1JGEA

Hla-b*2705 bound to nona-peptide m9
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-27 B*2705 ALPHA CH
publication title HLA-B27 subtypes differentially associated with disease exhibit subtle structural alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jgeA01
4M5YL 4I2XA 1E4WH 4Z7UA 3VXSE 3ARGA 5IFAH 3KG5A 4JKWA 4PJGA 5DD3L 3OF6A 1PJ9A 2ESVE 1HKLL 5I19L 5AG8A 2Z8SA 1ZVSB 2FEDC 1BEYL 1RQ5A 1UGNA 4O5LH 4WNQA 3HAEA 1WIOA 1BBJB 4YHZL 2ADJB 1JMXA 2I5YH 4X8JB 4OKDA 1TXKA 1YEFH 4TPRL 5IGXH 3NA4A 4S1SL 1F4XL 4PRID 2W0KA 3BN3B 4V3EB 3QCUH 4PJIA 4XI5D 2DMKA 4OKVA 3RWHA 3UPRA 3WV0A 2Q7YB 3VI3E 3VA6A 5HGHB 5ITBH 3QDJE 1D6VL 1H5BA 3SEPA 4XXCA 5IOPB 3RVTC 3F7PC 1W8NA 1B9ZA 3BISA 3Q6FA 4PR5A 3BJLA 5C0RL 1AD0B 4C59B 4JREC 4Y16C 1S9WB 4GJTB 5C0DB 3CMOH 1I1AC 5I1AB 4D94A 2BNRE 4FFYL 3QQNA 3IXTA 5IQ9A 3HAEG 1NAKL 5ENWB 4NRYA 4HZLA 5IIEA 3FONB 4X5XB 2IGFL 3HCVB 5DA0B 2XQBL 4BSVA 5J57B 1EGJH 5I1LA 1CICD 2BC4B 4W6XB 6FABH 3UBXB 4N0YH 3K8MA 1GGCL 4XNMA 3TIEB 3TYFB 4QRPD 15C8L 2NY3D 4YXHH 5E95B 3W11C 3HR6A 1I3VA 4X6CE 1F4YL 4K94L 5SWSD 4ODVL 4BFGA 4PJ7A 2DM3A 3EFDH 4GUPB 2DTML 3ZYOA 4LCIL 5HDQL 3UJTL 3KYOB 3BPCB 5F1NA 2HRPH 5K59F 5AD0B 4PJCB 5FECA 5JOFB 3L9RB 4M7ZC 1N59B 5DTFB 2EH8H 4HS8L 5DJ2A 5DQDH 5D7IF 1CXKA 3CDFA 4HUUA 5ICZB 4I3RH 2YC1A 5C0JB 2WBJA 3SPVA 1WBYA 2ADFH 2PNDA 3MBED 5IQ7H 5F3BB 5HHXL 4N5ED 3HE6B 2FWOB 5FYKD 5BO1L 1T0PB 4R7DA 1A1OB 2P5EE 1CFNB 5DJCB 5BVJB 1E4XI 3MJ7B 4LF3A 4NQUA 2FH8A 2EDTA 3NA9H 4LSSH 4OZ4B 2ED9A 2ICCA 2VQ1A 4KRPD 2LTQC 1N0LA 4DKFL 1Q9LB 3RY6C 1EVUA 5HVWA 5JW4M 1HWGB 4LSPH 2DWEB 2AEPL 3KPLA 3T0BA 5FYJD 5GGQH 2JCCF 3VJ6A 2H8PA 5KW9H 4LIQE 4GRLD 1FFOB 2VN4A 4CBPA 3QEQA 1NGYB 5KSAA 3WS3A 5ADOH 1LDPH 3V4VH 3NCJL 3L7FA 1UACH 3ARGD 4I8DA 5IVZB 3P4LA 4IMKC 3L3KB 4L8DB 1FL6B 1X6LA 4K3DL 3ULUC 2CR3A 3QRGL 5CEZD 1KLGB 3QIBC 1ZHKA 5IVOA 2AEIT 2LQRA 5B39A 1BGXL 3U48A 2P24B 5F7FA 1FNSH 1LO4H 3GSRA 2G9HA 3ULVC 4QHKJ 1JNHB 3V2AR 1CXFA 4YDJB 5DUBA 3HRZB 3CVHA 1NBZA 2DQIH 1BMGA 4XH2A 3K8LA 5JIHA 1B0WA 1QLFA 4XAKD 3GB7B 5CILH 2J7LA 1UB6B 5JUEH 1A4KB 4ZUWA 4BFEA 3ZZ1A 3BP6B 5JNYA 1OCWL 1ACZA 1U8JB 3SGEI 1RZ7L 1V05A 3H3KA 3G5YB 4O00A 4MQ7B 3JWNC 4YZFE 4FZEH 4OCNC 3I84A 4WHCA 4R6UA 3BSZH 2D7TL 1I3UA 4PJCE 4M4RA 3QQ3B 5B39G 2CIKB 3U7AA 3P40A 5J6HB 1Q9KB 3BH8A 3D87B 5AUMA 4FQXC 2AS5M 2Q3AA 4NQDB 3O4OB 1UCBH 2FYYA 3QCTH 3NACH 4FQJL 5FO9A 1YN6B 3SKOA 3I75B 3CCHB 1T5WB 2J2ZA 3EYOA 4GG6A 1RY7B 1FZJB 5EBWA 5CCKH 3UROR 3H9HB 2FJHB 4HCRL 3GJEA 5I1DA 5B4MC 5K9JH 5I1JL 3IXAA 3DX8A 3QHZH 3NAAL 4P5TB 4LLWB 3QAZC 3EOBB 4HUXB 3JWOC 3ZT6A 4GOSA 3B5TA 5EZJB 1G9NL 4BSWA 4OZFA 4RAUA 2YRPA 2FX9L 5D1XD 2VLLA 3ZYZA 5KN5A 2CXGA 3WE6A 2DQEH 1Q9OB 3RX5A 5F88A 1BBDH 1MVFA 2PTVA 4LASH 2X4QA 3CK0H 1HILA 1MREL 4PGCB 1JTPA 5INDB 4HXBL 4S1RH 5IR1A 5E6IC 3T0EC 2V7HA 2M8XA 1RZ8B 2Y5TB 3O3AB 5JORB 2VXTH 1DUYB 3VD4A 1OWRM 4X6FA 2VDLH 1IAIL 1GZPA 4WWKD 5MI0C 3CSYB 5L88L 4OZFG 4HKBA 2BDNL 5ABDE 4OD3H 1UC6A 4KFZC 2X4SA 4NNYA 5DJ6B 1A5FL 1F45A 4UB0L 3IETB 2JELL 4ODBD 4P9HL 4LSDA 1JNJA 2KQMA 4C58B 5KSAD 3QEQD 1OY3B 4TVSa 2HJKA 3O41A 1UZ6F 1FJ1B 3I9GL 4PB0L 1CE6A 5GGUB 4XX1E 4E0RB 1DVFB 5GS0C 3AXLB 4GW5B 1EZVY 1N6UA 4JO3L 4XP5H 1D9KD 1I3GH 3QWRA 5D7JC 2QQNL 1FNGA 1T22A 1INQA 2VDPL 3DMMD 4YWGH 1SYVA 1XGRB 4HH8A 2HTKD 1LK3L 1BQSA 3O11A 1RVFH 3O0RH 2A1WH 4AEHH 3VXOA 3VGAC 5I18L 1K2DA 1CG9A 4TSCL 4YQXH 5CD5D 4Z7OF 3MA7A 1WJ3A 4Y4KC 1A3LL 4HV8B 3QI9A 5GZND 3KPQB 4PS4H 3DURA 5LAXB 2J8HA 4JM2C 2QKIB 4PREB 1M7IA 5B3JF 2NQCA 1PZ5B 5EUKA 2VLKB 1T83C 5CSZB 4GSDL 25C8H 4Y88A 4YBQD 3REVB 4WY7H 4JFYA 1CN4A 1JWUB 5T1DL 3MLPA 5ICYA 4RZCB 5DJAB 1ZT7A 1TPXC 2ATKB 4RFEB 1RZIA 1I9IL 5CIPA 5JLZB 5KJRL 4HT1H 5FGSA 3CLEH 2BSRA 4YDLB 4F33A 2A9ML 5AAMA 4XXDA 3EAKA 3M07A 2CRIA 1DJSA 5IEHA 5BRZA 1LHZA 1A6UL 1FNAA 2JE8A 1OB1B 4G6AD 3ECBA 2BVQB 3L95B 1NGZB 4NNPH 3SGJC 3DRTA 3SDCD 5DLML 4NBZB 4GAJL 4PY7A 3NFNA 4DWHA 3BQUB 3I02B 3BW9B 2EECA 5EULV 2H45A 4OZIE 2R9HC 2YA0A 1ZEAH 3WHXA 4RQQA 4N90D 2IALA 1KYOJ 3ARBB 1QNZL 3K74B 2GK0B 3LKSA 1X5AA 4ZO8A 5GXBB 1MWAL 1WT5A 2EXWD 1BECA 1TIUA 5FO8B 4N8CH 1QLRB 1VFMA 1I8LC 1F90L 4G8GB 1JZ2A 2AJ3B 4KI5E 4RNRA 2C3GA 4M7JL 4Z7NE 5DJ8A 5TQ2H 3U1SL 1BVKB 4NQVA 5DZNA 4JN2B 5D7KD 3H3PL 3RVUD 5CZXC 5IMOB 2NTSP 2FX7H 3DNKA 3QUML 1PDKA 4FXKA 4AQOA 2QSTA 5KTEH 4DUXA 4XPBL 1JPGA 1S7VB 3QEUB 4Z0BL 5FGCB 2WANA 4XZUB 1T7YA 5JHLH 4QYOA 1EMTL 1A2YA 1CDGA 3KDMA 5DDHB 3TPUE 1CU4H 3EFFA 5CGYD 1T1ZB 1NUFA 3UYRH 3WUZA 1S5IL 4CU7A 3PNWB 2R69H 4ZPTB 4BQ6A 1ADQL 3V6FA 4HGWB 4IRSB 4QGYA 3SDDA 3RDTD 1A02N 1DE4A 1TNNA 3EO9L 4JO2H 1KEML 2LV4A 4AENB 3UTPD 4ZXBA 3LY6A 1Y0LA 1ZWIA 4NQEB 4JFEB 3G6AA 4OZGB 2UZIH 1A21A 5CJQL 3PWPB 4F9LA 3MLTB 4P9MH 5GGRY 2XQYG 3F7VA 1MRDL 4JHAH 4X8XA 1CLOL 2VLKE 1RZFL 1TZIB 3JSSA 3VWKB 1AP2A 3ZE0E 1AXTH 3MV9D 4KGLA 1OTUC 3MCKB 4CADB 4DZ8A 3ERYA 2AJZA 3F12A 5EN2A 3RGVC 4JFHD 4NRZA 4UBDD 1JYXA 3FFCB 4MMXC 1H3UA 1RUQL 4X4XA 1MJ8L 4X98A 2XZAL 4JVPA 4AJ0A 4FQIH 4Y5YA 4MJIB 2DOCA 5I1GL 3O2DL 5BZWA 2GY5A 2XWJA 3FQUB 3QI9D 3FRPA 4G5ZL 4XBPB 4TUJA 2EIEA 3PL6D 5HI3D 3ALPA 1NPUA 4FXGB 4KJWC 5FHAH 1TVDA 1QG3A 2NXYC 4LLDA 3H6JA 4F15B 3MRFA 2VDMH 4H1LA 1U95B 4EI5A 3DV4B 3TN0C 5TE6L 1YMMD 3WDIA 5E8PB 4U1SA 3OG6B 1LE9B 2IF7A 1JHLH 2UVFA 1A4JB 1HQ4A 3EYQD 4NN5C 2FIRT 1NBYA 3HC0A 5DRZB 4F7CB 4JGJA 5DRNB 1S78D 3F58L 3FRPG 4TOYL 5E5RB 5BRZD 3K7UA 3DETC 3B9KA 4ZFZB 1F3JA 2E8ZA 5LXGH 1RIVL 4R96B 4H1LG 5SV3A 1BFVH 1KELH 3U79A 4PTUA 1QO3B 1V3LA 1QBBA 4MZ2A 1VFAA 4AEEA 4JFFA 4KKAD 3O6KL 4U1MB 2NY4D 1J7VR 3QNYB 1ONQA 2GQHA 4C54A 3RVXD 5IVXF 5FGCE 1C7SA 1H3PL 1PQZB 1FC1A 3WSQH 3ZHLA 4OGAD 1OLZA 2EO1A 1A1MB 1Q1JL 5TF1L 1OSPH 35C8H 1DBAL 2P8MA 2AVGA 5EO0B 1U3ZA 3MROA 5CUSH 4NCC1 4H8WC 4XC1L 4HS3B 3MOBH 1YC7A 3W5NA 4YEFA 2WWMD 1MCFA 3MODL 1LNUB 3O3BA 5H94B 4NQEE 3MRDA 3LSOB 2GCYB 4EI6A 3HTLX 4QHMA 5IB5B 2CDGB 3OKMB 3PWPE 4KJQC 3TYGL 2H9GA 1EO8H 3FHQA 3Q5OA 4UILL 5EC2B 4G7VL 2A2QT 5D2LE 3VGGA 4G6ML 2W0FB 2DQUL 3DBXB 1X44A 4ODSL 5GS0H 4ZUUA 1YY9D 4JREB 4Y16B 4XTRC 4TTDD 1BHGA 5IW1A 2Q8AL 1RMFL 2DBJA 5CHNB 5D5MF 4P23C 5GGRA 4ZXBD 3WIIL 4L9LA 2C4XA 5IMLA 4YXLH 2OJEA 2RBLA 3QH3A 5IEKA 3GKZA 2B1HL 3C60C 3UTSA 4EN3B 2OTWA 1WIPA 3D85A 2PR4L 5DQJB 5E2WH 2VABB 4JHWL 4FTVB 4JY6A 3D48R 1P7QD 1UJ3C 2MTPA 3B9AA 2VXVL 4QY8A 3RVWC 3GM8A 3N85L 3GIZL 3G5ZB 1DQJB 4JZNA 5JMOC 3VE0B 2Z0BA 4F57H 1KG0A 3KS0H 2R8SL 3QXDB 1T1XB 1TCMA 3EIFA 3RL2B 1NKOA 5HGDA 1TJHL 5T5FL 4POYA 3STZA 4ODXB 4KVNH 3MUGA 2FD6H 2NPLX 4XVSH 3K0WA 4LRIA 2WUCH 3O2WL 2Y06L 3QWOA 4HIHA 4QT5B 1KEGH 4YHIA 5C0EB 1RJLA 2GEEA 1GH7A 3RZCC 4Z77A 2V7NB 3MTRA 3L3DA 5F89B 4PJ9D 4BQBA 1R3LA 5IFHL 3LZFL 4PLJD 5KS9F 3TF7A 1Q8MA 3SQOH 1FFQA 4FQ1H 2VL5B 3LPWA 1BFSA 1Y18A 3P11L 5D93C 5LVEA 4MDIA 3SE8H 1D5ZB 1SJXA 2H41A 4OD1H 5AYUL 4PTTB 2RB8A 1NKRA 3OKNB 5F7HA 4KKLC 5E4IA 3UDWC 4NKMA 4R4BB 2HAZA 3BI9X 3H0TB 1DLFH 4UMGA 3RIFF 3LKOA 3RWGB 3TJHC 5IT2L 5F93C 2MJWA 3LRSA 3M17B 1EBPA 4MXVE 4ZUTA 3QG6B 4JFFD 2IQ9H 4X6BA 2XT1B 1U92A 1QEWA 4L4TA 3TO4A 1OPGH 4X5WA 5DS8B 1EFQA 2ZUVA 4E9LA 3MV7A 1NC4D 1E4WL 4PJIE 1A7OL 4NC1C 5IFAL 3RU8H 5JIKA 1ROWA 3QIBB 4OUUA 3KR3L 3SE9H 1K8IA 4G43A 4O5LL 5A16B 3FB7B 1JWMB 1F42A 3BPOC 3IGAB 4BFIB 4LNRB 2HN7A 1YEHH 1YNKH 1T6WA 4MCZA 2I5YL 5IW6B 3W39B 2H32A 5GGTH 1YEFL 5T3ZH 4HQQH 3PJSA 5L8JB 1KJVA 4PLOB 2X4RB 4CRPA 3TESA 2V5SA 1FFPB 3VFSB 4FTVE 3QJHB 3PHQA 3MXWH 3SOBL 1KF9B 5ITBL 3AREA 3P3YA 4QTHB 2EDXA 4KXZH 4L5FH 2AGJH 4HMCA 1MY5A 4APQB 1XGTA 3GBLA 3Q0HA 3CMOL 1IE5A 2FO4B 1YQVH 4O58H 4L3CB 2QQLH 1KB5B 1UXSB 1JHTA 2HKHH 1IEBA 4PIRF 5D1ZC 4I3SH 3IAPA 4ZUVA 4MYWB 4WEBH 3N1QC 4PJ7E 1MAKA 4FFEX 1X5LA 2Z4QB 3D85D 4KJPC 1MY7A 4K3HA 3HUJB 3T77B 1EGJL 5F7UA 2WK2A 4JY4B 3LEXB 5EUOA 6FABL 4N0YL 3QWQB 1W0VB 3SDXA 3U0TB 1RZGB 3WXVH 4NOFA 1NFDA 5HGBA 1BIIB 4YXHL 3DX9A 4X9GA 1EK3A 3KLAA 1T1YB 4YHLL 3NGBC 5F72S 1XCTB 2YPVH 3Q3GB 4P48A 4YUEH 3FCTA 5BW7C 3QAZB 1C12B 4WUUD 1D7FA 2WY3A 1CFTA 3MFGB 5DVMA 1DANU 4XCCH 2N7AA 3X17A 3QDHA 4X7CC 5BS0A 3CFEB 5F1KC 2EH8L 5DQDL 4ODUB 2EYRA 1TCRA 5FYLH 2AJYL 4JDTL 1SJHA 1H15A 5IBUB 1AGBB 1KLFA 2ADFL 1A14H 1JVKA 1UXWB 2ZUQC 3G04A 3FQWB 3SCMC 1LO5B 3WFEH 1P5VA 4YK4C 4S0SD 3D0LA 5CWSB 5DR5L 3T0EB 2XA8H 1CBVL 3D69A 3Q2CA 4EDXA 2AEWA 3NA9L 5HYIA 2D7PA 5B3NA 3HR5B 4LSSL 3D39A 4ERSH 3ULUE 1INEH 4KUZH 2NW2A 4I0PA 4P4RB 4Q6IA 3DXAA 2DLFH 4PY8J 5MI0B 2DYPA 3PDOB 4DJMA 2X2YA 4L8SA 2RAMA 3HRPA 3WN5A 5DZOA 3MLVH 1CS6A 1HYRC 4IOFD 1MCLA 4HGMA 1HN1A 1II4E 3GFUA 1YPZF 4ELMB 4FFWD 5GGQL 5LBSH 2HMID 5ESVB 4HS6A 5KW9L 4PJBB 3ULVE 3MOQA 4CVZB 4L4TD 4S1QH 3N1GC 5D7JB 4XCEB 1LDPL 1TMCA 1MI5E 4H8WH 3V4VL 1K3ZA 1UACL 5A1AA 1D6EB 2X9XA 5JXEA 5GGVL 2XZQH 1GXEA 1NCBH 2AJXL 3CDGB 3IFPB 3DV6A 3QUZC 1JHKL 4KUCD 4R2GB 4JKMA 3RTQD 1LEKA 3SJVA 1INDL 3D18B 3J8F7 4RGMC 2RQ8A 3T04D 4LPCA 4WFED 2EEDA 3T8XA 1P6FA 4FABH 4Y4KB 2AKRA 2NY6D 5KAQF 5JDSB 2DKUA 1P84K 2XFXA 4JM2B 5TJWK 3ZKND 4F3FA 2P42B 1ZKAA 1FNSL 1LO4L 3GSXB 1MCRA 3UX9B 5KSBF 2M2DA 4WJ5B 3VXUB 3BDYH 3FQTA 4GO6B 2KQNA 4H0GA 5DRWB 5DJZB 1MCNA 5HVHC 1FZKB 4MGXA 2DQIL 2PO6D 4NKOA 4NWTH 2Q76A 1RULH 1FYTA 2QLVB 5CGTA 3DIFA 5CILL 4P4KC 4LCWB 5JUEL 3VRIA 1LQSR 1IGML 3DTXA 1HDMB 4XCYA 4PG2A 1TPXB 1MFAH 2ZCLH 2KDGA 4MNQA 4PJDF 3DX7A 4RGND 4XI5C 3BKJH 1BLNB 3JTTB 4BUHA 4G80A 1LP9F 4FZEL 2OI9C 4QCIA 1QOKA 3L3IB 5JW4N 3BSZL 4LVOC 1LQVA 4GKSB 1FVDA 4LVNC 4Q9CA 5FCSH 3VFPB 1DTUA 3C8KA 3JUZA 1UCBL 3WEXA 3QCTL 1TZHB 1YZZA 3NACL 4N9GA 2I27N 4J3UA 4J7RA 1D5BA 5J13C 1N8ZA 4NO0D 1Z0NA 1MQKH 3EOAA 3CXHJ 4DN3H 3OKDB 3V6OC 3T0EE 4YEEA 5K9JL 4EUPH 4Q9QH 5TFSH 2E7LA 1CICC 3IJYB 1FRGH 3DI2B 4FP8L 5DMKB 4ZYKA 2IPUG 4M00A 3VXRD 3TIDB 4OZHE 4U6VL 1ZT4B 1A6TB 4P5MB 2WIIB 1OWWA 1Z2KA 4RAVA 5T1KA 2DQEL 5SX4I 4QXGH 3HKFA 3O8XA 4OIBA 4XBEL 4Y5VC 4HMDA 4LPXA 1BBDL 4IMLA 3PABB 4LP4A 4LASL 1EO5A 4OLZH 1IM9B 5FM5M 2I24N 2PW2B 4YFLF 3QP3A 4ZQKB 4QRTB 2GJ6D 1QR1A 5F7YC 4S1RL 4NQSB 4WU5A 1MLCA 4JFZL 1ZA3A 2DM2A 4I0PD 2YUZA 2WLZA 3DXAD 2F53A 3K4ZA 3MBEC 2EYSA 2VDLL 4JY5L 3MRPA 4PBVC 5CBEA 3V6BR 1I8MA 4N5EC 1ZLWH 3AGVA 1YDPB 1RIHL 3BE1L 4HUNB 4OQTH 1B2WH 4DCQB 5L6YH 3RFZC 2E5EA 2N4IA 4PRPB 2FJFA 1WC7B 3U7YH 5E08H 5GRXG 2XNAA 5F7WC 3ARDB 1A47A 3T4YA 4KRPC 3VXUE 4JFDE 3QULB 4LL9A 4XP5L 1I3GL 4LCCC 5JXED 4PYHA 4XCNB 3W81A 5TDNB 3H9SA 3VFTA 4LCWE 3OB0H 5E9DA 3O4LB 5T1LA 4Q9BA 3P4OA 3EKCA 3CIQA 2NW3A 4AMKL 4GRLC 1R5VB 1XR8A 4IS6A 2PUQT 2QSCH 2A1WL 2XI9A 1NLDL 3VXME 4YHMH 1JV5B 1MCKA 3GMLB 3IF1B 4HG4J 3EYUL 3GK8H 3MXVH 4YQXL 3SQBA 1VKXA 3ARGC 4OFVA 4X9BA 5SWZA 2NXYB 4PS4L 3HZYB 2ZOKB 1Z5LA 3RKDC 5K9QG 4GBXD 3C2AH 1FYTD 3TN0B 3U4AA 1PG7X 2M1KA 4KVCH 5DGQA 4DN4H 4URTB 4K71B 5D5MA 2EDDA 3QDMA 2BFVH 2GK2A 2X05A 1X5GA 3U0PB 3LKPA 5TQ0H 5DEFA 3OG4B 2AQ3A 4DKEH 1FFNB 5JIIA 3QFJB 4B0MM 5D72H 3U6RA 4HJGB 4HT1L 3MSPA 3A6OA 3S96A 2B1AH 3CLEL 1FVCB 4CMHB 1FL5B 1QSEE 4XXCC 2C7UB 4ZAKB 2YD1A 5IB3B 3TNMA 4ZDHA 3T3MF 2LFGA 3UC0H 2IPKB 3BIKA 4GW4A 4G8IA 1KFAH 4P46A 1ED3A 4U2ZA 4I18B 5HJ3A 1KTRL 5HYJD 2Z92A 3NBNA 4Q9RL 4JRXB 4AK1A 1BX2B 3TP4A 3P0VL 1CDCA 4Z7VA 3WMSA 1MNUH 3Q5YA 1OD7A 3P73A 5EZLB 2YPLB 2AABH 1ZEAL 2IAMA 1UYWL 1MCJA 4MJ5A 2GAZA 1R3KA 1QQDB 4PRHD 5FO7A 1P4LB 2AK4B 3HPJA 2R23B 4N8CL 2XZCH 5T1KD 2DF3A 2RIKA 2DS4A 2A6KB 1G6RH 4CVWA 3FO1B 3BAEL 3U9UB 3VFVB 3HI1A 1LVEA 2EC9T 4EXKA 4G8FA 5EPMA 5I6XB 2FX7L 4GRMB 2FGWH 4NT6B 5D1XC 5KTEL 4LGSB 3KNBB 2X4OA 3GI9H 5HGGS 1I8IB 2WBJC 3MNZA 2F53D 3FQRA 5JHLL 2R1WA 2R2HB 1IAKA 4V1DB 4LQFL 3MRHA 2A6JB 4Z18A 4MWFA 3G6JF 4CGTA 1L7IH 2CSPA 2IMMA 1CU4L 4JFXB 2R15A 1I85A 3AS2A 1E28B 5E5MA 4GAGH 1A3QA 1KCVH 2X89D 3QXWA 3CFBB 3C60B 3P30H 3ULUL 2D31B 4DUWA 5C8JA 4HUVB 1EUTA 2V2WB 1JZ5A 2UZIL 1A9BB 3C2SA 3KPTA 1GL4B 4P9ML 4WWKC 4JHAL 1UJ3B 4AIOA 4KC3B 3H9SD 5E9DD 3MJ9H 5T1LD 4CVXB 1T4KA 3BZFA 2XTJD 4OD2B 3LN5A 3CUPA 2B8OT 2P4AB 5KSAC 3MMEA 5DURD 3MRLA 5HHOA 3QFJE 5L9DH 2A9NH 1SEQL 4FQIL 3BZEA 3GEWB 4V2CB 1D9KC 4XHJC 1BD2B 3W9DB 5K9OA 1J1XH 1U8IB 3DMMC 3WCYA 3TNNB 2HTKC 5DI8A 2OZ4A 3CGTA 1MAMH 3QHFH 4G6FB 3RZCB 4EUPB 2XKNB 2VDML 2GSGB 3FHAA 4HPOL 4RMVA 2JB6B 4JRXE 2J4WH 5CD5C 5LG1A 4OGYH 3KWWA 3AAZB 1EBAA 3QIUD 1ETZB 4MJ4A 5C3TA 1OGAD 5K59E 2YPLE 2EIZA 2V9QA 5F1IA 2OSLA 3QA3A 5D7IE 2ICWB 2AK4E 3RZWA 5ID1A 4KY1H 2VISB 3ROOB 3F5WA 2BJML 3VMPA 2P5WA 3IDXH 4YBQC 5IESL 1QSFD 2AJSL 5MENE 1U8NB 4BH8A 1A9EA 3KPRA 5LXGL 3DSFH 1NGWB 2V5TA 2W9EH 1BFVL 4XNQB 4LSRH 2YUVA 3EYSH 4D9RE 2DQFA 2JJSC 4Y4FB 4HSQA 1KXTB 1I7UA 3TCXA 3G5XB 1GGBH 3VXNB 1XF3A 2B7DT 4LU5H 4Z7QF 2AEQH 1U9KA 3WSQL 3LN9A 3VFRB 1MCHA 3CAFA 4P2QA 1MHHA 3VXPA 3MGOB 4M02A 4G6AC 4QRRD 2YD5A 5FOJA 1AFVL 2VLRB 2YSSB 1OSPL 4LVEA 3WO4C 2V17H 2IFFH 3LV3B 4D0DB 2UV3A 1A1NA 1CLZH 1U3HA 2JCCE 3WIHA 5CUSL 3TZVD 5DYOB 3NIDF 3MOBL 3NCBB 5HY9A 4U33A 1MH5B 1XGPA 3B2VH 2F5BL 3VG9C 4MNHA 2JJUA 2GUOA 3ZDZF 5FYKH 5EO1A 1ZHBA 1AHWA 2EXWC 2Y36L 4KUCF 4L4VB 1EO8L 2VLJB 2ENYA 3QO1B 1FZOB 1G1CA 1CGVA 4JN1L 4YNYA 1UG9A 5GJTH 2WNGA 5GS0L 2DMCA 5D7LD 4XP1H 1G7JA 3RVUC 1XT5A 5K9QI 3DWTA 1E6OH 4F58H 5C0GB 1R0AH 1NFIB 5D1ZB 4TTGA 1YEDA 3GDBA 5FYJH 3U9PH 3RWFA 4YXLL 5IMKA 3OX8B 4P99A 3OHXA 4NZTH 1DLHB 4Y2OA 1AGFB 3HC4H 4JO1H 4X6DA 3SDAA 3EUUA 3KPNA 2BY0A 1IC7L 3QEHA 3RDTC 4I1NB 5CP7B 3IKKA 2YHGA 5EOTB 2APBA 1K4CA 3NGBB 4F57L 3HAEH 4KRNA 4NZRL 3SKMA 4GQ9H 1UB5A 3MJ8B 4NNXA 1NBQA 3B2UD 4KVNL 2GT9A 3A6BH 5DWUH 4PRBA 5C08D 2IH3A 2IFGA 2MKLC 1Y6KR 3RWCB 4XVSL 3OR6B 4CN6A 5IM7B 5I8OH 3ARPA 2PYED 4C83A 1HHJB 5KZCB 1YEIL 1N5AA 1QSVA 3PUCA 1KEGL 2E7BA 1GOGA 2GJZA 1AGDA 2Z91B 4UBDC 1NBVH 5C0CA 2VZOA 1ZA6A 1IEAB 4B7IA 2W59A 3C8DA 3E8UH 2ZUQB 4ORZC 4S1DD 2F54B 2OQJA 1YECH 2HWZH 4YK4B 3H9YA 2CGRL 3ULSA 1LP9A 4W70A 2X4PA 4QHLA 3U7WL 3QI9C 1HYSD 1J8HB 5CD3A 1MCPH 3O6MH 2F58H 5GSVA 1G6RB 1AKJD 1C5BH 3G5VA 4XPHL 1QBMH 4FQQA 4DQOH 1UENA 3O9WA 3HMXA 3SE8L 4DOHE 3O45B 2CQVA 4OD1L 4CNIA 1BJ1H 4MSWA 5GGSY 5CEXB 2VLRE 3STLA 4LAJH 4U7MA 1WZLA 3X13A 2GW5A 2IPTL 4PJ5A 5AWNL 1C8PA 4G9FD 1DLFL 3HE7A 1G7HB 5KANI 4X4MA 3TBVA 5IHLB 4HULB 3EYQC 3PHOA 1LWRA 2N1KA 2IQ9L 3D3VB 1OPGL 3IS0X 4X99A 4FNLH 4L4VE 2VLJE 1PKQA 1NGXA 4P3DB 5ACLA 2VO5A 5GS2D 2DKMA 4F37K 4MD4B 2BSSB 5D70H 5HGAB 1E4KA 4TNWF 3GMNA 3RU8L 5IP4A 5HHQA 4JPKH 2BMKB 4RDQF 4RGMB 2ICWJ 3SE4C 3OKLA 2LVCA 5J6GB 2BNQB 4PUBL 1U3HD 4IDLA 4J4PA 1U93A 3CX2A 4KKAC 1AD9A 1YEHL 1YNKL 2NY4C 2YA2A 1UZ8A 4PRNB 2AJVL 4O2CA 1UZ6E 1QPXA 3SKNA 5GGTL 2RCSL 2BOBB 3JUYA 5T3ZL 2CLZA 4QF1B 3LS4L 4HQQL 3BHBB 2HT3D 3PQYA 4O02L 4ENED 5HVHB 4IHOB 4JKPH 5FB8B 5I2IB 1PG7H 3RNKA 5AZEH 5HD8D 2EDRA 3OR7B 4G9DA 1YYML 3MNWA 3QFDB 1IGJA 3MXWL 3U0WH 4YDVA 2GFBB 2IBZY 2AGJL 1CF8H 2WWMC 4NQXA 2R39A 4KQ4H 2R56L 4QRUA 4PRIB 4B53A 2GITB 3AS3A 3TT1H 1J9CT 4OCWH 3VWJD 1JZ3A 4Z7OE 1IQWL 4LKXA 3LIZH 2QQLL 3FT3B 2OI9B 4OI7A 5GRYA 2HKHL 1BP3B 3WDHA 1YEKH 1JGDA 5HHNB 1ZXQA 4D9QE 4LVOB 4GRWH 4I3SL 5JQHC 2HRLA 4WEBL 2VAAB 2YD6A 4IOSD 1DEEB 4LVNB 5B3JE 3MRNA 3VFUB 4YHYC 1OGTB 5I1IH 4D0BA 1YY9C 3BEVB 1EEQA 1WLHA 4R26H 5C0IB 4NO3A 4TTDC 5DD6A 1KN2H 2GY7B 1S7SA 5BS0E 3ORJA 3SDDC 3WXVL 3UCRA 2F54E 3BO8B 5MP6H 5I8KH 4ZXBC 2FZ3A 5B38A 3FMGH 4FA8A 3QCVH 1J8HE 1VGEL 2X1WL 2YPVL 1CICB 4YUEL 1OP3K 5HYSA 4LSQH 2C1OA 4QRPB 4MVBD 2BHZA 2NY3B 5E70A 4XCCL 4QRQA 2JTDA 3V4UH 4M1DH 4Y8DC 5C0CD 3CVHH 5SWSB 4DAGL 5FYLL 5EO9A 4GLRI 2NLJA 1U6AL 4OV5A 4Y5YC 5GSRB 1YEEH 1OARH 1GZQB 2NX5A 5FA3A 3WFEL 1GC1C 3P4MA 5MERB 3MA9H 4DFIA 3BGAA 2C1PB 1CGSH 1S9XB 2XA8L 3E3QA 4ZFGH 3PWUB 5B38G 1BQUA 1WTGT 4NJAH 1V7ML 1NCWH 3LS5L 1JPFA 5DEGB 4HK3J 3FN3A 2NXZD 2HT4C 3C5SA 3MBEB 4JG1H 3CX5J 4ERSL 1INEL 5HYSG 1NSNH 3BT2H 1E27B 4A2MA 3CC5A 4K7FB 4PJ9C 4PJ5D 5JOEA 2VZ1A 1OP3H 2V2TA 1FG2A 3F6IA 1IKFH 1OF2B 3KPOB 2WW8A 3MLVL 2I9TB 2DWDB 1RPQA 3WFCL 1G7QA 2J8UF 3FQXB 4MD5A 2XYCA 1AO7A 2AW2A 3IU4H 4I77L 3ZE1E 5HDLA 5LBSL 4KRPB 1KIRB 1BVLA 1RJZA 43CAA 1WEJH 3X11B 4H8WL 5FUCC 3PWVA 3B9KC 3CPLB 4BH7B 3C09C 1X4YA 1C5CL 3D0VA 2XZQL 1NCBL 2H26B 4X7TB 4OZFH 3W9EB 4GRLB 1P4BH 2IAND 2Y4SA 4PRIE 2EE9A 1IBGH 2Y7QA 4G8GD 3R8QA 4M3JA 4I2XB 4JZJB 4EIGB 1PVHA 3ARGB 3ES6A 1J5OL 4FABL 4UTBH 3OKEA 3MFFB 5EA0H 1U0QA 3PQYD 2ARJA 4MS8A 5SX5H 2X1QA 4WNQB 2HFFA 3BDYL 3UTOA 2VIRA 3G6JA 2MSPA 3GJFA 3V0VB 5HYQB 3V9FA 1KENL 43C9B 2CIIA 3LD8C 1NDGA 1KN4H 1C08B 2X70B 5I17A 2ADIA 4NO2A 3KPSA 2HLAB 2YPKA 3BKJL 4PJ8A 1LEIA 1KJ2B 3GUTB 1A7PH 5E2TH 1HI6A 3C6LA 3RJDA 1MRCH 5IBTH 1N64H 5J9PB 1OAQH 3ARRA 2SEBA 3S97C 2CRYA 1GHFH 1DQQB 5SWSE 5E8OA 4HKXB 2PCPB 2XN9D 3V5DA 3IXTB 4P2OD 2XIDA 3RIAK 4V3DB 4XMLH 4NRYB 4P2YA 1K4DA 4XAWL 1YNTA 3VGDA 2ZNXA 3FFDA 4JPWH 4L9LC 4TVPH 5HVFB 4KJYA 3VMNA 1Y6NR 2DLHA 4MCYB 4X7EC 3TA3A 4BSVB 2K9UA 1ZLVK 5I1LB 4J6RH 4DN3L 3HNSH 1I1YB 2J1KA 4Q9QL 1CXHA 4WUKL 3RWDB 5TFSL 3WFBH 1RZKC 8CGTA 3NIGF 5L8KB 1FRGL 1YJDC 5FEBA 5IVNA 4U0RC 3V8OA 2P48B 5GRWA 2NR6D 4IRJD 3QXTA 1X4XA 4ZOAA 1ULVA 4QXGL 12E8L 5KS9B 5IHUH 1K9TA 4X4ZA 3GO1H 4YZFF 4OLZL 1QVOB 3BPNC 5IVXE 4IIQC 5D1XB 4BUGA 2NNAB 3DECA 4OLUH 2QR0B 2B5IC 3UTTE 5CJOH 5CIPH 5J56B 2Q6WA 1ZLVH 2G5BA 1QFWM 3FT2B 5H2BA 2CO6B 4O51B 2XQYK 4LKCB 4BK5A 1MCBA 1L6XA 3O6LH 5TDOB 3VFMA 1DDHA 2W60A 5L6YL 1XIWA 2K7PA 5F8QC 1IL1B 1JRHI 4MHHG 1T66D 3L3GA 1QRNA 5E08L 1R3JA 4U7SA 1BZ7B 1XR9B 4WWKB 5CEZE 1J8KA 4X4YB 1NUDA 1HHGA 1MFDL 2VDKH 4X80H 1DBBH 4IOFC 3VJ6B 2CK0L 2NTFA 4Z0XB 4YFLI 5KSAB 4YHOH 3QEQB 5EOCJ 2IH1B 1ZGLB 3CSBA 4FFWC 2HMIC 3KYNA 1LD9B 5IWLA 3JZ7A 3NFPB 4JE4B 3TO4C 2QSCL 3D2UA 4PP2B 4YHML 1D9KB 3MRRB 1K5NA 5JO5B 3MXVL 2VYRE 3DMMB 4OCLC 4XAKE 5C2UB 2MCPH 2YEZA 3B3IB 3FB6B 3MRQB 4HAFA 4ZO6A 5FM4A 1HH6B 2YK1H 3RTQC 4NFBA 5J3HC 3E2HA 1L9NA 3C2AL 2R2EA 4KVCL 3BZ4B 4DN4L 4LPUA 1K85A 4ZO9A 1EEUA 4JRYA 4NPYB 3RVTD 3MACH 5EIQA 2XZZA 1UWGH 4OIIH 2NY6C 1I1AD 3MV8A 3K1KC 5TQ0L 2H3NA 3KPSD 4XMKH 2IJ0C 4AIZB 4DKEL 4G59A 4HWBL 5D72L 1FSKC 1QLFB 3C6LD 4OGXL 1U58A 3O6FA 1WAAF 2B1AL 2P46B 3ME0A 2HVJA 2CUHA 5EZOL 2WQ8A 5C0BA 1URLA 2UYLA 4ZUWB 1GVIA 1CT8B 2JJTC 4O2EA 3H7BA 4RFNB 3UJJH 1U91A 3UC0L 4ZUSB 5ANMA 1KFAL 3VRJA 3L3HA 5DMJB 2R29L 1UCTA 4WWID 3MPCA 1IRAY 2JKXA 2VXUH 1SBSH 5I75B 5KS9E 5BMFL 2AP2A 4DUVA 3GSWB 4XCFH 1MCEA 4WW2A 1L4IA 1ZS8B 1PSKH 3V7AE 1JZ7A 3HS0B 2OXGA 2CKBB 5DSCA 4TUKH 5CJ8A 5EG6C 5FO9B 3SN6N 4NWUL 3VXTA 4PG9B 2R1YA 4NN7C 2P8PB 5EBWB 1F00I 1GC1H 2G5RA 2YMXH 4D9LL 4LDOB 1YEJH 3WO4B 4LHUD 3GJEB 1RUMH 2HH0L 3OAUH 4WU7B 3SDCB 3MLWL 1IC4H 4IBLT 5FKPA 3MLSH 3FO9B 3QBTB 2A0LD 5GJSH 4H1LH 4JANA 1HHIB 5AEAA 3T0XA 2JJWA 4EVNA 5J06A 1G6RL 5DVLA 1EJOH 1A7QL 3P0YH 1AC6A 2CDFA 1FNHA 3RWEA 4MDJA 3BD5A 2FGWL 1B4RA 4LLYA 4R8WH 4B7LA 4K2UH 1EIBA 1FNEA 3LKNB 5ITFB 3IDJA 3BIAX 3GI9L 1B0RB 1ZHNA 3A0OA 1QKZH 5EIIA 3JTCA 4L1DA 4Z7WB 2A6DB 3IDGB 4H88H 1L7IL 1YPZB 1VCAA 4PV9B 4RIRA 1QSZA 4GAGL 1F6FB 2QADC 1JF1B 3EBAA 1IMHC 3OGCA 1KCVL 3LKRA 4A6YB 1OAZL 5HHOE 5ACZB 1P69B 4I0PC 2YUWA 1NEZG 1T89A 3FOLA 3WN5C 4NNYB 1MF2H 1WBXA 5GZOD 2PTTA 1Q9WA 3IKCB 5D2NC 3RDTB 2EH7H 4WIQA 3P9MB 2HJKB 3MJ9L 4PGJA 3JTSA 3PGDA 5ISZE 1VFOA 4XP9L 5JHDA 4M3KB 4U31A 5J11C 5JQ6H 1KXVC 2A9NL 4N8VA 4JFOA 3HG1A 5KSBB 4UTAL 3PF2A 5JXEC 3MV9B 3TBSB 1J1XL 1G7IA 2APTA 1GGYA 4N1CA 4RRPA 2HYMA 1MAML 3KXFE 2DM7A 3LOWA 4ODTH 1B6DA 2APXA 4GKZB 4KTDH 1K2DB 4JRYD 3BGMB 3HFMH 5L2KA 1ZVYA 2X9YA 4XWOD 3QI9B 5LJYH 2Y07H 3DURB 4E5XA 4WEMB 2AK1H 2J4WL 3QZWB 4OGYL 2P8LB 4PJDB 3MREA 2ZOLA 3VXSA 1HOCA 1M7IB 1UWXK 1BM3L 2ESVA 3NABH 3WLBA 4GBXC 1JPTL 5HHMD 4OAWA 1F13A 1HIMH 5C0BD 1YMMB 1MHCB 4FQXD 1T7ZA 5F6HI 4N8VG 3PP4H 4FG6D 5ICYB 1G7PA 3B9EA 3GHEH 3P0GB 4HHAA 3IDXL 1WZKA 5F3HB 4IOIB 4RRPG 2D03H 4UINH 1YJDH 2I07B 1WWCA 4N90E 4HK0A 3GMRA 3VD9A 3DSFL 4M62H 5F9JA 1AIFB 3TWCH 5B4MD 4LSRL 1U8LA 3S37X 1RIUL 3EYSL 3ARTA 3QDJA 4K9EC 4U6TA 5BRZB 5JOPD 1A7RH 2BY3A 4YBLC 1HSAA 2AEQL 1L0XA 4MHHI 4Z7WE 1EHAA 1CFSA 3DRTB 1HSBB 5D7KE 2BNRA 3NFNB 2IBGA 3CD4A 5LGJA 4PBXA 1IKNA 1DEDA 5L0QB 4BQ8A 2V17L 2NY4B 1YPZE 2IFFL 2XKUA 1ND0B 5IG7A 5D96C 5MEPA 1QA9A 1CLZL 3M45A 5EBLB 3T4AA 3NMEA 1GGIH 2A74B 3B2VL 1DUZA 3TC9A 2Z31D 3LKSB 5B22A 4UDUA 4F2MA 1QBAA 4HIXH 5FYKL 2VR4A 5SX4H 1IT9L 5E6ID 5HPMA 1XF2A 3X3GH 2VDRH 4FQ2H 4R7NA 5DJ8B 4Z76B 5CEYA 3T2PA 3IDYC 4X6CA 4NQVB 3LN4B 3OSKA 1R3HB 3NCMA 3UTPE 5GJTL 4U1GB 3FB8B 4Y4HA 3VCLA 2BVOA 4KI1A 1M6OA 4XP1L 3T1WA 4X83A 1E6OL 4F58L 3V79C 3AVEA 1R0AL 1CXEA 3QUMA 5KSBE 3BP5B 5BOPA 5FYJL 4KK5C 4RWYH 3MV9E 3U9PL 2Z93A 4XB8A 3NCYP 2WWKT 1PG7W 4N1EA 1OP5H 4YHYB 4Z78B 4JFHE 4NZTL 3Q1SL 5CMAA 1MRFH 3C08H 4LRNH 1FLRH 2XKSA 4JO1L 4XVUC 1KTDA 4QGTA 4ZXBB 1J05A 2P5EA 1ZWIB 4PB9H 1FE8H 4JDZA 1IGYB 1D5XA 4K3GA 3PG2A 4PJDE 3V6ZB 4XNXH 1WZMA 4YLQT 4E41D 5CEZL 4C56D 5JXAH 3KLHD 4OZGF 4GQ9L 1SJVA 4WI8A 3I2CH 1MHEB 3HG1D 1P7QB 1I1RA 3A6BL 4HFWA 5E8EB 5DWUL 2H32H 4PJAF 3VDCA 2C3WA 1T0MB 2YRZA 4QTIH 1YMME 1BBJA 4R90H 2ADJA 3RUGB 5EC1B 1FN4A 4U0QB 1KXQE 2ITCA 4X8JA 4X4XB 1FNFA 1WCQA 2XTJC 4YDIH 4Y5YB 1NBVL 1VEPA 3E8UL 2QTEA 2X9WA 4UT6H 4HDIB 1BPVA 1YECL 2HWZL 5D9SB 2XY1A 2GJJA 2Q7YA 5HGHA 1MSPA 1QP1A 2W65B 2EDBA 3NFSH 2ESVD 5AZ2H 4M7KH 5IOPA 3O6ML 4RAHA 3NN8A 3TT3L 1QBML 2X10A 1AD0A 4DQOL 5GGSB 1S9WA 5I1AA 4YE4H 3DOSA 4PJ9B 4M1GH 3ZTNH 1WBZA 4HKJA 3JVGA 3OXSB 4GKNA 1A0QH 1B90A 3QIUC 2APVA 3IU3B 4X5XA 3HCVA 1RHHA 5E6ZA 5IHBA 5E4EC 5F7EH 2BC4A 4U1NB 2VR9A 4L8BA 5E56A 2MCG1 3UBXA 3TYFA 1TVHB 3B9KB 5DMIH 3NPZB 1FDLL 4FNLL 4MA8H 3C09B 2DQGH 3U36A 1KTKE 4OLXH 4XRCB 4X7SH 4CDGC 5D70L 2BNRD 1N7ML 4JPIB 1FC2D 5IFJB 4JPKL 4GUPA 1VFAB 2QHRH 4ZO7A 4JFFB 2WP3O 5C9JB 4H25B 1PGRB 5AD0A 4PJCA 5JOFA 1NC4B 1N59A 2VMFA 2VC2H 1EEYB 1T3FA 3JV4B 4LFHD 5ICZA 3T2NH 2P8MB 4U6YA 5C0JA 4KHTL 4J3TA 1PEWA 3TFKA 1SBBA 1PG7L 3DVGB 5AZEL 1EXUB 5KVMC 5KVFL 3UBXG 3NZ8B 4HK3N 3HE6A 2FWOA 1NAMA 4UUJB 1A1OA 3W82A 3GZKA 4TNVK 4UIKH 3TZVC 1WFTA 3U0WL 1CFNA 5DJCA 3MRDB 2D7MA 3MJ7A 4EI6B 2OTPA 2VWEC 1DBKL 4KQ4L 4QHMB 2HFTA 5M94B 1ZSDB 3EJJX 4XP6L 2R0LH 2OR9H 4OZ4A 4OCWL 3TH3T 2R4RH 2H1PH 5JZ7D 1Q9LA 1A6AB 2GSIA 1GPOH 5CLTA 3EDKA 1J0YA 1IAII 2DWEA 2Q7NA 5JPMB 5I1IL 5JA8B 4UNTA 4WENB 1JGLH 4R26L 2UWEF 4FMKA 1FFOA 1KN2L 1NGYA 2OR8A 2NY2C 1BWWA 2OJEB 3GSOA 3RGVD 5MP6L 5IEKB 5D4QA 4BFBD 5HBBA 1TZGH 4F9PA 3D85B 3FMGL 5IVZA 1X5ZA 1UH4A 3QCVL 3L3KA 1FL6A 4DGYH 1AJ7H 5J4MA 1NFKA 2DQDH 5GRJH 4S2SA 3QUXD 4U0RB 1OQXA 3CFKA 4JG0L 4JZNB 3VU2A 2DM4A 3V4UL 4MMZC 4M1DL 1OOAA 2C3VB 2P24A 4P2RE 4NDMB 3BKYL 2OMNA 4KV5F 4I4WB 4WUUB 4MJ6B 1JNHA 3B2UC 4UQ2B 4YDJA 5FDYA 1YEEL 3W2DL 3BPNB 1OARL 4IIQB 3QWOB 3W0WD 1V3JA 3SGDI 3MA9L 2B5IB 1RJLB 2F5AH 5FYLD 1CGSL 5CZKA 3GB7A 4ZFGL 5EB9A 3F7QA 1UB6A 2Y72A 4Z77B 1NCWL 5BQ7B 1A4KA 3BP6A 3L3DB 1IGTB 4JG1L 4AEIH 4D3CH 5BCAA 3BT2L 1B3JA 3DETD 4LAQH 3FJTA 2KL6A 3G5YA 4MQ7A 1B0GA 4JKLA 4YX2H 1HYSC 2CKBL 1FBIH 3ZYJA 3D9AH 4HAGA 1OTTD 3QQ3A 2CIKA 5J6HA 1TQCC 1Q9KA 4MDIB 3IU4L 5F97E 4NQDA 1MFBH 3TV3L 3KVQA 1J87A 4XX1G 2HKFH 4NKMB 1YN6A 1WEJL 1YNLH 3CCHA 1T5WA 2VZSA 1FZJA 3H9HA 3GI8H 3PV6B 2R0WH 1L9MA 3QQ9D 5IROA 4P5TA 4L4TB 4X5WB 1F8TH 4W4OA 3F7RA 1IBGL 3EOBA 4HUXA 2MOVA 1CFVH 2ZUSA 1CFQB 4JVWA 4UTBL 3VMOA 2A83B 4MX7A 1J1PH 4LPWA 5ALCH 3RTQB 1Q9OA 3MLUH 3ULUF 1RU9H 3N1PC 5KVGH 5DUMH 1CGWA 1DSFL 2XV6B 4MCZB 5EU6E 1U3HC 4JDVA 2VZ3A 3JV0A 4MA3B 1T03H 2R0KH 5B8CC 5INDA 2NY6B 4A6YL 4QHUB 3WJJA 3ZO0A 1LGVA 5HHVH 2WBWB 4OZIA 1JYVA 1RZ8A 5DGRA 2Y5TA 3PIQB 2VAJA 3O3AA 4P23D 5JORA 2HT3C 3ULVF 1FSKB 4XMPH 1P1ZB 1HXYA 2PO6B 3PHQB 5HD8C 3IAQA 1A7PL 1RZJC 3O3EB 1G9EA 1YEGH 5IBTL 1N64L 3UZQA 1OAQL 4ETYA 3UZVB 5DJ6A 2ZUUA 3KHQA 4XVJH 5F71A 3ZT7A 1ORSA 3IETA 1CL7L 3BESR 5FHBH 1GHFL 2VQUA 2NZIA 3VXQA 3EYVA 1WZ1H 2NY7H 3S35H 2B2XL 1UT9A 2BSTB 1FJ1A 4GXUN 4RGNB 3PXHA 4XMLL 1DVFA 4UNUA 4WUUE 5DHXB 4ZUVB 3AXLA 3L5WB 4GW5A 3BEWB 4TVPL 5DFTA 3S37H 4PJHB 5DD1H 3T08A 3F65A 5KVEH 1S9VA 3TVMD 3R0NA 1XGRA 5EUOB 5F8RC 1PBYA 3S34H 5DC4B 1AQKH 4NN7B 3HUJF 3WFBL 4C4KO 3BXNB 3L3OB 3TPUA 1VHPA 2MWCA 5EZIL 3WFDL 3MLZH 4M9PA 4BELD 4MQXC 1UA6L 2VB5A 4NO0B 3RL1A 5CAYB 3VG0H 4DEPC 4PJXF 5D8JL 4NC2B 3KPQA 5LAXA 1TTFA 1TJIH 4H0IA 3V52H 3FO2A 3PGFH 2QKIA 4PREA 3VXRB 1PZ5A 3GO1L 4MVBC 3FAWA 4L3AA 5F6HJ 2VLKA 3MX0A 4Z7QE 4YPJA 3ZKMD 2EYRB 4LLMB 5CSZA 4OLUL 1PLGH 1SJHB 3B8YA 5C07D 4AYFA 4CVUA 2ZUWA 1JWUA 1OTSD 2J6EL 1TJGH 4WI3A 4RZCA 3FL7A 4F7EB 2ATKA 4AZ8A 1UWEL 4RFEA 4PP1D 5JLZA 3QO0B 3NIDE 4NM4H 2ITDB 3O6LL 4NUGL 1F4WL 4Y1AD 1S7WA 4MA1C 5C0AD 3ZDZE 3WLWC 4DKDC 4I0PB 3S3JA 3DXAB 4POUB 1EAJA 3MCLL 2NXZC 4OLWL 2VH5H 3WN5B 5JIPA 5T33H 3L95A 1U8PB 1NGZA 1RUKH 3ROLB 2E9JA 4WFEE 5D2NB 4X80L 3KLSA 1C5DB 4RGOH 2FLBT 1DBBL 4HS6B 3BQUA 1BREA 3I02A 3BW9A 5DJDB 4ZTOL 1WIUA 1K6QL 4GW1B 4ELMF 4HFUL 1KNOB 3ARBA 4PJBF 1ACYH 3U46A 4U3HA 4PJEB 2YBRA 5FO8A 3OTTA 1EAPB 8FABB 4DVBB 1WQVT 4YFEA 2MCPL 2H6PB 3LAFA 2AJ3A 1LEKB 2YK1L 1I8KA 3FTGB 1JZ4A 1QZ1A 2W92A 3QDGD 4J4PC 4JN2A 4Q2ZB 4R4FH 5GRUH 3IDMB 1GRWA 4RGNE 5IMOA 3V5HB 1Z3GH 1N0XL 3UPAA 1UWGL 3MGTB 4PJHE 4HWUA 4OIIL 1S7VA 3QEUA 1NUGA 4XZUA 4XMKL 4NM8H 5DMGC 4GBXB 2Q76B 1W72A 4TULH 1NDMB 1CGXA 1HNGA 4HC1A 1FYTB 4XNYH 5DDHA 5DVOA 1N5YH 2JF1A 4Q97A 1GOHA 3G6DH 1T1ZA 2VLMD 3PNWA 4ZPTA 3VRIB 4HGWA 2FB4H 1WTLA 3CFCH 3DTXB 4OCSH 5JW5A 3UJJL 4NZUH 4AENA 3HC3H 2QQQA 4NQEA 3DGGB 2OMBA 1ZAGA 4F7TB 4HH9B 3PWPA 1SBSL 3LB6C 2BRRH 1S9YA 3VXRE 1JF5A 4L3ED 2EEAA 1PSKL 1OP9A 3JV6B 1I9RL 2W1NA 5D2LA 3C8KB 3VWKA 4N9OB 1D5IH 4TUKL 4CADA 1CR9H 1I1CA 1A22B 4N0CA 3IRZA 4N9GB 5IW3A 1F02I 1WV7T 4GXVH 3FFCA 5I9QC 1Q0XH 1GC1L 5HYJB 2YMXL 1N3NB 2VITB 1EJ6A 1XAUA 1YEJL 2AV7A 2OZ4H 4MJIA 3RX7A 1F3DH 1RUML 3OAUL 5D96B 1DBMH 1IC4L 2G2RB 2EDKA 3FQUA 4N8PA 3MLSL 2FATL 4XBPA 4ONFL 2GJ6E 4YBHA 5DHYA 1U8KB 4FXGA 4NHCH 3SCMD 1EJOL 3NPSC 3RWIB 1MJJB 1J0HA 3RNQB 1A7NH 4PRHB 4NN6B 5C09D 4LLQA 3DV4A 4JQXC 4LSUH 1CLYL 4OFYD 4R8WL 3WJLC 1MHPH 4K2UL 5T1KB 5E8PA 5D2NE 5F6IB 3IDYB 1G9MH 4IDJH 1QKZL 2YXFA 4IRJC 1NC2D 5EWIH 4MXQA 2ZJSH 1LE9A 2W07A 1A4JA 1HXMB 2UZYB 4YHPB 4MQTB 5CP3A 3RAJH 4H88L 3K80A 1DP0A 5DRZA 3V95A 5F70A 3E3QC 4F7CA 4HD9A 5EU5B 3QG7H 4PJEE 3RWJB 3ZMRA 5JHDE 4H20H 2VRAA 1SJEA 2DD8L 2F53B 1BZ9A 4ZFZA 1OVZA 4R96A 1J88A 1MF2L 1FIEA 4Y7MA 1QO3A 1ERNA 4RMQA 5I1KL 4XP4H 1VACB 1LEGB 3QUZD 4U1MA 4WI6A 3QNYA 2E9BA 5TGBA 5IKCA 4KPHL 1OAUH 5A3ID 1BIHA 3V7MA 4EOWH 1PQZA 5L2KE 1BF8A 4HBQA 2FJGB 5JQ6L 1XCQB 3TBWB 5IBLC 3WIHH 1CGUA 4S11A 1A1MA 5CBAB 3QNXB 1JI1A 1OAKH 4LDLB 5EO0A 3H9SB 5E9DB 2VN7A 5T1LB 3P4OB 2XTJB 3ARFD 1A6WH 3LKQB 4HS3A 1XR8B 3A67H 5DURB 4Y2DA 4ODTL 1UM6L 2DB8A 5F9OH 5H94A 3NCCB 3LSOA 3UP1A 1RZJH 4QOKD 5ICXB 3HZMB 1KV3A 4P4KD 5IB5A 4G6JH 3HFML 4NQCD 5I8EB 5FYKU 2Y07L 4F7PB 2AK1L 1QACA 1RK0B 5EC2A 2Z35B 1FGVH 4NRXB 3BDXA 2W0FA 4YIQB 4OUOA 3DBXA 3MO1B 4KK9D 4KQ3H 2R2CA 3NABL 4Y16A 3QDMB 2E7CA 1HIML 1F11B 2E27L 5HYJE 5EU3B 5CHNA 4Y19D 3LKPB 3QUYA 5DJYB 3PP4L 3QIUB 5EU7E 4CN4A 3O2VH 4KMQA 3WBDA 1L6ZA 1RZKL 1OGAB 2D03L 5FYJU 5F21B 2ADGA 4UINL 1YJDL 5E4EB 4PJ8C 4EN3A 2JIXD 5DQJA 2VABA 3C6LC 4N68A 4FTVA 4PRHE 3TO2B 3TWCL 1PX4A 2EKJA 3TNMB 3MUY1 1FGNH 3H8NA 3BIKB 4J12A 3DUUB 1L7TH 1A7BA 3G5ZA 1DQJA 2AXFA 3VE0A 1QSFB 3QXDA 1T1XA 2EC9U 2Y23A 4K07A 5MEQA 3K81A 2J8UE 2ICEA 1T04A 3VA2C 1WCBA 3T1FB 5DO2C 4R4ND 3I6KB 2R1XB 1H3VA 4J1UA 4ZFOA 5C0EA 4K7PX 4QRRB 4X7FC 2PXYD 4HIXL 2CK2A 4LCYA 3HPJB 2V7NA 5F89A 4FQ2L 2E3VA 3T0VA 3TZVB 2A0LC 3HMXH 4GQPH 4DK6A 5I1EL 2VL5A 4PPTA 3MRIA 1JJUA 5DMYA 4KWUA 3AU1B 3CH1B 4YGVB 1DQTA 3C6SB 1D5ZA 2AI0H 1MCIA 2OBGA 3DHMA 4YXKH 3DVIA 4PTTA 3LHPH 4HIIA 5ERWB 3OKNA 4ZD3H 3AS0A 3VGFA 3U2SB 4WHTB 4XPTL 4R4BA 3AB0C 2GTZA 3H0TA 3RWGA 1FPTH 1AGEA 1MELA 3OKOA 3PE9A 4OT1H 5D7LB 1YY8B 5DVKA 5F9WB 1MRFL 1MCDA 3C08L 3M17A 1FLRL 4M5ZH 1JRHH 3K1DA 4W6YB 3QG6A 4MAYD 1XIWC 3DROA 3CSPA 4PB9L 1S7QB 2AXGB 4WHYG 1O0VA 3ISWA 2J88H 4XNXL 4IMKA 2MFNA 1N6VA 4KHXH 3I2CL 1UADC 2EDWA 3R1GH 3QIBA 3AY4C 3OF6D 4PLNC 5JPNB 1FQ9C 3FB7A 1JWMA 5GZOC 3IGAA 3BZFB 4LNRA 2K3TA 3LN5B 4R90L 3RKDD 2YD8A 4Y2DD 1X3DA 5IW6A 2OJZH 3MRLB 5IWLC 3ARUA 4F7MB 3LQAC 3AS1A 2FCBA 3V4PL 5C9KA 2DQCH 5C08B 5K9OB 1JWSB 1FFPA 1T5XB 1MI5A 3IJSA 4UT6L 3VFSA 5TPWH 1A6VH 5DI8B 2PYEB 4M9OA 4Q7DA 2CO7B 1FH5L 3QUKA 4QTHA 3MCG1 1KPVB 3NIGE 4P49A 5AZ2L 4M7KL 4AL8H 3IVKA 4APQA 3I6LE 1NANH 2R2BB 2IMNA 3TPKA 2VXSH 4YE4L 3QUYD 2FO4A 4M1GL 3ZTNL 4L3CA 4CMMB 4XWOC 3EYFA 1KB5A 1UXSA 1YN7B 1M71B 1TQCB 1A0QL 3IFOB 2Z4QA 3N9GH 4UOW0 1AKJB 4JFQB 2OSLB 2FL5B 3T77A 3ZKXB 4JY4A 3LEXA 4G42B 4W4NA 1IC1A 3LPFA 1W0VA 3F5WB 2D4DA 3U0TA 1RZGA 1HCFX 4FG6C 1BIIA 3DUSA 4MA8L 1S5HA 2DQGL 4G9FB 5DD0H 4OLXL 3DYPA 3L5IA 4X7SL 1CCZA 1T1YA 1UEYA 2VWEE 1RFDL 3I6GA 5DK0B 1LO3H 4CDHA 2QHRL 1C12A 2G60L 4WW2C 1CDIA 2AXHA 2EDJA 5H8DA 1Q72H 3EOYG 2CKNA 5IB1B 4WRLA 4NKQB 1SEBB 1NCNA 1Z6JT 2VC2L 3DHJA 4ODUA 4PV8B 2BVYA 3AUVA 4AIXA 1P2CB 3T2NL 2JK5B 5D7LE 4UU9B 1AGBA 3TCLB 1O7SA 4LSTL 1U3HB 4TSAL 1UXWA 2WBJD 4KTEH 3FQWA 5B8CB 1LO5A 4N0UB 4MNHB 2JJVA 5CWSA 4JVUA 4QO1A 3CJJA 3T0EA 4PRAB 2Z31C 5E7FA 4L8CA 2R0LL 1IAOB 4P4RA 2H1PL 4OZHA 4HUWA 2X7LB 3GJFK 3PDOA 1OM3H 1GPOL 4Y0GA 5C71A 2EE2A 2V5MA 2YD2A 5D6CB 3BP7B 1G7JB 3ESUF 1KB9J 1BJMA 3G08B 1I7RB 3VWJB 5ESVA 4XNUH 4W6WB 5IBUG 4DW2H 1TTUA 1ORQA 2MHAB 5C08E 5D7JA 4XCEA 5ALBH 5IMKB 2PYEE 1D6EA 4JJHA 3HLAB 1VFUA 3GM0A 1WFOA 4GKOA 1T89C 1U8OB 2ILLA 4DGYL 2ORBH 1AJ7L 3CDGA 3IFPA 4XHJD 1Q94A 1WAAE 2DQDL 5GS1B 4X6DB 1UH2A 5GRJL 4B50A 4R9HA 2FRGP 2D0HA 4U1KA 1SYSB 3S4SB 2Y9RT 3MRGB 5DD3H 3GJFH 2X4TA 5E94B 1XGYH 4P57B 3GSUA 4NNXB 5JDSA 4JM2A 1SY6L 3GSXA 4XBGB 3KLHC 2IH3B 1OAXL 3VXUA 4JFDA 1MI5D 4NBXB 5EH1A 1ZK9A 5DRWA 2DI7A 5DJZA 3HN3A 1DFBL 1FZKA 1KIPB 3FT4B 4NQDE 1AGDB 3PWJB 2OS7A 4TPRH 2F5AL 5C0CB 4G9FE 4LCWA 4MB4A 5FGRA 1JNNH 1WK0A 5HYFA 3I50L 3EJZD 4AEIL 4OLYL 3VXMA 2X4PB 1V3KA 2F74B 3NTCH 4ZSOB 4K9EL 4LAQL 1QBLL 1BLNA 3JTTA 1D6VH 2AV1B 3ZL4H 4H26A 3EDEA 4NO5A 4YX2L 3L3IA 3D9AL 3T2OA 4MA1B 2MKWA 4TRPH 4GKSA 2VKWA 2D9QB 2NXZB 3VFPA 5DA4A 1MFBL 4FFYH 4OTXH 3OPZL 5EBMB 4DVRH 1TZHA 5EOQH 1GJIA 2HKFL 4PJ5B 1YNLL 1HNFA 4N5UA 3BH9B 3HMWH 5FXCH 5DC9B 1KT2B 2DQJH 4N0UE 2Q86B 2XQBH 4NJ9L 1CVRA 4G8EB 6CGTA 3GI8L 1IC5H 4PY8I 1A6ZB 3OKDA 1K8DB 5C1MB 1FIGH 3MV11 5D71L 2X1PA 15C8H 3IJYA 4WFFE 5DMKA 1R5WB 1UQSB 1PKQB 1FZMB 2Z9TA 3OKYA 2WAHA 4FQLL 4GFTB 4WI9A 3TIDA 5IV2B 1QSEA 3EJYD 1CFVL 3K4AA 1F4YH 5INCA 3ARWA 1A8JH 3VH8B 4UQ3B 1I8LA 1A6TA 4P5MA 4OCYL 1J1PL 2XY2A 3OKLB 2CDEA 3MLUL 2IANB 4ZPVB 3WNKA 1AXIB 1RU9L 1IKNC 4UDTA 3H42L 5KVGL 5DUML 3OKKB 3BD3A 3PABA 2BCKB 1WWBX 4HS8H 2R0KL 2ATPA 2C26A 1XH3A 2PW2A 2VOTA 3PQYB 5HHVL 3C9NB 4KRLB 2OXHA 3ZE1F 2FNBA 1LO0H 1TENA 4G9DB 2WLYA 3MNWB 1HHHB 5F7DB 1MCSA 1KPUB 1MJ7H 1R6VA 4ZNCD 2MQ3A 5T3XH 5I73C 1YDPA 1XZ0B 5FOBB 4NQXB 1R5IB 4BZ2L 1KULA 3UAJD 3MR9B 4PRPA 1KACB 3RBSA 1WC7A 4LLAA 1WZ1L 2XPGB 2NY7L 3ARDA 3MGAA 4QRSB 3U4BH 3QULA 5JZ7C 1A6PA 4HUMB 3S37L 5BV7C 2VNCA 3MRNB 1WWAX 2KUTA 5DD1L 2FIKB 4DGVH 2VDNH 5KVEL 3AM8A 3HPLA 5C7XH 3QWRD 4PJAB 2YS4A 3LQAH 1J1OH 5TDNA 5DD6B 2V9RA 3B9DA 4P3CL 3S34L 1S7SB 2XN9B 5I9QB 4S10A 4P2OB 4WV1B 2F8VA 5SWQB 3NCJH 4TVPD 1R5VA 3CFDB 1JV5A 2P47B 5B38B 3IF1A 3GMLA 1T2QH 3MRJB 3KYKL 3IDIA 2A77H 5IB4B 4P59L 3WKNA 3VG0L 3HI6H 5I30L 1WICA 2BHUA 4UZGA 2CLVB 4JFDD 4K7PH 1R24A 2X5PA 3HB3D 3PGFL 4QRQB 5E1AA 3P2TA 3QUXC 3TN0A 4PBWD 3Q6GL 3HZVA 3MUZ1 1BFOB 3R0MA 3WNLA 2YN3A 1IGIL 1PLGL 3ARSA 4IRJB 5TDPA 3U0PA 2OCFD 3IDUA 1TJGL 1FFNA 4YDKH 4PJFF 5FA3B 3QFJA 5D1QA 1DN0B 2LVEA 3DI3B 1G7MA 4HJGA 4ISVA 4ONHA 4NM4L 1FVCA 1FL5A 5TE4H 4PD4K 2V6HA 2C7UA 3FO0H 4ZAKA 3VFGL 5IB3A 1TETL 3NOIA 1RZ7H 1OAYL 1H8SA 2VH5L 3FQNB 2V2TB 1NGQL 3QSKB 1FG2B 2IANE 3O3UN 4I18A 4DTGH 5T33L 3WFHA 3JVGC 2COQA 4G8GE 4MD5B 2OTUB 4JRXA 1HKFA 5DD5L 5ILTH 2VL4A 1OTTC 1H8OA 1IAMA 1BVLB 5GISL 1RJZB 1S7UB 4Z95H 5E8DH 1FCGA 2R4SH 4FQJH 2YPLA 5EZLA 2A73B 3PWVB 1ACYL 4JB9H 1QSED 1QFWL 2YD9A 1QQDA 1S7XA 1R3IH 1CDUA 1P4LA 5D7IA 2AK4A 5CGMA 5GS3A 3G9VA 3O3DB 2R23A 5I1JH 1EO7A 4LLUB 1N4XH 1GIGH 2A6KA 5MENA 3FO1A 3QQ9C 4PGBB 4NKIH 3U9UA 3VFVA 3K2UL 2YOCA 5GRUL 1IQDA 4R4FL 3S3SA 2ZG1A 4LP5A 2O5ZH 1GAFL 1L0YA 1Z3GL 4GRMA 4NT6A 3VFOB 4WHDA 1W8OA 1H3XA 3KJ6H 4JFEE 2ERJC 4PFEA 4OZGE 4PJGF 3KNBA 4KDTA 4OLEA 3GJFB 1EUUA 4PJAE 3TFKC 4NM8L 5ID0B 2R2HA 1HE7A 4TULL 2XN9E 3UMTA 2A6JA 1HHKA 5ADPH 4HXBH 2CIIB 4OM1L 4JFXA 3G6DL 1E28A 2JCCA 1KCLA 2UWEB 1I1AB 1EPFA 3CFCL 3FFCE 4NO2B 4PRDB 3KPSB 2M26A 2XXMB 4NZUL 4LK4A 3HC3L 3C60A 3CFBA 2EDNA 4XVTH 3SDDD 3WKML 2D31A 4HUVA 4MJIE 1HI6B 1A9BA 3C6LB 1ZMYA 4Q6YA 1J11A 1ZTXL 3I3EA 2BRRL 4GG8B 4LBEB 1KGCD 1A5FH 2X4UB 4Q0XH 1KJMB 4ZS7H 5J12C 2L7UA 5HDBE 1D5IL 4CVXA 1GCFA 3WL9B 4GXVL 1Q0XL 4EDWH 2Q8BL 1KOAA 2OZ4L 1LK3H 5E2VH 1DBML 4OB5L 1Y6MR 3W9DA 1KCUH 1U8IA 3TVMC 2H2PD 3TNNA 4M7LT 3HI5H 2NYYC 5FDWA 3WXWH 4LLVA 4M7ZB 1OHQA 3EOTL 2XKNA 5I18H 3GSQB 1O7VA 5I16B 4LHUB 4RISL 5E2JA 2KPNA 2DLIA 1EEZA 2JB6A 4LSUL 4R0LC 1A3LH 5FGBA 4EI5D 1MHPL 3K2MC 3NCYS 3SKJL 2HT4D 2MQ0A 4RA0C 3DGCR 1G9ML 4N0FA 1VSCA 5EWIL 5EBGA 5D1QD 1ETZA 2ZJSL 3T09A 3B5HA 3QEGH 2ZUTA 4XPGH 2DICA 2YKLH 4GSDH 2VDQH 3BOVA 3EO0A 3PWLA 4ALAL 4Z6AT 4YPGB 3ZKMC 2ICWA 3UDWA 3RA7H 2ENSA 3QG7L 5T1DH 3L1OL 2Q6WB 2FO1A 2VISA 2LTQB 3AB0B 3D25B 3OAYK 1T80A 4MZ3A 4J2XA 3TJHA 1OTSC 2VE6B 5KJRH 5I76B 1BOYA 2BNUB 1U8NA 3B9KD 2IQAA 3GSNA 4YR6B 1X6NA 1F97A 1NGWA 4PP1C 3EO1B 1DDHB 3MOAH 2YUXA 4XNQA 2FECL 3PP3K 1RJCA 3S98A 4XP4L 1X7QB 2DDQL 2HFEA 1I7TB 4Y4FA 4UV7L 3G5XA 3JBG7 3VXNA 4HWZB 3HNTL 5JR1L 4EOWL 3T2QA 3GNML 2C3HA 2ED7A 2XWBB 3QQ4B 4O4YL 3VFRA 4EZMA 3I3BA 1IZJA 1CZ8H 2F15A 2XICA 4K3JH 3MGOA 3SDYL 3WIHL 4GAJH 2YSSA 2VLRA 4F37F 4OF6A 1BWMA 3WHE0 3HZKB 4D0DA 5MEND 2PYFB 2UWEE 2XG5A 1A6WL 4GRWF 4PDCE 4D0CB 1MH5A 1FCCA 3A67L 2EIBA 1P6AB 3OAYH 4KGJA 5F9OL 3X12A 3SE3A 1RZJL 4JGMA 4D9RD 2ZSVA 1FP5A 3BYYA 4G6JL 1F90H 1QHOA 2YEZB 2WUBH 4L4VA 5IGXL 1JFQH 2VLJA 3F62A 3QO1A 4M7JH 1DL7H 3RKPA 1FZOA 2FBJH 3QCUL 3PP3H 1H0DB 3WNNA 4R3SA 2NY1D 4KQ3L 4JRYB 3QUMH 4WW1B 4Q74A 4KXZI 5BV7H 3ELAT 3QHTC 5E5UB 3BN9D 3B9VA 3SGKA 4HPYH 3L3JB 2XWTB 5C0GA 1KBGH 1NFIA 5D1ZA 3JWDC 3WJJC 1C1EH 4KV5E 2DTSA 3O2VL 4LEOB 3OX8A 4Y8AA 4OF7A 1DLHA 1S5IH 5HHMB 2HVJB 3UTSD 1BQHA 5C0BB 2CLRA 1AGFA 4FQXB 4UIMB 4KI5C 4AH2B 1PAMA 1FGNL 2VXQH 5ANMB 1M05B 3BP4B 4O2FB 1XEDA 3BFOA 5I8CA 5CP7A 5KSVA 5EOTA 2XOTA 4PGDB 4OFKA 5BW7A 3R06B 1WGOA 5LCVH 2XTLA 4PJXB 4CJ0A 1RZFH 5KVDH 1NUNB 5E00B 2D0FA 3RWCA 2E9IA 2NY0D 4ACPA 3OR6A 4LIQH 1NCCH 3EFDL 5IM7A 2FEEL 2R1YB 2OP4H 2HRPL 2Z91A 5EORH 1AC0A 5I1GH 2V2XB 1IEAA 4GG6F 5D7SH 4RX4A 1PYWB 1BQHG 2F54A 3IFLH 4I3RL 1REIA 1U3YA 3HMXL 4OI9A 5IQ7L 1J8HA 3MBXH 2WBKA 2Z31B 1PY9A 4MDJB 4QXUH 2I60H 3OJDA 5E6IB 2AI0L 1FNEB 5CEXA 1UVQB 4ZD3L 4UT9H 1SHMA 3IAGC 4G7YH 3QRFM 1QFHA 1FPTL 3HNVH 1VFBB 4Z7WF 4OT1L 2GYSA 1XF4B 3FZUD 3WUWA 4M5ZL 3PV7A 4M8QB 4RIRB 4LSPL 4DZBB 3F58H 3ARQA 1EV2E 3MQIA 3LKRB 3EDDA 1UKSA 1VEMA 4M7LH 1NMCC 1GGUA 3UTZB 3TO4D 2J88L 2APFA 2G75B 5ADOL 3ILPB 2FDBP 4M6MH 2BSSA 5HGAA 3MV7D 4KHXL 2PTTB 1Q9WB 2BMKA 3O6KH 2FLRT 4BZ1H 5J6GA 2BVUA 2DLGA 7CGTA 2APWA 3BQUC 3FOMB 3JTSB 4MAUH 1N2RB 1H3PH 1ZHLB 4HJ0C 5J3HD 4PRNA 1BOGB 2EC8A 2L0DA 4E41B 2OJZL 5A3IC 3VGAB 1IVLA 1H8NA 3ARBC 4C56B 1Q1JH 2R0ZH 1NAMH 3BHBA 4JFOB 3HG1B 3TGXA 3WUWG 2DQCL 4IHOA 5HHME 5FB8A 5I2IA 4XC1H 5TPWL 2UVEA 1A6VL 4HX1B 3QFDA 4KK8C 3MODH 3HUJE 3ARFC 3DARA 5C3LD 1JTTA 2XA3A 3PHSA 2RFXB 4AL8L 3ARED 5KG9B 5BZDA 4PRIA 4FFZH 4E5XB 2VXSL 3L5HA 4PJXE 3MREB 1HOCB 4OM0H 1I1FB 5HHNA 2ZZUT 1U8HB 2ESVB 3GMPA 4ODSH 1AE6H 1DEEA 3CFJB 2PETA 3LMJH 4JHZA 5IMMB 1FO0A 2MPAH 3N9GL 3VFUA 1NCAH 4MB3A 4OAWB 5I66B 4ODHH 1OGTA 1RMFH 4KK9C 1BF2A 3BEVA 5C0IA 1EA9C 4D8PA 1YUHB 3VFWB 3WIIH 3FN0H 1G7PB 4HHAB 4J23A 5DEZA 4MB5A 4KTYA 3BO8A 3GSVA 1KYOK 2OL3A 5DD0L 3RIAF 2PR4H 3BD4A 4HK0B 5F9JB 5E99H 4L1HA 1CICA 5CCKL 3TH2T 1LO3L 4D9QD 2VXVH 3D1MC 4QRPA 3GIZH 1Q72L 5HDOA 1AQDB 1ZLWK 3VFNB 3QHZL 2R8SH 4XGZB 5CJ5A 5SWSA 4FQHB 2GHWB 1KPRB 2BNRB 5LGJB 5BS0D 4UOW1 5A2KH 2EDHA 3MUJA 5IG7B 5GSRA 4AM0B 4RBPK 3WNPA 1A3RH 1MIMH 5DFVC 3VRLF 3RPIB 4ELME 5EFIB 4R4NC 4UDUB 2C1PA 1S9XA 2KZ1B 2ICWI 4PJBE 3MC0A 4WI4A 3CK0L 4WGVB 1MVUA 5DEGA 5HPMB 4NFCA 2PXYC 3OB0K 3MBEA 2QADD 5IFHH 1E27A 5I73B 1BQLH 3M8OH 4MNGB 4K7FA 3D39D 5CEYB 1OM3L 2VXTL 4MXQC 1OF2A 1PW3A 2A6IA 2DYPD 4A2LA 2DWDA 2I9TA 1VDGA 4I9WE 3FQXA 3P11H 1X5IA 4E41E 5AYUH 4C56E 1TVBB 2IC2A 4OD3L 4XNUL 3PXJA 4XT1C 4DW2L 3ALWA 5IVXA 1JF6A 4ETQA 2VR5A 3ZT5A 5ALBL 3X11A 1RK1A 3CPLA 3UTTA 1FAIH 1T20B 4BH7A 2RHEA 2JLLA 3C5ZA 4RBPH 3V5KB 5HI4D 4QNPE 1Q0YH 3UO1H 4ODWB 2H26A 1VPOH 2ORBL 4X7TA 3W9EA 2ZWLT 4GRLA 5GPRA 4YWGL 1JE6A 4MAYC 2AERT 3FB5B 3RGVB 1D5XB 5TH2B 4LMQI 1RVFL 4JZJA 3SJVD 3MLYH 1CIDA 1CDBA 1A7OH 3BKCH 3O0RL 1LK2A 4H5SB 4AEHL 1TLKA 1XGYL 3MFFA 4HFWB 3KR3H 1Z9OA 4WFHE 4YO0B 1C16B 3QUXB 5GIRB 3V0VA 3JWDH 1FN4B 3WIFB 5HYQA 4K8RD 2ITCB 43C9A 1XGQA 2YZ8A 1KTLA 3RUGF 4Y2DC 1U36A 2J3SA 4EIZC 1D5MB 1C08A 1JNNL 2X70A 5IJVB 3MRMB 25C8L 2HLAA 4L4JA 4U1IB 4WY7L 3NTCL 3SOBH 3EDFA 1KJ2A 3W0WB 3GUTA 4MNQD 3ZL4L 4NN5B 2RR3A 5J9PA 3NN8B 3P77B 3PDGA 4TRPL 1KIQA 2P7TB 1DQQA 3C8HA 3MRBB 1H5BC 1PFCA 1WBZB 4HKXA 1J10A 1HEZB 2PCPA 5LKNA 4OTXL 2YD4A 4HKJB 5ESQB 2ZPKH 4DVRL 4P5KA 5EOQL 3GGWB 3QUYC 3KS0J 4GKNB 3V8CA 3ZSSA 1C7TA 4X0KB 3HMWL 2X41A 2DQJL 1RHHB 4MCYA 5DK2B 2X44D 1IC5L 4EN3C 1I1YA 4L8BB 4OFDA 1FIGL 3NCEB 4NNPL 4YH6A 2X42A 2ZUYA 4LOUD 3RWDA 1QTYT 1S7RB 1XGUA 2HG5B 3U36B 4ELKB 4WGWB 1MCQA 4MNGE 4U1JB 4YHLH 1T7XA 3EZJB 5T3ZE 4FHBD 5KOMC 3RPKA 2FH6A 3DSNA 2EICA 4HJJH 1F58H 2BX5A 4NFDA 5KS9A 4ZOBA 3O8XD 1QVOA 3PGCB 5D1XA 4PRPE 5TQ2L 1T3FB 2ERJB 2NNAA 2AJYH 4JDTH 2QR0A 4U6YB 4RFOH 5HTSA 5DHVA 2AAVA 1LO0L 4Q58C 1OSZA 1UJTA 1ZVHA 1NAMB 3DUHA 4KK5D 1MJ7L 3FT2A 5KANG 1OT2A 4O51A 5T3XL 5DR5H 4LKCA 2PKDA 1CBVH 1E4XH 5TDOA 3QJFB 3NH7H 3O4LE 2ZCHH 1GSMA 3CVIH 1KCKA 1IL1A 4P23B 3UYRL 4XVUD 3CNKA 1X5XA 2R69L 1AR2A 3F7YB 2GSIB 3U4BL 1BZ7A 1XR9A 4WWKA 4JO2L 3UTTD 4X4YA 1AR1C 1JUFA 3C5ZD 3BRGC 4DGVL 3V7AG 2VDNL 5J12B 1IM3B 4JJ5B 5FCUH 2O93L 2EXYD 5C7XL 3LQAL 1J1OL 4Z0XA 4QWWC 4JM4H 2IH1A 1ZGLA 1LD9A 3CDCA 3GSOB 3NFPA 1GOFA 1AXTL 4PP2A 1I9JH 1D9KA 3MRRA 5JO5A 1T2QL 3MNVB 3MZGB 1ZLUK 3W0WE 3VDAA 1VGKB 2IBBA 5GGVH 3DMMA 2A77L 2AJXH 3TVMB 3HI6L 5FYLE 1JHKH 3DRQB 3B3IA 3FB6A 3MRQA 4PGEA 4S2SB 1INDH 4K7PL 1HH6A 4QLRA 1HQRB 2EDLA 3CFKB 1QD0A 5SWZD 1ZT1B 3ABZA 4ZS6C 3BZ4A 4LNVA 4R0LB 5FHAL 3GRWA 4NPYA 3Q48A 2PTUA 1JBJA 1W72H 4KKBD 4HC1H 3QDMD 2CUMA 5ISZA 4GT7A 4AIZA 5ECJE 1U8MB 1G0YR 4FN0A 4YDKL 1I4FB 2HVKB 2O61B 1JHLL 4Y5XA 5D93B 5TE4L 3X14B 5C07B 1IGMH 3FO0L 4APQC 1CT8A 1KC5H 3KXFA 1ZLUH 3P4NA 2IADA 3QPXH 4ZUSA 3SGEH 3BUYB 3EJZC 1B0GB 4DTGL 5IB2A 4P46D 1I3RA 1F6AB 3GSWA 4CU8A 5ILTL 1ZS8A 4Y1AB 2JJSA 5C0AB 2GTWA 3HS0A 2CKBA 4KH2A 1T6VN 1KELL 4NYLB 2GIYA 4Z95L 5E8DL 2R4SL 5C92A 4X6EA 5MHSD 1CK0H 4PG9A 2P8PA 3T65B 4UNVA 4JB9L 2IAMD 1KCRH 1R3IL 4X5LA 4WU7A 3SDCA 1IGFH 5I1HH 3B6SA 1N26A 3FO9A 5FUZH 4V1DE 3E6HB 1HHIA 1N4XL 5B21A 35C8L 3BPOB 1GIGL 4FP8H 4NKIL 2IG2H 3FRUB 3S5LB 4OBRA 5T1MB 4U6VH 4ONOA 2MNUA 1RUAH 2O5ZL 4CL7A 5DJXA 4L29B 4CU6A 3EJYC 2DQTH 4MX7B 4QKXB 3KJ6L 5L7XH 3LKNA 5ITFA 5CP3H 1B0RA 1WFUA 4XBEH 4Z7WA 1CD1B 3MRKA 2A6DA 3IDGA 3UZEA 4JDVB 3QDGB 4JO4H 5ADPL 3P9LB 1YPZA 5JW3H 4PV9A 4OZIB 3L7EB 1S7TB 3QNZA 4JFZH 5L2JB 1SM3H 1JF1A 2QQKH 32C2B 1H3WM 4A6YA 3EZ8A 1RJYB 5ACZA 1HXYB 2NY2D 4JY5H 4XVTL 4HIJA 4CW1B 5E2UH 3T3PF 1BD2E 1RIHH 3BE1H 3QB7C 4Q0XL 1ORSB 4ZS7L 3IKCA 5DXWA 3RDTA 5E2WL 3VXQB 3CMGA 3EYVB 3P9MA 1VADA 3UAJC 1G84A 4PYGA 4NOBA 4QXTB 1KCSH 3RQ3A 4EDWL 1IILE 1S9VB 1UKQA 2FHFA 4L3EB 5HHOD 5KSBA 1M7DB 4PJHF 5E2VL 3TBYA 4UI2A 1AXSB 1KCUL 5JW4Q 3MV9A 1W2KT 3TBSA 3LQZB 5C07E 5BXFB 3TPUB 4MD0B 4R2GC 3RGHA 1YMHB 4AMKH 5EUOF 1JPST 3HI5L 2FD6L 4HLZG 1NLDH 2DN7A 4NKDA 3WXWL 3SDXF 3T0WA 4GKZA 2HJLB 2WUCL 3B4NA 3EYUH 1NFDF 3RL1B 3DX6B 5K93A 4GMTH 3BGMA 1JGUH 4X9HA 5ISZD 3PL6A 3QZWA 4PJDA 2P8LA 5HVGB 4Y1AE 3CZFA 3FO2B 5C0AE 3SCMB 2V9TA 4J8RA 4I48B 5C0FB 3QEGL 3HB3C 3EGSB 3QXUA 4XPGL 5H35B 5C09B 4N0RA 4YHNA 3SQOL 2YKLL 2VDQL 4FQ1L 4JFPB 5KAQG 5CFHA 1YMMA 1MHCA 4NC1E 3BVNA 3RA7L 2H2SD 3KXFD 1P84J 1MAJA 1JGEA 2ZG2A 5E1HB 4E42A 3BWAA 1NC2B 2PN5A 4NHUB 1EZVX 4U1HA 5F3HA 4IOIA 3KHOA 1EX0A 2P5WD 3RY5A 2I07A 5BJTB 5FKAB 2J6EA 3SY0B 3MYJB 1AIFA 3MOAL 1S7WB 3KPRD 3WNOA 2FHCA 4HIEB 2WSKA 1NMCB 5E8NA 2CPCA 1MUJB 1E6JH 4HF5H 3QZWG 4RMUA 4LMQE 5EU4A 4F80A 1CZ8L 4Q9RH 4K3JL 2F8XC 3SE4A 1WWWX 1HSBA 3QDGE 2UZXB 1DN2A 3VD5A 5J1AA 3P0VH 4P2QD 3QUZB 1ND0A 3GMQB 2J5LC 1UYWH 5EBLA 5DQ9B 3SE9L 2A74A 1VENA 4KU1A 1VESA 1F2QA 3U46B 3ZSTA 3H2WA 4WHYH 1ODAA 4U1LB 3KYAA 2YBRB 1I7ZB 2YWYA 4NSKB 3GMOA 5FF6B 2VLME 2DJUA 4NQTA 4JR9H 1V8HA 2WUBL 4PJEF 1JFQL 2VDOH 3ARFB 1WT5C 3BAEH 1DL7L 2EEBA 4Z76A 1I8KB 2FBJL 3KPMB 5FV2A 3LN4A 1R3HA 5FM5O 2HJFA 3FB8A 5KSUB 3IJHB 1HH9A 1CDYA 4QOKB