1JGEA

Hla-b*2705 bound to nona-peptide m9
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B-27 B*2705 ALPHA CH
publication title HLA-B27 subtypes differentially associated with disease exhibit subtle structural alterations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 75
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2001-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jgeA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1jgeA01
2VUYA 5GSVB 4OFDA 4OLEA 4H26A 5C09D 1GSMA 4MQXD 4HK3N 1ZEAL 5EA0H 4OM0H 4PG2C 1D9KC 4HIIA 4L9LA 4P5TA 2C3VA 2WIIB 3BDBA 3TN0B 4GAYA 3S36X 4K3HA 1YNLH 4L5FL 3UO1L 2B39A 3MBXH 4XWOC 2ARJQ 4CVXB 4HUVB 1F4WH 1CIUA 5SWQB 4CADA 2E7LC 4FMFA 4L3CB 1P2CA 4EVNB 1JPST 4YR6A 4HBCL 1LK2B 3H9SB 3EW3B 3PGFH 4ZYKA 1R3KA 3GJFH 5EOCJ 5ICYB 4LGPB 1D5XA 4LHUA 1IZJA 1HXMA 4F15B 2YD7A 3E3QE 4DOHE 1QD0A 4JDTL 4YWGH 4NNYA 4F57H 3NFNB 1OGAA 3JUZA 3ZDZE 2HLFC 1QSEA 1TVHA 1NFDA 3GI9H 3KPOA 5AG9A 1IT9L 4ZTOL 4UNUA 3E6FA 5E2TL 5C9JB 4Y4FB 3QI9A 4KH2A 2DQJH 1BVLA 4KI5F 3KR3H 4RGOH 3ES6B 4JR9L 4M48L 5I1DB 1JTOA 3VG9B 1S7VB 3IGAB 2AJVH 4P5TD 2VZ1A 4PJEB 5F7HA 1XH3A 3JTSA 2ADFH 4AEIH 2IQAA 1FPTL 4JREC 5BRZA 1UVQA 2BC4A 4JN1H 2NW3A 1KB5B 4PR5B 3HE7A 2Z92A 3HLAA 4F7PB 1BHGA 1ZVSA 3U2SA 2JELH 4OUOA 4XP5H 1KT2A 3KPTA 3MV8E 1BQHB 2EH7L 2E7MA 3B3IB 3IJHB 1JUFB 3GRWH 5CBAA 1FL6B 1DLHA 3BP4A 4QYOB 5BXFA 4LP4A 5KZCD 3EKCA 3WN5A 4XI5C 4LHUD 4GH7B 2GTWA 1UM6H 1R5WB 3GMPB 3TJHA 4PJ9A 3WLBA 4ZOAA 4YHKH 1IJ9A 4JZNB 1OGAD 1QSED 3AMLA 4K8RL 4NC0B 5HVHC 3RIAK 1EV2E 2IANA 4NZDA 3VXRE 5LVEA 1FGNL 3RVUC 3QI9D 4JKWA 3RL1B 4TUKL 5IROC 5D1ZD 3TWCH 5ALCL 3DSFL 3G04A 3KYNA 2CGRL 1FFNB 5HVFB 4PJFA 5DEGB 5EUKB 5BRZD 5C0EB 4KHXH 3JTCA 1JHTB 5JHDB 1I7ZA 2DQIL 4B50A 2AKRA 3BZFA 5T5FL 4F3FA 2BY2A 3BDXA 1XF4B 2QQKH 4OFKA 4EI5A 1UENA 5E03A 3D69B 4S1DC 1A7NH 1HYSD 3C5JA 4D9QE 4LLMA 3AS3A 4NQCE 3IRPX 3DMMB 1P53A 1TTFA 2O5ZL 1YEJL 2WUCL 4OZFA 3IDNA 5EU6A 2DMCA 3ET9F 4UTBH 4PJ9D 1T7YA 2DS4A 4ZTPL 3QJHB 4G9FA 2GUOB 1IM3B 4BKLB 5D7KD 5EU7E 1I1AC 3V6ZA 2VLJE 1KIUA 3DX8B 5FM5O 4LCIL 3OZ9H 3LRSB 3EOBA 3D2UA 4OFVA 4QGTA 4QHKI 5DEFB 4D8PB 2VDPL 5JPNB 1A6VL 3ROLB 1IAMA 4WDIA 4QTIL 5KVFL 1KXQE 5AD0B 2DQFB 4GKOA 2VAAA 3ZKXB 4ZAKD 1P4LB 1G9ML 3P0VH 3TVMC 8FABA 2YK1L 4KQ3L 5IEHB 2C7UA 3DO7A 3FCTB 3O0RL 2XZAH 4JB9L 3BSZH 1PYWB 5CJXC 4EI5D 5EU5B 3BQUA 1R5IB 3T1FB 1T66C 2PXYA 4PJAB 1MAKA 3CXDH 4R2GB 4M7JH 1HHKA 3QBTB 3E2HA 3BMWA 1ZLSL 1U8PB 3BP6B 4D9RD 5HGDB 5A40E 3FFDB 4FNLH 3HC3H 3NIGF 4HMCA 4L9DA 1MCNA 5EU6D 5F1IA 5KSAB 2A9MH 1XAUA 2VKXA 4XMLH 3E6HA 5D1QA 1MNUL 4O9HH 1LO4H 3W9DB 2GJJA 3OMZA 4GW1B 1IM9A 1XF3B 4GMTH 3CGTA 5T3ZD 1IQWH 1F90H 1BFTA 1RZIA 3JXAA 1AJ7L 3OL2A 4PRDB 3T2PA 4DQOH 5MEOB 1RVFL 3QZWG 2RFXB 1P1ZA 5DWUH 3MGOB 5JIPA 2OZ4A 2XI9A 4LLYB 1NGXA 2W65B 1LE5A 2PYFB 5BJTA 1FZKB 1AO7A 4NHCH 4E9LA 2UWEA 5LAXA 2HVJB 2Q76B 2LFGA 2FL5A 1DQDL 1UXWA 3KPQB 3BQUD 3P11L 4QXGH 5EOQL 5SWSA 2AI0L 4Z7QF 1A9EA 1F3DJ 1FAKT 4KVCL 4MA7L 5EG6C 3TBYB 3A6BL 4Y5XC 2FYYB 1D5ZA 5GGTH 4OGAC 4NQED 3KPPA 1V7MH 4PJIE 3OR7B 5MERA 2QKIB 3LS5L 1JZ7A 4Z9KB 4P4KB 4DOHB 5DGQA 3DLQR 5D1QD 1F4XH 2X41A 3T04D 4LU5L 5B3JF 5SX5H 5F88B 2F53A 4B53A 1IM9D 3MRRA 1Z3GH 3F58H 1IBGL 3RGVB 1H3WM 5KANG 4X6DA 3BIKA 1U8IA 2GTZB 2R69H 2X4UB 4BK5A 4PY7A 1EVUA 5DTFA 4KTDH 4TULH 5J12C 3SY0B 1MJ7H 1AO7D 4JG1L 2OI9A 1FYHB 5IIEB 1AFVL 5I71C 5D2LA 3BP7A 3DGGA 4XNYL 4ZUWB 3CMGA 5HD8C 4MXVE 3TESA 3K2UH 5SWSD 5JTWA 5HGGS 3U30C 3MV8B 2UVEA 4H5SA 1G7PA 3L3GA 1OM3L 4QRPA 5J1SC 1MWAA 3IFPA 5C0AA 4EN3A 5JORA 1EAJA 7FABH 1MQKL 1FO0H 3TIDB 4WW1A 1MJ8H 1A7PL 1GPOH 1RIHH 4N8VG 4JEGB 3VE0B 1DJSA 4WW2C 4XPGL 1CFBA 1QR1A 5I76A 4YHIB 3QFJD 4ZS6C 2F53D 4Y5YB 1JE6A 4I3RL 2HLFD 1RJLB 5CJ5A 3OXRA 4HPOH 3IFNH 1AGBA 1RJZB 2EDTA 3VXRB 5EO9B 4XPBL 2GITB 3TV3H 5I2IA 5EA0L 2D7TH 3T2OA 2EDJA 2QADC 2V7HB 3WEXB 3RKPA 5HHMA 4ETQA 3QCUH 3PHSA 5I1HH 1YN7A 2VQUA 2Y72A 3MBXL 4M43L 5I1CL 2I9LB 3H6JA 2J12B 1WC7B 3FFCD 4I48A 4NQSB 5FV1L 2BERA 1F4WL 1SJXA 5ITFA 4UU9B 4RNRB 3RVWC 4E41D 2NYYC 4ZPVA 5IHUH 3DV6B 5JPMA 3KJ4C 2VXTH 2P8PB 1JNHA 2GT9A 3UJIH 1WICA 4GRWB 3EJYC 3OXSB 2UZIH 1HILB 2YD8A 2FD6H 5D1XA 4QRPD 4RFOH 3N85H 5C0AD 1IZKA 3MLUH 1AHWB 2BNUB 1FZMA 1YNKL 3C9NA 3RWIA 1RJYB 1KPVA 2F54E 4OD3H 1AGEB 3LD8B 2G5BB 3QULB 4Q9RL 4YWGL 1X4ZA 4F57L 3FT4A 4UTAH 2VLMD 5IFAH 2DWDA 3RTQC 2N4IA 2WWKO 1CLZH 4X4MA 3T4AB 3MFGB 4UDTA 1ZT1B 2DQJL 3I85A 2LQRA 3KR3L 4R7NB 3D0VA 4R4NC 2AJVL 5HHMD 4WI9A 1J88A 3C60A 3CFKA 4M5ZH 4FFEX 1J0YA 2ADFL 2ZG3A 3N9GL 1OOAA 4BSVA 1CE6A 1MJUL 2EH8H 3ULUF 4U05A 1HZHH 2X5PA 3TVMA 3C5SA 5ETUB 4DEPC 3L5IA 2ITDA 4RFEB 5DHYA 2NY7H 4EOWH 1QSEE 1Z9SA 3MRMA 5KVDH 4R4FH 3MGTA 2IBZX 1ZE3C 4U6YB 3MNZA 4X6FB 2VISB 5D1XD 3BYYA 1SEQH 4H1LH 4P46C 4WFEE 1MCSA 3LDBB 3NN8A 5DA0B 3T0BA 2FBJH 4XPTH 3LKRB 3S5LB 5IG7A 1FAIH 3ARUA 4IS6A 4AL8H 1UM6L 3DROA 4FQXC 4FMKA 1P4IL 1FNSH 3W39B 3HNSL 4YHKL 3BN9C 3O41A 4PJDF 1T3FA 2KZ1B 2X70A 3HZKA 1JGEA 1MLBB 2D4FA 2JJTA 1S7WA 4G9DA 3B2UC 3KYMB 3MBEA 4JFYA 2JIXB 2NY3C 3DWTA 4HUMB 3D39E 1A4JB 1BLNA 1QNZL 4POYA 2AGJL 4TNVF 5MP6L 3TBVB 1FSKC 1EGJL 1MEXH 4IMLA 1U92A 3LPGA 1NC2A 2OTWA 3C60D 4XB7A 3VI3E 4AQ1B 2Z8VC 5BZDA 4ODXA 1ES0A 3DURB 4KHXL 3TVMD 4U1MA 1QBBA 5FYKU 2FO4A 3IDIB 1WEJH 4HKXA 4W6WB 3NFPB 2W0KA 4Z77B 4KJPD 4LLVB 4X9HA 5DJ6B 1FV1A 1UWGH 3PWLA 4PJ8B 1ZLVH 3ZTJH 2IANE 2YN3A 5EULV 4RZCA 4D9LH 3BT2H 1ZHLA 1M7IA 4XWGH 3BH8A 5IHZB 3BKYH 2OX5A 3MNVA 3QWQB 5IVXE 4ZFGH 2E9IA 2ZCLH 3QO0A 3HNTL 3TH2T 1KN2H 4PJIB 3MODH 4HWNA 2VERN 1WBZA 4EDXB 3QEQE 4PJFE 2ATPA 1CDYA 4XXCA 3QXAA 3TNMA 2IH1A 4K2UL 3QIBA 1FL5B 2AXFA 4CDGC 2FJFB 3RVXD 3DJ9A 4Y5VC 5FKAB 2AJSL 2FR4A 4LLWB 3OKKA 4DAGL 3MREB 2EYRB 3FB8A 4MD4A 5E4EB 3CXHK 1NC2D 3O2WL 4QRUB 5HI4C 1D5MA 3GDBA 1ADQH 3P0VL 2OJEA 3FO1B 5EU6E 1NL0L 3H3PH 3HS0A 1IAIH 2P8LB 3PL6C 4EEEA 4OZGF 1P7QA 1BFSA 3IKCB 5FOBB 1YPZA 1NFIA 4G9FE 1KYOJ 5DDHB 2XA3A 1KJMB 1ITCA 4OZ4A 2ITCB 4LCCA 4M7JL 4FQHB 5T3ZE 1RURL 3PDDA 5FCSH 2MCG1 1XGQA 3RZCB 1K2DB 1GZQA 1UACL 4RMVA 3CFBA 4N5UA 1EBPA 3HC3L 3EGSB 4OGAD 1CLOH 5GGUB 1KCVL 2A9ML 1RY7B 4XMLL 5DC4B 1NANI 1IGJA 2ZUYA 4Z95L 1FFPB 3WNNA 4XNQA 3BUYA 4FG6C 4W81A 4ELKB 4WW2A 1LO4L 1NMCB 5TFSH 5ESQB 5I8CA 4NNXB 5HHPA 4ELMA 2HKFH 3QIBD 4Y4HA 1N7MH 4UINH 2Z93B 1CK0L 4IEFB 4IHOB 1TJIH 3FRPG 3CH1B 4DQOL 1WZ1H 5I73B 2BX5A 5KSBB 4KZDH 3RX5A 5EO0A 4FN0A 1X6LA 2DTMH 4P5KB 5CZXC 3NCMA 4G80A 2AQ2A 4P3DA 1N2RA 3MOAL 4JZOA 2ZSVA 3ZDXE 1DVFC 1X6NA 1ZHBA 4NHCL 3L95B 3H7LA 5DI8B 5JOPE 4OD1H 4ZO7A 5GXBB 1UC6A 1P7QD 5FB8B 2W9DH 2ZZUT 3OG6B 5HD8D 1JGUL 1VACB 3QHFL 3PGCA 4Z7OF 4HFWB 2R0WH 5HI3D 2APFA 4XCCL 3V0AC 5FGCB 2EYSB 4H26B 4OB5L 4A2LA 1AKJA 2Y7QA 4QNPF 3WFCH 5GRXG 3S37L 5GGTL 5I17B 3WUWB 4H0IA 5A2LH 1CWVA 4XBPB 1DQLH 5JW3H 3I2CH 4L9LB 4QCIB 2HFFA 4P5TB 2C3VB 1CBVH 1IGIH 4OGYH 2F54B 1W72H 4GAYB 1D6EB 15C8H 2ZNWA 2R56H 4M00A 4V2CB 1F4XL 1AO7E 4FQIH 2HN7A 4TTGA 2UWEE 3RNKB 3SDXF 1N0XH 1L7TH 1XGTA 4OZHA 2DIJA 2YPVL 2X10A 3R06A 2E7BA 3KLHC 1E4WH 4JFHD 4CADB 3GM8A 3KAAA 4N9OB 1CVSC 5TE6L 1DLFH 1EO7A 1P2CB 1INDL 2FX8L 4YR6B 1R3LA 3P3YA 2R0KL 4D3CH 4KAQH 2IBBA 2R69L 2QADD 2ENYA 4ZYKB 1R3KB 4OI7A 1K8DA 5DRWA 4PRHA 2YZ1A 4LEXL 4MAYC 2NY0C 1QYGL 1D5XB 1B3JA 1EJ6A 3B9AA 1XF5A 3HE6A 5F7KC 3LIZH 4IRSC 4RIRA 1VGKB 4NNYB 5SWZE 4FABH 1JGVH 3A6OA 4K7PY 3K2UL 3UPCA 1QSEB 4OTXH 1TVHB 5TJWK 2VLKA 3E6FB 1BIIB 4YHNA 3EJYD 3GSNA 1AKJD 4P2OA 4M03A 1BVLB 3C6LC 4LPYA 4X6DE 2AJYL 3TT3H 2GKIA 4L4JA 4NC1C 4JRXE 3P4MB 4JJHA 1PVHA 3S3JA 4N1CA 3B9VA 2BSTA 3R4DA 3MA9H 1F58L 3QHZH 3MCLH 3DBXA 1UVQB 2BC4B 5I9QC 3DRTA 4YXHH 5D2LE 2NW3B 4LCWA 2A74B 3HE7B 3IFNL 3U4BL 2XG5A 4CNIB 4WGVB 5GRYA 4UOW1 3HLAB 1T04A 1FDLH 1ZVSB 3TH3T 3TV3L 4YE4H 3D39B 2J8UA 1KT2B 2D7TL 4PLJD 5FO8B 5IW6A 4R4ND 3MJ6A 5CBAB 5C0AE 4PRHD 1DLHB 2COQA 3CH8A 1YEIL 2HTKD 5I19L 3WN5B 3MV7A 3VRLF 2GTWB 5E70A 5LQBL 4NRYA 4WV1C 5CIPB 2IFFH 3HE6D 4JFOB 5HGBA 4PRPE 1GC1H 4B7LA 5IHUL 4N9GB 4W6XB 1TQCB 4HQQL 4NSKA 1VFMA 4A6YL 2AV1A 2IANB 2VLKD 2QHLA 2FD6L 4RFOL 3N85L 3LN9A 4X6CF 2QQNH 3EYQC 4EDWH 1YYML 3MLUL 4U2ZA 5IVXB 5H8DA 1LO5B 5HHME 3ARWA 1XGUB 5D8JH 5JNYA 2FIKA 3G04B 2YPKA 4OD3L 3KYNB 4HH9B 3QEQB 3VWJA 4PJFB 2IPKB 2H41A 3BN9D 4U7KA 4Y1AD 5GS0C 1HINL 1I7ZB 2VR4A 3QJFA 5IFAL 2Q8AH 2J88H 4LCWD 4G6KH 4MS8A 1BAFH 1CLZL 2AKRB 3BZFB 4F3FB 3B2UD 1LDPH 4HJ0C 4XT1C 1L9NA 4JPIA 1YECH 4NDMA 3ULSB 3IAPA 2XXCB 1DEEA 4HULB 1MRFH 1DSFL 1L0XA 4PYHA 2R2HB 4K3JH 1NUDA 3HZMA 4S1RL 2QTEA 1OP5K 2QQLH 4OZFB 5EU6B 3IDNB 3R1GL 4HGMA 5DD3L 4I4WA 3LV3A 4PJXE 3STLB 3RUGF 2EIZA 4HKBA 2NY7L 2WBKA 4G9FB 1Q0YL 1LP9F 2WIMA 2R39A 5KVDL 4R4FL 3R0MA 1MREL 3DVIA 1SJHA 3DARA 2A6DB 1SBBA 4D0CA 3B2VL 3EOBB 2YOCA 3D2UB 4XHQA 3T2QA 3SDYH 1F2XK 3ZE2E 4YPJA 3QXDB 3HMWL 4KK8C 1FNSL 1CVRA 3MJ8B 4OLWL 5AUMA 4S1QL 4IRJC 5FGBC 3GMQB 2IAMA 2EDNA 1MCQA 4Y7MA 4ONFL 3DO7B 4MS8D 2G2RA 1NEZA 1F97A 3RY6C 2V6HA 4Q0XH 4PS4H 1EFXA 2CLRA 2PXYB 3CSYA 4E0RA 1U2HA 1HHKB 4YDIH 1LO2H 2DQHL 5F1SA 2GK2A 5HI4D 2X4RB 2V2WA 3VCLA 1BECA 1EHXA 1MJJA 5F1IB 4XMPL 5FYLE 4RX4A 4JFPA 4MVBC 4OD2A 2OM5A 1OAQH 3KPNA 1WEJL 3E6HB 4NN7B 3IU4L 2B2XH 1QBLL 5D1QB 5CMAB 4ZSOA 4GW5A 4X80L 5I74B 5DR5L 3RI5K 2V5MA 3HAEG 3BT2L 4XWGL 1Y6KR 4U1SA 4OCYH 4P2RA 4QHKJ 1Z5LB 2VDLH 4QLRA 3MO1A 1KN4H 3RQ3A 1KN2L 5K33A 1CD0A 1NGXB 1LE5B 3MJ7B 4PV9A 4JZJA 5BJTB 4KDVA 5MI0B 4ZOEA 1AO7B 1S9WA 2UWEB 5GGRA 4KK9C 4QT5A 5LAXB 3BEVA 5EBWB 2YBRA 1UXWB 5DGRA 4ODHH 1SMOA 1T2QL 2DI9A 4OLXL 4CJ1A 3FOLA 4K8RD 5I16A 5LKNA 2IPTL 5C6TL 2FH8A 2NY6C 1ADQL 3U1SL 3KPPB 5D7JC 1DVFD 5MERB 4RX4D 1D3CA 5D7LE 2D31B 1Q94A 3FQRA 2VL5A 1GGBL 3W11D 4PLKC 2ZOKA 4NN6C 3BJLA 5DD5L 4MLIA 1J0KA 3UTQA 3H0TA 2DLFH 3K4ZA 4DGIH 4P2RD 2VITA 3C6LA 1RFDH 1ZV5A 1MHCA 4HUUB 3W5NA 4X6DB 4FQQB 4RGMB 3HC0B 3BIKB 2J1KA 1U8IB 5C7XH 4JRXB 5GHWL 1S9KC 4PY7B 5DVOA 2BHUA 2J4WH 5DTFB 1RUPH 4WCYH 5T1KA 2UY7A 3UAJC 4YFDB 2OI9B 5DT1H 4YZFF 1N7ML 4U6HA 4UINL 3H7BA 1I9JL 5D2LB 3BP7B 1WF5A 3DGGB 4HEPG 3UJTL 5EC1B 2AJZA 3UBXA 3KLHD 1TJIL 4PRBA 3G6DL 1S5IL 4NZJA 1WZ1L 2A6IA 5HYEA 3CX2A 2DTML 4H5SB 3ZE0E 1MCWW 3LN4A 4QGYA 1U41A 1DBAL 1G7PB 3L3GB 5HHXL 4QRPB 1MWAB 5C0AB 3MR9B 5IJVA 4EN3B 4DGYH 1E6JL 4GG8A 1GGCH 2GI7A 1AE6L 5KAQG 1UM4H 2NY0D 3VFMA 5BQ7A 3Q1SH 2FHCA 3QG7H 4WW1B 1G7QB 2Y07H 3VA6A 3VRIA 4QRSA 5CZVH 5DHVH 4IRSD 3BZ4A 4PRPB 3V79C 3B9KA 4ELME 5FIEA 1E4XI 4HXBH 3OXRB 1R3JA 5KTEL 5J8OA 3KJ6H 5HTSA 4WI4A 3P30L 1AGBB 2IEPA 4CUCA 3OKMA 1L0YA 3DUSB 2EEDA 3TIEA 3C6LD 1WFNA 2NX5E 1O0VA 3MACL 4LLQB 1DQLL 3L6FA 5JW3L 5HHMB 1EUTA 2D0GA 1IGIL 4LPWA 3GNMH 3K8MA 4ETQB 4LRNH 1W72L 1QVOA 15C8L 5T1KD 1TFHA 1MCDA 1YN7B 2K3TA 2VDNL 1N0XL 1S7UA 1L7TL 4LOUC 1SM3L 4I48B 1V3MA 1WQVT 1E4WL 4CL7A 4WWKA 5JPMB 1JNHB 2GT9B 4NZTH 1S9XA 4ISVB 5E5MA 2DM4A 2MKWA 3IJYA 3M1BA 3SQBA 4YK4B 1HOCB 1R3IH 2ZPKL 2HJLA 3IDYB 2R23A 3ZKMC 5KJRH 3C9NB 3W2DL 2UV3A 1KPVB 1WK0A 4PRIA 4O2EB 3S7GA 1UKQA 4M6OH 4FABL 1EFQA 3SO5A 3B9KD 5ITBH 3OWEA 2HJFA 4UAOB 4OZHE 3LHPL 1KB5H 2DWDB 4Z0BL 1BEYH 1IQDA 5J13B 2YR3A 1MSPA 4UDTB 2OL3A 1TJHH 5BS0E 1QFOA 4F7CA 1S9YA 4U6XA 3LB6C 4BA8A 1HCFX 4PRHE 3C60B 2O5YH 3T77A 2GJZA 4LF3A 3GJFK 1KCSL 4YGAB 4BSVB 3MV11 1MAML 3MLXH 3EOTH 4P9HH 5HYIA 3C5SB 4YXHL 1U42A 3ARBA 2AP2A 4EQ2A 2ITDB 3KGRA 1YY9C 5DHYB 1IC5H 4QHMA 4O4YL 4WWKD 1IEBA 3MRMB 4XXDA 4YHOL 2ZUQC 3OB0H 4P57A 4PUBL 3WE6A 2VE6B 3MNZB 4K3GA 2XTLA 4MJ4A 3QRGH 3UPAA 4KI1A 3QWRA 1QRND 4IS6B 3OKLB 1UB6A 4PRID 3RWDA 4Z7WA 1YEFH 2IG2H 1M71B 1YEHH 1GC1L 3MFFB 3HZKB 4HZAA 1R24A 1U8NB 1S7WB 4G9DB 1FE8H 2NLJA 3EDDA 4DN3L 2QHRH 4JFYB 3MBEB 3TBTB 1LEKA 5FF6B 2QQNL 4EDWL 1BLNB 4KI5E 1QSZA 1G7IB 3B83A 3GEWB 4LFHD 4X8XA 1KGCE 4HLZH 4DKEL 1A3RH 3UYOD 4I77H 1X5GA 5D8JL 4HEME 4PJ5A 5DJXB 5EO1A 5J11C 1U92B 1LQVA 2OTWB 2WP3O 3ARGA 5FUCE 3MV7E 2NY2D 1ES0B 4IRJD 2O26U 4PJDA 3VFOA 3WO4C 4U1MB 3EJZC 3ARBD 5KANI 2FO4B 4HKXB 4G6KL 1BAFL 4WHDA 1TJGH 3D25B 1LDPL 4H8WH 4LRIC 1YECL 2CKBL 1FV1B 4GQPH 1JRHI 4U1KA 4RZCB 1KEGH 4M8QA 3BH8B 2VDRL 2WM0A 5E8NB 5GGVL 1NLBH 3UZQA 4JPKH 5TE4H 3QWRD 1FJ1A 2FX7H 1UB5B 3BD5A 2FGWL 3QO0B 2XQBH 3QWOA 3T8XA 3BKMH 4CU7A 1Q8MA 5D7LB 4TNWF 1WBZB 3HNVH 3N1MC 4FP8H 3TNMB 4HC1L 5T1LD 2IH1B 4PRNA 3QIBB 1OAXH 1JYNA 2AXFB 1ZS8A 4KV5F 2JK5A 2IQ9H 3D3VA 2FR4B 1KCLA 4TRPH 1O7SA 3BP5A 4L8BA 4M4RA 1F13A 1CE1H 3L3OA 3SGJA 1CQKA 3VH8G 3FB8B 1UWXH 8CGTA 5I1JL 3N06B 2GYSA 1I9EA 4XCFH 1TVBA 2V17L 3ARGD 1R0AH 3ZTNH 1DN0B 4HS8H 2OJEB 4UOJA 1ZKAA 2H8PB 4GSDL 4HKZA 4M93B 4M9OA 4MDJA 4RCAA 4AM0A 5C0FA 1BFOB 5IGXH 4XNMB 1IC1A 2GJ6A 3U0WH 1NFIB 4PS4L 1RMFH 3AC0A 5ESAA 2DLGA 1XGQB 1LO2L 4M7KL 3U7WH 2OLDA 4TPRL 4NQDA 5I1GH 3CFBB 5E2VH 3DYOA 3OJVC 2ESVA 5DJ2A 1EGJA 1IGJB 4LBEA 4X6EA 2XZCH 5EU4B 3BUYB 2B2XL 4OCWH 2AK4A 4OZGA 4MJ6B 5I8CB 5HHPB 1JPGA 4ELMB 4Y4HB 4YDKH 4DZ8B 1IEAA 3TFKA 4JGUA 2ZP0T 4P99A 3UTZA 3D3VD 3B8SA 3NH7L 4GMSL 3UTOA 3F7QA 2NX5B 4IMKC 3O9WC 2VH5H 1KN4L 3LKNB 5FYKL 4P3CH 4DK3A 3CLFL 4JZOB 4GKSB 3ARSA 3ZKND 4KRPD 3PNWA 3BPOC 2DJUA 3X13A 3BESR 2MSPA 2B1AL 1BZ7A 1I3UA 3O45A 3MYZA 3PGCB 5HGAA 2Y5EA 3BKJL 5BVJA 5DMGD 43C9B 1MCKA 3U36A 2Y7QB 4NQDD 4Z18A 2YD2A 2G60H 4V3DB 2ESVD 3NIGE 2K7PA 5HDQH 2HFFB 4XVUC 1AGFA 1V3KA 2DQCH 1QFWI 4NBXB 2I27N 4RRPG 2HN7B 3EIFA 3AXLA 3QZWA 3C2AL 1DBJL 1XGTB 4OZHB 1P5VA 1RV6X 3AAZB 1YEKH 2NW2A 2O61A 2DLFL 3NCBB 3ZKQD 4DGIL 5BS0B 1NMAL 4BK4A 5J1AB 3QUZA 4G8GA 2EKJA 1K8DB 5DRWB 1Y6NR 4PRHB 3FB6A 5D71H 5DT1L 4XP9H 4ESKA 1XF5B 1UEMA 3FZUC 1WTLA 1KULA 2P4AB 4K23H 2MPAL 3SDXA 3IXAB 4YAQB 4RIRB 3UEZA 3ZHLA 1S78C 2EO1A 4LOUD 5B3NA 5CEXA 1H0DB 1QBML 1M7XA 3QDAA 4O02H 5FFLA 4LSUH 3VD4A 1TLKA 2ICWA 1MI5A 4Z7QE 5SX5K 1VENA 4YHNB 5I75C 3BD4A 3GSNB 4GKNA 1R6VA 4P2OB 1I3RA 5D72L 3NBNA 3DVGA 3OAZK 4DGYL 2AABL 5DRZA 1GGCL 5JW4R 1G9EA 4F9LA 3MV9E 4OIIH 5EBLB 3QG7L 2FHFA 4AQOA 1ZA6A 3QIUA 1T7XA 3BIAX 4D0BB 5CZVL 5E8DH 3V4PH 3I9GH 2BCKA 5LGKA 4UIMA 1MY5A 3DBXB 5B3JE 3DRTB 3KJ6L 3DXAA 3FQXA 1DL7L 1IGTA 4O2FB 1T04B 4HWZB 4NHUE 2J8UB 5IW6B 4R0LC 1DQML 4GRWH 3QUZD 4JFDA 5CHNA 4G8GD 5FCUH 3LB6D 4LRNL 4Z7UF 3QH3A 4Q2ZA 1MVUA 3GSVA 1BVZA 5GGTA 3MV7B 4EBQL 4NRYB 1EH9A 2UY6A 4LP5A 5IB5A 1IC4L 4NCDA 3VFWB 3KPMA 5HGBB 4HMEA 1CFQA 3FRUB 4MCYB 1XIWA 1MI5D 1U8LA 2AV1B 1CZ8H 4MX7A 1HQ4A 3EAKA 1REIA 1NCAH 1VB9A 3QDJA 1P7KA 2XZQH 3SJVE 5IFJA 3KXFE 5C2BH 1MIEH 3UDWC 4WUUD 3QFDB 5E2UH 1CG9A 2R4SH 5JXAL 2FIKB 3SKOA 3NCJH 3QIUD 5B38G 4HJJL 4LAJH 5GGQL 5L0QC 4UQ3A 3RKDC 3VWJB 1A7RL 4GRLA 5I1AB 1NBYA 2FLBT 5HYJA 1KB5L 4K9EL 1BEYL 4J3TA 5I6XB 2EE9A 1AQDA 1T1WB 2XT1B 2PO6C 2R29H 3MXWH 1TJHL 3DI2B 5FYJE 4NDMB 3IAGC 1KNOA 3QDHA 1OTUC 4X6CA 3S35X 5FHAH 1DEEB 4JFDD 1FC2D 5ISZD 2O5YL 4MJ5A 3HZMB 2BFVH 3TF7A 4P9HL 1U2CA 4CBPA 4ORGA 4I4WB 3LV3B 2DWEB 2WANA 3EOAA 1IC5L 3FQWB 2D0FA 1GGYA 3TO2A 4YIQB 2P45B 3VFUA 4QY8A 1XIWD 2YUZA 1XF2A 3UJJL 5DZNA 3K4DA 1SJHB 1PSKH 2VXVH 3QDJD 1E4KA 4AMKL 1JK8B 3PHOB 3IAQA 3QRGL 1I75A 1FZOB 1O7VA 1HQRA 4OKDA 4MA1C 2XOTA 2PUQT 3WIHH 5GGSY 1YEFL 1VKXA 5AUMB 2R0ZL 1KFAH 3RUGA 4GRLD 3I6LD 3PV6A 1L7IH 5HPMA 4HGWB 2IAMB 2YRZA 4KJWC 5HYJD 1FE8L 1IILE 4NC2B 2G2RB 1NEZB 4GO6B 5JZ7C 1EFXB 5A2KH 3CSYB 4I9WE 4E0RB 3C8DA 4P23A 2Q87A 4L4TE 4A6YA 4GG6F 2X7LA 4L4VE 3DYPA 2VB5A 2NTSP 3P77B 4QXTB 1I3VA 5LCVL 2C1PA 5D7IF 2V2WB 1VFBA 3GB7B 1DBKL 4JG0L 3ULUE 1MJJB 5E6YA 4JFPB 4OD2B 3KPNB 3OKOA 5IMMA 2H32A 4H8WL 1PFCA 1Z9LA 5JMOC 4GW5B 3WIIH 1MHHB 3V5HA 3EUUA 3LAFA 5CAYB 1CQYA 4G7VL 1KJ3L 4U1SB 4JY6B 5JLZA 1KJVA 4JPKL 2HFTA 4G43B 3GSQA 5TE4L 4KTEL 5EORL 2FX7L 2F5BL 1S8DB 4PJ5E 3X11A 2FEEL 3LQZA 5EOCL 4JN2A 4FP8L 4PV9B 4JZJB 4PJDE 1S9WB 1NCTA 2UYLB 4M02A 4QT5B 3BEVB 1OAXL 1UZ6F 3C08L 3QDME 2PR4H 3ESVF 1YEGL 4F33A 1CXIA 2WWMD 4YHLH 1J18A 3O4OB 3MOBH 3HI6L 4K7FA 5F6IB 3O9WD 2ZUVA 3FOLB 4AEHH 1ZLVK 5I16B 1J87A 3U83A 3BOVA 5CJBA 4HS8L 4FFVC 1CR9H 3BZDA 3RJDA 2O5XH 4M62H 3PUCA 4NKOA 5K9KB 1Q94B 3FQRB 1WT5C 5DSCA 2VL5B 4MMZC 3U0WL 4HWEL 2ZOKB 4JGMA 1OAZH 5MENA 2XACC 1U8OA 2W60B 4PJ7F 3H0TB 1KOAA 2PCPA 2XTJC 3W82A 3D3VE 2JTDA 4WI8A 4Y4KC 1CGSH 1ZA3A 1KPUA 5I1GL 2B5IB 4TUOA 3P0GB 1MHCB 3FT3A 5E2VL 1T2XA 3ARDC 3MV9B 3S8WA 1N5AB 4QHNA 4ODVH 1PG7W 5T1KB 3WUZA 1J8KA 3CD4A 1HHJA 2E3VA 4C54A 4YDKL 5FHBL 1IGFL 2GJ6E 2A9NH 1AP2B 2ZNXA 2BNRA 2AJZB 4OSUL 4PRBB 4NM4L 5C0IA 2A6IB 1NPUA 1G7HA 4NHUB 4NJ9L 1S7TA 5DQJA 4N1HB 3V6OE 4KFZC 2BJMH 4KY1H 5C0BE 2VQ1A 3D9AH 4LPTA 4JO3L 4P3CL 1V3LA 3WSQL 4D2NA 5IJVB 5FECA 1QFUH 1P5UA 5IB1A 5BQ7B 1KLGA 2YUVA 3S9DB 4YC2C 3FMGH 4JDVB 4JGJA 1U3HB 3PWPA 3VRIB 4QRSB 2AK4E 5I1KH 4OZGE 4ZXBC 1S78D 3BZ4B 3ZTJG 3B9KB 1CU4H 3MLWH 2X89A 3F65A 1EAPA 1P6AB 1I7UB 1R3HB 3I6GA 5C07A 4NFBA 3S98A 4MNQD 2CMRH 1AXSA 1F4AA 2P44B 3O2DL 1J1XH 2AEQH 3TIEB 3SJVB 1A1NA 1TTGA 5HDLA 2G60L 4LVNB 3L6FB 1NMBH 4HHAA 2IALA 3UDWA 2IGFH 4U4BA 4AG4H 43CAA 1EEYA 1HIMH 4RWYH 2C9AA 1S7UB 2BNRD 4CU6A 4WWKB 3R8BB 2VZ3A 3BUTA 4XP1H 2X4QB 4HIXH 4JFEA 1S9XB 5H2BA 4U33A 3IJYB 2I60H 3M1BB 4WFFD 1BFVH 1BJ1H 5F7EH 5GRUH 2HJLB 1EHLL 2R23B 5D71L 4YDJA 4B7IA 4ZDHB 4DW2H 2OR9H 5IR1B 1FLTX 2EXWC 4UV7L 3SCMC 3MLTA 4K23L 3PWPD 4OZIA 4PJBF 1BD2A 3ARFB 1IC7H 1X5LA 4O02L 2HJFB 3ZSTA 1K8IB 2X89D 4Z7OE 6FABH 1IQDB 3IRZA 4CU8A 2OL3B 4QNPE 1QO3A 1YY8B 2DYPA 5EWIL 1S9YB 4NKQB 4WHYH 3PIQA 4OIIL 5FA3B 4G8GE 2VTFA 2LABA 1JTTA 4LARH 2GJZB 5DQ9A 4ONGH 3V4PL 4NP4H 4KRMB 1T7VA 5CJ8A 3SDXE 2FEDC 2Z91A 5A2JH 4EUPG 4MA3B 2BHYA 4MWFA 2BVTA 2PO6D 4I3GA 4V2BA 4HAGA 2BP3A 4XXDB 2NY5H 4TUJA 3WE6B 1JWUB 3JV4A 2SEBB 5D93B 4L4TB 1FVCA 3STZB 4YGVB 1T89C 1YEEL 5F72S 1C5CH 1UB6B 2BVOA 4NRZA 4KUCF 4U6TA 3FO2A 5E6IC 1PZUB 5FA4A 4Z7WB 4NUGH 3T0EC 5CILL 3O6KH 5H94B 5ICXA 4FZ8L 4OLUH 1BD2D 1IL1A 2CDGA 2Q1EA 4J3UA 3MNWA 4MGXA 5AYQA 4JVUA 1J9CT 2VL4A 4CW1A 3WJJC 3BFOA 4XVTH 3SDDC 1CL7H 3DXAE 3GUTA 3FTGA 3DUUA 3SDCC 3FAXA 5K59F 3VDBA 2DYPD 3IJSB 4L3EE 1CD8A 3PG2A 4ZG1A 4FQ1L 2R4SL 3MUHL 1X5AA 4APQC 4PJ5B 5EO1B 4DN4H 4YQXL 3ARGB 1ZAGA 2R8SH 2JJWA 3KNBB 5KVMC 4PJDB 4M1GH 4OZFH 4F7MA 3TH4T 5ICZA 2ZJSH 4KJWD 3QDMB 5F7DB 1VGEL 5GJSH 3GHBH 4M6NH 3P40A 3D85A 2R29L 3MXWL 3Q6GH 4R4BA 2PYEA 5FHAL 3VGAC 5I18H 5JZ7D 1ACYH 4GJTB 3IDJB 5T3ZH 4MAUL 2GSGB 4M8QB 3QDJE 2Z31C 1RZFL 2ZOLA 5B8CA 1JNJA 2A6KA 4UNTA 1WWCA 1FJ1B 3QWOB 4UBDD 3VRLE 5C08A 5EU3A 3PDGA 1CFNA 3QUKB 4V1DE 3O3AA 4KKNA 4AZ8A 4PRNB 2Q86B 4PP2B 3F5WB 2I5YL 5DD1L 4MLSA 2A77H 4Q9QH 1NCDH 1DBML 1ZS8B 5T5NG 4AENA 2ADGA 2XPGB 1IKNA 2HFGH 3D3VB 4X6CE 3BP5B 4L8BB 4GS7C 1E0OB 4JFQA 1INQA 2CDFA 3L3OB 2M1KA 3O11B 2EE3A 1F8TH 1TVBB 2VXUH 3BPNC 4OT1L 1KFAL 5KS9F 3RWCB 4NUJA 4KRPB 4NWTH 4HKZB 1JF5A 5IB4A 5E94A 5EUOA 5C0FB 4MJID 2J8OA 1CIDA 4MDIA 3TN0C 3P4OB 2GJ6B 2R4RH 1S9VA 5CSBA 4OUUB 2EIEA 3CFJB 2PYED 1WBXB 5FDWA 3HRZA 1JBJA 2FB4H 4P9MH 1I85A 4NQDB 4CVZA 3MZTA 4FFVD 2ESVB 5C08D 1NDGA 5KVGL 2BRRH 2OZ4H 2AQ3A 1ZGLM 5LWYH 4X6EB 1QBAA 5E5RB 5DD6A 3RUGE 2AK4B 4OZGB 3T0DA 1NAKL 4J4PA 4ETYA 1TIUA 3VFPA 1T0PB 1DBBH 1JV5A 5AZ2L 1LP9E 3WIIL 1OLLA 4F15C 1MQ8A 1SEBB 1IEAB 5HYFA 1WAAF 2XNAA 1QSFD 3UTZB 3WFHB 3T0VA 4G6FD 3GI8L 4ODSH 2FATL 2CKBA 4OQ1A 3IFLL 3CPLA 1FYTE 4Y4FC 1MHPH 2APVA 2HP4A 3QCTH 5EC2A 2VZOA 3MRDA 3PNWB 4XAKD 3X13B 2PR4L 3RFZC 1AD9A 2XA8L 5DJZA 5E7FA 4ZUVA 4B5EA 4JRYD 5I8KH 3O45B 4JY5L 4HC1A 5HGAB 4JCMA 4TSBH 2PW2A 4TVSa 1KCGC 3BMVA 1Z2KA 2WBJA 4BQBA 5B4MC 5DUMH 1CR9L 3SDAA 3MXVH 4NKIH 1AGFB 1AI1L 3SGKC 3CUPB 4DJMA 4OF5A 1CF8H 4HAFA 5HHOA 3VGBA 3O3DA 4P9HC 1W0VA 3QZWB 1V5JA 4N8CL 2NW2B 2O61B 3EYUL 2R1XA 4ZQKA 5I30H 3WFZA 1A5FL 5EZOL 2K9UA 2XG4A 3LQAH 3FN3A 1X44A 4G8GB 4ODVL 3UYRL 1MWAH 4HUNB 4XNZC 3H9YA 2LTQB 4NO5A 1BQLH 3N1QC 4ZUUA 1OARH 5EZLA 5LG1A 3MTRA 1D9KB 2VN4A 3LEXB 2YD9A 3SDXB 1J86A 2RB8A 3ALPA 5EPMA 2FWOA 4LLUB 5CEXB 1I8IA 2I07A 3MRJB 3PHQB 1D5BA 1MF2H 1LILA 2ICWB 5MENE 1S5HB 2EDKA 2R9HD 4EQ3A 5E2WH 1I3RB 1MH5A 3DVGB 2WBJD 5DRZB 5BZWA 1QFUL 3D0LA 4L3AA 4C83A 2YEZA 2F5AH 3FMGL 1ZA6B 3UTPD 1EEZA 1UJ3A 5C0DA 5I1KL 3S36H 2BCKB 4I0CC 4UIMB 3DMMC 5JDSB 2DQDH 2D7PA 1CU4L 3MLWL 2DM7A 1R5VA 2P5EE 25C8L 3TBWA 3DXAB 2CMRL 3SDDA 3FQXB 1IGTB 3QQ4B 4H8WC 3SDCA 1J1XL 4L3EB 3GBNH 1NMBL 1ZVHA 1TTUA 2F58L 5CHNB 4N90E 3R0NA 4GXVH 3RL2B 5L7XL 4Q2ZB 1MVUB 3GSVB 1JZ4A 4RWYL 1JGLH 5AZEH 3WS3A 2ED7A 4GRMB 1TZIB 4YZFE 5JW5A 1A0QH 3KPMB 1D6VL 1GGIH 2YPLD 3MUY1 5C0RH 1QFWM 2FEDD 4KROB 5HHNA 1CFQB 3ZKXC 2H2SD 3MA7B 4XP1L 4Y16C 1XIWB 2KDGA 3QEHA 1U8LB 3RDTA 5C07E 4MX7B 4X99B 1HQ4B 2I60L 1A02N 4N8VB 3QDJB 1P7KB 5F7EL 2B7DT 3I3BA 3KG5A 4Z7UA 5IFJB 1MCPH 3UTSA 2AEPH 1CG9B 4R2GC 1N3NB 3O6MH 1MOEA 3SKOB 2X1WL 4RMSA 3H2WA 3PWNA 3UPRA 2YD4A 4UQ3B 2XY1A 2XQYK 3ARXA 4V1DB 4GRLB 1NBYB 2DL2A 3AUVA 4LKXA 1G6RB 1CFTA 2W1NA 3L3DA 6FABL 1AQDB 3SDDD 4J3SA 3SDCD 4BYHA 5J06A 2DBLL 4JFEE 4X6CB 5FO9A 5GPRA 3TYFB 4POZC 3PP4H 2BY1A 1OW0A 3GKWL 3BDYH 4LARL 3MX0A 1B4JL 35C8H 1MFAH 1T0NA 4WU5A 2NQCA 4ORGB 1KXTB 3JVGC 3CC5A 4L8DA 3EOAB 2ICEB 3QUMB 2H6PB 1NCNA 3TO2B 3VFUB 1FQ9C 1KIPA 4TVPE 3CCHA 4N0YH 4HUVA 5SWQA 5JA8B 2Z31D 3TCLA 4WEMB 4DGVL 1PLGL 4MA8L 5F21B 1LK2A 3V9FA 1JHLL 3GMOB 3PP3H 2CRYA 1VKXB 3VXSA 3RUGB 3PV6B 3UC0L 2RQ8A 3W0WE 1LO0L 5HPMB 2F8XC 5D70L 3QYCA 5I1EH 1LP9B 1PDKA 1CL7L 3E3QC 1U6AL 2W9LA 2DL9A 2VZVA 1WWBX 5IJKC 1G7LA 2P1YA 4NT6A 5F96L 4P23B 3OB0K 4L8SA 4A6YB 2X7LB 1FYTB 3U0TA 5C9JA 3RGVC 2C1PB 5HHVH 2Y23A 1VFBB 3ES6A 3ERYA 4M1GL 3BISA 5ABDE 5IMMB 4IOFD 2ZJSL 7CGTA 2AS5M 2Y25A 3FL7A 3VXTB 3GHBL 5KVEL 3TN0D 2CUIA 1OQOA 1VERA 3AY4C 4U3XA 1B9ZA 2A1WH 3FN0H 3Q6GL 1Q72L 4F37K 5I18L 3LS4L 5I8OL 4BM7A 2QV2A 3GIZH 3EJJX 3I50H 1Z0NA 4JO4H 1ZHKB 2YKLH 3X11B 4HXAH 4JHWH 3C6SB 1VFAA 3F7PC 4JN2B 1FL6A 3TA3A 3GKZA 4H88L 3U48A 4F9PC 1G9NH 3KPRE 1EO8H 1B0WA 4KJYA 4KRNA 4ZFFA 2DM3A 4NNPH 4XCYA 3WJLC 2P8MA 3RVVC 1J1OH 1NCDL 4MQ7A 3NMEA 5GIRA 4YLQT 3IETB 5JW4M 4PP1D 4Y5YC 4K7FB 3T0AA 1F8TL 2Q3ZA 3C8KB 4ZMAT 4G8FA 4WY7H 1D5IL 1BWWA 3BE1H 4JPWL 3RL1A 1I7TA 5L9DH 5FOJA 4MCZB 4NWTL 3BHBA 3MLVH 5DSCB 2VIRA 1LK3H 5T5NF 1A6WH 5DLML 3CFEA 4G5ZH 1AGDA 2R4RL 1P9MA 2DOCA 4M9PA 1K9TA 1MCIA 5DEGA 1KIQA 3WHE1 5MENB 1G0XA 2NR6C 4P5MA 1JCKA 2APBA 2PCPB 2FB4L 3VW3L 5DA4A 2NZ9C 1U3JA 1KPUB 1ZA3B 1ZMYA 1XF4A 4TUOB 3FT3B 2R1WA 2D9QB 4KUZH 4UT7H 2R2CA 1Z9MA 3BN3B 3D69A 2DICA 1UWXK 4OBSA 5LWYL 3EOYG 1CLYH 3QT2A 3TA3D 3QQ9D 1HHJB 1AHWC 3ARTA 5F97E 2CKNA 3NTCH 2P5EB 4FZEH 4YHZH 2BNRB 4PJ7A 3EO1A 4WRLA 1PBYA 4NRXA 3QJHA 2GUOA 1IM3A 4WHCA 4WFGD 5EU7C 1KPRA 3SO3B 3RAJL 2B4CH 1QLEH 1MHPL 4NJAH 4ZODA 5GISL 3KPLA 2PETA 1A1MB 5JPNA 1NSNH 3VFGH 4PB0H 1SBSH 4WNQB 2EECA 5BO1H 4JFZH 4RISH 4WI5A 3EYVA 3PQYA 5AD0A 5I8KL 4PJGF 4DKFL 1IGYB 4LKCA 4QXUL 5C07B 4J6RL 4ERSH 1AXSB 4DCQA 2VDQL 4XHJD 1IGCL 5E8PA 5DO2D 2PNDA 1A1NB 5M94B 4U0RB 2O93L 5DUML 3QXTA 5DMKB 4P2CG 1R5IA 4HHAB 2IALB 4I5BA 4PJAA 4ZD3H 3FO0L 1CF8L 4OFIA 1EEYB 2WBWB 3FFDA 1DQQA 5ESVA 3SN6N 4XAWL 5IB2A 5KSAA 2NXYB 3NACH 1UH3A 2F19L 5I30L 4RBPH 1N6QH 2X40A 4PJHF 4JFEB 1CXEA 4WWID 5D7SL 3NA9H 1RZGA 1XF3A 1ZSDA 4JQVC 3GSNH 2IJ0C 1HWGB 4S0UC 1CFSA 4YDJB 4R96B 2ZUTA 1OARL 2HH0H 1HE7A 4RWHA 4JFXA 4FA8A 3MGOA 3MLTB 2E8YA 3RVTC 5HHOE 4OZIB 3JVGA 2W9EL 4LLYA 2PYFA 2GEEA 1MF2L 1RUKL 3ZE1F 1FZKA 4OM1H 2X1OA 5E2WL 3VDCA 2Q76A 2NCMA 4QHLA 2DYPB 2B1HL 4PJ8C 4RRPA 2EICA 2Z8RA 3PIQB 1UG9A 4Z0XB 3S36L 2FGZA 4PJBA 3W0WB 3PF2A 5KSAD 3OR7A 2QKIA 3VXUE 1IAOA 1NBVH 3VA2C 4I0PC 4P4KA 1ODAA 4L5FH 3UO1H 4PREA 1GCFA 1U93A 5F88A 3EDFA 2BY3A 3RTQB 1XFPA 3JV4B 3SQOH 3HC4H 3LOWA 5E8EA 4POZD 1RUML 2MQ0A 3VGDA 3W81A 3O2DA 2AJUL 1F4HA 2JKXA 4Z8FH 2BVOB 4HBCH 4NRZB 1Y18B 5E4EC 5FYKE 1O5DT 4PP8C 5FA4B 3MRPA 3DTXB 4O51A 2IADA 5ICXB 1P69B 3QR2A 3SKMB 1IL1B 3WFEH 3AM8A 2CJUH 2NY4B 3MNWB 4PV8A 3L7EA 5EFIA 5F9OH 1RSFA 3AY4A 4YDLC 4CW1B 3BRFA 4AEFA 5A3ID 3GUTB 5IIEA 3FTGB 1MCWM 2AXGA 1JWMA 1UJTA 1MCPL 4M1DL 2FCBA 1E6OL 5CCKL 3C5ZA 4NM8L 4POUB 3O6ML 5AG8A 3RZCC 4ZTOH 4M6AA 3VFTB 5A2IH 2ZWLT 1U3YA 4X83A 3KPRB 4JR9H 3ZL4L 4F7MB 1WVZA 4Q6YA 4FQXB 5ICZB 1GIGL 4OFPA 2JF1A 4U31A 3TIDA 1NGZA 3D85B 2WV3A 1MRCL 4P4KD 3EFFA 1ZTXL 2C4XA 1NMCC 1FPTH 1PKQA 3UROR 4R4BB 4L29A 4I18B 3EDJA 3IDXH 1RJLA 4Q9CA 2NY3B 2YD3A 1X5XA 2ZOLB 4Z7UE 5B8CB 3UTSE 5EO9A 1BOGB 5DD0L 2A6KB 3H42L 2GITA 1MFAL 5E1AA 5HXMA 3D6GA 5FYLL 2EH7H 3X17A 3K80A 3JV0A 3O3AB 1T80A 5IV2A 4XZUB 1WC7A 3LZFH 1ZOXA 1WBYB 1JTPA 2ADGB 3DV6A 5ACLA 4RGNE 1XCTB 4JFQB 1INQB 2CDFB 4LVHB 4K8RH 4K71C 3MV8D 3OXSA 1FGNH 1PW3A 4TUKH 3UXFA 1DQJA 4NUJB 4Z5RA 4JKLA 3BWAA 4NQCA 3RX7A 4L9LC 5IB4B 3WNPA 3FB7A 4P5TC 5EUOB 1SYSA 1A6PA 3DSFH 4MDIB 1AGEA 1WIUA 1S9VB 4Z7VF 2G5BA 2X4NB 2FHBA 4X4XA 2VJXA 1CYGA 4HS6B 3LKPB 2DTSA 1DP0A 2DQIH 5M7QA 4I8DA 2OMNA 2VLJA 3IS1X 3T4AA 5T5FH 3VXRD 4CVZB 1ZT1A 3HMXA 4W4NA 5IW3A 5KS9A 3G9VA 3PWUA 5T3XE 3VXSE 3BVNA 5DD6B 3Q5YA 3ZHKA 3HI1A 3G6JF 2CRIA 3CK0H 3VFPB 2A1WL 1JV5B 5HYSG 4HIHA 3I75A 3WFDH 4YBLB 1IAII 1H9VA 2WUCH 3PL6B 5DMIH 4XMKL 3RPIA 4P3WA 2W0PA 4OCMC 2NZ9D 4GFTB 2YKLL 3INUH 2CKBB 5IMLA 4Q6IA 2F9BT 1KG0A 3ZO0A 4X6FA 3QI9C 3MRBB 4JRWA 4LCIH 4D9QD 3NPSB 4KKCC 1G9NL 3G08A 5EC2B 4NQCD 3S5LA 1A6VH 3RWEB 4NQVB 1J1OL 2JCCF 5DJZB 4QTIH 5JXEA 4ZUVB 4HD9A 1HDMA 1G9MH 3F7VA 4ZFOL 4JJ5B 1GAFH 1X3DA 4KQ3H 1VCAA 3V2AR 2PW2B 3MCG1 2BVQA 3HE7C 2ICES 5DJ8A 3O0RH 4GG6E 4JB9H 4JQVA 2VLJD 2WBJB 3KYMA 1ETZB 2EDRA 1NH6A 3LMJH 5D7IE 1A4JA 3SDAB 1FCCA 5I0ZA 1QRKA 3TBVA 1A6WL 3U4EA 3VXNB 5HHOB 2YC1A 3DV4B 4N5EA 3O3DB 3WN5C 2C1OB 4OFYA 5B22A 5DJAA 2BRQA 4JQXA 3TJHC 4PJ9C 1JPSL 3WO3B 3IDIA 2R1XB 2WINA 4X9IA 1C12B 2NY5C 2D7OA 5DJ6A 5CKGA 4KUZL 4UT7L 1TZGL 5IKCA 4ODWA 5C2UB 1J1PH 5J6GB 4ZUUB 1AJ7H 5EZLB 2BVEA 4C58B 3UX9B 1AXTH 2UUDH 1RVFH 1KIRB 3KPSE 2XKUA 2DIBA 3NTCL 1UZ6E 4OLYL 4PJIA 2FWOB 1LEGB 5JXED 3VXUB 4EDXA 5J9PA 1HKFA 3JV5A 1YJDH 1D5BB 1OP3H 3S88H 3IS0X 3CDGA 4ODBD 4F37F 2B4CL 3V0WL 1GRWA 1QLEL 2XWBB 1MH5B 5BZWB 1RIVH 4MB3A 1FFRA 2ERJB 3D0LB 3P11H 4ALAH 1MUJA 2V7NA 2YEZB 1NSNL 1EEZB 3IKKA 4KVCH 4PB0L 3MREA 5IBUG 3ORJA 3A6BH 1BF8A 2Q6WA 3MGAA 4MAYB 4RISL 3RWHA 5C0DB 4QRUA 4N5ED 3GBMH 4OFYD 3FO1A 1R5VB 4LPUA 3TBWB 4EXPX 3PWJA 3LS5H 2P8LA 4PJ7E 4Z6AT 2OYPA 5EN2A 4FRWA 5FYJH 5FOBA 4LU5H 4N0UA 3QUYA 5DDHA 1TVDA 4X7CC 4J3VA 4GBXA 2K1MA 4ZD3L 4U3HA 4C4KT 4WEUD 3VJ6A 3RZCA 1K2DA 1IBGH 4S2SA 2IBGA 4NYLA 3WLWD 3HUJF 1KB9J 5JW5B 5C0CE 4U7SA 3PQYE 2R1YA 1KSRA 1N6UA 3KHQA 4WTZG 1N6QL 5I9QB 5F1NA 3QEHB 4H25B 5ESQA 3RDTB 4NNXA 3NA9L 3GO1L 5MHSE 4LL9A 1AFVH 3GSNL 4L8CA 1BZ9A 2Z93A 4XNYH 2OL3H 3UTTA 4M7LH 3U9UA 2DLHA 4Z7UB 3KHOA 3TPUE 3BQUC 3UTSB 2HH0L 2PXYC 1VHPA 2DDQH 4B41A 3BD3A 3V4UH 3E2HC 4P5KA 5HHQB 1ORQB 3PWNB 2XWTA 3L5XL 3ARPA 2YWZA 2RGSA 4WV1B 3O8XA 3VI4F 3V7AE 3LH2L 2QSVA 4OAWA 5D1QC 2G5RA 4XPGH 5FB8A 5FDYA 5I74C 5FO9B 1MHEA 1VACA 4RGNB 2CO7B 4I3RH 5B39G 2WNGA 4XTRC 5T1DH 1PZ5A 3OR6B 1RUQL 3JBG7 2EYSA 3RZCD 1CDGA 4XPBH 5I17A 3WUWA 4BUGA 3ULUH 1T0NB 3MRCA 4WU5B 4XBPA 2A73A 4QCIA 3CC5B 4L8DB 1NBVL 2F54A 1D6EA 1WIPA 1QHOA 1KIPB 4M43H 5I1CH 3RNKA 3SKUD 3CCHB 5D96B 3VXME 3SQOL 3HC4L 4TOYL 2VABA 4IRZH 5BMFH 3UTTD 5DUBA 1TNNA 3TCLB 4KHTH 1V3JA 1RZKC 2BSRA 2QL1A 4TSCL 1RI8A 1KYOK 4HDIA 4Z8FL 5ID0B 5C3LD 3O81A 3VXSB 3WFEL 4PJBE 2CJUL 4XPHL 3BWUC 5F9OL 3DVFA 1BBDL 5JQ6L 3O8XD 1YNKH 1HK6A 4Q9RH 1HSBA 1RQ5A 1VGKA 1G7LB 3ULVF 1TPXC 4NT6B 4L8SB 3PDOA 3U0TB 1BIIA 4LHUG 2CH8A 4EUPA 4Q7DA 4RGMC 1J5OH 3MLZH 1AR1D 3AVEA 5K9JL 3P4MA 2CSPA 3E8UH 1DTUA 2F54D 1F45A 4JPVH 1OY3B 1PY9A 3N9GH 2OI9C 4JDZA 5IM7A 3CDFA 1MJUH 1U0QA 4BJLA 4HT1L 3IDXL 4Z76B 4EIZC 2A74A 4CNIA 2VKWA 3CFCL 1DUYB 5D7IB 3D39A 3LQAC 1IFHH 3WDJA 5FO8A 1BZQK 2I25N 1VFAB 5GRVL 4A2MA 3L7FA 4RSVA 4EN3C 3TA3B 4YEFA 4KJYB 4ZFFB 4ONHA 4XCYB 5C0JA 1EZVY 4DFIA 2P8MB 4NIKB 4UILH 5CIPA 4MQ7B 1P4IH 3LZFL 4JFOA 4FQJL 4WHYG 5GIRB 3HNSH 1PKQE 4HCRL 1B0RA 5ADPL 5K59E 4N9GA 4S0TD 5GQBA 1WCBA 1TDQA 4ONOA 3HB3C 4G8FB 5C0NC 3FQUA 1I7TB 1F2QA 3AROA 5L2KA 4WFED 1QNZH 4KKCD 5SX4H 4PTUA 4KPHL 3BHBB 5IVXA 2AGJH 1LO5A 5MP6H 2VIRB 3KPSB 1XGUA 4G6JL 1EGJH 4IOSD 3CFEB 4ODUA 1AGDB 4HH9A 3QEQA 4PBVC 2IPKA 3DX6A 1KIQB 1GOFA 3FOMB 1TZHA 1RZ8A 3L3KA 4P5MB 3QB7C 3QNYA 3B9EA 2VN7A 3HE7D 3RWGA 2DLTA 4UOW0 4JO2L 1OPGL 3ULSA 2R1WB 3D39D 4NGHL 4RMRA 3VU2A 3S34H 4XP6H 4YK4C 2VLRE 5D1XC 2NY6B 2Y9RT 1QPXA 2R2HA 3IDYC 1FBIH 4GRWF 1KTDA 3CK0L 3WFDL 3HNTH 5DMIL 2ZKHL 1CN4A 4F8QA 3VH8B 3TJHD 4PJ7B 3EO1B 3STLA 4NRXB 3INUL 5A43C 4UAOC 4PD4J 4K2UH 1N5YL 1KPRB 2IAND 3QEUA 3C87A 4U1LA 2A6DA 3K0WA 3FQNB 3ZT5A 3KPLB 2AJSH 2DRUA 5DRXA 1DR9A 5KS9E 4DAGH 2Y4SA 4M61A 2E6PA 3C60C 3QXDA 3BGFB 5K9OA 5C0CB 3EYVB 3O2WH 3PQYB 3EBAA 3QEQD 3I3EA 3MJ8A 1HHIA 4P4RA 4J3OC 1SY6A 3JWDH 4LKCB 3GMQA 1GAFL 1NL0H 4DCQB 3LQMA 5E8PB 1UKTA 3LSOA 4KJPC 4NN5B 1YUHA 4X6BA 3TPUB 3LMJL 5MEPA 4I5BB 4LSTH 3C8HA 1X5JA 3FHAA 3RNQB 1RURH 4KQ4H 3Q5TA 5IOPA 4YX2L 3EFDH 3QXWA 5HSFA 3CDCA 4LSPH 1UACH 2XICA 3V8CA 2X4RA 1DQQB 5ESVB 1I1FA 4M5YH 5IB2B 1KCVH 1PJ9A 1WAAE 1XZ0A 4Z95H 3GM0A 4C56E 5CMAA 2DD8H 2JJTC 3AREA 4G9FD 3OF6A 1RZGB 5T1MB 1I8LA 1ZSDB 2EC9T 4ENEC 1I7RB 2IMNA 3MBEC 1K3ZA 3PV7A 3RVXC 1J1PL 1CK0H 1W8OA 4NO3A 1CFSB 4RMTA 4KJQD 3D2UD 1AXTL 1X4YA 3H3KA 3BGMB 1Z5LA 1QR4A 4JFXB 3NGBB 4X9FA 4XNXL 3ECBB 3QAZC 1LE9B 1JPFA 1NAMB 3O3EA 1MFCL 5F3BA 4EXKA 4GQ9H 3MOAH 1H3TA 3MJ7A 1YJDL 3NPZB 3S88L 1FH5H 1RZ7H 3VXMB 5EBWA 4QHLB 1RIVL 5TDOA 2EDEA 5GSRB 1JGUH 4ALAL 3QHFH 2PXYD 2FH6A 2RJMA 4U1GB 1QSVA 1JWSA 1UADC 2EDDA 4XCCH 4OB5H 5FUOL 5IB3A 1A3LL 3S37H 3VDAA 4GXUM 3GBML 4PJBB 2N56A 3ROOB 4F58L 2D31A 4YJZL 5JOPD 1IAOB 4XXCC 2DKUA 5SWZA 5FYJL 4PREB 1U93B 2OR8A 3ALXA 3QIBC 3OF6D 5E8EB 3X14B 2YPVH 3OGOE 3QRFM 3K2MC 4XTRD 3OAZH 3X3GH 4OI8A 1KCUL 5TE6H 1I9IL 3EDKA 4HUUA 1INDH 1TENA 2FX8H 4IJ3B 2HLAB 2R0KH 4FQQA 3HC0A 3MRPB 4O51B 4JRXA 2IADB 3WV0A 2AW2A 4LEXH 4PV8B 5EFIB 1G9NC 1PEWA 3L7EB 5CGMA 3SE9L 1QYGH 4TQEL 5AAMA 2NXZD 4M93C 4CMHB 5M95B 3OTTA 1N64L 2OL3L 1VESA 1WFTA 2AXGB 4JCLA 3T2NL 4M7LL 5EC1A 2ZUQB 1JWMB 4N0UE 4AY0A 2P5WA 2HVKB 4WO4A 3ZDYF 4LCCC 5HI3C 2DDQL 3C5ZB 4Y19A 1SJEB 3N0PB 3V4UL 2HRPL 4MXVF 5F3HA 5GZND 4IDJL 4ZNEA 2QQQA 3MR9A 5CWSA 1ZANH 2AJYH 3BJ91 2J6EL 3HZVB 5IK3A 5LGHL 2BNQE 4FFYH 1G7QA 1NGZB 3EFFB 1ZT7B 5E8OA 1PKQB 5SWZD 4PRPA 4L29B 2CLZA 1F58H 4Y4HC 2Y1VA 4HWBL 1NC4B 1EERB 1WV7T 5T1DL 3UTTE 1OVZA 5DC9B 3U4BH 4JO1L 1KV3A 3DUSA 1OT1A 2WY3A 1J8HA 3CNKA 5E1AB 3ULUL 4LLQA 3U79A 2X44D 1P7HL 2ORBH 5D2NA 1KJ2L 5KSBF 4JRXD 4QRRA 5J6HB 2XFXB 5FKPA 2YHGA 1VPOH 1YEIH 2R15A 5IV2B 4Z7NF 5I19H 5LQBH 4JY4B 3DUHA 3OKYA 3MLPA 4KMLB 3DO3A 4IRZL 5E9DE 2EDQA 5B38B 3P9MA 5BMFL 4KHTL 4E5XA 2AXHA 4WO4D 1J0HA 4OBRA 4HQQH 1H15B 4A6YH 4ISVA 2B4CC 2VLRB 1HOCA 2ZSWB 1DQJB 4EN3D 1YYMH 2VLLB 4NQCB 3BWAB 4Z5RB 5D5MF 3PGDA 3FB7B 2J2ZA 1JN6B 1SYSB 2VUOA 1UXSA 1QFWH 2DI7A 4O2EA 2H32H 5CLTA 5ADOH 5HY9A 2AJXH 4X4XB 1UCTA 4PJXA 4PRPD 3MLYL 3OPZL 3QEGH 1HINH 5GS1A 4WI6A 3NZHL 2VLJB 2BOBA 5CBEA 2A83A 3HB3D 5C0ND 1KACB 4PLJC 3HKFA 5KS9B 3HRPA 1J5OL 4X0KA 3MLZL 3Q3GA 3PWUB 4J12A 3E8UL 1T1ZA 1DSFH 3BVNB 3DNKA 2L7UA 3U9PL 4M6ML 5BV7C 2HTKC 4JPVL 3PP3K 1JMZA 3HI1B 4S1RH 4Z7VA 1JVKA 4HIHB 3I75B 4XGZA 3HE6C 3R1GH 5DD3H 1A47A 3RPIB 2V2TA 1RK0B 1Q0YH 3TLRA 5AWNL 5IMLB 1IFHL 5AYUH 4Q6IB 1MREH 1KG0B 2VE6A 5F93C 4P2OC 1MVFA 2KQNA 3LCYA 4ZOCA 1NFDF 3VD3A 4DVBA 1S3KH 5F9WB 5DFVD 3B2VH 3SGEH 2IPUK 1G7MB 3G08B 4NOFA 3OKLA 1A1OB 3HMWH 4UILL 4WTWA 1HDMB 4OLWH 4S1QH 2MOVA 1M71A 4C56B 2Q8BH 3F7VB 3HCVB 3MFFA 1C16A 3OHXB 2BVQB 4ONFH 1MCCA 2Y36H 1U8NA 5DJ8B 5J56B 2E7HA 3GBLA 3TBTA 5FF6A 1G7IA 2N1KA 1P4BH 3AGVA 4CVUA 5DJXA 3U4EB 2HT4C 3B43A 1FNEA 2JCCA 2DQHH 2YC1B 1FLRL 4OV6F 4B0MM 1E27A 5FUCC 1BJMA 4IDLA 3HG1E 4X4ZA 3NIDE 5DJAB 4LIQE 4NQXB 4XMPH 5JIIA 4NZRL 2WINB 3IU4H 3SBWA 5IW1A 1CI5A 3D25A 1QBLH 3OBAA 4NPYA 4X80H 5DR5H 5IKCB 1JFQH 1FNFA 4ODWB 3S34L 3WNMA 4XP6L 5EIQA 3WS6A 5I1IL 5L2KE 1FBIL 5E8NA 1XGYL 4AH2B 5HDOA 1C7TA 1UB5A 3E0GA 5FYLD 5D7LA 3HTLX 4PLNC 1IGMH 3VWJC 5J9PB 1A7QH 5H37H 3JV6A 5J7CC 3X3FL 3CDGB 5JR1L 1IAIM 4UT6H 1IMHC 3I84A 4YDVB 4MS8C 5I6XC 3G5VA 1QUNA 4ENED 2F8VA 1T7ZA 3MBED 1OL0A 2DJSA 3GGWB 2VC2L 1MUJB 2V7NB 4N0RA 4OLXH 1T2QH 2XRAL 4QKXB 1CS6A 3TM6A 2Q6WB 1JZ3A 2IPTH 3RWHB 3ZMRA 5C6TH 5GJTH 3U1SH 1QEWB 1DN0A 3JWDL 4JM2A 1BIHA 2EXYD 2H8PA 3PWJB 5CEZE 2XY2A 2XN9E 3NFSL 1BFOA 1GGBH 2MFNA 4PBXA 4HS3A 5EN2B 4XNMA 1K3IA 1A64A 1TQBB 3PJSA 3QUYB 4N0UB 2GK0A 2ZCHH 4LSTL 5DD5H 2XTJE 4GBXB 4ZFOA 1YQ2A 4OF0A 3SE8L 4KQ4L 3VJ6B 3EFDL 3RIAF 4LSPL 1RIUL 3KDMA 4G7YH 4NYLB 4S2SB 2DIAA 1F6AA 3PXHA 5D6CA 4M5YL 3LPWA 2BNQB 2H1PH 2R1YB 5GHWH 5D7LD 3KYKH 4Y89A 4QRQA 5EU4A 4YFLF 5F1NB 2IAMC 4MJ6A 2DD8L 5IWLA 1I1CA 2P7TB 1I9JH 3FJTA 4DZ8A 1BZ9B 4L8CB 3TNNB 3UJTH 3UTTB 4LSSH 3U9UB 3G6DH 1S5IH 1JYVA 3DVNB 3QDGA 3QPQD 4R0LB 2WUBL 3MV01 2NX5A 5GGRY 1CCZA 4K8RC 3V5KB 3LKNA 5HBBA 5ECJE 5E24E 2XWTB 1DBAH 1ZXQA 2VAJA 5HHXH 5DRNA 4GQ9L 4H0HB 3AB0B 4G8EB 5SV3A 3WNLA 1E6JH 1A8JH 4GKSA 3N50A 2E6QA 4PJGE 3NCFB 1AE6H 3O8XB 4JM2D 1FH5L 4XBGA 5CD5C 1F11B 1RUAL 1RZ7L 2APTA 4HV8B 4GAFB 3W11C 4OAWB 2OS7A 1MFNA 3B6SA 4P48A 5E9DB 1WGOA 2VXSL 1JRHL 4MNGE 4RBPK 3CSBA 2HWZL 1MHEB 1MFEH 4WEBL 4BSJA 1PZ5B 5KTEH 43C9A 1KBGH 1NLDH 4X98B 3MPCA 3P30H 3LRHA 4U1NA 3QUXA 2PW1A 3NAAL 3MACH 3MRCB 2A73B 2C26A 4WFHE 3LN5A 2CIIA 4JZJC 1FVDA 1WISA 4QEGA 4PJHE 2D9CA 2VDNH 1CD9B 5ENWA 1OHQA 4Y4HD 4G6ML 1HWHB 1SM3H 2VABB 2DBJA 3AAZA 5C9KA 5DUBB 3X3GL 2BSRB 5BS0A 1EMTH 2PTTB 4K55A 3GMRA 4HDIB 2NX5D 5F6IC 3ZSSA 3VXOB 5J1AA 1BX2A 2QEJA 4GUPB 1ED3A 2ZPKH 3F6LA 4UQ2A 3THML 3BH9B 2NMSA 2QR0B 1G6RL 3CJJA 5FK9B 3ZE1E 3W2DH 1FN4A 3UMTA 5E6ZA 1UYWL 4TTDD 3IXAA 4YAQA 1HSBB 1QG3A 1H0DA 2BDNH 1EUUA 1H5BA 1G9MC 4PLOB 3LHPH 3PDOB 4Z0BH 2AQ1A 1I8KA 2Q3AA 2EKSB 4EUPB 3OB8A 4WHTA 1ZANL 4R97C 1RHHA 5C70A 5EBLA 4FFYL 4HFUL 3VFVB 2DQTH 3QUML 4D0BA 4JDZB 5IM7B 1KCSH 1LMKA 3VGFA 1MAMH 1MFBL 1YMMA 2EDBA 4JVPA 4X7FC 1NDMB 3T65A 5DHXB 4NFDA 1LDSA 3TZVA 3VWKA 2BY0A 2P5WE 4O4YH 4X5LA 4O2FA 3WXWL 4GAJH 4YHOH 5BS0D 4HWZA 4Y19E 4PUBH 2ORBL 1ZGLP 1I4FA 3L7FB 4ZNEE 2W0FB 3MYJA 2LVEA 4U1HA 1MRDL 1VPOL 4ONHB 5C0JB 2VXQH 3HG1B 3T0EE 3TEUA 5DFWH 2MCPL 2VMFA 4UV4L 3VFWA 4X7DC 1B0RB 3B9KC 1YJDC 3K8LA 3FRUA 2DKMA 2RCSL 4MCYA 1WCBB 2N7BA 5GGSB 4DN3H 1F6FB 2KBGA 3FQUB 3MC0A 4P2OD 1ZVYA 4OF6A 4H0GA 4O2CB 1J8HE 5L2KB 4LVNC 4PTUB 4DKEH 3QFDA 5D2NE 4QRRE 1QFWL 2OK0L 4ODUB 5ADOL 2OXGA 2AJXL 3DHMA 1KELL 3DX6B 4Y2DB 1TZHB 2D4DA 1RZ8B 3L3KB 3QEGL 2HTLD 3G5ZB 5I1AA 4AK1A 1KC5L 4BZ1L 3K8KA 3QNYB 4HUWA 4BZ2H 3RWGB 3VWKD 1T1WA 3O6FB 4WWKC 2GAZA 3QQNA 1HH9A 2CKBH 3NA4A 4KI5D 1KGCD 5DQDH 1A7OH 1T22B 2NTFA 2VDRH 2HT4D 5GGVH 1KTDB 4LDOB 2FX9H 5AAWA 4MZ2A 3MV7D 4KMQA 1FFOB 2FGWH 4U1JA 2XN9B 3LKQB 3A6CL 1CDCA 2DWEA 1H3GA 3FQWA 2VWEC 4HC1H 1Q9OB 1BM3L 4YIQA 5AYUL 1XMWA 2XTJB 5AEAA 3QEUB 3W9EA 4U1LB 1S3KL 1BWMA 1VEMA 1JK8A 3ARDB 5DRXB 3PHOA 4NZUH 1FZOA 1F3JA 3SOBH 1ZLWH 4M61B 5IBTL 5I1JH 5K9OB 3WHXB 2V17H 1NGYA 4Z7VE 2NY2C 3VWJD 1HHIB 4P4RB 2Q8BL 1Z9OA 3ARBC 4HGWA 1VFUA 4GSDH 4CN1A 2Y36L 2HRLA 5F6HI 3T3PF 3TPKA 3LSOB 3P73A 3RWFA 1YUHB 3TO4A 4X6BB 5CINL 2BXYA 5MEPB 4HCRA 2EDHA 4NKDA 1P4BL 4KK6D 5D93C 3CVHL 4KRLB 5IOPB 4M7KH 3KLSA 3X12A 3P77A 3SE4A 4QXTA 2HMID 4TPRH 3G6JE 1L0QA 1I1FB 3GB7A 5TH2A 2E5EA 5HI5C 1CD1B 1FNGB 1XZ0B 3KLAA 1AQKH 2X9XA 3VD5A 2EDFA 1EHAA 1UQSA 2GFBB 3AREB 4MNGB 3TP4A 3VFNA 1HH6A 1J11A 1JFQL 1YNTA 1MHHA 1WITA 3OKNA 4XCEA 5L88H 4NO3B 2Y5TB 4JY6A 1HNGA 3NH7H 4GMSH 2P46B 5EZIL 4G43A 4N0FB 4HJGA 1KTLB 4X5XA 1S8DA 5FYKH 1JPFB 3O3EB 5IQ9A 5F3BB 2JCCE 1MCOH 3ARGC 1IGML 3CLFH 1WLHA 1A7QL 3SKJL 1TCMA 2NXZB 4PJHB 3VGHA 1CICB 2UYLA 2IAMD 2X4TB 4UT6L 1ZT4A 3LEYL 4HG4J 2RR3A 3KYAA 1EBAA 2B1AH 1UH2A 3TO4D 5TDOB 4LPXA 1EFXD 1KTRL 3S96A 1QKZL 3O3UN 3BKJH 2CLVA 1JWSB 2OSLA 4LNRA 5IESL 5IB3B 1I8MA 4J7RA 2AEWA 3MRNA 5GJTL 4LSQL 2HA1A 5JDJA 2UUDK 5CD5D 4QO1A 5K9KA 5DF0A 5ANMA 2C3GA 4JHAL 5SWZB 2ED8A 2ZCHL 1OP3K 1DBJH 3C2AH 3FO9A 4LEOB 2W60A 4JHBA 2VSDA 4I3SH 4G7YL 3BX7C 1NMAH 5EBMA 4LCUB 3SGJC 3EYSL 1C1EH 3MV9A 1N5AA 1C08A 2H1PL 4K7PH 4PTTA 3KYKL 4HZLA 5DK2A 3ZKNC 4YO0B 5ELIA 4BFGA 5D9SB 4KRPC 5FAAA 5KW9L 4TVPL 3MOQA 2AERT 4KZEL 2MPAH 4XVJH 5ALBH 1AP2A 4LSSL 1QBMH 2CRZA 2P5WB 4WO4B 3EYOA 5DMGC 4Y19B 4NHUA 3VG0L 1YPZF 3DX9A 9CGTA 3PXJA 5F3HB 5D72H 3QISA 5CWSB 2AABH 1L4IA 4JQIH 2E7CA 5DUPL 3UBXG 5E6IB 5IK3B 3ZLQC 3T0EB 5DZLA 1MCLA 2JJSA 4JDVA 1PY4A 1LGVA 1U3HA 1T03L 2DKSA 4R6UA 5E8OB 4HWUA 2CLZB 2ZCKH 1B0GB 1MFEL 3L1OL 4WW2F 3TFKC 4V3EB 5LXGH 1Z6JT 1KBGL 1I7UA 1LNUA 1NLDL 1R3HA 4LLAA 4ELMF 1DL7H 2XKNB 3QDGE 1V8HA 2LE9A 1FP5A 1J8HB 4XP4H 3HUJE 3SJVA 4APQB 2MTPA 3KXFA 1P84J 2FECI 5C09A 1OAKL 4CJ0A 1DQMH 4MXQA 2BSED 3MV9D 4KWUA 4X7SL 5D2NB 1HKLH 1QQDB 4QRRB 4J23A 5FKPB 4OF7A 4LSRH 4EBQH 1NEUA 1MIMH 5GRJL 1IC4H 3P9MB 4YXLL 4E5XB 3O4LE 4XH2A 1EMTL 2X4QA 2R2BB 2DI8A 4PG9A 4DFHA 1JZ6A 3EHBD 4WVRA 2GY5A 3CX5J 4WUKH 3LRGA 3F12A 5J4MA 4LQFL 3PGDB 4YFLI 4ZDHA 3ARQA 5IR1A 5JXAH 1UXSB 4KDTA 5B39A 1NCWH 1U3HD 4HJJH 4WIQA 5HY9B 5GGQH 2C3WA 4BH7B 4PJXB 5C3TA 5JA9A 4OLZL 1A7RH 2BDNL 1OAYL 1K4CB 3ARFA 3JWDC 3S35L 3OSKA 5GS1B 1K8IA 5E0QA 4K9EH 1DN2A 2BOBB 1VEPA 5CBEB 1CDIA 2A83B 1KLFA 2OR7A 3BRDA 1YY8A 1A3QA 3SJVD 1KF9B 3KXFD 4OLVL 4X0KB 4MXQD 3Q3GB 3QUZC 4LSVH 5FA3A 1TXKA 2D7MA 5D5MA 5CUSH 1T1ZB 1T20A 3BPNB 3S6CA 2DQTL 4ZNCD 2LTQC 4PRAB 2G9HA 4Z7VB 1WTGT 3S4SG 2YD6A 3LKSA 4XGZB 3IB4A 4LFHG 5DHVB 2J6EA 2V2TB 2B8OT 5J89A 1HHGA 1JNNH 4MA3A 4F2MA 1L6XA 4DVRH 1B4RA 2YUWA 4GAJL 3REVA 5FYJD 3UJJH 4P2QA 4HWBA 1JWUA 2Z9TA 4GAGL 4GLRH 4DVBB 4EI6A 5FUZH 2SEBA 3OGCA 4I13B 4L4TA 4HF5H 4TNVK 4AMKH 3STZA 1EZVX 4F9LC 2FSEB 4L4VA 1KXVC 4YGVA 4U0QB 2VXQL 3G6JB 2YWYA 4NQUA 3QIUC 3JWOH 1U8KA 4JFFE 1FG2B 1KJ2A 1YMME 5H94A 2R0ZH 3ARFD 3EO9L 1I1RA 4OI9A 4WJ5A 3ULVE 1C16B 3REWA 3ZKSD 4DTGL 2CQVA 3TYGH 3SE3A 2ARJA 3IJSA 1VADB 4M1CD 5D6DA 4GT7A 4I2XA 2J8UF 1XEDA 1FNEB 2JCCB 2NY1D 1EPFA 3BKCH 5L2JB 5D1ZA 5LCVH 1E27B 4XC1H 1NGWB 4GS7B 3KNBA 2W38A 1DBKH 2M8XA 4JG0H 2V2XB 2X6MA 3QDMA 5F7DA 4BZ2L 4KROC 5IW1B 3K3QA 1KCKA 4IIQA 2OBGA 3MJGX 1SVZA 1XIWC 3WIFA 4NPYB 2JB5H 4PFEA 4P2QD 5DQDL 4I9WD 1A7OL 4BQ6A 1QZ1A 3IDJA 4S11A 2GSGA 3O6LL 4G7VH 1KJ3H 1VFOA 4L4TD 3MJ9L 2YZ8A 4L4VD 2D03L 4OGZA 2FX9L 5C8JA 4KTEH 5EORH 3QSKB 5KG9A 2F5BH 3ULUD 1EO5A 1A22B 2Z8SA 1GZPB 5EOCH 5HI5D 3QUKA 4GRLC 4EKXA 3C09B 4L1DA 3JV6B 4AT6B 3S3PA 1A6UH 2Q86A 2V9QA 1AY1L 3F5WA 4PP2A 2C4FU 3QIWA 3C08H 3G5VB 1YEGH 5BW7A 1QOKA 1T1XA 2XPGA 1IKFH 3I02B 5TF0A 4N8PA 3GMMA 3QXVA 4NZUL 3HI6H 4HIJB 3SOBL 4XNZB 3O11A 4PJ5D 5BVPH 1JF1B 3IYLW 3TF7C 4LDLB 4JM2B 4S10A 3RWCA 4OF3A 3RY4A 3MLRH 5H35A 1OGTA 3MRHA 1WCQA 3QDMD 1EEUA 4HS3B 3P4OA 4ZAKA 4CDHA 4AIXA 4HWEH 3PJSB 4OUUA 5CGYD 2GK0B 3CFJA 3T4YA 1WBXA 4ZFOB 5IEKA 3IDUA 1E4KC 3V6OA 2JLLA 3FKUS 5C0BA 3KDMB 4GRWE 1F6AB 3ELAT 5D6CB 3O3BA 4XNUH 1CGXA 3T08A 3TCXA 4AJ0A 1NAMH 4X4YB 3QNXB 4LHJB 4QRQB 1AQKL 5J1TC 3VRJB 1EDQA 2D7QA 1F42A 4X7TA 3QIWD 5FHBH 1IGFH 1SEBA 2WWMC 5L88L 4OSUH 3WFHA 2EEAA 3QDGB 4NM4H 4P23C 1C5BH 3HUJB 5BOZG 4NJ9H 3QA3A 3M8OL 3SGDH 1MCOL 5DRNB 4JO3H 2RIKA 3WSQH 1YYLL 5DURD 4XBGB 5IT2L 4OGXH 5EH1A 4J3WA 4PBWD 4CVWA 4LASH 5ACZA 3B6SB 2GJ6D 3GSUA 3PE9A 4Y16B 4LCYA 4GKZA 4YHPA 3KWWA 3VXPA 3O4LB 3CMOL 5F7MC 1PQZA 5FEBA 5L8JB 4X8JA 1JGDB 5TDPA 1UKSA 3OJ2C 4U1NB 2R0LH 3QUXB 3M07A 3O2DH 5C0BD 1GHFL 1MFDL 1CGTA 2PW1B 1CDJA 1I9RL 3DETC 4IBLT 2IF7A 3LN5B 2CIIB 2X1PA 3CUPA 2OCFD 4NQEA 1FVDB 3R8QA 5I1LB 2AK4D 1A6ZB 1FIEA 4R7DA 1X7QA 5ENWB 3M45A 5E1HB 4RAVB 3TFKD 3IDGA 4I3SL 2LU4A 1ZHNA 2DLIA 3GMRB 4MQTB 5F1KC 3ALWA 1C1EL 1BX2B 4K7PL 1ED3B 1GJIA 4UQ2B 5C92A 1EHLH 4ZPTB 4PG2A 1W0WA 4RMUA 1D9KA 1FN4B 2KPNA 5F7YC 4LAQH 4UV7H 3LEXA 5ANME 4XVJL 5ALBL 4LLUA 3MRJA 1FL3A 1H5BB 3GHEH 3PHQA 5IP4A 1S5HA 2EZ0D 3HR5A 3LPFA 1I8KB 1X5IA 3Q5OA 3RI5F 2E7LA 4WHTB 4JQIL 5E56A 4AIOA 5EWIH 5E08L 1RHHB 4UIKL 2LV4A 2Z4QA 3GSRA 4OCLC 1ZGLA 4JFFB 5CGTA 5F9JB 5GS0L 5JDSA 1YMMB 3T65B 1CFVL 4LHQB 2ZCKL 1RD6A 4KKAC 1KCRL 3TZVB 5LXGL 3VWKB 3LEVL 2J8HA 3MRGA 3QFJA 3H8NA 4DUXA 3QQ4A 2WZPD 4XP4L 4G8IB 4L3EA 3SO3C 3L3IA 2E9BA 1I4FB 1Q9LA 1HKLL 5T3XL 3RL2A 3MYJB 4U1HB 3VMPA 3MMEA 5DK0A 4LSRL 2QSCH 3D87B 1D9KD 1YEEH 2C5DC 3EYFB 1JMXA 1MIML 2OXHA 3AS0A 4GRMA 1TZIA 5CILH 3SKNA 1FGVH 4FZ8H 3MA7A 4K3EL 3FFCA 3ZDYE 1HN1A 2Z0BA 4XWOD 4E41A 4X99A 32C2B 3FQTA 4QF1A 1PG7H 2DN7A 1EIBA 4N8VA 4WI7A 3HMXH 4U0RC 4WUKL 5ERWA 2AK1L 5C09E 1M6OA 1F3DH 1HEZA 3EZJB 1N3NA 4FQ1H 3IU3A 1CDUA 4YQXH 1NCWL 1AH1A 4NOBA 5CSGA 4PIRF 4V1DA 3TBSB 5ACMA 3WKMH 3VGGA 1G6RA 1G0DA 4HUWB 2NXYC 1VGEH 4RMWA 3DXAD 4FFZL 2GAZB 1HH9B 4CMMA 4L3ED 4LSVL 3TYFA 2DQUH 4MAUH 1FNAA 2XWJA 5CUSL 2NTFB 2Q7YA 5KSBE 1RZFH 1U8HB 4UUJB 1YDPB 4OM0L 2CK0H 5IROA 5F8QC 4Z7NE 3EO0B 4U1JB 1YNLL 2YS4A 1BBJA 2ICEA 4KROD 1JNNL 3MRFA 2V5YA 2H6PA 3QUMA 4DVRL 3M17B 1JP5A 2I5YH 2H9GB 4DKAA 5DD1H 1DBMH 4KXZH 3W9EB 3FONB 5FUZL 4BQ9A 4HF5L 3MUZ1 4ZO6A 1DEDA 4WI2A 3IF1B 2A2QT 5FGCE 3PGFL 3K1DA 1F3JB 5D5ME 5C0GB 5CD3A 3JWOL 1NGYB 3WMSA 3GMOA 4F7EA 4OT1H 4V1DD 4XI5D 1A4KA 1YEDA 1LP9A 1Q1JH 1U95B 3P73B 3RWFB