1JGEA

Hla-b*2705 bound to nona-peptide m9
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-27 B*2705 ALPHA CH
publication title HLA-B27 subtypes differentially associated with disease exhibit subtle structural alterations
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jgeA01
4X6FA 1AD0B 4PLKD 2RB8A 2DLTA 1F5WA 4PG2A 5I1HH 1J05B 3HE6A 3SKOB 1E28A 2GJ6A 2NY7L 1R3IL 3I2CH 3EO1B 2J6EL 4MQXD 4NM4L 2FNBA 1AD0A 4HUXB 2IH1B 2WSKA 1YY9D 1BLNB 2D03H 1J05A 3SKOA 3EO1A 2AK4B 4HUXA 2IH1A 1S7XB 1BLNA 3LEVH 1W72H 4G9DB 2AK4A 3SGDH 4M00A 1I8LC 4GBXC 4KTDL 1S7XA 5GRZA 2V5SA 2XTJD 3PNWB 3O3UN 4KAQL 2VDLH 4YXHL 1LO3H 4L1HA 4YHIB 4G9DA 3QZWB 1JPTL 1A1NB 2GI7A 2MKLC 3PNWA 1N6QH 4TPRH 1IAIH 4YHIA 3B5HA 3QZWA 5DD0H 1WV7T 4A2MA 1A1NA 4N9OB 1UZ8B 4XBGB 5IB5B 4WFGE 4KPHL 3RUGE 5DURB 5IT2L 3GRWL 3IJSB 2IH3B 4LFHG 1UZ8A 4KROC 4XBGA 2APBA 5IB5A 5K93A 4OQTA 3ZKMC 4O02L 3QXDB 1SEBB 3IJSA 2IH3A 1FRGL 4QRQB 1F45A 2FD6L 1KB5B 2GEEA 2J5LB 3GO1H 3QXDA 1EO7A 4AIXA 1MQ8A 1SEBA 4FQXD 5IBUG 4KJQD 3GI8L 1HYSC 4FRWA 4QRQA 1FE8H 5BQ7B 1KB5A 1IAOB 1MIML 4G7VH 5DVLA 3AU1B 5IBTL 3VD5A 2E7BA 5GGVH 5AZ2L 1GGIL 1HYRC 2BVTA 4Z0BL 3KPSB 5BQ7A 1IQWH 1IAOA 2ID5A 1KJ2H 3AU1A 3D2UB 4F2MB 5JQHC 2WBJB 1EMTH 4HK3N 1JYNA 5GJSL 3MBXH 4Q9QL 2IBBA 4CW1B 2JIXD 4EXPX 3SN6N 5J11B 3SDCD 3KPSA 2BVUA 1OGAE 4IBLT 2C4XA 4DEPC 1BBJB 3D2UA 4F2MA 2VDQL 2WBJA 5GJTL 4C56E 4XPBL 4CW1A 1KIPB 1CE1L 1NGZB 1SEQH 3FO9B 5IEKB 4LP5A 5GRVK 3KDMB 4F9PA 1BBJA 4ZFOL 2EDRA 5CZXC 5DJCB 4EJ1C 3MGTB 3ESVF 1KIPA 2APVA 1NGZA 3FO9A 4W6XB 3U30C 3T0EE 5IEKA 3KDMA 4LCCB 2XTJE 5DJCA 4ODTH 1GGBH 1MAJA 1NGQH 3MGTA 2X44D 3U82B 4WFHD 4FFZL 3RIAF 1A7OH 1Q0XL 1I9RL 4LCCA 3TH2T 1KN4L 2A6KB 2AQ3A 2Z8WC 4ELMF 4N8CH 1ZLVH 2ENSA 3RY6C 3HFML 5ITBL 4J2XA 2LTQC 1CDYA 1CFVH 1WICA 4P4KC 1K8IB 3A67L 5HDBF 2A6KA 1EAJA 3O6KL 5F7WC 2BFVL 3P0YH 4N5UA 3KR3L 1K8IA 4FFVC 2BX5A 4M5ZH 1MJ7L 1NANH 3IFPB 1HKLH 4J4PC 5E6IB 3E8UL 1IEAB 3U79A 1VGEL 1PAMA 5EULV 3SKMB 2PETA 2VKXA 3EJZD 3IFPA 4ODVH 4OZIF 5E6IA 4WIQA 3P4OB 1MY7A 1IEAA 4TNWK 4R8WH 4YO0B 4NQVB 4OF0A 3SKMA 4Y4HD 2ZKHH 4K8RC 1BJ8A 2IC2A 2C9AA 3CZFB 3P4OA 4HFUL 1PBYA 4LL9A 2VDRL 4CUCA 5EH1A 4YO0A 1QFPA 1CQKA 4NQVA 4HWUA 5I66B 1YEJL 2YWZA 1B6DA 1WBXB 1FIGH 3QDJB 1OF2B 3CZFA 4M6NL 1J0ZA 4ZOAA 4NHUE 2EZ0D 4M43L 1XIWB 5I66A 1WBXA 2R69L 3QDJA 1OF2A 2O5XL 4DKAA 4KZDL 4H88L 4PRHD 3T3ME 2WP3O 4IRSB 3C6SB 1XIWA 1TXKA 4R0LB 3UJJH 3MSPA 2FX8H 2OTWB 3K46A 1NBQA 5C92A 4IRSA 1DQML 3C6SA 1J1XH 3KS0H 4R0LA 3HG1B 4PJ7B 4YBLB 2YRZA 2JF1A 3NFNB 2OTWA 1ZA6B 1KNOB 1O0VA 4WFHE 1X5KA 4WCYH 2A9NL 3LRSB 4H0HB 1IGCH 3HG1A 4PJ7A 2X1PA 3NFNA 2IPTL 1ZA6A 1KNOA 3V6OA 3K8MA 1MCNA 3LHPL 1H3WM 5JXED 1WITA 5CP7B 3TO4D 3LRSA 2HKHL 2QADB 3ZE0F 4M9PA 3HZVB 1AHWB 3B9DA 3RPIB 2ICEA 4PB0L 1CR9H 5IV2B 1FFOB 3LS5H 4X5LA 5L88H 5CP7A 5TQ2H 1II4E 4LU5H 3FTGB 2E7CA 3HZVA 1AHWA 3RPIA 1P4BH 5I19L 1UM6H 5IV2A 4GG6F 2ZUYA 1FFOA 5CSZB 3H2WA 3FTGA 1J1OL 2BNRD 4QGTA 5HHPB 1QLEL 3DX7B 2BSED 4LCUB 1CCZA 3QCTH 5IFJB 2KDGA 3GKWH 2NY3C 5CSZA 5GZOC 4LDOB 2WUCL 5HHPA 3BYYA 4PP2B 1E4WL 3DX7A 4LCUA 4MQ7B 5C71A 3UAJC 4PJ8C 3UTOA 4EUPB 5IFJA 1QACA 4LVHB 4B7LA 4OGYH 3HTLX 4Y2DC 5IFHL 3O41B 4PP2A 3RL1B 3S3PA 4MQ7A 4X9IA 1XGTB 5DA0B 4EUPA 5FKPB 5IUSA 3CX5K 3RX7A 4A6YL 1KCLA 2F19H 4F7TB 4R97B 3RL1A 1XF3B 3EDJA 1WEJH 5JW4M 5CKAA 1XGTA 1BX2B 5FKPA 5T3XE 4GAFB 1T03L 3FL7A 1UEYA 1EHLL 4FQIH 4YX2L 4PRDB 4HKZB 2DQEH 2N7AA 2V2XB 4F7TA 5D70L 1XF3A 3GRWA 1BX2A 3BIBX 4NQDB 3QQ9C 4QOKB 4PRDA 4HKZA 2V2XA 4PUBH 3EO9L 4NNXB 2HH0L 4NQDA 2ZPKL 1I7RB 2X10A 3ULUH 4GMTH 4QOKA 2W9EH 3ROLB 4LHUB 4BSJA 1GOFA 1KC5L 4NNXA 4HC1A 2DIJA 3IB4A 1TETH 5IROC 4F57L 1C5DB 1I7RA 1RAMA 3BKML 2JELH 3CXHJ 4LHUA 4N1HB 3ROLA 4Q9RL 3LV3B 1C5DA 1KB9J 3VMPA 4X7TB 3N85L 4UV4L 4Z76B 4Z95L 4XX1G 4XX1E 4PB9L 5C0AD 1F11B 4H25B 5HGHB 3CFCH 3LV3A 4AEHL 5EBGA 4ODUB 1OTTD 3UZEA 4X7TA 1KXTB 3LQAC 3ZDYE 4JHZA 2CIKB 4Z76A 1AQDB 1F11A 1QLRB 4H25A 3DVGB 5HGHA 4CMHC 1UH3A 5A3IC 5FA3B 1NAKL 2RQ8A 1ADQL 3F6LA 4ODUA 1I8MB 2BNRE 1UADC 2CIKA 2RFXB 4UT7H 1AQDA 1QLRA 3DVGA 4JM2F 2I5YL 4HX1B 4KMQA 5FA3A 2VL5B 3N06B 2F8OA 1I3UA 1I8MA 4HCRL 3THML 4PRIB 3T09A 5E2VH 2ZUXA 3W2DH 3WNKA 3O6FC 3QQ3B 3RX8A 4U1MB 4KK9D 3QQNA 4HX1A 1FORH 2XWBB 2VL5A 5EOCJ 4YJZL 4YFLF 4KXZH 3MLVH 4ELMA 4OCYL 4PRIA 4JM4H 3ARFD 3QQ3A 2QBWA 1KCKA 3BXNB 4U1MA 1PKQE 3IAGC 3OL2A 2XWBA 1IAMA 2BK8A 3OKKB 4OGAC 1QFWM 1B4RA 1A3LL 4CNIA 3O9WA 3BXNA 2LU7A 3F58L 3OZ9H 5H35B 1FCGA 5IBLD 2ZG3A 1VESA 1XF4A 5D7JD 3OKKA 4OZIB 4ZD3H 1AO7E 1V8HA 5ADOH 3OTTA 5KSVB 5H35A 3OGOE 2K3TA 5HHMA 3HAEB 5DC4B 3GJFH 4JO1H 4OZIA 2DJSA 2IFFH 1I85C 4L5FH 3U0WL 1MCSA 3KHQA 2EDOA 1MHPH 1TENA 5KSVA 3I6KB 2P5EB 1K8DB 1YYML 3HAEA 1TVDA 1JWMB 3T2NH 3INUL 3ULSB 2FR4B 2DLFH 4PJCF 4LPCA 3I6KA 2P5EA 1K8DA 3OQ3B 3TN0D 4PJAE 3VXNB 4JFDE 1OLLA 3DGCR 1JWMA 5IFAL 3ULSA 2FR4A 4MA8L 3FZUD 2VH5L 4GOSA 1LK3L 5C0AE 3WFBH 1T2XA 1NL0L 1G7PB 1CICD 4HQQH 1CK0L 4K3EL 3DI2B 1DBJL 1IFHL 2ORBL 1RUKH 4DN3H 3OJDB 1G7PA 5DRZB 4XP4H 4FZ8H 1X3DA 1ZMYA 3RVVD 4RBPK 2PYFB 3OJDA 4L4VD 1ZLSL 1OW0A 3ARRA 2VXSL 4WEBH 5DRZA 2FRGP 4X80L 3DYOA 3HC0B 2PYFA 2H41A 1A7NH 4OIBA 5JMOC 1KELH 3Q6GL 4U1LB 2FHBA 3MRCB 2NR6D 3EHBD 3NZ8B 4PJIE 5L8LB 3HC0A 1BOGB 4LMQI 4MXQC 5I1JH 4IM8A 4GG6B 4OTXL 5MI0C 3RTQD 4U1LA 3MRCA 3P30H 5H94B 3NZ8A 4XP9H 3UJIH 5JUEH 5BRZD 1BOGA 4K07A 4CDHA 1AGFB 3OKLB 3D6GA 1EEZB 5DEFB 4GG6A 2OM5A 1SBSL 2UWEE 5H94A 3SBWC 3LMJH 1P84J 4X7SL 4AYFA 1RIVH 1KBGH 1QFHA 3HPJB 1AGFA 3OKLA 4JO2H 3S34L 1EEZA 5DEFA 1GGYA 1FFPB 4XPTL 3WHE0 5F1SA 3BVNB 1OAZH 3PGFL 3HPJA 5E8DL 4JG0L 4J3OC 4XCFL 4OCRH 1FFPA 1U8QB 3TCLB 1MCLA 3BVNA 3DARA 3DO7B 1YNKH 2VZUA 2YD5A 5D2NB 4DN4L 4NN7C 4L9LC 3X3FL 1U8QA 3WNOA 3CMOL 5DHXB 3TCLA 3K2UH 4KMLB 3DO7A 4KK8C 2AQ2A 2AI0H 2H26B 3LS4H 3SEPA 5D2NA 1TVHB 3EDKA 1RI8A 2VSCA 5D7IE 1A3QA 4FP8H 4M7LL 3VGHA 1MY5A 1UCTA 2X70B 2Y06H 3ARED 1TVHA 3BQUB 1G0XA 3C60D 2DQUL 3FFCE 1WZ1L 4JFZL 3ALPA 5L8KB 2J4WL 5ISZD 4L3EA 3CK0H 5CINL 4I2XB 2VUYA 5C0CD 2X70A 1MPAL 5I8OH 4S10A 1YQVL 2VDKH 3BQUA 2VXUL 3P4NB 4P9HC 2NY0C 3D25B 3ZO0A 3ZTJH 3ZL4H 4L4VE 4PJ9D 2HN7B 4PLOB 1XGYH 4I2XA 2B2XH 3O9WC 1G1CA 1QYGL 3RZWA 3P4NA 2DM3A 5GRUH 5JZ7C 4NM8L 4HIEB 3VFSB 3AS1A 2EXWC 5JDJA 4PYGA 2NZ9C 3HI6H 3LDBC 4PJ5B 3HE6D 1QFOA 4JPKL 1DN0B 1CDIA 3PHSA 3MLYH 4YHZH 4HIEA 3VFSA 3K1DA 2UY7A 1YC7A 1LP9E 4WTWA 2Y6SC 3SJVD 2EEBA 4PJ5A 3W39B 4LQFH 2AJVH 1DN0A 5BRZE 4YXKH 5E6YA 3A6CL 1FL5B 2EXYD 5IG7B 5EB9A 3L3HB 3QIWB 2FX7H 3PDDA 3W39A 4JM2B 4ZFZB 4JKPH 2V5RA 2AK4D 4ONGL 1FL5A 5IG7A 4G3YH 3L3HA 1FGNL 2EDLA 3HI5H 4YHOH 2W9DH 5F9WC 2FSEB 3QIWA 5C6WH 4JM2A 12E8L 4ZFZA 3FQTB 2XQYK 4K7PL 1YMMB 4RDQG 4KKCD 2HT4C 1AXSB 5FUZH 2FSEA 4WHYH 3N0PB 3SDYL 2P42B 1WISA 2XZZA 4PV8B 3FQTA 5FXCH 1YMMA 4JO4H 4KJPC 4HCRA 1OP9A 1AXSA 1OD7A 3KXFB 3VRJB 3O2DH 1UWXH 1MHHB 5CGYC 5B4MC 4PV8A 1KGCD 2NY5L 2LU4A 3EYQD 4APQC 2DIAA 3BGFC 1BWMA 4LSUH 3SE9L 3TT3H 3KXFA 3VRJA 1NSNH 4ODXB 1MHHA 3UO1L 4AIZB 2GY7B 3HR6A 3V4PL 1CLCA 1FZKB 3I3EA 3P4MB 4TULH 2R2EB 3S97C 3TBSB 4O9HL 3R1GL 4TOYL 1ZHNB 4ODXA 5ISZE 4AIZA 2Q7YB 1FZKA 3P4MA 4XI5D 1NMAL 2R2EA 5F7MC 2ERJC 2VSDA 5C0CE 3TBSA 1F3DJ 1ZS8B 1ZHNA 2AV7B 4AT6B 3FQUB 3MLUH 4PJCB 2Q7YA 2HP4A 5EOCH 3VGAB 4GMSL 1ZS8A 4NN6B 5LQBH 4AT6A 1SQ2N 2AV7A 3FQUA 4PJCA 4XVSL 1XR9B 1MCIA 4MA1B 2AERT 4L8DB 4NFCA 4DTGL 4Y5VB 5IHBA 4X7CC 3ZTNL 3HRZB 3AMKA 3E1F1 4NZDA 1OLZA 1XR9A 3BGMB 4KVNL 1OP5K 1HSBB 2VWEE 4L8DA 4Y5VA 3HRZA 4R3SB 3OAZH 5L6YH 1U95B 4DFIA 2IMMA 3IVKB 4OLWL 3S36L 3WFDL 3BGMA 4LLYB 3QDMB 1HSBA 2D7PA 4XVJL 4QHUB 4ZO6A 4R3SA 3MCLH 1J5OL 2CGRH 1U95A 3OKEB 3IVKA 2AK4E 1FHGA 1MFEH 2GAZB 2R29L 3DMMC 4LLYA 3RDTC 4XNZB 3QDMA 4X4ME 5IW6B 3NFPB 4WNQB 4QHUA 1HINL 2VOTA 3KGRA 1YUHB 3OKEA 2DYPB 4TSCL 5C7XL 5T3ZL 2OMBA 2GAZA 3D3VB 5IW6A 1DE4B 3NFPA 4WNQA 1U3JA 1YUHA 4O58H 2DYPA 3QZWG 5T1LB 3D3VA 4U6VH 3GBML 1DE4A 3QPQC 1MCPH 3M1BB 5E9DB 3RGVD 4TSAH 5DWUL 3KJ6L 3OB0H 4JR9L 2DBJA 4NC1E 4EN3C 4L4JA 3I75B 1ROWA 5T1LA 3BQUC 4KDWA 2RCSL 2B0SL 3M1BA 1INDH 5E9DA 3VXQB 1H3PH 4ZAKD 4EQ2A 1AGDB 4EI5C 3I75A 3G6JB 2LQRA 1WIPA 1ZTXH 1DR9A 3VGDA 1YEFH 3VXQA 4JQXA 25C8L 4FA8A 3M45A 1AGDA 2R8SL 5AZEH 4HPYH 4K3GA 1GC1L 4OF5A 2UZYB 4UQ2B 4O2EB 1FYHB 1RV6X 3MLRL 3DHJA 1FFRA 1T1ZA 2XZQL 3BPNC 3U48A 1I1FB 5EWIH 1T0MB 5ILTH 5GS1C 2NYYC 4UQ2A 3LB6C 1TJIH 4O2EA 3I50H 3L9RB 3DYPA 5C8JB 4NYLB 4G6ML 4U05A 1I1FA 5EN2B 4GSDL 1CU4L 1T0MA 2H2PC 5HHVH 5GS3A 3QDJD 1AH1A 3L9RA 5C8JA 3GNMH 1WZLA 1RUML 4NYLA 1DBKL 1OOAA 3VWKB 5JOPD 2HFGH 2MPAH 4QWWC 5EN2A 3FT4B 1N3NB 1U58B 4KHXL 4JREB 2HWZH 1IKFH 1MSPA 4L3AA 5T33L 4X98B 4ERSL 3VWKA 1N5AB 4KUZL 4H26B 1A6TB 1N3NA 1OY3B 1TQCC 1U58A 3FT4A 3GSUB 4LCIL 1H8SA 1KEGH 3O2VL 4X98A 3O4LD 5DMGD 1J11A 3OAYH 4D9LL 4ZXBC 1N5AA 3QCVH 3AGVA 4H26A 1A6TA 5T5FL 3GSUA 1H5BC 3KWWB 3O8XC 2J1KA 1KN2H 4MS8C 1A2YB 2GHWB 2ED9A 3GSNB 3JVGA 4S1RH 1EX0A 3VRIB 4XH2B 3QA3B 4EI6B 3V6FB 3KWWA 5CLWA 1NEUA 2RIKA 1QKZH 5FYLH 3V9FA 1JBJA 2HKFH 1N59B 4DQOH 2IPUG 1FNAA 4FTVB 1A2YA 1WT5A 3GSNA 4OUOA 5BV7L 3VRIA 4XH2A 3QA3A 2W92A 4EI6A 4NT6B 3V6FA 4QRRB 3GSRB 1N59A 3HNTL 1KJMB 4FZEL 3MJ7B 4FTVA 1FO0B 1LQVA 3TM6A 2EH7H 1WGOA 4HMDA 4ONOA 4XP6L 1D9KD 1S8DB 3BESR 3ULVH 4NT6A 3TNNB 3U4AA 3DHMA 5HI3C 4QRRA 5C0RL 3GSRA 5CJQL 1KJMA 3T2PA 3MJ7A 1UWGL 1W0WB 1A6UL 1FO0A 1BAFH 4LGSB 3LEYH 5EOQL 1S8DA 4PYHA 4OD1H 3TNNA 3TF7A 2DAVA 2HFEB 1SVCP 4IOFD 1S9WB 1W0WA 4OT1L 5TE7H 3JWOL 5DVOA 1A6WH 4NRXB 4WUUB 3C08H 2HFEA 5HVGB 1S9WA 1S7VB 1RU9H 5E2TL 3TCXA 1TIUA 3CNKA 4NRXA 4BA8A 4WUUA 4YWGL 4AEIH 4YR6B 3R06B 2ATKB 2XA8L 4GQ9L 1ZEAL 4JQVC 1F8TL 3GSOB 2B20A 2DKMA 1S7VA 3PWNB 3QDJE 3RKDC 1R3JB 5L2KD 3L5WB 4YR6A 3R06A 2ATKA 5D96C 5JOPE 4J3WA 1G9NL 3GSOA 4O5LH 4NQCB 1F4XH 3PWNA 5CZVH 2D7TL 1UACH 2YPLD 2NY4B 4D3CH 2F8VA 1R3JA 3MOBL 3L5WA 4NQCA 4WGWB 5FYKU 1UENA 3O4LE 5DZNA 1D5IL 5E99L 5BO1L 3ZDXE 3NPZB 4K8RH 3UPRB 3HG1E 4PJ7E 1QBAA 1U3HC 1Y6NR 3V6OE 2VAJA 4H8WH 3MBEB 1QLFB 4FQCH 3V8CA 1JI1A 3RWDB 4P2QD 3UPRA 5H8DA 3T4YB 3QEQB 3LVEA 1BHGA 1NCDL 3C2AH 4Y8AA 3AY4A 2HJKB 3MBEA 3ET9F 3QRGH 1QLFA 1FDLL 4YNYB 3CLEH 3RWDA 2L7UA 3T4YA 3QEQA 5EO1B 4QCIB 4EQ3A 2HJKA 3PL6D 4YNYA 5HGGS 2DICA 4XPFH 3B2UD 1FAIL 1F3DH 5EO1A 4QCIA 4Y4KB 4FXLA 4X5XB 3SPVB 3C8HA 4ORGB 4ALAL 2PXYB 4Y4KA 1J8HB 2A1WL 1DCLA 4GAJL 2G5BB 3B83A 4MNQB 5M95B 4LIQL 4X5XA 3SPVA 1FN4B 1UXWB 3MA9H 4OQTH 5B3JE 1JWSB 4ORGA 1RPQA 1ACZA 5HYFA 3IDJB 2PXYA 1J8HA 4UQ3B 3RWEB 43C9B 5I8KL 5F8QC 2FB4L 1C7TA 3ARBD 4XVTH 2G5BA 4MNQA 1FN4A 1UXWA 3PP4L 1JWSA 4UTBL 3ULUD 2Q1EA 2UY6A 3IDJA 1R3HB 4UQ3A 3RWEA 2ADFH 43C9A 4NC2B 3RU8H 5KVEL 4ZS7L 4LOUD 1QD0A 2YPLE 1OAKL 3S37X 5CCKL 3MUJA 1RMFH 1SM3H 1NC2D 1R3HA 6FABH 5KVGL 4URTB 2BY2A 3JV5A 2Q8BL 3RA7L 4XC3H 4WTZA 5CWSA 2ZNXA 3TYGL 1F3JB 1L4IA 3HCVB 5LGHH 2WLZA 3LKOB 4P5TC 1YN6B 4LHUG 4JQIL 5DRNA 1F3JA 3KYAA 5I8CB 1DBBH 4Y4FC 1S5IL 4GS7C 4N0UE 3HCVA 3QRFM 4E41B 3LKOA 2YRPA 4R90L 1YN6A 2EC8A 5FHBH 5F7LB 4JFOB 4GT7A 5I8CA 1HXMB 3DXAB 4YIQB 4D9QD 5CP3A 3S35L 2Z91B 2WBKA 1PX3A 1AXTL 4XP1L 4E41A 4PREB 2O26U 1N64H 1RJLB 3LKRB 4LCYB 4JFOA 1NPUA 1HXMA 3DXAA 2AJXH 3O6LH 4KMTH 4X6CE 4O2CB 4U2YA 4YIQA 1UWEH 5JW4R 3OKYA 1X4XA 2Z91A 5F7UA 1J0HA 1X6LA 4OZFG 4PREA 2YA1A 3DJ9A 1RJLA 3LKRA 2VXVL 4LCYA 4KK5C 1SJEB 1LNUB 4IRJD 4XP5L 1LGVA 4O2CA 3QG6B 3KPRB 5ADPL 1BIHA 1KYOJ 2EDEA 4HK3J 4LEOB 4Z7QE 2X9YA 1SJEA 1LNUA 3O3AB 3QG6A 3KPRA 4AL8H 5CD5C 1X5ZA 2NY5C 1ZLVK 2XKSA 5TE6L 1P9MA 3VWJB 4ZUWB 3O3AA 1IGFH 2ZUQB 1ODAA 5BV7B 1F58H 5KJRH 1JFMA 1FZOB 1MCFA 1MOEA 3ULUE 3VWJA 1DL7H 3F65A 4ZUWA 2E7HA 4HAGA 4JFED 2EIDA 5C09B 4DGIH 2BJML 1JHLL 1X5LA 3LQAH 1FZOA 4PDCE 4OLVH 5DJ2B 4F8TA 1WWWX 4M02A 2H8PB 2VABB 3PWPB 2RJMA 4WO4B 3CCHB 5C09A 5EU3B 2AJYL 5CSBA 5I1DB 2DQGH 3U9PH 4Z7NF 5DJ2A 5FM4A 3HAEG 2H8PA 2VABA 3PWPA 4WO4A 3U2SB 3CCHA 5EU3A 3HC3H 2YKLH 4NNPH 1A1OB 5I1DA 1AR1D 3QIBB 3P0GB 1UQSB 4F15B 4G6KH 2P5EE 4YHYC 2NY2D 4U6HB 1I4FB 4PP1D 3U2SA 4Y2OA 5FB8B 4LVNB 1A1OA 3QIBA 1YNLH 1PG7H 3H6JA 5FOJA 1UQSA 4YLQT 4KVCH 4NZUL 4U6HA 4K3JL 3O45B 5FB8A 5EG6C 3FAXA 5TFSH 2A9MH 4OV6F 4XMPH 4LSDA 4OLYH 4NUJB 4JHAH 1NDGB 3O45A 4J3VA 1BVLB 5BOPA 2EYSB 4JHWL 5J89A 3VFGH 3CFKB 4S11A 1W0VB 4HGKC 5F7KC 4TVPD 4NUJA 5IQ7H 1NDGA 1BVLA 5DSCB 2EYSA 3CFKA 4XWOC 1DVFD 1W0VA 1HHKB 3TEUA 3U7YL 5CJXC 3OB8A 1HHHB 1D5ZB 5HHOA 1WTGT 5DSCA 4RFNB 5HDQL 5E4EB 1HHKA 1FFNB 3C5SB 5JW4Q 5GRYA 3QEGH 1WBYB 2NY7H 4WWKD 5ETUB 2J6EH 4KI5D 2DKSA 4HT1L 1HHHA 4NM4H 5ERWB 1D5ZA 3NIDE 3SGEI 4BQBA 3TJHA 2W60B 5DD3H 1DQDL 5FM5O 1FFNA 3C5SA 3R8QA 1NMCB 3ZYJA 1WBYA 4R4NC 3TWCL 5ETUA 3MFGB 2YZ1A 5ERWA 5A2FA 3OHXB 2E27L 4YQXL 4AENB 2VKWA 1U36A 3S4SB 1ZT1B 4J1UB 5H37H 3OHXA 4ZNEE 1BJ1J 3RVUD 4KTDH 1JMZA 1GC1C 3NCMA 2CLVB 5D1QC 4AENA 4KAQH 4RIRB 4YXHH 1S7QB 2XZCL 3MMEB 5KVDL 3S4SA 1YEKL 1ZT1A 5I9QB 4J1UA 4EUPH 1F2XK 1JPTH 3RY4A 4UTAL 1PLGL 2CLVA 1KPVB 1S7QA 4DOHB 3MMEA 1U93B 3BKYL 4F7MB 1EPFA 2CKNA 3MR9B 3BP7B 5IVZB 2QKIB 2DM2A 1LVEA 4KPHH 1U93A 4PFEA 4P46D 5IT2H 4F7MA 4X9GA 3GRWH 1DANT 2X4UB 3MR9A 3RWCB 3RWHB 3BP7A 3VG9B 5IVZA 5D8JL 2QKIA 5FFLA 5D2NE 1J10A 4MJ4A 1CDHA 4O02H 3QH3B 2X4UA 3RWCA 3RWHA 1CGUA 2FD6H 5A2KH 5TH2B 3BN9D 2X4PB 2R9HD 2GSGB 2NY1D 3QH3A 5DZLA 5IVOA 3GI8H 2QLVB 3UBXI 2GQHA 4TVPE 5TH2A 2C26A 3K4AA 1MIMH 2F15A 4M7ZB 4FFYL 1UG9A 3MODL 2X4PA 5IBTH 4OV5B 2GSGA 2NY6D 5AZ2H 3VMNA 2CIIB 1GGIH 2IQAB 4Z0BH 5EPMB 4AM0B 5IW3A 5D1XB 4OV5A 5DR5H 4Q9QH 4XHQA 5GJSH 2CIIA 5IK3B 2A6DB 3IDGB 2DWEB 5EPMA 4LPTA 1T3FB 1T7XA 1JFQL 1WFNA 5C08D 4AM0A 5D1XA 4GRLC 1JGEB 5DJ8B 1GOGA 3C5ZC 5EBMB 4G80B 2VDQH 4X5WB 5GJTH 2PF6A 5IK3A 4XPBH 2EH8L 3TA3D 2A6DA 3IDGA 1CE1H 2IFGA 2DWEA 4PJ5E 1T3FA 2YUZA 3DO3A 4Z7VE 4UAOB 4R2GB 1JGEA 4OCXL 5DJ8A 5EBMA 4G80A 5GGQL 4X5WA 3T0AA 4S1DD 3UXFA 2EIZB 2PTUA 1JRHI 1H3UA 4X6DE 2DQHL 2WBWB 4GAYB 2P49B 3PJSB 3JWOC 1JF1B 2AW2A 3UTQB 2EIZA 4FFZH 3QUYC 1Q0XH 1I9RH 5EU7E 4GAYA 5B3NA 3WIFB 1KN4H 5DK2B 1JZ7A 3PJSA 5E00B 1JF1A 4MB5A 5F3HB 3UTQA 5LWYL 1OTSC 2C3VB 3HFMH 5ITBH 3A67H 3WIFA 2XY1A 5DK2A 3W5MA 3D3VD 5E00A 2YC1B 5E1HB 5F3HA 2CK0L 3O6KH 4M5YL 2BFVH 2C3VA 4KRLB 1G9NC 3KR3H 1JIBA 4K55A 5HSFA 1MJ7H 2YC1A 3KXFE 3L5XH 4KGLA 3W0WD 1VGEH 1LK2B 3V4UL 1T0NB 5GHWH 3GFUA 3HAEH 1N8ZB 1MLBB 1Q9KB 1EZVY 5I74C 1LK2A 4JY4B 1T0NA 2R1XB 2V2TB 3V6ZB 1B9ZA 1N8ZA 3RFZC 3TJHC 3L3KB 1MLBA 1QR4A 4U1JB 4HFUH 1Q9KA 3NCEB 4NN5B 2I60L 2VDRH 1NAML 1VCAA 4JY4A 2R1XA 2X1OA 2Y36L 2V2TA 1YEJH 3V6ZA 5LJYH 1MFAL 4PD4J 4U1JA 1ERNA 3S3SA 5B38G 4M6NH 2XWTB 3QCUH 1KXVC 3CFIC 1IL1B 3FT2B 4M43H 4PJBE 2IG2L 1ACYL 4MJIB 4Z5RB 4XPGL 3N1FC 4DKFL 2R69H 5C08E 5DHVH 2O5XH 2XWTA 5F7YC 1P4IL 4H88H 4KZDH 3LPGA 1BOYA 1IL1A 4P2OC 1BZ7B 2DTML 3FT2A 1A02N 4MJIA 3CH8A 4Z5RA 1T66C 4ENEC 5HY9B 1A4KB 2HRPL 2R4SL 1BZ7A 1DQMH 4KRPC 4PJDE 5HHQB 4Z77B 2XI9A 2VLKB 2KZ1B 1U6AL 5HY9A 1A4KA 2ILLA 1CVSC 2VLJB 2JJVA 3QDME 5HHQA 4BZYA 1P7QB 4Z77A 2A9NH 5MEPB 4MXVE 4C58B 2VLKA 1GSMA 4TYUA 2IPTH 1JF5A 2CMRH 3L5JA 5L0QB 2VLJA 1JF6A 4NC0B 3LHPH 1P7QA 1ZLUH 5EUKB 2HKHH 3AB0C 4BFIB 5MEPA 2XG4A 2C1PB 3K80A 3O81A 3D3VE 3EUUA 4PB0H 5ENWB 1U41A 2C3GA 3BZEB 3TBYB 1TZHB 3L5HA 3PHQB 5EUKA 4BFIA 1V3MA 2C1PA 4IHOB 5CJBA 3EJJX 4C59B 1MCJA 5I19H 4GBXD 5J3HD 5ENWA 4JDTL 4R6UA 3U7WL 3W0WE 3C09C 3BZEA 1KSRA 3TBYA 1TZHA 3PHQA 4E5XB 4IHOA 1EK3A 1J1OH 1QLEH 1E4JA 5DO2C 2C4FT 2FWOB 3B9VA 1Q8MA 1FBIL 4O00A 4OJFL 4E5XA 2WUCH 4NWTL 5FK9B 3FCTB 3G6JE 1E4WH 1ZHLB 2VERN 5B39B 1CDCA 1EXUB 2P47B 1P2CB 3ARQA 5FK9A 3WUZA 3FCTA 5IHLB 5IFHH 1OM3L 4Y1AD 2BVPB 5CIPB 1ZHLA 4KROD 4GXVL 3IFNL 4HWEL 5B39A 3WIIL 3ZKMD 1EXUA 4A6YH 3G5ZB 4KTYA 1P2CA 1WAAE 1AGEB 1CFQB 2BVPA 5CIPA 5I16B 5IMKB 1T03H 2Q76B 4WFFD 1T83A 3G5ZA 1EHLH 4ODTL 4YX2H 1NGQL 1AGEA 1CFQA 2X89A 5D70H 4GRWH 4FABL 1HYSD 2V7HB 4MX7B 5IMKA 5I16A 1GYAA 2Q76A 1NC4D 1BJ1H 2XNAB 4BELD 5CZKA 1DP0A 4H1LB 5E8NB 2ESVB 3QIUB 3EO9H 2PO6C 1IC1A 1UGNA 2HH0H 1O7SA 3MOAL 2ZPKH 2V7HA 4MX7A 5FYLD 1CI5A 3VFUB 4BSVB 2AEQL 2JJTC 2XNAA 4H1LA 5E8NA 2ESVA 3MJ6A 3QIUA 1KC5H 3D85D 5KANI 1QRND 4HXAL 5JQ6L 4F57H 1IT9H 4UIKL 3VFUA 4BSVA 4NGHL 3BKMH 3OR6B 1WCBB 1MJ8L 4LRIA 2FGWL 5HI5C 4Q9RH 4EXKA 2NXYC 5GGSY 1W8OA 3U1SH 5CEZL 4O4YL 3N85H 1W8NA 4ODVL 4UV4H 3OR6A 5SX4I 1RZ8B 4PB9H 1J0KA 1WCBA 3LD8C 1Z9LA 5CZXD 4R4BB 1WLHA 1QSFD 4AEHH 4P23C 3S6CA 4DVBB 3T0DA 3QI9C 2B5IB 1RZ8A 1ZK9A 1FAKT 4R4BA 2E9JA 1NAKH 1ADQH 4DVBA 1LD9B 1JV5B 3BRDA 2ZUWA 1FCCA 3IAQA 5C3LD 2I5YH 1A9EB 4MVBA 2EO1A 4HCRH 3THMH 1LD9A 1JV5A 1CGSL 4P4KD 3HS0B 4IJ3C 4XNXL 1A9EA 5L8JB 4OCYH 5HI4C 2MKWA 4FFVD 2Z9TA 3CXHK 3HS0A 4YFEA 4NP4H 5DUPL 3HUJE 4TUOB 4WUUE 1OHQA 1KB9K 2PXYD 1J8HD 1UYWH 3BT2L 1A3LH 3F58H 1UWXK 4JCLA 2CO7B 4WFFE 4TUOA 4Z7OF 1N6VA 4KHTL 2JJWA 4K8RD 2FATL 1J18A 5LGJB 1U91B 3BEVB 3ZE1E 3CX5J 1TNMA 3WIHL 1QBML 4NUGL 3IXAB 4EEEA 1A7BA 4TNWF 4DKEL 4NQCE 3U0WH 5I73B 5FYLE 2ZZUT 5DHYB 1YYMH 1AC6A 5LGJA 1U91A 3BEVA 3FKUS 3INUH 3IXAA 1QRNE 2YN5A 3KPNB 4MAYB 3FB8B 1NAMB 4ZDHB 4RA0C 1I3GL 4PGZA 1P4BL 3DX6B 3K0WA 5DHYA 2WY3A 5D6CB 4MMXC 2EDWA 5IFAH 3KPNA 2C1OB 2IAND 1N4XL 1NAMA 3B9AA 3FB8A 4MA8H 4MAYA 4ZDHA 4GJTB 4Z78B 3DX6A 1W2KT 3WN5C 1WFTA 1LK3H 5D6CA 3TFKA 1CT8B 3TIEB 4NOBA 1NL0H 2C1OA 2DQJL 1CK0H 1S3KL 4Z78A 3IXTB 5HPOA 1DBJH 1P6FA 4N90E 3V52L 1IFHH 2ORBH 1CT8A 3TIEA 3ARGB 2K7QA 3OAZK 1YNTB 4QTHB 5LAXB 2OI9B 3IXTA 1BMGA 3U0PB 4HUMB 4ZO8A 3RUGF 2H2SC 1R6VA 3ARGA 1NGPL 2GFBB 1YNTA 4QTHA 1ZLSH 5LAXA 3HMWL 2VXSH 2OI9A 2ICWB 3U0PA 4X80H 2EEDA 1I3RB 5KSUB 2GFBA 2NW2B 3P40A 4NBZB 4LAJH 1B88A 1SY6A 2ICWA 3WKML 4HBCL 3Q6GH 4H20L 4P59L 5LVEA 2AP2A 3WE6B 1I3RA 5KSUA 3ALXA 1I1CA 1OD9A 2NW2A 1WTLA 1LO5B 3VFOB 3WDJA 2C4FU 4OTXH 1J8HE 3WXWL 3WE6A 1OCWL 4X9FA 4MNQE 3OB0K 3VH8B 4IMKA 3CU1A 1Z0MA 2NY3D 1ZAGA 1LO5A 3VFOA 3MRRB 1SBSH 1X4YA 5GZOD 1EUTA 5FOBB 4X7SH 1GH7A 3VH8A 5F70A 3UAJD 4PJ8D 5JIIA 3S34H 3MRRA 1EH9A 3G5YB 4YHLL 4XPTH 4CADB 1SVZA 1RIUL 4Y2DD 5FOBA 2X41A 1MLCB 3PGFH 1V3LA 2NXZB 1OAQL 4YBHA 5E8DH 1AI1L 2QL1A 3D39B 4JG0H 4XCFH 2YS4A 3G5YA 4WTZG 4OFVA 4CADA 3HPLB 1MLCA 3W9DB 3KLSA 5D1ZB 3I85A 4IDJL 4OM0L 3D39A 4DN4H 2EICA 4GRMB 5C0BB 3F7PC 3CMOH 2NMSA 1FJ1B 2GTZB 1EIBA 1RZKL 2IANE 2MHAB 3HPLA 3W9DA 3AFLA 5D1ZA 3QIBD 1MNUL 5SWQB 3QQ9D 4GRMA 3OX8B 5C0BA 1FJ1A 2GTZA 2MHAA 2WLYA 4M7LH 5IHUL 3MPCA 3VXRD 2VDML 2VZTA 3CD4A 5SWQA 3TLRA 2CUIA 3OX8A 2DQUH 1WZ1H 4JFZH 2J4WH 3MRHB 2YUVA 3CC5B 3MLVL 4RISL 1ZV5A 5CINH 3MZGB 4WI9A 1MPAH 3B9KC 2VXUH 2JLLA 3MRHA 4YBQC 3S36X 1IAIM 3CC5A 2VXTL 1QYGH 4F37K 4NM8H 1S9VB 1BF8A 3F7RA 4Q97A 3QFJD 4KKNA 5HVHC 4P2RB 4JPKH 4XCCL 4QEGA 3HZKB 1S9VA 5TDNB 2JCCF 5A3ID 2Y07L 4P2RA 1EFQA 5HGAB 1RZJL 3KYMB 3HZKA 3A6CH 5HYIA 5GGVY 5JW3L 5TDNA 3HNVL 1QA9A 5FV1L 2YD3A 1EFXB 4BZ1L 2LAGB 1ZVHA 1BJMA 5HGAA 4K71B 4I0PC 3KYMA 3O6FD 4YDLB 2CD0A 4ONGH 4A2LA 1FGNH 4G9FB 1VEPA 2G5RA 1EFXA 3E3QC 12E8H 3MRBB 5B21A 3NPSB 3MFFB 4K7PH 2W65B 3T3MF 4WU7B 1E4XI 4AY0A 4G9FA 2NPLX 1V3KA 2CXGA 2WMPA 3SDYH 4KQ4L 3MRBA 4OGAD 3MFFA 4UDUB 2W65A 1I1AC 1Y6MR 4WU7A 3FMGL 3PABB 4LKCB 4WV1C 1YEHL 4PTUB 5GRJL 3TVMB 4UDUA 4X9HA 2NY5H 2XOTA 2ICWI 3P11L 1XFPA 3SE9H 3PABA 4JRWA 4HLZH 1OARL 4LKCA 5JTWA 4PTUA 3UO1H 2GJJA 2D4FA 5FV2A 3TVMA 3V4PH 1CDJA 2CKBL 4MJ5B 5C6TL 4O9HH 1Q1JL 3QNYB 1CXHA 3BRGC 3R1GH 3DUUB 1NCTA 4TOYH 5KSBF 1T89A 4RMRA 3SDAB 3H0TB 4HWBL 1NMAH 1Q0YH 4MJ5A 3QNYA 3QO0B 4HUNB 2ITDB 3DUUA 5I17B 2FX9L 3OV6A 1O7VA 3SDAA 3H0TA 4P5MB 1I7ZB 5F7EL 3QUMB 1EO5A 3QO0A 4GMSH 3PXHA 1F6FB 2ITDA 5JPMB 1KCGC 4XBEL 4IMKC 5I17A 3NCCB 4XVSH 1CFTB 1D6VL 4FNLL 4HH9B 2J88L 3OF6A 4P5MA 1I7ZA 4DTGH 3MRLB 3ZTNH 3QUMA 3RWJB 3FB7A 3UTTD 5JPMA 5J13B 2IBGA 3QEUB 1CFTA 1ES0B 4B7IA 4HH9A 4KVNH 3V4VL 2L7JA 4JKKA 3MRLA 3HE7B 3RWJA 3WLBB 2DQIL 1HCVA 1IGIL 2CR3A 4OLWH 3S36H 2Q8AL 3WFDH 4OGZA 1ES0A 3O6ML 3RUGB 4MMZC 3DPBA 3HE7A 4XVJH 5T3XL 3WLBA 1J5OH 3ARUA 3UTSB 5L7XL 3NFSL 3FQNB 3RUGA 2EC9T 3H8NA 4M1DL 1HINH 5I0ZA 3S4SG 4TSCH 2AI0L 3UTSA 5C7XH 5T3ZH 3FQNA 3VXSD 1UVQB 3UPAA 4XB8A 4MXQD 3X3GL 4B5EA 5HDLA 5FYKL 3Q3GB 5EZIL 5IBUB 2EKJA 3DVIA 4RRPA 1NFKA 3LAFA 3IT8D 1BM3L 3GBMH 1YZZA 4Z6AT 4FMFA 5DWUH 2BMKB 3KJ6H 3Q3GA 4JR9H 3DURB 5BS0D 3ARSA 5D7SL 4OQ1A 2RCSH 4XRCB 1AE6L 2B0SH 5IEHB 5HYQB 2AABL 3EFFB 3DURA 5F9JB 5DT1L 4CMMB 3VDAA 5TF0A 4XRCA 1MFCL 5IEHA 3F6IA 5HYQA 1CGTA 3IKKA 25C8H 1EAPB 3EFFA 4N0CD 4LSPL 5F9JA 5C0DB 2R8SH 4CMMA 3SGEH 3PUCA 1EERB 2COQA 3IKCA 4WI4A 1GC1H 4NQED 3ZSTA 3TZVC 4J3XA 1EAPA 3HRPA 4WVRA 1EEQA 3MLRH 5C0DA 4P0DA 2XZQH 3RHWK 3REWB 1EHXA 2BC4B 4KK8D 2PR4L 2IALB 1LDPL 4JZNB 3BISA 4G6MH 3REWA 2BC4A 3ECBB 4KZEL 4G42B 5TDOB 4GSDH 1CU4H 4KQ3L 15C8L 4ORZC 2IALA 1T21B 1D7FA 4JZNA 3QQ4B 1RUMH 1DBKH 2ADIB 1T7YA 3ECBA 4P3DB 4G42A 3JTTB 5TDOA 1QHPA 3OJMB 4PLJC 4KHXH 5MHSD 5T33H 1FNEB 1Z9OA 1T21A 2NY0D 4ERSH 4KDTC 3QQ4A 2DQTL 4OZGE 2ADIA 3GMPB 4HHAB 4P3DA 3JTTA 5JA8B 4KUZH 1J0JA 1P69B 2DF3A 4LCIH 1FNEA 3MJ8B 5HYJD 5JZ7D 3IRZA 3O2VH 2UVFA 4NZTL 4WHCA 4IRZL 4UOJA 4S1QL 4HHAA 4D9LH 3MRQB 4XXCA 2NZ9D 1TCMA 2B4CL 5T5FH 3MV8B 2BDNL 4QXTB 3MJ8A 3VXSE 5FGRA 3MRQA 3G6DL 2Y6SD 4FQXB 2JCCB 4QXTA 1NBZB 1T6VN 1JZ2A 3AM8A 1Q9WB 4FQXA 5BV7H 5C0JB 2JCCA 1U8NB 1NBZA 1U9KA 5E5UB 2CH8A 1RFDL 3HNTH 4LSTL 4FZEH 5D9SB 5J6GA 3BPLC 1Q9WA 1OTUC 5C0JA 4NHUB 4XP6H 3CVHL 2JIXB 4X99B 3CU7A 4PJAF 1U8NA 3SDCB 2OJEB 5C0RH 5CJQH 3TNMB 2HT4D 5D9SA 1UWGH 1A6UH 2QQLL 1Y18B 2VN4A 4NHUA 5EOQH 1U8OB 2JIXA 4X99A 3Q0HA 3SDCA 2OJEA 4LEXL 3CZJA 2YZ8A 4XNMB 3TNMA 1OSPL 4FN0A 4NQEE 2BRQA 4OT1H 1Y18A 4XB7A 3KPOB 1U8OA 1H0DB 4Z7NE 5CGYD 5B4MD 2YPVL 2Q6WB 4NZJA 4XNMA 5GSVB 4APQD 3DLQR 1BVZA 1ORQB 3KPOA 5E2TH 1H0DA 4J3SA 1LE5B 3VD9A 2XKNB 2P43B 4YWGH 4GQ9H 2XA8H 4OKVB 1ZEAH 5CEXB 2Q6WA 1F8TH 5IR1B 5GSVA 4JFYB 1LE5A 1MQKL 2XKNA 1YC8A 4OKVA 5CEXA 5KSBB 1G9NH 5IR1A 3JUYA 2OR7A 4JFYA 2Z31C 1QO3B 3FQWB 2D7TH 4D0BB 3BMWA 3MOBH 5KSBA 4PJIF 4CVUA 3WMSA 1FNSL 2FBJL 2QR0B 3NCYS 5CJ8A 4AG4L 1QO3A 3FQWA 5B8CA 5HYJE 2R0KL 3BD3A 4D0BA 3UP1A 1T1WB 3F8UB 1D5IH 1Q72L 5BO1H 1MFNA 2QR0A 4YDKL 1QR1B 4YXLL 3VXUD 1KV3A 1T1WA 2UWEF 1P7HL 4KK6D 3NGBB 3WFHB 4MCZB 3WS6A 1XR8B 1QR1A 4PLKC 5CMAB 3NA9L 3NACL 4OD3L 4Q6YA 1V3JA 5JPNB 1NCDH 3WFHA 4MCZA 4I9WD 3CDFA 4MQXC 1XR8A 1HSAB 1FDLH 2EC9U 5CMAA 5AZEL 3F5WB 3MACL 4I18B 3DMMD 5JPNA 3AC0A 1G7JB 1E4KA 1RZIB 1A8JH 1CGVA 1HSAA 4XHJC 2AJSL 4JGMA 5D5ME 3QUXC 3F5WA 1FAIH 4I18A 3VXTB 1MJJB 5GGUB 4PRHB 1YPZF 3I84A 1G7JA 2ADJB 1RZIA 3T0EC 3OKOB 3BD5A 2YWYA 1WC7B 1JNLL 3PWVB 4MVBD 5I71C 4UV7L 3SOBL 2XTJC 1MJJA 5D7IF 1XT5A 5GGUA 1DEDA 3RZCC 4PRHA 3STBA 2ADJA 3QPQD 5E7BA 1TMCB 2VTFA 3GMQB 3OKOA 1NFIB 2A1WH 5EZOL 1WC7A 2E9WA 3PWVA 1RZKC 2E6PA 4EN3D 4YE4H 2Q3ZA 3KJ4C 4GAJH 5JO5B 4LIQH 3VDBA 5I76B 1PY9A 2Q7NA 3P3YA 4GLRH 2G60L 1TMCA 1CIDA 4NBYB 3GMQA 5B39G 2B7DT 2BOBB 1NFIA 5I8KH 4EI5D 1RZFL 2FB4H 5JO5A 5EORL 1KEGL 1VPOL 5I76A 2XRAL 5JIPA 1IZKA 1FNLA 4UTBH 3D0VB 1CYGA 2BOBA 4DZBB 4UB0L 3TO4B 5KVEH 4ZS7H 1TVBB 1OAKH 4U3HA 5CCKH 3D0VA 3MC0A 5JXEA 1P7KB 5BVPL 2V7NB 4DZBA 3TO4A 5KVGH 1C8PA 3LOWA 2OXHA 2Q8BH 1SJHB 2R56L 1TVBA 4S0SD 2NYYD 3EYFB 1RZ7L 3RA7H 4BQ9A 1P7KA 3LB6D 2V7NA 4KJQC 1V5JA 4NKDB 4H1LG 1CF8L 3TYGH 2V5YA 2BNRB 1G6RL 1TTUA 3VXUE 1SJHA 2BHZA 5KVFL 3T65B 3EYFA 2ICCA 5T1KD 3OG4B 1PQZB 4NKDA 4JQIH 1N26A 2Z8RA 2BNRA 4QWWD 1S5IH 1AGCB 3T65A 1RZJC 4R90H 1PQZA 1MWAL 3SDDC 4I9WE 4RDQF 1DDHB 5KW9L 3S35H 1AGCA 3QUZC 1AXTH 4XP1H 1KCVL 3VU2A 4LCWD 1PKQB 5DS8B 2FL5B 3WFCL 4N9GB 5I30L 4RAVB 5D93B 1S78C 4HMEA 3X12B 1YJDL 4ZXBD 1DDHA 1RULL 1YEGL 4G8FB 3H3PL 2UZXB 2NX5D 3O8XD 1PKQA 5DS8A 2VXVH 4RAVA 5C9KA 4MS8D 3X12A 1YYLL 5I1GL 4G8FA 4XP5H 4RFOL 1ONQB 4Y88A 5ADPH 1VFMA 2JJSA 3L3IB 1GCFA 1T22B 1UA6L 4TTGA 1XF1A 4J6RL 4JDZB 1ONQA 3WNMA 3T77B 3CAFA 3WSQL 2WWKT 5FYJH 3V79C 3L3IA 3NCBB 1T22A 5TE6H 1XCQB 2NNAB 2BVOB 1WIOA 3JV6B 4JDZA 1JGUL 3Q5OA 3T77A 2H1PL 1RD6A 3CPLB 5B8CC 3BJLA 4PRPD 4PJAB 2F8XC 2WANA 4CJ0A 2NNAA 5FGBC 2BVOA 3JV6A 5D7KD 4WU5B 4YC2B 2EE9A 4U1GC 2BJMH 3CPLA 1JHLH 4PLNC 3GKZA 4EDWL 4PJAA 1S7RB 5C0AB 1OB1B 5E08L 4WU5A 3DYMA 4U1IB 4J23A 5SX4H 2OZ4L 2AJYH 1S7RA 1AD9B 1QP1A 4OZHE 5C0AA 5H2BB 2OR8A 1BGXL 5GPRA 4EBQL 4LSSL 1OB1A 5E70A 4U1IA 4Y4HC 3K7UA 1U8MB 2IQ9L 1NMBL 4NIKB 5DA4A 1KYOK 1AD9A 5H2BA 3RKDD 1E4KC 5FGCE 4YHML 1U8MA 3ZZ1A 4IIQC 4Y16C 5JNYB 4L9DA 2FIKB 3VA2C 1CTNA 4LSQL 4NZUH 3MYZA 4K3JH 3S5LB 2EZ0C 5IVXE 5C0BD 4XXDB 5JNYA 3ARFB 4D2NA 1JNNL 2W07A 4LLUB 4PJIB 3WL9B 2E6JA 5E7FA 2FIKA 1MF2L 4OCSL 4LSRL 2DQCL 3S5LA 4WW2F 4JHWH 1N2RB 3F7YB 4XXDA 5C6PB 2DIBA 3ARFA 4LLUA 5AG9A 4PJIA 2NX5E 3WL9A 3N9GL 1MREL 1GAFL 1U3HD 4KV5E 5D7JB 3T1WA 1N2RA 3F7YA 1KIUA 4OZ4B 1UB6B 2UWEB 4KY1L 3U7YH 5CUSL 1UKSA 2VLLB 1VACB 5D7JA 3RI5F 4OI9A 1EEYB 2VQ1B 3AMLA 4UI2A 5HDQH 4OZ4A 1UB6A 2UWEA 4EVNB 1X6NA 1Y6KR 1KB5L 4HT1H 2VLLA 1VACA 3IDMB 3UJTL 1ZLUK 1EEYA 2VQ1A 1DQDH 4RGOL 4V3DB 4EVNA 1JP5A 3GK8L 3TWCH 3TN0B 4MZ3A 4PRPE 4I48B 3IDMA 3QHTC 4UU9B 3GSVB 2E27H 4YQXH 1X5IA 1DQJB 5D7KE 2FYYB 2VDNL 1YPZB 4U31A 3TN0A 4MJ2A 1RK1B 3L5IA 1VFBB 4I48A 3S88H 4UU9A 5F89B 3GSVA 1DQJA 2IGFL 2FYYA 5D7IB 2XZCH 5DLML 1YPZA 5KVDH 2HAZA 4P9ML 1YEKH 1RK1A 3SGJA 1VFBA 5F89A 4MD4B 1FSKC 1PLGH 4WUKL 4UTAH 5D7IA 1VA9A 1CICA 3EYSL 1B0GB 1T4KB 3OXRB 4HAFA 4Y5YB 4MD4A 2YHGA 1F4YL 4L4VB 1B0GA 1T4KA 3OXRA 3WCYA 4Y5YA 3QJFB 3LPWA 4QHKI 3T08A 4BQCA 1EHAA 1XGQB 2B1AL 5CGMA 5D8JH 4L4VA 5D4QA 3RX5A 4HW6A 1JGLL 5C0BE 1JCKA 4L29B 5JR1L 4XVUC 5TF1L 2AGJL 3QJFA 1NCAL 2VQUA 1XGQA 5GGSB 4LARL 1UEMA 3VW3L 3RTQB 1K3ZA 1MRFL 3E2HB 2E7LA 2B4CC 5BRZB 4U6TA 2NTSP 5GGSA 2PN5A 1TZIB 4LPWA 4YZFF 1WVZA 4P5TD 4FFYH 3MODH 3RTQA 4OCLC 1WJ3A 5HVFB 3E2HA 3H3BC 5BRZA 3ARDC 4RGNC 5GQBA 1MJUL 1TZIA 1TDQA 2OR9L 5CBAB 1JZ3A 5L9DL 2QQNL 4L8BB 1JFQH 2WWKO 5CBAA 5F8RC 5I6XB 4FG6C 3RAJL 2EH8H 1MWAB 1T20B 4XZUB 2HLAB 4L8BA 4PJFF 1H8NA 2UZIL 4POZC 4OCXH 5F93C 1T1XB 2YPKB 5GGQH 4KK5D 1OTTC 1GGUA 1MWAA 1T20A 4XZUA 5FDWB 2HLAA 5I1KL 5CGTA 2IAMC 1LO0L 5DD1H 1KXQE 5HVWA 3HZMB 1T1XA 4MAUL 2YPKA 3NBNA 1CLYL 4JY5H 5FDWA 5CD5D 3AREB 5DFVC 2YSSB 4KVCL 4GKNB 2WIIB 4WRLA 3UTSD 3HZMA 1TPXC 3SGKA 5ISZB 3ILQC 2Y25A 3B2VL 3BDYL 4LSVL 2OK0H 3RVTC 5LWYH 5TFSL 3PP3K 5GZNC 5C0CB 3SCMC 5K9KB 2GW5A 3AREA 3D69B 5I1CL 2YSSA 4GKNA 2WIIA 3ZKXC 5ISZA 1PZ5B 4OLYL 1UJ3B 5F6IC 4PJ9B 2J12B 4CN6A 1X5FA 4WHTB 2CK0H 4YFDB 3VFGL 1X9QA 3DVFA 4M5YH 5C0CA 4PY8J 5K9KA 1CDBA 3D69A 1PZ5A 1UJ3A 4JVPA 3ZDXF 4PJ9A 4ZFGL 4WHTA 1WIUA 2W0LA 1GPOL 3V4UH 4Z7OE 2YUXA 1MCHA 2DTSA 2EDNA 3SJVB 5AG8A 3QEGL 4ZSOE 2WP3T 3QDAA 4U0RB 1DTUA 5DD3L 2D9QB 3SJVA 1JN6B 2I60H 1NAMH 2AEPH 2Y36H 4L8SB 2OZ4A 5F6HI 1MFAH 2BVQB 1JN6A 1H3TA 1L7TL 2ZCHL 1S7WB 1HQRB 5K59F 4L8SA 3PQYD 2IG2H 1ACYH 5D6DC 4XPGH 2BVQA 4DKFH 1O5DT 4FQLL 2CUHA 4X4MA 3TV3L 4FHBD 1VGKB 1P4IH 4YDIL 1S7WA 1HQRA 3FO1B 4R26L 2F53B 2DTMH 1E4XH 4L4TD 4WW2B 1U8KB 2BXYA 5T3ZD 4TTDC 3I02B 4OLUL 1A64A 1V7ML 2IPKB 1VGKA 4XAKD 3GSQB 1CICC 4LKXB 3STLB 1EUUA 2HRPH 3FO1A 2R4SH 1OWRM 2F53A 4HK0B 1ZWIB 4WW2A 4OF6A 4WHDA 2JB5L 5B3JF 1U8KA 1FGVL 2CK2A 1JYXA 1EEUA 5LXGL 5ACZB 3I02A 1U6AH 1ZVYA 2IPKA 3GSQA 5IJKC 2V2WB 4ONFL 4LKXA 1OQXA 3STLA 3IDIB 4HK0A 1ZWIA 1UCBL 2XXMB 5ACZA 1G7HB 4NKOB 2N4IA 3UTSE 3BUYB 3NA4A 4JZJC 5EZLB 2VZVA 3IDIA 2DDQL 5HDOA 4OIIL 1EA9C 2CRIA 4R4ND 5DJ6B 4ESKA 1G7HA 1EBPA 4PD4K 4RRPG 4NKOA 5JA9A 3MV8D 3BUYA 5EZLA 4P4RB 1GZPB 3BPOB 4HC1L 1J87A 1MCQA 3EHBC 5DJ6A 1JHKL 4LDEB 1MRDL 1GZPA 4P4RA 3CSBA 5FYJU 5D1QD 4JDTH 1W72B 3U7WH 1FV1B 2OP4L 4DVRL 1QBBA 1CL7I 1A0QL 2GTWB 3SKJL 1C5BL 1W72A 5DR5L 4X83A 3SO3B 1FV1A 1FBIH 4OJFH 4PBXA 1ZOXA 4NWTH 5FAAA 1BPVA 3W9EB 4ZNCD 4WDIB 2GTWA 1RJCA 4NOFA 3GHEL 2FGZA 3HLAB 2FLBT 3V0WL 1JNHB 3VFRB 5BW7A 2V5TA 1QHOA 1A4JB 2R23B 3ULVC 5ESVB 3ZHKA 3W9EA 4RGMB 2XXCB 3O4OC 4WDIA 1OM3H 3K4DA 5JMRA 4X6CF 3T0XA 5CEYB 4GXVH 3IFNH 4HWEH 5I1AB 3HLAA 3VFRA 1JNHA 3WIIH 5SV4A 1A4JA 1TQBB 2R23A 5ESVA 5LBSL 5IWLA 2N7BA 1RK0B 5KG9B 2CRZA 4C55A 5CEYA 3QAZB 5I1AA 3QBTB 1RZGB 2FZ3B 5EFIB 5I75B 3M8OL 1YJDC 4Z7QF 3MRDB 1RK0A 4FABH 5KG9A 1A3RL 3RGVB 1RZGA 5E5MB 4OD2B 2FZ3A 5EFIA 1E6JL 4Y7MA 3MRDA 3MOAH 3C60C 5ESQB 2HVJB 3RGVA 5HPMB 5E5MA 4OD2A 3WBDA 1ORSB 2AEQH 1JYWA 4M7JL 4ZAKB 3QWQB 1HIML 4HXAH 3EJYC 5JQ6H 3ULUF 4W4OA 5ESQA 2HVJA 4UIKH 5HPMA 1KJ2B 1ORSA 3I9GL 4NGHH 4ZAKA 3C5ZD 3L5XL 1MJ8H 3WXVL 2FGWH 3SE3A 1LMKA 1A6ZB 4DGYL 4JN1L 1ZLWH 5GHWL 1Z3GL 4O4YH 5CEZH 3MV8E 2X4RB 5I2IB 4M93C 1J88A 1KJ2A 4PG2C 1HH9B 2VMFA 3SKUD 3B8SA 4JG1L 1NUNB 2WNGA 4PJFB 2MOVA 1IKNA 3FQXB 3HE6C 2NW3B 2JCCE 5I2IA 1OAYL 2X4RA 5HBBA 5GS2H 2EDXA 1HH9A 2X42A 1QNZL 5DGRA 2VWEC 4PJFA 3FQXA 2NW3A 3NAAL 5EU6D 4H8WC 3PWUB 3QUYD 2EXYC 4QTIL 2GSIB 4QXWA 4BM7A 4CJ1A 1RUAL 3QCUL 2HTKC 5DJDB 4OUUB 2UYLB 3OKMB 1OTSD 3PWUA 1ED3B 1UXSB 3DECA 2GSIA 4LLMB 3G04B 1CGSH 4XNXH 4OUUA 5DJDA 2UYLA 3OKMA 1WZKA 2VIRB 1ED3A 3C87A 1UXSA 4LLMA 3G04A 4RAUB 4WY7L 4XMLL 5MERB 3O4LB 4FQHB 1FVCB 5DUPH 4D8PB 4WFED 2VIRA 1S7UB 5F7NC 3BT2H 3B5TA 4RAUA 5MERA 8FABB 3O4LA 4FQHA 1FVCA 5F9OL 3SE8L 1LWRA 2F5BL 4NC1C 4D8PA 4KHTH 3QISA 1S7UA 1S9YB 3QULB 2X9WA 2NZIA 3MLZL 2CMRL 2FATH 1IEHA 5CJOL 1EBAA 3GBLA 1C1EL 3WIHH 1C12B 1QBMH 4NUGH 3NIDF 5KSBE 1S9YA 4MXWL 3QULA 4DKEH 1AR2A 3H42L 1OAXH 4M6AA 3L7FB 1HKFA 1MFDL 2A77L 5FHAL 1D9KB 5D7LD 1C12A 1EO8L 4OAWB 1I3GH 4IEFB 2ICES 2J5LC 3MGAA 1D9KA 2QV2A 1NCWL 4P2OD 1F00I 4OAWA 1N4XH 4YHPB 1T66D 4F9LA 4ENED 2F54D 1VSCA 1D6EB 3GBNL 4OCMC 2DQJH 1IAII 4KRPD 3QP3A 4YHPA 2P48B 4ETYA 2J2ZA 1S3KH 5FM8A 5JHDD 1MCWM 1PEZA 4JPVL 3V52H 1DBAL 4IMLB 1S7SB 1D6EA 2WBJC 4GXUN 5EU6E 5J11C 4IOSD 5IMMB 3H3KA 1REIA 4QT5B 4F9PC 4IMLA 3G5VB 1S7SA 5L2KB 1NGPH 4LVOB 3P73B 3HMWH 3O41A 1CFNB 5IMMA 3IFOB 2YMXL 2YPLB 4QT5A 1MCKA 3G5VA 3VGEA 5L2KA 2CRMA 4PRHE 2MCPL 3P73A 3V95A 2PTVA 4TVPL 3WKMH 1CFNA 3IFOA 3P77B 4HBCH 4LCCC 4H20H 1JWUB 2YPLA 4JFHD 4P59H 4XGZB 2DLHA 4PJHE 4JB9L 2ENYA 2LFGA 4WFEE 5DUML 3GSXB 2F58L 3P77A 4XGZA 3WXWH 1JWUA 4YK4B 1UT9A 1OCWH 2C7UB 4KRNA 4MNHB 2X09A 3GSXA 3C6LB 2P45B 1F13A 4JGJA 5F1NB 4P2QB 5J6HB 4N0UB 1I8KB 1IT9L 2C7UA 3RJDA 5FO8B 5J12B 3F7VB 3EW3B 1MCEA 4MNHA 3EYOB 4UT9L 3C6LA 4KI5F 1VERA 4YHLH 3WO4B 5F1NA 4P2QA 5J6HA 4N0UA 3U1SL 1U8PB 1I8KA 1RIUH 5FO8A 4DKDC 3F7VA 3EZ8A 4XNQB 3TYFB 1OAQH 4FS0A 3L3JB 5E6IC 3EYOA 1AI1H 2OL3B 5D7LE 3NTCL 4X6CB 3PL6B 4Z7VF 4X7EC 1K85A 1U8PA 1QSVA 4OZFB 4XNQA 3TYFA 3L3JA 4IDJH 4LAQL 4OM0H 4HIXL 2OL3A 3CUPB 4X6CA 3PL6A 4X6DF 3BIKB 1RZKH 4OZFA 5ICYB 1MNUH 1D5XB 2F54E 3CUPA 4NWUL 3BIKA 5HGBB 2PO6D 5IHUH 3V7AG 3V7AE 5JHDE 5ICYA 2VDMH 1G6VK 1D5XA 2RFXA 4LPVA 1S7TB 5DC0A 4UOW1 4XAWL 5M94B 1IJ9A 1HDMB 5KS9F 4YGAB 5DFTA 1XIWC 3ARBB 5HGBA 4RISH 5EOTB 3HC4L 4P2CG 5EIVA 2BSRB 1C08B 1M7DB 1S7TA 4LIQE 3ILPB 4B53A 3S3JA 1HDMA 4NRYB 3DX9B 4NP4L 4IRSC 4CU8A 1BQSA 5HI5D 3ARBA 5LGKA 4R0LC 5EOTA 2BSRA 1C08A 2EEAA 3WUWB 1M7DA 1UYWL 2VXTH 3ILPA 2K1MA 3MRPB 1NC2B 4NRYA 3DX9A 2CUMA 4U1KB 3WUWA 4P23D 3DRTB 1V05A 4JFHE 4YBLC 3QI9D 4XCCH 3MRPA 3V6OC 1NC2A 1CLZL 2QHLA 3VCLB 4POYA 1NUFA 4U1KA 4YUEL 2Y07H 2PTTB 3DRTA 5CBEB 3MO1B 4RMWA 1RZJH 5E8OB 2CPCA 3ERYA 5JW3H 3HNVH 3VCLA 4BZ1H 2PTTA 1TNNA 2QADC 5CBEA 4S0TD 3MO1A 1AHWC 5E8OA 4OF8A 2R0LL 3BP5B 4PJBF 2YXFA 2E8YA 4DWHA 1UH2A 5HI4D 4YHKL 5DJ0B 8CGTA 1X5AA 3VXNA 3N50A 3BP5A 2XQYG 4KQ4H 3OMZA 3UYPA 2E5EA 5DJXB 4E42B 4KJYB 5J9PB 1QQDB 5DJ0A 1VADB 4MLSA 3VGBA 4PJDF 3FMGH 4IRJB 1ETZB 3BIAX 1YEHH 5GRJH 5CHNB 1WWBX 2J8UF 2G2RB 5DJXA 2X2YA 3UX9B 4KJYA 1A7QL 4E42A 5J9PA 1QQDA 1CTOA 1VADA 3P11H 4NRZB 4YHNB 4E0RB 1OARH 4IRJA 1ETZA 4LVHC 2EDFA 1RVFL 3U7AA 4MXVF 5CHNA 2G2RA 4M1CC 4Q58C 4H5SB 5CKGA 2CKBH 4NRZA 1B3JA 4MLIA 4YHNA 5C6TH 1Q1JH 5JXAL 3VFPB 4E0RA 4S0UC 4XCYB 4NHCL 3S5LG 3CXDL 3GJFB 4R97C 4H5SA 4HWBH 4FOMA 1FL3B 1KLUB 3UPCA 4XCYA 4G6AD 3DUHA 2FX9H 3GJFA 3C9NB 3FRPA 4JFEB 2V9TA 3N1QC 5F7EH 1FL3A 2KKQA 4NCC2 1KLUA 3TH3T 1RUQL 4XBEH 1A7PL 1D6VH 2DB8A 3C9NA 4FNLH 2J88H 4JFEA 4KKBC 5EU4B 2OJZL 4ZNEA 4F7CB 2HFTA 4UBDC 2X4SB 4Y5XB 3X14B 1ZA3B 3V4VH 1QRKA 3G6JF 3K8LA 1H3VA 3BX7C 5EU4A 1XMWA 1CG9B 4F7CA 2DQIH 2X4SA 1IGIH 1V7NL 4Y5XA 3X14A 1CBVH 3WJJA 2NY2B 2Q8AH 5GGTL 1ZA3A 2DOCA 3O6MH 1Q38A 4RBPH 2FIRT 4Q6IB 3RBSA 2DI9A 3MNVB 4BK5A 1CG9A 4W68A 4XC1L 5T3XH 4X9BA 4GW5B 5L7XH 1PD6A 3VD7A 1ZT4B 3NFSH 1WAAF 2AAVA 1ZSDB 1U8IB 3IDYB 4Q6IA 4M1DH 3MNVA 2JB6B 1YPZE 2RAMA 3VFNB 2YD9A 4GW5A 2APFA 1ZT4A 1ZSDA 4W6WB 1U8IA 5LKNA 1WCQA 4DUVA 3X3GH 5FYKH 1G9ML 2JB6A 4ZPVB 5EZIH 5ITFB 3VFNA 4LNRB 2H26A 3Q5YA 1B6UA 3DGGB 3J8F7 1BM3H 4JJ5B 3L1OL 5IGXL 5KAQF 3QEHB 1JPST 1DVFB 4ZPVA 5ITFA 4LNRA 3O3EB 5D7SH 3DGGA 2VRAA 1N7ML 4JJ5A 2Z92B 5ELIA 1AE6H 3QEHA 3J7HA 1DVFA 3GIVB 2AABH 5DT1H 4WWKB 3GM8A 1N5YH 3O3EA 2Z92A 2BHUA 3GSNL 3X13B 1MFCH 3D25A 3GIVA 1NUGA 2HN7A 4OFPA 4G5ZL 4LSPH 1CWVA 4WWKA 5J4MA 4IS6B 2G9HB 1GGCL 1IBGL 3UTPD 4Z7VB 1ITBB 2E7LE 1FVEB 4JJHA 3NABL 3X13A 1PVHA 4XPAH 2C3XA 5F21B 1WSST 4IS6A 2G9HA 3SDXE 4WENB 2YA0A 3H9SD 4Z7VA 3V6BR 1GGTA 4X6DB 1FVEA 1KT2B 2ITCB 4XWGL 5AEAA 1FO0L 1T6WA 5JOFB 3S8WA 5T1DL 2PR4H 5EO9B 3ABZA 1LDPH 2HRLA 2ADGB 4KZEH 4X6DA 1KT2A 3JV0A 2ITCA 5I1LB 3JWDL 3MV9D 4AJ0A 5JOFA 2MJWA 4KQ3H 5FCUH 15C8H 5EO9A 2HMIC 4HIJB 4QHNB 4QHLB 2ADGA 1HZHL 3BD4A 5KS9B 3KLHC 5I1LA 4OLZL 3QPXL 1U2CA 3B9KD 4MA7L 1FNHA 1BD2B 4HIJA 2DQTH 4QHNA 4YBQD 4P46B 4QHLA 2PCPB 5KS9A 2CSPA 2F53D 1NKOA 4NDMB 3HUJF 4C54A 3DTXB 4NZTH 4IRZH 4P46A 4S1QH 2PCPA 2D4DA 2RHEA 4NDMA 2B4CH 1A21A 1MFBL 2BDNH 3BEWB 3DTXA 4F37F 2NY1B 1OW0C 2H45A 3G6DH 1GIGL 3Q48A 1R0AH 3ZE1F 3BEWA 4G6JL 4N0YL 4HEME 4KC3B 2O61B 2NY6B 1AGBB 4YEFA 1Q0YL 1MVUB 4I0PD 4PRNB 4LSTH 1RFDH 2O61A 3DRQB 5B38B 4HPOL 1AGBA 4C83B 3CVHH 4PJBB 1ZGLM 3QXVA 2BNUB 1MVUA 3MXVL 5C08B 4PRNA 3U9UB 1I9EA 3DRQA 5B38A 4RFEB 5HHNB 2QQLH 1LO4L 2YUWA 4C83A 3TA3B 4PJBA 2BNUA 2J8OA 4LEXH 5C08A 3UTPE 5C07D 3U9UA 1I1AD 4WEUD 1OSPH 4RFEA 3TA3A 3SJVE 4PJDB 4G6FB 4HJ0C 3K81A 2YPVH 4JRYD 2X1WL 3ZSSA 3H9SE 4MB3A 3G6AB 2J8UB 5DQDL 3BP6B 5E94B 3MZTA 5BCAA 4PJDA 3U4BL 4HUWB 2EECA 3EKCA 5TDPB 2CRYA 1CQYA 3G6AA 2J8UA 3MV9E 3D5OF 1A6VL 3GHBL 3BP6A 5E94A 3O2DA 1MQKH 4HUWA 5TDPA 3VD4A 5KVMC 5GRXG 1G7MB 5D2NC 1FLRL 2VITB 3TPUE 3AROA 2F53E 1FNSH 1G7MA 2FBJH 2D0GA 1OP3H 4AG4H 4M61B 3LKNB 2R0KH 4GKZB 3W0WB 5F7DB 2VITA 3RY5A 4B41A 4RNRB 3ZYOA 1Q72H 1KGCE 2GK2A 4YDKH 2HTLC 3P9WB 4YXLH 3Q2CA 3LKNA 4M61A 2ZUTA 4GKZA 2WIMA 3W0WA 4XBPB 5F7DA 1MEXL 4RNRA 1DJSA 4WW1B 1H3XA 3I3DA 5SWSD 4PJGE 3ARXA 4XMKL 3NACH 3NA9H 4OD3H 3AVEA 3MCKB 4XBPA 1MCCA 4U4BA 2VLRD 4WW1A 4HG4J 2EDQA 3G6JA 4TNVK 5ECJE 3MACH 1TTGA 4PBWD 3MCKA 2IWGA 4MYWB 3E3QE 3PG2A 4FQJL 2AJSH 1T7WA 4N5EA 1QBLL 5F72S 3BRFA 2E6QA 2DRUA 1WAAA 5GGTA 1L8JA 4P3CL 4NCC1 1JNLH 5C07E 4KKAC 3RVUC 3KYKL 4RX4A 4UV7H 4DAGL 3SOBH 3WJLA 3C2SA 4YFLI 3QIWC 2A6JB 4JM2C 5FIEA 5EU7C 5DJAB 4JRYE 5EZOH 1CD1B 4NQXB 1EJOL 3QXTA 3CLFL 1Z0NA 2G60H 2A6JA 4I4WB 1MHEB 1XH3B 4JRXD 3IAPA 2Z4QB 2VDOL 5DJAA 1CD1A 4JPIB 4NQXA 2BRRL 3QWRD 1RZFH 5BJTB 3EAKA 1C7SA 3D48R 5EORH 1MI5D 1VPOH 2I27N 2XRAH 4I4WA 1MHEA 1XH3A 2UV3A 2Z4QA 4YPJA 4UB0H 4JPIA 3ZDZF 1KIQB 5BJTA 1I7TB 5J06A 1MRCL 3KPQB 1WWCA 2WQ8A 1RY7B 3TZVD 3UC0L 5BVPH 3T2QA 1KIQA 1I7TA 4RAHA 3KPQA 5CEZD 2R56H 4GBXB 4FFWC 1RZ7H 4U7KA 3VI3E 4WEMB 4YZFE 1CF8H 3RHWF 1G6RH 1I8LA 4GBXA 5KVFH 1CXFA 5GS2D 2R1WB 2XN9D 4PGEB 5K9JL 4JE4B 5AYQA 4AQOA 3O11B 4OF3A 2FJGB 3VXMD 5SWSE 3OBAA 4MDJB 2LV4A 3H7BB 5JW4N 4PLJD 2R1WA 4U7SA 4PGEA 4DCQB 1MWAH 2VLRE 1IRAY 3O11A 5D72L 1WWAX 5KW9H 3VGAC 1MELA 4MDJA 4NN6C 4Y1AB 3ZKNC 3H7BA 2X6MA 4HEPG 1DFBL 1OWWA 2OQJB 4KROB 2IADB 4MZ2A 1KCVH 4DCQA 4MA1C 3SQBA 3WFCH 3O3BB 5I30H 3HUJB 4PJFE 4FXGB 4Y5VC 1MCOL 3S98A 3FQRB 1YJDH 3RGHA 1JGDB 1RULH 1YEGH 4Y1AA 3H3PH 5EIQA 1NJ9B 2OQJA 4GFTB 2IADA 4KJWC 3OKDB 1R5VB 3O3BA 3HUJA 1GZQB 1JRHL 4FXGA 1A14H 3FQRA 1YYLH 1JGDA 1WFOA 5I1GH 5HD8C 2ZG1A 4RFOH 2Y5TB 1NJ9A 4QRSB 5JHLL 3OKDA 5C3TA 1NC4B 1R5VA 1GZQA 1UA6H 1YEIL 5A16B 4J6RH 1A6AB 2Y5TA 2ARJB 4QRSA 3WSQH 4QRPD 1I1RA 1NC4A 4XNZC 5A16A 4F7EB 1XF5B 1OTUD 2R0WL 1IVLA 1FNFA 4JPWH 3D85B 1QRNB 1A6AA 4CVXB 2ARJA 1JGUH 1NGXB 3MCG1 4YGVB 4OFDA 2I9TB 2H1PH 5KZCB 5SWZD 4IOIB 1BBDL 4F80A 4DEPB 5DTFB 4F7EA 1XF5A 1LEIB 2OLDA 4OI7A 3D85A 1QRNA 3DOSA 4CVXA 1NGXA 2FHCA 3OR7B 4YGVA 2I9TA 4MNGE 2AV1B 1CS6A 3FHAA 4FQPA 1OAUL 3LKQB 4EDWH 4IOIA 1NLBL 3RI5K 5DTFA 3SHSA 1IQDB 1LEIA 5E08H 3OR7A 1QSFB 3C6LD 3OKNB 3U30B 2AV1A 3DBXB 2OZ4H 4YEEA 3LKQA 1IQDA 3FOLB 4K9EL 4JQXC 1BGXH 4EBQH 4LSSH 1QSFA 2UVEA 3OKNA 2IQ9H 1NMBH 3DBXA 3JV4B 2ZCLL 1CZ8H 4LLQB 4LVEA 3EFDL 4WFGD 3FOLA 3LY6A 3PIQB 5IJVB 3RP1A 4K94L 3S37L 4YHMH 1AIFB 1I9IL 3VXME 3JV4A 2LTQB 1VHPA 4LLQA 4P4KB 2Z31D 2LVCA 2P44B 3PIQA 5K59E 5IJVA 4LSQH 3BO8B 1L0XA 5JLZB 1AY1L 1AIFA 3CIQA 4WGVB 4F33B 2VYRE 3MV01 4QY8B 4YDJB 2IMNA 1JNNH 4P4KA 2M1KA 4Q0XL 3UYRL 2A6IB 4HXBL 3ZHDA 3LCYA 3EDFA 1MF2H 4OCSH 1B2WL 4HIIB 2DQCH 3BO8A 4LSRH 1JJUA 5JLZA 5BOZG 4F33A 4LLDB 4QY8A 4NSKB 1FL6B 4YDJA 4YE4L 2A6IA 3N9GH 2YRLA 1MREH 5ABDE 4HIIA 1VKXB 1GAFH 3S7GA 1NUDA 4J4PA 1KACB 2APWA 1NCUA 4RCAA 1L0QA 4LLDA 3VWKC 3RRQA 4NSKA 1FL6A 5CS7A 1G9MC 4KY1H 4CDGC 4JREC 5CUSH 3TT1L 3CSGA 2HT2C 2XY2A 3TPKA 1VKXA 4ODBD 5HYSB 2F74B 1I75A 5L2KE 1HK6A 2E9BA 3VRLE 1NBVL 4I5BB 3MV11 4UNVA 4QRPE 1DN2A 1OGAD 3AS0A 4KRMB 1KB5H 3C8KB 1IE5A 4JFPB 3UJTH 1PG7X 5HYSA 2F74A 5C0ND 3JVGC 4C56D 3K1KC 4RGOH 2ZWLT 2DD8L 1CDGA 4I5BA 3GK8H 3IF1B 4XHJD 3QUXD 1M7XA 3C8KA 1FP5A 5SWZE 2OSLB 5ACLA 4JFPA 4KKLC 1WT5C 2W1NA 2X40A 2VDNH 2IANB 5AWNL 4Y0GA 3T0ED 3IF1A 2A38A 2V9QA 4O2FB 3HMXL 3LH2L 2OSLA 2CO6B 5J3HC 4UIMB 3RZCD 4UNUA 2IGFH 1MIEL 2IANA 1HXYB 5DLMH 4BH7B 2A73B 4O2FA 3CX2A 4P9MH 4AK1A 3ZLQC 4P2QE 4UIMA 2XTLA 2GIYA 4WUKH 3HR5B 1QFWL 4MHHG 1HXYA 4BH7A 2A73A 2WQRA 3EYSH 3FHQA 3TF7C 1E27B 2YK1L 2ZUUA 4ZOEA 4OZGF 3JWDC 1F4YH 3HR5A 1BEYL 1NCBL 1E27A 1CVRA 4HS3B 2B1AH 4HWZB 4MJ6B 2VUOA 2XQBL 1JGLH 5JR1H 2NTFB 5TF1H 2AGJH 4Z7WE 3QDGD 3V5DB 1NCAH 1ZHKB 4HS3A 4HWZA 5HJ3B 3KHOA 1BQUA 4LARH 4MJ6A 3VW3H 3WKNA 3MRMB 4NQUA 2D0HA 2NTFA 1QPPA 1EV2E 1MRFH 2BHYA 3DSFL 3V5DA 1ZHKA 5FYJL 4LEOA 1YDPB 4H0IA 1CXKA 5DD5L 5HJ3A 3JTSB 2NY3B 1BFSA 3B6SB 3MRMA 2WV3A 2FDBP 3RVXC 5C0EB 1OT1A 1YDPA 4QLRA 5FUOL 1MJUH 2NY4C 4AMKL 4PJ8B 3JTSA 2OR9H 3B6SA 1MCDA 5C0EA 3SDDD 4Y2DB 1INEL 3WUWG 3VDCA 5L9DH 2QQNH 3QUZD 4LLVB 4PJ8A 3K2MC 5ALBL 1ZLWK 1S78D 1C5CL 2V9RA 4NO0D 5DVKA 3RAJH 4Y2DA 2EE6A 4V2CB 3MOQA 1WF5A 1ZVSB 4LLVA 4LPXA 3D9AL 5EBWB 4CN4A 2YD8A 2UZIH 3EYUL 3ROOB 1J12A 3AY4C 3MBEC 1J7VR 1U2HA 1FG9C 1ZVSA 5I1KH 4LHJB 4P2YA 2O5ZL 3BKJL 5EBWA 1LO0H 3E6FB 2X05A 4MAUH 1LHZA 1CXIA 3ROOA 4YDVB 3PF2A 1CLYH 3VXRB 4P9HL 2R2CA 3E6FA 3IU4L 3ZT6A 3H9HB 4YDVA 1I4FA 3B2VH 3BDYH 4LSVH 4MA3B 4ZUVB 3VXRA 3KNBB 2CJUL 4D9QE 1T2QL 1DUYB 3QHZL 5I1CH 3RBGA 4W70A 2G75B 3H9HA 3HNSL 3T0WA 4MA3A 4ZUVA 4Y4KC 2GJZB 2HFFB 3KNBA 5IROA 5F96L 1DUYA 3F7QA 1BQHB 2G75A 4ZFGH 4LGPB 2PXYC 2GJZA 2HFFA 1GRWA 3GIZL 3QFJB 4OLXH 3QDGE 1GPOH 1BQHA 4K23L 1ZANL 4NJAL 3QHFL 2W91A 5DC9B 1LILA 3GMMB 4OFYD 3OJVC 4PJEE 5DUBB 4CMHB 2IF7A 3QFJA 3NIFE 3DROB 1DSFL 3CJJA 3IRPX 1IGJB 4QXUL 3GMMA 5DUBA 2BNQD 1E6OL 3DROA 3FRPG 1EGJL 1JI2A 4Y16D 5FDYA 3RIFK 3O6FB 3FO0L 1IGJA 4PV9B 2W60A 5I1EL 5D5MF 1L7TH 2ZCHH 1TJGL 4NNYB 2I25N 2VR4A 4JFEE 1A5FH 3R8BB 3O6FA 2NLJB 5T3XD 2HJLB 4PV9A 3S88L 2B8OT 4FQLH 3TV3H 2D3VA 4YDIH 4NNYA 1X4ZA 4JHBA 5E5RB 4R26H 2QQKL 1F97A 5GGRY 2NLJA 2HJLA 1AKJD 5GSRB 1TLKA 4HS8L 4OLUH 1V7MH 4RIRA 1N0XL 4PY7B 2HT3C 5K9QI 2JB5H 2WWMC 4ZO7A 5FYKD 1FGVH 5MP6L 3JXAA 5LXGH 5GSRA 3LIZL 5FECB 1KPVA 4G8GD 4ONFH 1BD2D 3PV6B 4PY7A 1F02I 1UCBH 2UUDH 3E6HB 2JK5B 3EOYG 4KDVA 2ICEB 1MCWW 2OS7A 5FECA 3GGWB 3H7LA 1AQKL 3PV6A 3D0LB 3NCYP 4B0MM 2DDQH 4ZS6C 1H15B 4OIIH 1IMHC 1I85A 1I9JL 3IFLL 3E6HA 2JK5A 3MNWB 5CJ5A 3ISWA 2X4TB 3GGWA 4P49A 2EIBA 3D0LA 3ZYZA 1H15A 4HC1H 4U6YB 5E24E 2VDPL 3BWUC 5GIRB 5BZWB 3MNWA 2J6EA 2R4RL 4QF1B 4Z7UF 1JHKH 3FN0L 2X4TA 1L7IL 4F3FB 1P9MC 1MRDH 1Z9MA 2ZOKB 4U6YA 2EO9A 4GW4B 1QOKA 2OP4H 5GIRA 5BZWA 4DVRH 4ZFFB 1L6ZA 3UTTB 4QF1A 5DF0A 4I77L 5C2BL 1PG7W 4F3FA 1A0QH 3SKJH 3VWJC 1C5BH 2ZOKA 2GT9B 4DJMA 4O51B 1PEWA 2ZUQC 5EO0B 4GW4A 5BV7C 3O2WL 3NCFB 4ZFFA 3UTTA 4NQTA 2P5WD 2IQAA 2QHRL 4KI5E 5JIHA 1F6LL 3HMXA 1HQ4B 3B8YA 2OL3H 3GHEH 1G0YR 2GT9A 4O51A 4OZGB 5EO0A 2BNQE 3V0WH 3VI4F 4OZFH 4UZGA 5TPWL 1HQ4A 1IC7L 3MTRA 4HDIB 4PJXE 4OZGA 3BSZL 3ALWA 4WO4C 3R0NA 4G6FD 5LBSH 3HKFA 4XVUD 4MGXA 2EDBA 3GB7B 5DD1L 4HDIA 1YEDB 3VXSB 5C2UB 3MJGX 3MRIB 1B4JL 4JY5L 3M8OH 3W82A 5MI0B 3Q1SL 3QIBC 1AO7D 2BXZA 1Q94B 3GB7A 5E95B 4JFFD 4F15C 1A3RH 1YEDA 5FO7B 3VXSA 3MRIA 4MXQA 1J86A 3VJ6B 4LVNC 4CBPA 1K4CB 2OK0L 5EC1B 4GRWF 3DETC 4NFDA 1E6JH 5FYKE 1Q94A 5BS0B 5KS9E 5EUOF 4RZCB 3ARDD 4RGND 5FO7A 5T5NF 4HMCA 4QNPE 1UJTA 4G8GE 3VJ6A 1K4CA 4M7JH 1BD2E 5EC1A 1YEEL 3SBWA 1HIMH 2SEBB 4NZRL 4QRTB 5BS0A 4PP8C 4RZCA 5TGBB 4JFDD 1JGVL</