A 4PJAE 2NNAB 5LAXB 4H1LB 3RZWA 3BZ4B 1M7IB 2EKSA 3DXAD 4H5SA 1FH5H 5FDWB 4BZ1H 4YDLB 1RZIA 4MNGA 3O3BB 4FFZL 3UJJL 4HLJA 5DMKB 4U2YA 5HI4C 3D0LB 3TNMB 3MV9D 4P4RA 1WAAF 4YPJA 2BCKA 2ICWA 4P59H 2VLME 5GGUA 3O8XD 4L9DA 4MD5B 1U95B 3CSBA 2WUCH 3U0TB 1HSBB 3LEXA 5CINL 5DD5L 3N1PC 4XHJD 1MEXL 2EO1A 3MBXH 4PJ8D 1WZMA 1D5IH 4RWYL 2E7LA 4P5KA 3MXVH 4WWKD 3FONB 2FEEL 5IB3B 3W5MA 3SKJH 1U8NB 2NY3D 4ZFGH 5GIRA 4Y16B 5BCAA 3O8XC 2FGWH 3EYFA 4NQDD 4DKAA 5IW3A 4OLWH 4DKFL 1UCBL 4KI5D 2A9MH 1U93A 5LGHH 2FO4A 3TH2T 5CJXC 4XHJC 3FRPA 3QG6B 4DAGL 1OARH 4PJ8C 4LCIH 4QHNB 4NUGH 3V5DA 2YA0A 4PJ7B 3CCHA 4U4BA 4TVSa 2OXHA 1HHKA 4WWKC 4R8WL 1BX2B 3O81A 4H8WC 4LVHC 5L2JA 2DQFA 4F7MB 4P48A 2G60H 2H1PH 4U7MA 1C5BL 3VH8A 4JO3L 4QWWD 5C0JA 1FDLL 2C3VB 4KI5C 4ODSH 1RMFH 43CAA 2YPVL 5KZCB 3I84A 4QHUA 4P2RD 1WEJH 1ES0B 3QIUB 3VGDA 5DHVB 4I0PB 5FM5O 5JW5B 3VWJB 2VQ1B 4OIAA 2W38A 3O45A 1UEMA 3AAZA 5HVGB 2DBLL 2NXZB 3U7WL 2VLRB 3Q5TA 2F58H 1QBAA 2QQNL 4IOIA 4YFLI 2CR6A 3T0EC 2XWBA 3A6CH 3BHBB 4WTWA 3ULVF 4QXGL 5DMJB 1IBGH 4JO2H 4JR9H 1XR9A 1NQBA 1Z0MA 2IQAA 4UQ3A 4PRBA 1G9NL 2EKSB 4XMKH 3N85H 1RZIB 3KYMA 3C2AH 3C60D 2YSSA 4KQ3L 4APQD 1DVFD 3CVIL 4J6RL 4P4RB 1T0NB 4R0LC 2EDWA 1P7QA 4PRIB 4N0RA 5DJ8A 1NMBL 1FFRA 4LNVA 3BD3A 4JDVA 5JHDD 4JB9H 1GSMA 1IRAY 1BAFL 2Y1VA 4X6FA 1FNSL 1XH3B 3SGKC 1A6AB 4RMQA 4Z5RB 1DUYB 1MHPH 3CX5J 1HINL 3CZJA 1ZLVK 1BHGA 5H94B 3VE0B 1AC6A 1U8JA 5MEOA 2X1WL 1NC2A 1HIMH 4KV5F 1P7KB 2CO6B 5GJSH 3H9SA 3C60C 4K3DH 5FYJE 3TCXA 2F74B 4APQC 4CDGC 4OV5B 1DVFC 3T0AA 4UUJA 4OLYH 5L9DL 4U05A 4RGMB 3ILPA 3QIBA 5E1AA 3I3EA 1TETL 1QZ1A 3IJSA 5IF0A 1ZA3A 2RB8A 4OCRH 1D6VH 1T1ZA 2EKJA 4KUCF 5FGBC 1QP1A 4QRRA 5HPMB 5K59E 1YQ2A 3MRGB 4OD2A 3QQ4A 3AM8C 4AZ8A 1W0VB 4P46A 2IQ9H 1UQSA 4LDEB 2J88L 4Q9RL 4M8VA 3UO1L 2AABH 5C0AA 4ZTPL 1OP5K 2HKFL 3VH8B 1MFCL 1YEGH 1J05A 3BP4B 4UI2A 2EE3A 5C0JB 3DX9A 2AS5M 4KHTL 1EJOH 2Z35B 5D6DC 2ICES 2ATKB 3EO1A 2FBJH 4J3SA 4AL8H 5IGXH 2XA8H 4YHKL 2X4SB 5E99L 1C5DA 1CL7H 5DVMA 3FFCA 3VGHA 1JF6A 1PG7L 1VFOA 4JPKL 5J0BA 2WINB 5KVMC 4IOIB 5KSAA 4P2QD 3VXPA 3FJTA 2A1WL 1IQDB 3WO4C 3SE9L 5JXEA 1M6OB 2DQGL 2OP4L 3HC0A 3SCMA 1QRNE 5I8KH 1RQ5A 2APBA 2F53B 3U4AA 5KTEH 2NXYB 3VFUB 1XR9B 1A4KA 5F7FA 2IQAB 4HS3A 2FX8L 1XGTB 4JVPA 5F9WC 1FVEA 2HT4D 4NO3B 1BQLL 5AD0A 4PJXE 3HRPA 4X4ZA 2AXFA 2ZOLA 4MQXD 1ETZB 2Y5TB 2Z8WC 1MPAL 4R26H 5DEFA 4Z6AT 1XGUA 1P7QB 4QTIL 3ILQC 2YD3A 5BMFL 5GGRA 2IBZY 5IV2A 1C12B 2DM4A 3MO1B 1MH5A 4PP2B 3EW3B 5LG1A 4YR6A 3MJ6A 4P57A 1RJCA 5IT2L 4Y88A 1R6VA 3G5YB 4U1LB 3E3QE 3QULA 1U8JB 2BY3A 2I5YH 3QUZC 4Z9KB 4O9HL 4MQXC 4OLEA 2JB6A 2ICEA 2P5WA 5HGHB 1EHLH 3BIAX 3QB7C 1G7QB 2BRRL 3MV8B 5HVHB 3NGBB 5HYJD 4WI3A 1UWEH 2OM5A 4AH2B 4WW1B 4HGMA 2Q3ZA 2JJTC 3C6LD 3T08A 1BM3H 1ZV5A 3VG9B 3QXDB 4OTXL 4OLUL 3VDCA 2MNUA 3ZYZA 4J3VA 4LSPL 1T21B 4OD2B 3QQ4B 1UACL 3VFRB 1IGIH 5I76A 4P46B 5EIIA 1E4XH 1MREL 1PD6A 3WUWG 1JZ7A 1GVIA 3KS0H 1J05B 2J5LC 4DUVA 4AK1A 1YC7A 1YEEL 1HNFA 2XQBH 3LEVL 5HYIA 3K8KA 4Y7MA 3DETD 2H2SC 3B9EA 1B88A 4FHBD 1C5DB 1SHMA 3FFCB 4HQQH 3SDAD 3WFHB 5JOPD 2BFVH 5HHMA 4IIQA 5MERA 1R5VA 5KSAB 1BVLB 1VB9A 3VXPB 1U0QA 3GSQA 4PJGF 2EH8H 3JWDL 3HC0B 2CKNA 5SWZA 2HFFB 3S35H 4GXVH 4NRYA 2CGRL 4CMHB 1LP9A 5FGCB 3SGJA 4XHQA 3S5LB 4EI5B 2F9BT 3HMWL 1KNOB 4Y8AA 2I9TA 4HS3B 3QCTL 1FVEB 1NCTA 3QXUA 3V2AR 5AD0B 3LN4B 3FQNA 2ZOLB 3QRGL 5DJCA 2YHGA 5JHLH 1TVBA 5FYKD 3PP3K 2HAZA 1DQMH 2C3XA 4G6FB 1VFBA 5GGRB 4MGXA 5IV2B 1MH5B 3MSPA 4JG1H 1OAKL 2WANA 5LBSL 1FLTX 3QNYB 4YR6B 2G75A 3MQIA 1FGNH 1IAMA 2WBJA 4NM4H 4TSCH 3WXVL 4WO4B 1S9WA 1EAPB 1GHFL 5JQHC 4JO4H 4M7ZB 4OI7A 2EDYA 4NUJB 4X4MA 3PWUA 2VZ1A 3ARFD 4P5TC 1VKXA 4U6XA 3QULB 2RBLA 2PR4L 3HZVA 4M3JA 2JB6B 2AEWA 2P5WB 4TQEL 5FAAA 5C09D 5KVFH 1CT8B 4V1DD 1S7XB 1QBLH 4LPWA 5C6TL 2GHWB 4UMGA 4K3JH 4M1DH 2VLKA 1DUZA 1E6JH 1MFEL 4O02H 1HK6A 3OKLA 5FB8A 5EU7E 4PDCE 4LHJB 1CXEA 3K74B 2A83B 3PIQB 4BH7A 4IRJA 1GOHA 2MJWA 5L2KD 1XGPA 1CLOH 4WFHD 5BVJB 1DBAL 5KSBA 1WTGT 4JPIB 4LPTA 5DC0A 4JKLA 1MLBB 4YWGH 2QJDA 3GMNA 3S36H 1EO8H 1PZ5A 2AEQH 3FN0H 1Z2KA 3ARBA 3T65A 2QSCL 3E6FB 4PJ7F 1NBZA 4S1DD 3BISA 1FSKC 1QKZL 3W39A 4DWHA 4TNWK 1BREA 3U4BL 2XTJE 4RSVA 5I6XC 1R5VB 4PTTA 1T66D 4I4WA 3MV8E 2OR9L 1FG2A 1SEBA 3GSQB 1CLYH 5ID0A 2JJSC 1NCBH 1LP9B 3ARVA 1L0YA 4WEBH 5E94A 3UTQB 5E5MA 5HY9A 1PJ9A 4JQVA 3VXQB 4E9LA 2GQHA 4FTVA 1MFAH 3D2UA 2A9NL 1SJVA 4UT6L 1G84A 2VQTA 3WIFA 3FQNB 5CZXD 1EDQA 4ZPTB 4XVJH 1TVBB 3CMOL 3CDGA 3RL2A 4NN5C 3QFDA 4QLRA 5EOCL 3OF6A 5C07A 4NC0B 4CU7A 5H37G 2Q8BL 4JY4A 4MYWB 3PWUB 1XGQA 4JFQB 4YEFA 2YBRB 2CLRB 3DGGA 5CZXC 2BHYA 3DPBA 2VISA 4AT6B 4RX4D 4L8SA 2PTTB 4XP1H 1V3JA 2RIKA 2Y06H 4MAUH 3U79A 4DN4H 1F4WH 1JRHH 1KCRH 2WAHA 4PB9H 3HUJA 4JN1H 1CFSB 1MF2H 4LLVA 4ORZC 5FB8B 1TXKA 3WEXA 1EGJH 4LQFH 3BSZL 3K4AA 3VMNA 3S96A 3BPLB 4JM2C 4BH7B 1LNUA 1RUML 1YN7A 4HH8A 3BEVA 1YEHL 5LJYH 5E8PB 3BAEL 4M5ZL 3V0AC 3ARRA 4MS8A 4NJ9H 4X9HA 5KSBB 3ULUL 1DQQA 1F11A 3SE3C 4HT1H 1J8HA 2R4SH 1UH4A 3VGEA 3L3JA 1N5YH 2HYMA 3WHXB 3GBNL 3CVHH 1J8KA 4MX7B 2P8MA 5LGKA 4ODWB 3U1SL 4G8GD 1NJ9B 1FGVL 1LD9A 3T65B 3NMEA 3SO5A 2FBOJ 1NCCL 4WU5B 4S0TD 1Q0YL 3QCUL 1MAMH 4PR5A 3TESA 3WIIL 1DDHA 5GS1C 4OGZA 5E2JA 4IDJH 4K94H 3MRDA 4K8RH 1X5YA 4WV1C 3TFKD 2YRZA 5FFLA 3RX7A 3VD7A 2GK0A 2H9GB 1K2DA 4S2SB 5I16A 4M6NH 5T5NG 4UBDD 1RHHB 4HPOH 3W2DL 5E94B 4PGCA 5D7LD 5HY9B 3ROOB 3MRJA 5E5RB 1IMHC 4HBCH 1SYVA 2XN9E 2D7TL 2AJ3A 4R9HA 4RGNE 3O3AA 3C6SB 3TNNA 2G9HA 3KPPB 3CDGB 1MJ7H 2B4CL 2Z93A 2EH7L 15C8L 3PDDA 3ZL4H 2ZCLL 3BKYL 3BUTA 5C07B 4UOW1 1C7SA 1CD1A 3T0DA 3HR5B 4FFVD 1A6TB 3GUTA 1JPST 1QTYT 5F72S 4XI5D 4PJDE 5JOFB 3AMLA 3I6LD 4YGAB 3MBED 2VISB 1FO0L 1WCBB 1H15B 2VABA 5DK0B 1P5VA 1HEZB 4XXCA 1D5XB 1P6AB 4WTZG 1OAQH 3KHOA 3FT3A 4Z78A 2VXVH 4LPXA 3TPUA 3HUJB 4UDTA 4D2NA 3IDIA 3ARGD 3WEXB 1CBVH 3PV6A 1RUAH 4GRMA 3S96B 1ZS8A 4DEPC 1FAIH 4P4KD 1B4RA 4KY1H 5IVOA 3MBEC 4PJ5A 4LPCA 3EAKA 1DQQB 3L9RB 4XC1L 1MELA 4FZEH 3PE9A 3L3JB 4IJ3B 3M45A 4QY8A 4F3FA 5GSRB 5B4MD 5ESVA 3IJYA 1IAKA 4LMQE 2X4PA 3QJHA 3LSOB 5IVZB 2QQQA 5F88B 1VPOH 4BSVB 4OLXL 4XNYL 4QRPA 3MRIA 4P4KC 2E8YA 4LVOB 5JQ6H 1FZJA 1AJ7H 1VGEL 5EOQL 4JHBA 1GL4B 5I18H 1ADQL 4HAFA 3O2DL 1NCAL 5FUZL 1YEKH 2L7UA 4R7DA 5B4MC 5I16B 3KPSE 3VXUA 3B8YA 4XAKE 5AWNH 3HE7B 4PGCB 4DKEH 3BXNA 4Z7NF 5D2LE 5ECJE 2ZG3A 2AJ3B 1OTUC 1KIRA 1R3JB 2R15A 1UGNA 1A6ZA 1U8KA 2XG4A 4F57H 3TNNB 3HFMH 3D9AL 2X7LB 2XT1B 2VERN 1LEKA 4O2FA 2I60H 1PBYA 2BVPA 1X9QA 2L4OA 5BW7A 1CD1B 3FHQA 4OB5H 4Y8DC 2BY1A 4XNXL 3GUTB 4MHHI 1HKLL 5KS9A 4KH2A 1LO3H 2I9LB 4K9EC 2R0LH 1QA9B 3DARA 2VABB 3GDBA 2F54A 3PUCA 4I9WD 5CMAB 3MLTA 5IJKA 2NY2D 1PQZA 4IS6A 4Z78B 4U1HA 1DN2A 3PWLB 1BBDH 4WUUA 2DD8L 3IDIB 3QXWA 3HZYA 4FXKB 4RGOH 4YE4H 5J56B 2W9DH 4P23D 1ED3B 5JR1L 1AHWA 3T09A 3FCTA 4GRMB 4ZUVA 1FIGH 1HHJA 1TNNA 4EI6A 2X1OA 3QDJB 5JW4Q 5ICXA 4AQOA 4O2CA 4JFZL 3SEPA 3MRMA 5DQ9A 2HWZH 4I18A 3QXTA 1UENA 2YUXA 1YMME 2IG2L 4U6YB 1HKFA 5HGDB 5BZDA 4JO1H 4WI2A 5DMGD 3T2QA 3IJYB 1E4KA 4MD0B 5HHQA 1EFXA 3QJHB 3VXRE 5CEZE 4OUUB 4C56D 2F8OA 5I9QB 4P23C 5D93B 5J6HA 4WI7A 3W9DB 1KJMB 4DVBB 4CNIA 4HC1H 1X7QA 4QRPB 5F89A 5FHBH 4OQ1A 3MRIB 1TTGA 3P30H 3TA3C 4HF5H 4LHUG 1CFTB 1QR1B 3V0WL 2ILLA 1S7WB 4NM8L 5C0BE 1HYRC 3IT8D 4YHPB 2DLFH 4R96A 2X4UB 3H3PH 3FO9B 5CKAA 5DMGC 4R7DB 4J8RB 4R7NA 4NT6B 3VXUB 3GSXA 5C0NC 2AI0L 2DKUA 3T4YA 3WUWA 4LGRB 2HRLA 4NBXB 2VXSL 2AJVH 4EJ1C 2BMKA 3BEWA 4ERSL 1KIRB 8CGTA 1WFOA 2XZAH 3E8UL 1KLFA 2CKBL 2VYRE 3CZFB 3I2CH 1LP9F 2BNQD 1LEKB 3FQWA 4O2FB 5FXCH 3NCYS 1RFDH 3PHOA 3E2HA 1U3JA 1G1YA 2X1XR 4XWGH 4K7FB 5C0IB 5FK9A 3FO1A 3B83A 1LO2L 2BVTA 1Y0LB 4EUPH 2EE9A 3EGSA 4F58H 5DDHA 3I9GH 4H88L 5AZEH 4PJAA 1QSEB 1K8IA 4KVNH 3NFPA 1Q0XL 5FKPB 3IS0X 3RL1A 3MJ9A 4LCUB 2P8LA 1HXMB 5T33L 5T3ZD 2AK4E 3S3PA 4EN3D 3SPVB 3V5HA 2X2YA 3V4PL 5BRZD 2F54B 1KBGH 4EQ3A 4J3OC 3LMJL 4Z0BH 5IROA 3K8LA 1WGOA 2OZ4H 1AO7A 4IS6B 4QXUH 1MAKA 4U1HB 3MLXL 1F6AB 4PFEA 1JPTH 1IGML 4WUUB 7FABL 1OP3K 2BNRD 2EDTA 3VFMA 1HQ4A 4QEGA 4ALAL 4D9LH 1TZGL 1AHWB 1LO0L 3CUPA 1N7ML 2A6KA 4JLRA 2B0SL 1JV5A 3IDGA 4JFFA 1XF4A 3P40A 4JQXC 2R2EA 3NH7H 3ULSA 1IKNC 1JGUL 2GFBA 4OZHB 5B3JF 4U1MA 1AD9A 3TO2B 5EU6E 1FYTD 4TUJB 1HI6A 1QSFA 1HILB 5HHQB 3OZ9H 2FJFA 2H32A 3FB8A 5IQ7L 4PJ9A 3JTTA 3REVB 4F9LC 4KC3B 3QEGH 3Q1SH 4JJHA 4CNIB 2ED9A 5CBAA 2CDEA 4XVUD 5KSBF 3MMEA 3V4UL 1F3JA 1FH5L 4BZ1L 2OMBA 4M4PA 5SX5K 1KN4H 4F9PA 1KPRA 1IILE 4P59L 5A2LH 4IEFB 3LCYA 1B0WA 2FX7H 1F5WA 5A2JH 2C4XA 5TDPB 2WUCL 4U1JA 2VDLL 3CFDB 3P4NB 3B9KA 3WUWB 4XVUC 2ZCHH 2BMKB 2YD6A 3MBXL 1UVQA 2E6JA 3FQUA 1A1OA 4LEOA 1T2XA 3MXVL 3T1FB 3DV6A 1RVFH 3EYSH 2V2TB 4WFEE 3VI4F 1OSPH 3SKJL 1F42A 4ZFGL 3FQWB 1EEQA 3E2HB 3IETB 5DJ2A 3STLA 3ZZ1A 5T1MA 1FO0B 4NN7C 4JRYB 1B4JH 2GCYB 4OLWL 1P84J 1BEYH 3FOMB 2A9ML 4OI9A 4L4VA 5LGHL 3U7YH 3NN8B 3RAJH 5ALBH 2NY7H 1FFOB 1D5MB 1K8IB 1QG3A 3PGDB 5F7WC 3RL1B 2V2WA 4LCIL 4NUGL 3REWB 4H0IA 3WKNA 4BSJA 1CWVA 4R2GD 1I9RH 3KXFE 2F5BH 2G60L 5GJTH 1AO7B 2HLFD 1GC1C 2H1PL 1J5OH 2UUDH 5E4EC 3IDNA 3RGHA 1YEJL 5IFHH 4ODSL 1RMFL 1MRDH 5IMLA 3BKCH 5CIPA 3TPKA 1KCLA 1WEJL 3TN0B 3MRQB 3RU8H 4P2OD 4JFFB 2W0KA 1CZ8H 1XF4B 4BFGA 4U1NB 2YK1H 2R2EB 5INCA 4OZIB 2E9BA 4I2XB 3DO7A 2MWCA 12E8H 2F58L 4FFWD 4R2GC 4OKVB 3HUJF 4YX2L 3GSOB 2P24B 2DOCA 1AD9B 2HLFC 3RDTB 5C0FA 2IH3B 5F71A 1QSFB 4FA8A 4YAQA 1U92A 5FO8B 1HDMA 5EBWA 3RTQB 3O0RH 1F4XL 4PG2A 1I1YB 1IBGL 4JO2L 2IH1B 4DW2L 4G8FA 2J12B 3ZDXE 5CBAB 4P2OC 4F8TA 4BJLA 3MMEB 3VGBA 5CJ5A 3WXWH 4XMKL 5I1EH 3N85L 3QUKB 4NO5B 5CAYB 1W72A 3C2AL 2XWJB 5D7JA 3ISWA 4FFWC 1KPRB 1ZAGA 1UB6B 4HG4J 4LVNB 1YQVH 3V5KB 1HXYB 2PO6D 2Q76B 4PJEE 1ZLWK 5MP6H 2BSTB 2D2OA 2HT2D 1BZQK 3TJHD 2FGZA 3TYGH 3D85D 3GMMA 5F9DC 3E6HA 3TO4D 1L6ZA 2Y7QB 3OKKB 1J1PL 3OG4B 1XGYL 4JZOA 4XC3H 1MHPL 2C1OA 3O6FB 3MXWH 4HEME 4YFLF 2CUIA 1HIML 1U8QA 4XCYA 1A1OB 1T4KB 3B9VA 1BQHB 4HX1A 4K3DL 1ZMYA 4OLYL 2PO6C 2O5YH 3QISA 2LU4A 2CDFA 5D1QD 2HFEB 5DJ2B 1BIHA 5T1MB 1H8NA 3TJHC 3RWIB 1JF1B 1QRNA 3BW9B 1KLGA 3TO4C 1T7ZA 1XF3A 4LEXH 5HYSB 1JK8B 4OCRL 1D6VL 4MVBA 4M43H 4PJXA 5IMMA 2CD0A 2IQ9L 3WNMA 1JPSH 2FD6L 2KZWA 2AABL 5D1QC 1S78C 5EU3B 4G59A 4LLWB 5B39G 1YEGL 1R24A 3CFEB 5EU4A 2XKUA 4OZ4B 4L3ED 1EJOL 1LGVA 1KN2H 5CIPB 2E8ZA 2OL3H 4R4ND 1XF5A 3LQMA 3SBWA 5C8JA 1JPGA 3HNTH 1MHCA 2FBJL 4ORGB 1A3QA 4AL8L 3E3QA 5IGXL 2XA8L 1OWWA 4XWOD 4I48A 3V6FA 2A6IA 4PJBA 3OHXB 3DO7B 1TJIH 3BESR 5SWSB 3ZHLA 1U3ZA 2XV6B 1SBSH 4KI1A 2EZ0D 1HDMB 4GFTB 4JRYE 1AGBA 2YA2A 3KAAA 4S0UC 4QT5A 2VXTL 4XX1E 5HGAA 5KTEL 2MQCA 4JKPH 3GSUA 3EO9L 2BRQA 2Q8AH 4WTZA 3QDAA 4XWOC 3W82A 3WIHH 3VW3H 1A6PA 4HUNB 2EEDA 4MQTB 3RY6C 3WO3B 2LFGA 4H0GA 4BZ2L 4CKVX 1T89A 3MOBH 4R26L 3W0WE 4RAUB 2EZ0C 3FO2A 5BS0A 2CKBB 4GSDL 2N4IA 1XIWD 3U83A 1X5GA 5I8OL 1S9KC 3OAZK 3QEHB 4JZOB 1U3HB 2HG5A 1RV6X 1FL3B 3BD4A 4LVHB 2I5YL 4BK4A 4POYA 5KANG 2IFFH 5ICYA 4NPYB 1M4KA 3WFDH 2NR6D 2DQEH 3I75A 3OKMA 2V9QA 1UWEL 3BWUC 3RWFA 3DOSA 4X0KA 1CDUA 1XIWC 4OZFB 3S8WA 2A6DA 3F7QA 1DFBL 1KLGB 2NX5B 3ERYA 1XF3B 3L3DA 2YZ1A 5FOJA 1BFOA 1JYNA 1SQ2N 3OR7B 5FGSA 3QFJE 1HSAB 1CDHA 1IGIL 3Q3GA 3QUXB 1W0WA 5E24E 3LV3A 1T5WA 2VAAB 3BDBA 3SE4A 4GMSH 3SGDI 4NWTH 1R5IA 4OQTA 5EU4B 4G8IA 3ZYOA 1GPOL 2GY5A 3QI9D 3WMSA 2EXYD 4I0KA 5E70A 1MHCB 3P11H 3TF7A 4GUPA 2GUOB 5KAQF 5IFAH 1JMXA 4R0LB 4G6AD 4HQQL 2ZSVA 3MCG1 4M61B 2BFVL 1CF8H 4WHYH 3ULUF 2AJXH 3R4DA 1CICA 5F7HA 2XRAL 4LLDA 1MY5A 5IMOA 3JUZA 2EH8L 4Y5YA 3NCMA 3S35L 4X7DC 3QI9C 5DD1H 5GRYA 5H35B 3RIFF 5IHZB 5EBLB 1TTUA 2IAMA 1KB5H 5C0CD 2W9EL 4G6AC 5I1KH 1D5BB 2W0FA 5AG9A 2O61A 5CEXA 5GGVY 4YHLH 4YXKL 2NW2A 1I75A 3LRHA 4GRLC 4RISL 1DQML 2J8UA 3HI5H 3FO2B 4HSQA 4HUWB 4JZJA 4LLMB 5BS0B 3WHE0 4JG1L 2EDDA 5B38G 4B41A 1TENA 3GM8A 4AIZA 3RNKA 1FGNL 4TSCL 1N26A 4JO4L 5CZKA 1K9TA 1K8DA 4ZNCD 2NW3A 4NFDA 2IGFH 1NCNA 5SWSE 2ZUQC 5C0DB 2NY0D 2VAJA 2AJYH 1J88A 2F19H 4FXLA 1QBLL 3KPTA 5D96B 1MLCA 3MC0A 2GYSA 3RWFB 1YYML 1F90L 4K3JL 4X0KB 4MA7H 2A6DB 4M1DL 1VA9A 4MXQA 5KSUA 4LHUA 3DXAE 5A16A 3SN6N 5INDA 1I8IA 1ITBB 1CGSH 4FQCH 1CFNA 1G7IB 4JPVH 5DQDH 3L3DB 1V7NH 3VA2C 4ZPVA 1BLNA 1F3DH 3MV9E 4TSAH 4MD4A 3Q3GB 2IPKB 1K6QH 4F15B 1RIUL 5L88H 3L3GA 3WO4B 1BVKA 1CLOL 2EE6A 1W0WB 3LV3B 5HTSA 4L8BB 2CRMA 4RA0C 4I5BA 2X9YA 4FQLL 1QD0A 3LZFH 2VXQH 4G8IB 4YWGL 3L5XH 5F9WB 3S36L 1EO8L 3LH2H 2AEQL 1C5CL 3HE6D 3FN0L 3L3IB 4IMKA 3EDKA 3INUH 4YEEA 1A21A 2GT9B 4HLZH 3V6ZA 4WVRA 3CXHJ 4GUPB 3VRIA 4GKSA 4PRAB 2CMRL 4FQHB 4NQDE 1IZKA 1UWGH 2XICA 2FB4H 5I0DA 4KI5E 4G5ZH 2QR0B 2UY6A 3MR9A 3BE1L 2WZPD 1CLYL 4HFWB 5B8CA 1E4JA 4YHYB 1NCBL 2UWEA 2NX5E 4RWHA 1ZSDB 2R1WB 4WEBL 3HPLB 3WS3B 1VDGA 1MFAL 5C3TA 1LE9A 5D1XD 2EEAA 1CIDA 1RK0A 3T0EE 1F97A 1N8ZA 4QRSA 3ZT6A 4XVJL 3FN3A 4K7PY 4NJAH 4PGBA 1FFNB 3ZLQC 4HV8A 2J8UB 3P4OB 3PDOA 4J4PC 4X6DE 1UB5A 5EA0H 4MNQD 3O11B 1UCTA 5EOTB 4XB7A 4LAJH 5DJ0A 4Z77B 3BKJH 2EC9U 1GAFH 5GGVH 1RIHH 5T3XH 2YWZA 2NW3B 1T5XA 5E6IA 4HIEB 2J5LB 1ZHLA 1EBAA 4PD4J 5FYJU 5I1DA 3CX2A 4L5FH 1MLCB 4MAUL 1KCRL 1V7ML 2H3NB 3M07A 4PB9L 5KSUB 3MCLH 5INDB 1Z3GH 4JN1L 1I8IB 1MF2L 4PRPB 3LHPL 1EGJL 5HHOD 4F7TA 4Q0XH 5DRXA 1ZVSA 4U1IA 2X4NA 2FZ3B 2BSSB 5DEGA 2HJFA 2PYEA 1BVKB 2XZCH 5JHDE 3RX5A 4KKAC 5E00A 4GG6A 4NQSB 3RVUD 1OGAB 4NJ9L 4LSUH 4J3XA 5FA3B 4HT1L 2R4SL 1N5YL 4HUKB 3BP7A 1U8MB 5JDSB 2BVQA 4XAWH 2RCSL 5DJXA 4NKDA 2R9HC 3V6ZB 3FT4A 4HWBH 3MUGA 2MTPA 4UIMB 1CFVH 2GJZA 5I1CH 4PJCB 1H8OA 1MAML 4PJDA 5JORA 4WW2C 4XX1G 3RVUC 1A22B 3ZKND 4IDJL 4K94L 4K8RL 3RWJA 4TPRH 5DQJA 5CWSB 1A3RL 2IANB 3ZE0F 2VWEC 3N1MC 1AKJA 3OAYH 5F3BA 2VDRL 5ETUB 2UWEB 3ORJA 4HPOL 3GMRA 1FN4A 5DTFA 4M93B 1U8LA 3TBWA 3H9ZA 2EXWD 5L0QB 4G80A 4Y4KB 4F7EB 4HBCL 4Q9CA 3BH8A 4NYLA 5EO9B 3GBLA 1N8ZB 4UINL 4QRSB 4U7SA 3ZHKA 1BVZA 2F5AH 3RZCD 1KTRL 4YUEH 4PGBB 3SHSA 4HV8B 1MJ7L 5DMIL 3ULVD 3GIZH 2P44B 1Y18A 3KJ4C 4PGDA 4L9LB 5K59F 3X14A 4KRNA 5I74B 1EA9C 1TLKA 4Z7OE 3MRLB 4Z7QE 1WSST 2P48B 4K7PH 2FH6A 2H6PB 4HJJH 3TBTA 3R1GH 2FLRT 1A1MB 2M1KA 4YHMH 1T5XB 5DVLA 3RZCC 1T1YB 4XTRD 1BQUA 1PYWA 5I1DB 3ULVC 4HK0A 5GGSA 5TDNB 2V5YA 4UTAL 2G2RA 1OAQL 1AGFA 2KQMA 4PJFB 1D6EA 2VXVL 3AU1A 3KPSA 1CBVL 1WISA 3DUSA 5D2LA 2VO5A 1GIGH 2X4NB 3CC5B 5DEGB 1FAIL 4IBLT 5F3HB 2J7LA 4KY1L 5E00B 5GRXG 1KUMA 3THMH 4JRWA 5GGTH 4GG6B 1JE6A 4H26B 4X5XA 4BELD 3QJFA 3N9GL 5F1NA 4FQQB 3IGAA 4FZEL 2DM3A 3LKSA 3HB3D 3HCVB 3VWKC 2BVQB 4DOHB 4ZAKC 5HXMA 3ARPA 4RZCB 4ZQKB 2R0WL 1VPOL 4PTUB 4Q9BA 4YZFF 4LRIA 1LEGB 3VD9A 4U7KA 4Y1AB 2RFXB 2GJZB 2IBZX 3GHBH 3AREA 3P4LA 5JQ6L 3RJDA 5JORB 1MCBA 1J18A 1AJ7L 5IKCA 4WWID 1H3GA 5KG9B 4LF3A 2WW8A 4FQIH 2R29L 1WCQA 3BPNB 1YEKL 3CDCA 3G08B 4HKXB 4PRPE 4L3CB 1FN4B 5DTFB 3TZVD 4DKEL 4PJBF 3TBWB 3MREA 1MCOH 4G80B 4Y2DC 4M03A 4Y4FA 1NGWB 5B39A 3NAAH 5DYOA 1I1AB 3WJLC 4F57L 2ATPA 2LV4A 2PCPB 1G1CA 3HFML 3I6GB 3ECBA 2EDXA 5HDQL 2XFXB 4L4TD 4ZFFA 4N9GB 1I9IH 3DBXA 3O4LB 1JWUB 1UYWH 2I60L 4G9FA 5T1LA 1T04A 2UYLB 3UBXG 1CK0H 1OF2B 1FQ9C 4XNZC 5E2UH 1L7IH 5C7XH 3VXRA 4OB5L 2FYYA 5JOPE 4PV8A 4QHLA 4KKBD 1CI5A 3BGAA 4CVXB 1LO3L 5J9PB 2VKXA 3MNZA 2L7JA 2R0LL 2EEBA 3L7FB 5C0BA 3K7UA 5BO1L 4HK0B 5F1OB 5DA4A 2IANE 5F9AC 1D6EB 3FT2A 1BBDL 2N56A 5B3NA 5EIQA 1M71A 2ID5A 3GRWA 4HUXA 2W9DL 5I1LA 1UJ3B 1OGTA 3DUSB 5EBMB 5FYKE 2HLAA 3BGMA 5GS1B 1DEEB 3IU4H 4IRSD 4OGYH 4WV1B 2FJHB 4E41A 2OLDA 1NEUA 4A6YH 4X80H 5IEKA 2HWZL 4JZNB 1ODAA 5F1NB 3VFGH 3IGAB 2FWOA 4XP4L 4L4JA 4DGVH 3NVQA 3GHEL 1X6NA 4LARH 4KRPB 4Y5XA 3KYAA 4JVWA 1SEQH 2LTQB 2VDKH 4V1DE 4HC1L 5DJYB 1ROWA 1SJHA 1IM9D 3RQ3A 2MHAA 3MJ8B 4UU9A 3P30L 3ZSTA 1VACA 2EDHA 4HF5L 4R97C 1XGRA 4XPHL 5D7KE 4B7IA 1NC4A 1J0IA 4OSUH 4NQXA 5DD0H 4BQCA 2Q1EA 3WS6C 3PL6A 1WUNT 3RBGA 3SDCD 1IM3A 4OV6F 1CS6A 3DVGB 1MCEA 2P49B 1NMAL 3ARSA 1RZKH 1U8OA 3DSFH 2OMNA 1OCWH 1S3KH 1E4WH 2Q7YB 1YNKH 3L1OL 2AJVL 2X89D 2DJSA 1E27A 4QTHA 3GBMH 1NGZB 2OTWB 2DQTH 4NO0B 5EN2A 1G0XA 3ECBB 1KACB 3SDCC 4G9FB 5T1LB 3U9UB 1RFDL 5IB4A 1INQA 5EC1A 1HNGA 4GBXD 3ARDA 2HN7B 2UVEA 2JELH 4PV8B 4A2MA 4DEPB 4F58L 5EO1B 3I9GL 5CP3A 5DT1H 4KVNL 1KJ2L 1MI5A 5CS7A 2AEIT 3EJZD 1MQ8A 2J8UF 4OM0H 1F3RB 3QIWC 5KN5B 3QPQC 5DVNA 2HVKA 1ZHBB 3BDXA 1B0RB 1KBGL 1K3ZA 5EORH 2WIMA 4KKCD 1G7JB 1CDYA 1JUFA 2OZ4L 4QXUL 5IK3A 4Z0XA 4GBXC 1JPTL 3TV3L 2AJSH 1AQKH 1OAUH 4W68A 2X1PA 2HLAB 3QO1A 3HAEG 2C5DC 1J10A 1LILA 3T4AB 3V9FA 5HGBA 3FQTB 2NQCA 3EJZC 4LRNH 5B38A 4E41B 1S7TB 2X4TB 4URTB 3FB5B 3NH7L 3OSKA 1IC7L 4JG0L 4NKIH 4KKCC 1KJVA 5D1ZB 3O4LE 1TZIA 4YDLC 5MHSE 3DX8B 3TIEA 1KFAL 4G6MH 4KAQH 3OZ9L 4L8DB 3IF1A 3NIGF 4LLYB 3I6KB 3T2NL 2DYPB 3QEGL 3Q1SL 4U0RB 3BRDA 1A9BB 1SJHB 5GZND 3KPRB 4UU9B 4WEMB 1FL5A 3ZKMD 4X4XB 1A2YA 5JW4N 1PVHA 1K85A 4ESKA 1NC4B 4NQXB 1I3UA 3EFFA 3KXFA 2EYSA 3AXLA 3V6OC 2FX7L 2XXCB 2HJKA 5JZ7D 3IB4A 3ESVF 4Y16C 4PJCF 2D31B 4HKBA 3WN5A 3BUYB 4ZUUB 3GB7A 2ZCHL 5CBEB 5L8JB 1NDMA 3V52H 1K4DA 2BSED 1XEDA 5KZCD 4GRWH 1X5KA 2BSRB 5DFWH 3EYSL 1RVFL 5EN2B 4G8GE 3S88H 3QIUD 4I0PD 2UWEF 5KSVB 3VWJD 4GAJL 4YDIH 5IESH 2D03L 4LIQH 5IB4B 1INQB 1S7UA 3MGTA 5EC1B 3OKNB 2VLRD 1A7OL 5JZ7C 1D7FA 2GK2A 4XB8A 1BEYL 5KW9L 4HKZA 2JK5A 4MJIA 5DD6B 5ADOH 2ZNWA 3RAJL 3ZTJH 5ALBL 2NY7L 4NKMB 2YA1A 3ZE2F 5I0ZA 3PJSB 1AGCA 3QIUC 5GRWA 5E2VH 4GT7A 2F5BL 3VWJC 5D7LE 2AJZA 3IVKB 5ESAA 1JUFB 5GJTL 3HMXL 1BD2B 1J5OL 2B8OT 2NXZC 2VDNH 4Z0XB 5GGRY 4PJEA 3D3VB 1J0YA 3T0VA 5IFHL 1MRDL 3BKCL 3OKOA 4B7LA 4PRID 1ZWIB 4ZFZA 1NAMA 4HWEL 1JGEB 3MJGX 1CZ8L 3MRBA 2YK1L 4PIRF 4QNPE 5B38B 2VJXA 1JMZA 4O4YH 1ZLUH 4HMDA 1J0ZA 4ZO9A 12E8L 1R3LA 3RVXD 1II4E 4LPUA 4Y4HB 2VDMH 1INEL 1B9ZA 3V7MA 1V3KA 4Z7UA 3IF1B 3O0RL 2QADB 3KLDA 3Q6FB 4HZAA 5DS8A 4GG6F 3H42H 3IYLW 1SM3L 4MXWH 3PWVB 4D9QE 5K33A 3WXWL 3U36B 5I1EL 2APFA 1MCPH 3QNXA 5KJRL 5D6CB 4GW4A 1QUNA 5C08E 1FZMA 2ADJA 3EFFB 5BXFB 1S7QA 3UTTE 1IEBB 1YMHA 1JN6A 2Q86A 3TT1H 2E7LC 1R3IH 2P42B 5MP6L 1A6VH 3OKYA 1FORH 1BQSA 5I8CA 1OAXH 3PF2A 5EB9A 2OS7A 3WLWD 4AEHH 4HKBB 1N5AA 4HIJA 2R56H 4RGMC 4XPBH 3C87A 1HH6A 4KU1A 3MXWL 4JDTH 4S10A 3D69B 5DSCB