3VXNA

Hla-a24 in complex with hiv-1 nef134-10(wt)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 79
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxnA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxnA01
5GGRB 1TZIA 4WGWB 1OAXL 5GGRA 2VDPL 3UAJD 1ND0B 1JGUH 3QHZH 4F8TA 3TWCL 4X8JB 4HV8A 4R8WH 1WIUA 4PB0H 4ZOEA 3QO0A 1II4E 4KK6D 3SGDI 2VXSH 3T2PA 1DEDA 1I8LA 1YMHB 4X7EC 1YEHH 1RIHH 1CR9L 1ED3A 1P2CB 4PFEA 3R4DA 2RIKA 2VUOA 4BYHA 2EYTA 4NM8L 1U8QA 1PJ9A 4PRDB 3QIBC 5C7XH 4KU1A 5IOPA 1GJIA 4X6FA 1N6VA 1QFOA 2VDPH 5FM8A 4M4PA 1P4LA 1QO3A 1KJ2B 4P5TA 5D1QB 3TWCH 3ZE0F 1UCTA 3FFCD 1R5WA 3LH2L 3MLTB 1K4CB 4FTVD 5HVHC 1JGDB 1JPTL 3SDXE 5E8OB 2EDBA 1CR9H 5E8OA 4YFLF 1LO4H 1A7NL 4FFVC 3S4SG 3MOQA 3G5XB 3T3MF 5BS0E 3G5XA 2VLJE 3T0AA 4NM8H 3LOWA 1XEDA 2J2ZA 4YGAB 4PJ8C 1OF2A 4XAWL 3PWVB 3WO4B 3U6RB 5LGHL 5CEYB 2WWMC 3PWPB 4QTHA 5D2NB 5CEYA 4Z77B 1OW0A 3HPLA 5IB4A 3VMOA 5LWYL 2DD8L 3LH2H 4MQTB 1R5IB 2D0HA 3SGJA 1R5IA 5K33A 1A7NH 1A2YA 1QLRB 4WHCA 1W72B 2ZSVA 1I3GL 1NMBH 5E00A 5E6IA 3CZJA 5AWNH 2ZCHL 5I1DA 1MSPA 5LQBL 2QQQA 5LGHH 4TNVF 5CHNB 5CCKL 2C4FT 1I85A 2CGRH 3TNMA 1P5UA 5DC0A 4G8FB 2UYLA 2E7MA 4GQPH 4XP1L 3EHBD 4G8FA 2FH8A 3KLAA 4MS8D 3ZTNH 2J8UB 1NCAL 4JFED 5D5MA 2BZDA 5DRWB 4PJDE 2R1WB 2R1WA 5HHOB 3BH8B 4JM2D 1I75A 4XPBH 5F7HA 5LQBH 1U92B 3CCHB 4Y4FA 3BN9D 4JKKA 5CCKH 2L0DA 5SX4I 2P1YA 3QCVL 3V5DB 2XZCL 2JJSA 4U7KA 2Q8AL 2MSPA 4MSWB 5GISH 2X9XA 4NKIL 5EA0L 5GIRB 4TYUA 5EU3A 5I9QB 4W4NA 2IPKA 2E8ZA 4Y88A 3NFSL 2WNGA 3DV4A 2YSSB 2QADC 4MX7A 3BPLB 2VSCA 3HZVA 4FOMA 5CJOH 3T77B 3QFJE 2F19L 3QCVH 3O3UN 2W9DL 2XZCH 4RFNB 3I9GH 3MREB 2Q8AH 4GRLB 4GKSA 4D94A 3P0YH 4NKIH 3B6SA 3BPCA 3SGKA 2C5DC 2L7UA 3BWAB 2COQA 2YPLD 4OGZA 4GLRH 1G7MA 1CXEA 2OTUA 4LSQL 4RWYL 3J7HA 1WBZB 2NXYC 3P9MA 4JFDE 1RZFL 2DQGH 5DMIL 5IB3B 2IH1A 1KCLA 3GHEH 2XZAL 3SHSA 1AE6L 4AIXA 3BQUC 2W9DH 3HC0A 3MTRA 3DO7B 3LRGA 4JZJC 4KKAC 4MMXC 4WFEE 3C8HA 4JVUA 1T6WA 4HBQA 3EZJB 1MEXH 3RVUD 1B0GA 1OGAB 1QFUH 3H9HA 3LQAL 3EOAB 4LSQH 4RWYH 4O5LL 3WDHA 5FF6B 4Z0XA 1KCKA 5CFHA 3W11D 4U6XA 1RZFH 5DMIH 3VD5A 4CADB 4G6AD 4GKOA 5E1HB 2B4CL 25C8H 2XZAH 1AE6H 1LEGB 4AK1A 3VCLB 1A6UH 1F58L 5BVPL 3FRPG 3D85A 4PLOB 3MV7A 3T0EA 1GZQB 2B5IB 1N3NB 1GZQA 1J8KA 2C7UB 5ISZA 3LQAH 4CNIA 1RU9L 3NOIA 1FC1A 5ITFB 2QQNL 4EDWL 4I9WD 2DQDL 2C3VB 3KYOA 4GW4B 3JTSB 1YPZE 2B4CH 2PTVA 1K4DB 3TEUA 1K3IA 2HLFC 4GRWE 1A64A 2EEAA 5DDHB 3D39E 4AEIH 5JW4M 1F58H 4WW1A 5C92A 2CDEB 5JOPE 4ZTPH 4OGYL 4GBXC 3GSWA 3C6SA 1AR2A 1MRFL 4H20L 3IAQA 1JF1B 4DZ8A 5EDXA 1CGYA 2E9WA 3CFDB 1RU9H 5AYUL 2RB8A 5CZVL 5D7JC 3AREB 2RCSH 3RUGA 3TPUB 4PJXB 4KRPD 1XH3A 2ITCA 2R23B 3UTSD 4PRIB 3WD5L 2XFXA 5IFJB 3QPQD 4JEGB 1YQ2A 2EDHA 4LCUA 3MRKA 1MRFH 3QWOA 4NO5B 1BIHA 5D9SA 1FFPA 3QCUL 1DP0A 4Y5VB 5AYUH 3BIBX 4Y5VA 4DQOH 5FYJU 5FCUH 2VLJD 3VRIB 2DYPD 2CDGA 3WD5H 1DBAH 2IG2L 3LZFL 3HCVB 4P23A 4ZAKB 4UU9B 5DSCB 4PJBF 2A6DB 1BMGA 3FOLB 4PJGE 5DSCA 1QSFE 3V8CA 1RZKL 1Z3GL 4IHOA 1DN2A 3QCUH 5LGJB 4OCWL 3IDYB 1P4IH 2JJTC 1WUNT 3IXTB 3BD5A 1KNOB 1XGRA 5I73C 4WU7B 3MRPB 1R3JA 4F9PA 4EBQH 1T4KA 1LP9F 4Z5RB 3TO2A 3O3AB 1U9KA 2IG2H 3LZFH 2JK5B 5L2KE 5TFSH 2OI9A 3C5JB 4A6YA 3E6FB 2BNRA 5J12C 1KB9J 3P4LA 4M3JA 1NAML 4MD5B 2VZOA 3TCLA 5BZDB 4QRRB 4QXWA 1Z3GH 2IAMA 1AQKL 3MRFB 3PQYA 4XP6L 4ZPTB 3MRFA 3HFMH 4K3EL 3DROA 5JNYB 1J12A 5D1ZB 4ZNCD 5F7LB 4B41A 3SO5A 4PJFB 5E1AB 4Y4KB 1AIFB 3QQ3B 3EBAA 5E1AA 3ZKQD 1AIFA 2DLHA 3ROOB 2P8LA 3QUMB 3RNKA 3OG4B 2AVGA 4E41D 3ROLA 1NAMH 5GJSL 1J88A 5GS2D 2D7NA 2GW5A 5BVJB 5CIPB 3RBSA 2HKHL 2W1NA 4I18C 1F2QA 3UJIL 1AQKH 3OKMA 2GHWB 8FABA 2DQJL 5H37G 1AHWA 4ZSOE 3K2UL 2UWEB 4QHLA 4JE4B 4KZEL 4UDUA 3BN9C 1KLGB 1M7DB 1XR8A 5ADOH 5E2TH 4LLQA 2DQFB 3SKNA 5C08E 1AQDB 2YPKA 5C0AE 5KZCD 4OBRA 3MMEB 1DANU 2Z93B 2Z93A 4P2QB 3O8XA 1JPGA 3OF6A 3QXAA 3V5KA 3QXTA 2HKHH 1H9VA 3GMPB 3P73B 1G9EA 4XP4L 2AJZB 2R2HB 4CKVX 1X5YA 3WEXA 1EA9C 5D2LA 4DJMA 4X80H 3K2UH 4HIEA 1BX2B 4RAHA 4PGCA 2I24N 4OKDA 3WKMH 5F8RC 1Y18A 3DARA 1JPFA 2BVPA 3GSXA 3QULB 5B38A 2IMNA 3I6KA 4JVWA 1D3CA 2WIIA 5D96C 5TGBA 1T1WA 3X14B 2BY0A 1NFDF 2WK2A 43C9A 3U7AA 3BIKB 1PZ5B 3BGFC 4WFED 4HAFA 1PZ5A 3OR7B 4YHKL 1OB1B 1S9XA 2FO4B 4QRTB 1EO7A 5M95B 1BZ7B 1V7NL 1MPAL 3DVGA 4BQ8A 4POZD 5ANMA 3NCJL 4HFUL 4YO0A 4TQEH 2C3HA 2UWEF 4PJ9D 1QR4A 5EOCJ 2J7LA 1P7QD 4ZUSA 3B43A 1CL7L 2Q7NA 2X5PA 5I2IA 1U8MB 4AIOA 4X0KA 4YHKH 5C9JB 3EO9L 3GMQB 2W91A 3GMQA 1FQ9C 1UQSB 3EFFB 4HK0B 4YNYB 5T1KD 1V7NH 4BFIA 1FYTB 1Q72L 5GJTH 4G6AC 4Z8FH 3KPPB 3VA6A 4DTGL 1G9ML 3WJLC 3NCJH 3MV8B 5EUOE 2JTDA 3DX9A 2JCCF 1A1MB 1A1MA 2ZPKL 5F9AC 3D39D 1NL0L 1CL7H 2HRLA 3VFRB 5JOPD 4C56D 4UTBH 1C5DB 4QCIA 3MLSH 3B9KC 4UIMB 4ZFOA 1D9KC 2BVOB 3EO9H 4JFOA 4UIMA 1IGCL 5JORA 5EIIB 5IHUH 5I1JH 2VLMD 1Q72H 2D0FA 4JFXB 3D18A 1DLFL 3ZYZA 4ELMA 5EORL 4DTGH 1D5XB 2FLRT 4UAOB 4NHCL 5C07D 1D5XA 2G2RB 4G9DA 1JNHA 3PUCA 2G2RA 4O2CB 4O2CA 4K7PY 3V4VH 3HKFA 1FVDB 1CFBA 4F3FA 1FVDA 4H1LB 2C1PB 2QQKH 3PL6C 1NL0H 1P69B 4WV1C 4WO4C 4XPFH 2NQCA 5KS9F 1HQRA 5MENA 1Z2KA 3GHBL 4D0DA 5KSBE 5B8CB 1IGCH 5KSAD 2VDNL 3ETBF 4KKLC 5B8CA 2EC8A 5MERA 5BRZB 2YN5A 5E9DE 5GGRY 2CLZA 1DLFH 2X9YA 4XCEB 4YDJB 3VXQB 1AC6A 2HJLA 2X41A 1E6JH 4QHNA 5DEGA 3P4OA 4F7TB 5IHBA 4F7TA 3L5WB 1ZK9A 1FLRL 1B6DA 3F6LA 3TO4B 3U79A 1ZA6A 1NBYB 3G04A 5E2UL 3VXSD 4XH2A 3MBXL 3T09A 3MJ8B 5E0QA 3G08B 1Z5LA 4O4YH 4YPGA 4U1LB 2HRPL 3G08A 3VXTA 3C09C 3DHJA 3B83A 2CIKB 1EJ6A 1FFNA 2A74B 1MCQA 2VDNH 2E9BA 3S35L 1KEML 5IHZB 1UKSA 4L8SC 1CICD 4HS6B 4HS6A 3VH8A 2YWZA 5C2UB 5AAMA 3CDYA 2B0SL 1XR9B 2OZ4H 2BSRA 3OJ2C 1FLRH 1NUDA 3VFSA 3VXUD 3VWJA 2GITB 3GBNL 4OCNC 1ZGLM 4ESKA 5I1IL 5L8LB 4H0GA 1EEZB 5E2UH 1FLTX 3UTZB 4ZFZB 3V6BR 2B1AL 2W92A 4LDOB 2IPUK 4X6CB 4TVSa 2DM4A 2HRPH 5GZND 4IJ3C 4YHIA 4YHPB 1TXKA 3WUWA 3HG1A 2HFTA 3EJYD 4YHPA 1YUHB 4WUUD 5CINL 3S35H 3O3BA 1KEMH 4PJCB 3INUL 3FMGL 4OD3L 1U6AL 2BNQB 5KVEH 2ADIA 4FXGA 1JZ8A 3EW3B 4NRZA 3V7AG 4ORGA 1EMTL 2B0SH 2B1HH 4JFFA 3QQ9D 4TUOB 3FQTA 1WBXB 5I1IH 2HTLD 1WBXA 3QAZB 2APXA 3HS0B 2IANA 3FB7B 4X9HA 2UY6A 2BVQA 3QB7C 5CINH 1V3KA 3FO0L 4PTTA 4R90H 3INUH 2VR5A 3FMGH 3KAAA 4OD3H 1AXSB 1UB5B 1KPVA 3V52L 1IARB 2H2SC 1OTUD 4ZDHA 1EMTH 1X4XA 2FGZA 3ILQD 3S36L 4GMSL 4IRZL 1F4XL 2IBBA 5DVKA 1SY6L 4X6BB 5C0AD 1UEYA 1CT8A 43CAB 3CVHA 4J4PD 1RUML 1OP5H 3GJFB 3FT2B 5ACMA 5EO1A 3FT2A 3HI5L 4TOYL 4PGEB 3RWEB 3PNWA 1OP5K 3WNLA 1A8JH 3V52H 4J6RL 3T0VA 4CW1B 2F8OA 2R39A 2OQJB 3V6FB 5F6IB 1F4XH 2XRAH 1HHHB 4ONGL 4R4FL 3EDKA 4PJCF 3T4YB 4K7PH 5H8DA 1RUMH 4LPYA 2I5YL 2Y5EA 2NY2D 2X6MA 3I75A 4PTUB 1U8NB 3HI5H 3O11B 5EZJA 3RL2A 4GKNB 1VFOA 4QXGH 5I74B 2FR4B 3RHWK 4D9RE 5DUPH 1N4XH 4AM0A 2O5ZL 3LKSB 2FYYB 4H88L 1MHEB 3NZ8B 4X4ZA 4ONGH 1WGOA 3O6FC 2JIXA 3L3JB 2I5YH 2R2CA 3L3JA 5B22A 5J1AA 1MCNA 3BKJL 4HUXB 2IFFL 2NXZB 1JWMA 1KB9K 4LNVA 1LK2B 2NY0D 3DTXA 4KTEL 3ZHKA 5SV3A 4N0UB 3FHAA 1KCGC 3UDWA 2X2YA 5I6XB 1VFBA 2FEEI 3Q2CA 3VGAC 2O5ZH 5EN2A 4I0PB 3MV9D 4H88H 3VWKD 1IMHC 4P46D 2A1WH 1KJ2H 4FQXB 5LAXA 5JXED 2DI9A 4TTGA 2IBGA 3X13A 1PKQE 2D7QA 1UM5H 4X9GA 2LABA 5FO8B 2PUQT 2HWZL 1C08A 3BKJH 3S3JA 2IFFH 3MPCA 4G8GE 4Y5XC 3SKJL 2PYEA 1MELA 3QIUC 1ZHKB 4DN3L 4KTEH 1JUFB 2YA0A 3U4AA 5FGCE 2MMXA 1NKOA 3FN3A 4NBZB 2FIKB 4OZHB 4WI5A 5ICXB 4F8QA 1DL7L 3C60B 2FIKA 3EYVB 4ONFH 4OZHA 1QPXA 3CNKA 5E5RB 1ZSDA 3LPGA 2FLBT 3L7FB 3RVXC 3L7FA 4H1LG 2E6PA 5IFHL 4WTXA 4IIQA 5DMGD 3SKJH 4NO0D 3OJMB 3STZB 1RIUL 4DN3H 4NJ9L 2AJ3B 4K9EH 3VRLE 4ZPVA 2A0LC 5A43C 3VGEA 1DL7H 1AGCB 4LNRA 1IGFL 5JZ7D 2NNAB 2VLKB 2CRZA 4EN3A 2VLKA 4Y0GA 4K2UH 2HMID 5EOCL 4M7LH 3HNSL 2H9GB 3EOBA 2AK4B 3U7WH 2V17H 1FORL 5D7IB 2ICEB 4UV4L 4LRNL 5ESVB 3ECBB 1RUQH 5KN5A 2QEJA 3LS5L 4NKOA 1BFOB 1AO7A 4AYFA 5DJ0B 1INDH 3L5JA 5DJ0A 3R0NA 1ITBB 4CVXA 2C26A 2P5EA 2YD6A 1IGFH 4N9GB 4GW5B 1FZMB 1S9YB 3BUYA 1FZMA 1S9YA 1KTRL 3PF2A 1G7LB 5EOCH 1X7QB 2AQ1A 3GKWL 3QUYC 1KSRA 3HNSH 1M71B 3T65A 1KYOK 4OM1L 3RTQA 1FORH 2R8SL 3VXNB 4UV4H 4LRNH 3RVWC 3SKOA 4OGAC 4NZDA 3GSVA 2HKFL 1MIMH 2VDMH 1QKZL 1JGEB 2GYSA 3U0PA 1EHXA 1XGTB 3UPCA 1W0VA 1OD7A 2EYRA 3ABZA 3LEXA 4ODWB 5C70A 4NO2A 1A3RL 2HVKA 5FYKH 1AGBA 1C16B 2C3GA 2R2BA 3JWDC 5ETUA 1JF6A 5E6YA 5KG9A 4W81A 4XBEL 3MJGX 2R8SH 4N8VA 1RZIB 3OKEB 2IQ9L 5ERWB 3U0TA 4RMQA 2HKFH 3FL7A 1F5WA 1U3HB 3EJYC 3RI5F 3B5GA 5CBAB 4NYLB 1MVUA 5IF0B 5CBAA 2J88L 4ZXBD 5D7IF 1Q0XL 5F3HB 3ARBC 2IH3B 3ZLQC 1BVKA 1F45A 1KOAA 5F89A 1YN6B 5B3JE 1IQWL 3TBTB 3R8BB 2ZOLB 4PP1D 3VFVB 1FBIH 4O2FA 3HE6D 2AJSL 1YEGL 1SJEB 5C0JB 4POYA 1SJEA 5DQJB 4GG8A 35C8L 2YR3A 5C09B 5C09A 3RGVC 4NP4L 2J88H 1Q9WB 1F11B 1Q0XH 3RVVD 1Q9WA 2A6KA 5CD3B 1V7ML 1XGPA 2VIRB 4YGVA 2WBJD 5T1MA 1QSEB 5IMMA 3BT2L 2YHGA 2OR8A 1IQWH 1QSEA 4OLZL 3QG6B 2VISA 2KZ1B 3C5ZA 3Q6FA 4Z7VE 4J4PC 2AJSH 1QA9B 1L9MA 35C8H 4BQ9A 1QFWH 4XVJL 4BELD 1WEJL 4NP4H 1KIQB 1UH4A 3WFHB 4GFTB 1V7MH 1FSKC 4KMTL 3QEUB 3W0WD 1W8OA 1YN7A 1T5XB 2BDNL 3BT2H 4D9RD 4OLZH 2R4RL 1D6EA 4PY7B 4WENB 4AQ1B 1TJGH 5CEZE 2Z31C 3TT1L 3WIFB 4NQEE 3GMOB 4ZG1A 1MI5A 3WIFA 3ZYOA 2VDKL 4NSKB 4PPTA 1J5OL 5C6WH 5C0FB 3IDIB 3LB6C 4P49A 1WEJH 4WW2B 5TPWH 1PEZA 1GGBH 3CFJB 4GW1A 1XF3A 5C6TL 2NY6C 4KMTH 1FNLA 1DDHB 1EDQA 5HHQB 4FQPA 1KV3A 3ZKXB 2BDNH 1BPVA 1U58A 4GRMA 2R4RH 4PGDA 4Y16B 1ZV5A 5BO1L 2EC9T 1YQVL 1MH5B 3CX2A 2XG5A 2VDKH 4UBDC 1J5OH 2VN7A 4L4TD 3GB7B 1V3MA 2LU7A 1T1ZA 1X4ZA 1Y0LA 5IJVA 2ATKA 1DQQA 2V2TB 2ORBL 3KPQA 4X5XA 5EBLA 3O9WC 5D1XB 4KJYA 5C6TH 5D1XA 4Q6IB 3WJJC 1J1OL 5JHDB 5DRNA 4S2SA 1E27B 1A5FL 5DURB 2XKNB 1A14L 5JQ6L 1YC8A 3ZDZE 2ITDB 4NOFA 2GT9B 3FQWB 4YHOH 1KCUL 3ILPB 5IVXF 5BO1H 1YNKL 2X7LB 3FQWA 2DJUA 1VGKB 4RMSA 4A6YL 3DMMC 2APTA 3BHBB 2H8PB 5BMFL 3L5IA 1JZ5A 3MODH 4MAYD 4F7EA 5DK2B 2V5SA 3A0OA 5DK2A 2H2PC 2ORBH 4QXUH 1BWWA 3LQAC 1MRCH 4PRHA 2FWOA 4N90E 4K94L 4BH7B 3T1FA 5JQ6H 4BH7A 4MZ2A 4WW2F 2MCPL 4Y5YC 1KCUH 3PWPE 3DBXA 5D2NE 1YNKH 1G7IB 1G7IA 5DMGC 4A6YH 4N5EC 5EU5B 1RIVL 2FECI 4LCCB 1DBKL 4IRSD 5C0IA 4OLYH 2D4FA 2O26U 3IDJA 1J1XL 5ID1A 1NC2A 2BSSB 4M61B 1EO5A 2ZJSL 1AGFA 3EDDA 3UPRB 3LS4L 4P2RB 3UPRA 4P9HL 3DURB 4K94H 1ORSB 1I1AB 3LN4B 1TPXC 1GZPB 3LN4A 5FA3A 5LBSL 1GZPA 4H5SB 2MCPH 1BFVL 3VXOB 3TVMB 3IDNA 3NCYS 3PWJA 3BYTA 3DRTB 1RIVH 3FQRB 3QXWA 3KPLB 2BCKB 1JF5A 3HTLX 3KJ4C 5EH1A 1FP5A 5E8PB 4DOHB 4L8BA 1J1XH 4KC3B 4EQ3A 1BJ8A 2J8UE 2ZJSH 1KCSL 4XPHL 3TBVB 1NGYB 3LS4H 1NGYA 4BFBD 4P9HH 5HHOE 2CPCA 4X6EB 1DE4A 1X6NA 3V7MA 2Q1EA 2MQCA 4OZGB 1VEOA 2QSCH 4OZGA 5LBSH 3S37L 3U30C 4DEPC 1FH5L 2LU4A 2FCBA 3ARFC 2D03L 3FTGA 3S35X 4HWBA 1MUJB 5FUZL 9CGTA 4XPHH 1KCSH 2RR3A 2R69L 3BP5A 2AABL 1TCRB 3I85A 1TCRA 1PW3A 3IJYA 4HIJB 1QLFA 2DIBA 4HC1L 2BOBB 4P4KB 4Y2DC 1S7XA 1PY9A 1M4KA 3OKNA 3RWCB 4PLNC 5FYKE 3V8OA 3LVEA 3VD3A 1SVCP 2DQEH 4HUWB 5TF0A 3H8NA 1FH5H 2ICWI 2IADA 1C5BH 4JQXC 5JIPA 4L4VB 4LBEB 4MNGA 3CDFA 5FUZH 1TCMA 4LBEA 1AY1L 4ZXBC 1UWXH 3WS3B 2R69H 4YAQA 3MOAL 1XGYH 3OGCB 1OP9A 3L9RA 3BMVA 3V0WH 5DLML 3JV6A 1H0DA 3HC3L 3GRWL 3ME0A 4P4RB 4WFHE 2C3WA 3GSRB 3UEZA 3PV6A 2ARWA 3GSRA 1J8HA 1UWXK 4HHAB 4R2GC 3QEQD 1S9WA 4GMTL 5J6GB 3H9SA 3X3FL 2CK0L 1DUZA 5A2IH 1DVFD 5GZOD 5IKCB 3D5OF 3RWDB 5IKCA 1ZTXL 1R24A 1AY1H 4RMWA 2Y1VA 2NTFA 5MEPA 5EU6A 4ZOBA 3MOAH 2FH6A 3VXRA 2XTJC 1OGAE 4F33A 5DLMH 3IYLW 4LSRL 5DUML 1JI1A 4WGVB 1UT9A 1IKFL 2Z35A 2ZSWB 2Q7YA 4K7PX 3PXJA 3MR9B 4GMTH 4JCLA 2AJXL 5DJ8B 3X3FH 1P84J 1A0QL 4ZD3L 3EO1B 3MRRB 5DJ8A 4QHMB 3VG9C 1KF9B 4YR6A 1R0AL 4UT6L 1WAAA 1ZTXH 2CDFB 3HR5B 1DLHA 1GCFA 5C9KA 4HS3B 4QRPB 1MCKA 4N8CH 5FCSH 4FFEX 4QRPA 3OBAA 1SVZA 4RMVA 3LKNB 5D6CB 1RULL 3I3DA 4U3HA 1DUYB 1IKFH 3HC4H 4ODVL 1I9JL 2HJFA 4FRWA 5ADPL 2KBGA 1X5ZA 4UQ3B 3HPJA 1MFCL 3TZVC 5JPNB 2AJXH 2CIIA 1XIWB 3SJVB 1LO3H 1WTGT 3IU3A 3IDXL 4TSBH 4UT6H 4LKCA 4U1JA 5EZOL 3X11A 4LP5A 3X12B 3GSNA 4QO1A 3X12A 3IFPB 5AUMA 5CKAA 1FL5A 3DVFA 1INQA 3F7VA 2PXYB 2Z91A 5EIQA 1J86A 4ODVH 4TTDD 5E70A 1CQKA 4XCYA 3TPUE 1CIUA 2UZYB 3FZUD 4KGJA 1MFCH 4NFCA 4PJXE 4XC3H 4ACPA 5KOVC 4PRIE 4UT7L 5F1IB 4ETQB 4JG1H 3NGBC 2HJKB 4JR9L 3IDXH 5D1QD 3U2SA 2W0LA 3NFPB 4DKFL 2VQ1A 2W65A 3SDAD 1KPUB 1XGUB 5GRZA 1MJ7L 3P3YA 1XGUA 2Y07L 3KGRA 4LRIA 2N7AA 1RK0B 4B0MM 3UTQB 1JFMA 5FDWA 3ZT6A 4X6DA 1CDCA 5D5MF 5D71L 3BXNB 4JR9H 2P43B 1UXWA 1KIUA 5DRXA 5HPOA 1NC4B 2C3XA 3BZ4B 2OTWB 1IM9B 3FHQA 2QSVA 4WFGE 4DKFH 2R1XA 1UZ6F 5IMKA 2Y07H 3SE4A 5A40E 2EO9A 5I8KL 2BERA 1BAFL 3BZDA 1SBSL 1GRWA 2AXFB 5CZXC 4G43B 5IMOA 4MNQB 4XNMA 3V4PH 1CI5A 4M1CC 1MJ8L 3KPSD 5E8DL 4JFQB 5ALCL 1BJMA 3S7GA 1JYXA 4IRSC 4HFWB 2VR9A 4BSJA 2JLLA 4Q2ZB 3WFBL 6FABL 5HY9A 4Q2ZA 4TPRL 5GHWH 3QIBA 3RDTC 4MA1C 2X42A 1LEIB 4QRRE 1V3LA 3PQYE 4S0TD 5F88B 4Z7OE 4R4NC 5I8KH 1BAFH 4Y1AA 1C7TA 5EUKB 1HHKB 1L8JA 4POUB 1X5XA 5HHOD 2F53A 3IETB 3TYFA 4PJFE 1DBBL 4I5BA 2OLDA 3V7AE 2DLGA 2VZUA 3BW9A 3U1SL 4F7CB 4RISH 2F8VA 3H7LA 3AB0C 4F7CA 3CVHH 2ARJQ 3OX8A 3SDCB 2PW1A 4U1GB 6FABH 2NR6D 4TPRH 5CJQL 1VA9A 1KTLB 1X9QA 4KQ3H 5T3XL 1PFCA 2WQ8A 4JFPB 2DKMA 4MHHI 1CFQA 7CGTA 2YPVL 1J0YA 1MOEA 2UWEE 3I2CH 3OR6B 1F4YH 1H3PH 3MRLA 2HG5B 5C0CB 1DBBH 4Z7UF 4YDLC 3P9LB 1T5WB 3U1SH 1RMFH 1TVDA 2WMPA 4QRQA 1ZXQA 2BSTB 2X9WA 4M43L 4P2QE 4NNYA 4Z7WB 3BE1H 5CJQH 3MLVL 1KULA 5IEKB 1VFUA 4GRLD 5D2LE 3MCLL 2YPVH 5BQ7B 3D3VA 3W9EA 3RKDC 1F8TL 3MGTA 2UZXB 3MCKA 5IR1B 1IM3B 4RRPA 4RWHA 4ISVA 4WFHD 4OCXH 4YUEH 4LMQE 4NQDA 5I1EH 4PJAB 3GSQA 4CUCA 4JKPL 5ACZA 4X7TB 5IQ9A 4M43H 4X7TA 1EX0A 5GSVA 4O9HH 1UFUA 3IKCB 3U7YL 2CXGA 5E4IA 2PW2A 3KPRB 3MLVH 3GBLA 2CLVA 3IFNL 4OUUA 5T5NF 4ELKB 3V2AR 2FBJL 1LD9A 5CP7B 2WQRA 5F7EL 3RVTC 1Q0YL 2NYYD 1OGAD 4UT9L 5CJBA 4ODUA 4NDMB 4XVUD 4WNQA 4P2OD 2C1OA 4LAJH 3HR6A 3JTTB 1OWRM 1DVFC 3DRQA 1TTUA 4JKPH 3OZ9L 5F6HI 3SDDC 4LLWB 5E08L 3C9NB 1TTFA 1WK0A 4LLWA 1FO0A 1TJHH 5F97E 3CZFB 5DO2D 4PGJA 3WLWD 3FB5B 2FBJH 2R1YB 1Q0YH 4PGBA 3BWUC 3TIEB 3NIDF 1FYTE 1TVHA 4JY4B 4UT9H 4Z7WF 3TIEA 1U8JB 4HXBL 3P9WB 1QVOA 1C7SA 2VKWA 1IAOB 4OF0A 3RWHB 3OZ9H 3RRQA 3FO1A 3V6ZB 2EO1A 4OFYA 3PDOA 4PJEB 4TUKH 5E08H 1ZGLA 3QIWD 3QWRD 4LASL 5CILL 2Y7QB 3CSYB 3W39A 4PG9B 4JPWL 1TZHB 4MA8H 5LXGL 3QDGD 1AH1A 4NQVA 4HWZA 1BBJB 2NY1B 4HZAA 1BBJA 2DLEA 2CKBB 1T04B 4HXBH 1DQMH 5E2VL 4EDXA 3UTPD 3ARED 2OJEB 1TITA 1GPOL 1HDMB 3O41B 1NDMB 4PRNA 1NDMA 4PRID 3JZ7A 2AKRB 2NW3A 4G42B 4WU5B 2X70B 4LLDB 4EUPA 4FS0A 5IQ7L 5J3HD 4YBQC 1I8LC 2X70A 4X4YA 1R3HA 1FGVL 1QR1A 4U1HB 4JPWH 5F7WC 4NJAL 2FJGA 5LXGH 2P8PB 3PABB 5BRZE 3QUZD 4JHWL 3RX5A 3DX6A 3JV5A 2BY3A 4HKXA 3SOBL 3BJLA 5HBBA 4MDIA 4Y4HB 3PDDA 4NM4L 5ACLA 4E5XA 4FZEL 5IQ7H 4NQCB 1BBDL 5F7FA 3GI8H 5CEXA 3KR3H 1CFTA 2IJ0C 4PREA 4YFEA 4OV5A 4F7PB 4F7PA 5HGGS 3BZFB 1M7IB 1HOCB 4PJEF 3BZFA 3SOBH 3OKOB 3IU4H 12E8L 3OKOA 3WO4C 4GBXA 2Y06L 4NFDA 5D2NC 4YBLB 4UUJA 1KJVA 2E5EA 1P84K 3I3BA 4OJFH 3SGJC 3TIDB 1YEFL 4X6CE 4YFDB 1EFXA 3QUXD 1FNAA 4K9EC 1TJIH 4NO3B 1ACZA 3AVEA 4QRRD 4BKLB 4MJ6B 5AAWA 4PJCE 4QHKJ 5E6IC 3W5NA 4R7DA 2BNQE 1BWMA 12E8H 3AXLA 4HD9A 5MEQB 2Y06H 4O00A 2KUTA 4XGZA 3CDGB 4WTWA 3ARGB 3TGXA 2JF1A 4Y4KD 4MQ7B 2DQIL 5K9JL 1BGXH 2H6PA 1YEFH 2DWDA 1LQSR 1IVLA 1L7TL 2BHYA 2NX5B 3QDJA 3NA4A 3FFCB 1FNEB 3FFCA 2BY1A 4FTVA 5HD8D 4Y4FC 1F6AB 4U3CA 1ZHNA 2X4QA 2AXHA 3OXRA 2EE9A 2WW8A 4TSAH 3S97C 2YK1H 5KAQG 4WTZA 1Q9KA 2DQIH 1IQDB 2NR6C 3SE9L 5K9JH 1F3JA 2JJTA 4I3SL 4DFIA 4NZTL 4P2QD 1L7TH 4I77L 4PLJC 4WI2A 1I7RA 2FB4L 5F9WB 3DIFA 1VKXB 2VDOL 5I9QC 3K8LA 5MP6L 1EJOL 3C5SB 2FIRT 3F12B 4GXVL 1KLUA 3O45A 4FQHA 4RMTA 3F7QA 3K7UA 2QKIB 3FO2B 4OCSL 2QKIA 2AJVH 4F7MA 5EC2B 1ZVYA 3VA2C 1Q94B 4RFNC 1AGEB 3SE9H 2GAZA 2Q6WA 1OSPH 3F65A 1K9TA 4NZTH 4LLVB 3SGEH 1KPRB 1FCCA 4U6VL 2PO6B 1A6AB 3KPMB 1A6AA 5I30L 2VDOH 1JK8B 1UGNA 4Z95L 5MP6H 1EJOH 3SGDH 1EVUA 4LU5H 4GXUM 4GXVH 4Q74A 5F3BB 2P5WB 4JFEA 3TN0B 4OCSH 1CXHA 4GAYA 4XBGB 1Q1JL 3MLXL 3RP1A 4JM2A 4ELMF 3DWTA 3HNVL 4APQB 4U6VH 1NKRA 1I9RL 3BVNA 3B3IA 3P77A 4N0UE 3FO9B 5I30H 2DQUH 3TA3B 1CFNB 1E4WL 4X4XB 1L6ZA 4XVUC 4Z95H 5TE7L 4QY8B 4R6UA 4OF7A 1UVQB 4QY8A 4XPGL 5EFIA 4MMZC 2CSPA 2DJ4A 3QI9B 5GGVY 5EO9A 4YK4B 4CN4A 4YZFE 1OGTA 3MLXH 3RY6C 4TVPH 3MV8D 4FG6C 1G6RB 3BFOA 4PLKD 3EYSL 5EPMB 5ITBL 3HNVH 1NBQA 1AI1L 4X5WB 1XCTB 4X5WA 2MNUA 1I9RH 1XCTA 2B5IC 5GS1B 1CXFA 3BI9X 3C6LD 4IOFD 2BXZA 5M7QA 3QDMA 1VFAA 4OZHE 2YUZA 4XPGH 3BPNC 3DVNA 4P3DA 2XNAB 1GC1L 2W0KA 3BP6B 3HE7B 2YC1B 1OLLA 3BP6A 1KIRB 4OQ1A 2YPLA 4LDLB 3VFUB 5L2JA 3EYSH 3H3BC 4JHZA 1C1EL 5HJ3B 3L95B 3VFUA 5ITBH 1AI1H 3C8DA 5JTWA 3ULVL 4M6NH 1B90A 4LCIL 3TBWB 4ONHA 5GSRB 2JB6A 2AV7B 1A4KA 5FA4A 4QWWC 5BRZD 4YHLL 2VLKE 1TIUA 4FZ8H 4L1HA 3MRQA 4M62H 2FX7L 3HZYB 3SCMD 3EYUH 3HZYA 5MI0B 1IEBB 2AK4E 4XCNA 4JAMA 3CAFA 5D7IE 4AT6B 1C5CL 1C1EH 4HWBL 5TE4L 3SN6N 3MJ7A 3TO4D 3JV0A 3W9DA 3ULVH 3E1F1 4KJQD 2ZUXA 4LCIH 4JDZA 1E4XI 4QOKA 5SX4H 2YRPA 4OI9A 3GMLA 4YDKL 5DYOA 1I1FB 4Y5VC 4RAUB 2ATPA 4Q7DA 2DB8A 3DXAB 3BRGC 3MNVB 1JTPA 2D7MA 1G7PB 4M03A 2YOCA 3G5VB 3K2MC 4ZOCA 4YFLI 4P23C 1U8OB 2QSTA 1C5CH 4I2XB 4ZAKC 4HWBH 5TE4H 2NLJA 5IB1A 3B5TA 5JPMB 1TVBA 3GJEA 1HXYB 2AQ3A 2FBOJ 3M8OL 5CJ5A 4R0LA 3L3IB 1ZVSB 3L3IA 1NLDH 3QO1B 4QGYA 4YDKH 2OBGA 1WWAX 4KZDL 1IC5L 4H25A 2P8MB 1CE6A 2X89D 5JUEL 2GJ6D 1N26A 3PL6A 2BNQD 1SEQL 3H9YA 4OV6F 4L3CB 3ARYA 4IM8A 5GGVL 1S5IL 4NN5B 1KBGH 3DOSA 1S7RA 1XF2B 1NAKH 4KQ4H 4KRPB 5T1LD 5GS0D 3M8OH 4M7KL 4NHUB 3UTSA 4D9QE 2IAMC 1EBPA 4FNLL 1HH6A 2YD8A 4HKZA 1OTSC 3ZKNC 1SJHB 3T8XB 1YEEL 3JSSA 5D1ZC 3GSOB 4YDIH 5FO7B 2X1QA 1OP3H 4F58L 4JQIL 3SDXA 3MSPA 4WTZG 4M9OA 3WV0A 3MRCA 4XWOD 1DANT 2E27H 1AD9A 4MVBC 3ORJA 5GGVH 4HDIA 1S5IH 5DRZA 4R96A 2VLJA 4EI5B 4H26B 1FGNH 1F4HA 3L1OL 5JOFB 1A6ZB 3TNNB 4L8SA 1OP3K 4UTAL 4M7KH 1A6ZA 1AD0B 1BZ9A 2DYPA 2H32A 5C09E 3RIAK 1A1OB 1BZQK 4FNLH 2ICES 1AHWC 3BD3A 3GMMB 3MRHB 5HD8C 3GMMA 3MRHA 4K23L 4CMMB 2VAAB 3EYFB 2A73B 1QUNA 1QSEE 2EYSA 3P30H 3BGAA 4F58H 4HKJB 4AY0A 3VFTB 2AERT 5CAYB 4XT1C 5IJKA 5HDBE 4KVNL 5I76A 1S7WB 3O8XC 5F72S 2Y5TB 3L1OH 3GSNL 5L8KB 3A67L 5DJXB 1UEMA 2SEBB 1P7HL 3DX8A 5FYKU 2HT2D 2XXMB 1RZGB 4K23H 3QFDB 5JXAL 4JVPA 3B2UC 3PWLB 3QFDA 5IVNA 4U3XA 3Q5YA 1I4FB 4O58L 1IGJB 4KVNH 5K9KB 1IGJA 5DUBB 1MI5E 3BSZH 1MHCA 4PJDA 2OR9H 2HFEA 1J1PL 3A67H 3R06B 2LVCA 2VZ3A 3RZCB 3QSKB 1EEYB 3QDAA 5FGSA 4JPKH 5DK3A 4E41B 2BC4A 3IXAB 4F80A 5JXAH 1JMZA 1J0HA 1T0MA 2GTWB 3R1GL 4Y19D 3BDBA 2FSEA 4Q9RH 1RJLB 1VSCA 4UINL 1UWEL 4NC0B 3ZO0A 3FFDB 1JRHI 5IEHA 2PTTA 2O93L 5C6PB 4MB3A 1RI8A 3G6JB 1H3VA 4L9LB 3BPOC 2D3VA 4OM0H 1KJMB 3B9VA 4G80B 4L9LA 4PRAB 1NGZA 4E42B 4HPOH 1A7QL 3AAZA 5HHNB 5C8JA 3CFEB 1CG9A 3EYOB 3R1GH 4LVHB 5GRVL 5EO0B 4U1IA 5JHDE 2JE8A 3C60D 4HIIB 1XAUA 3OKKB 3BO8A 4PJHB 4UINH 1FL6B 3BISA 1UWEH 4HH9B 2HYMA 4TVPE 1OPGL 4IRJB 4PV9A 3VE0B 1E6OH 2LTQB 3M45A 2P48B 1T20A 3NA9L 1A7QH 1AXTH 4JFDA 1LNUA 3RNQA 1KELL 5CGYD 1IAII 5FYJL 4YWGH 1B88A 4W6YB 3BP4B 3ULSA 4IMKC 2X4TB 4MCZA 4DGVH 4TN9A 1ETZB 1FAKT 4KHTL 1HHGB 3H7BA 1CCZA 5GRVK 5DHYA 2ADJB 5JO5B 2AK4D 3BKCL 2Q87A 3CLEL 1P6AB 3KLHC 4KKCC 1Z9OA 4P57A 4BFGA 2GJZB 1PX3A 1RAMA 2GJZA 3NA9H 7FABL 5DJAB 4ALAH 1VACB 4ZQKA 5B8CC 2QQLL 1KELH 4PJ9B 5FGRA 3HZMA 4P2RE 3G6JF 1K2DA 1KCVL 1P7QA 4X7CC 4JRYB 1CDUA 4I48B 4CJ1A 4S1DD 5DD0L 3EKCA 1EBAA 1TDQA 3MACH 1L0XA 4RIRB 5DQ9A 3U9PL 3H42H 3SQOL 4LCWD 3DUUA 4RIRA 5T1KA 1N6UA 3CSGA 3TO4C 3N9GL 4HGMA 4U6TA 5GS3A 1EXUB 2D2OA 3GIZL 5T3ZL 4DOHE 3VI3E 4XB8A 5HI4C 4D0CB 3UJJL 1EAJA 3SPVB 1TQCB 1YPZA 4LPTA 2QQLH 5FV2A 5TH2B 4JN2B 2WUCH 1R5VA 3D39A 4OTXL 4C56B 5SV4A 1BVLB 5FECA 4OZGE 1HKLL 5EBMA 1QRND 2FZ3B 3SQOH 1IAIM 1IL1A 1WC7A 2R0ZL 1KGCE 1LO5B 3N9GH 3U4BL 3MNWA 3LKRB 5GGTH 3GIZH 5C07B 3LKRA 5T3ZH 4WIQA 3MRBB 3UJJH 4YXHH 2VLRB 3MRBA 4QRUA 1TENA 1O7VA 3TBYB 2VMFA 1U3HD 4FMKA 1NCUA 1F02I 2FX8H 4D9QD 5D7LD 2ICWB 1QFHA 2AP2A 4OTXH 1UACL 1LGVA 1W8NA 4OZFB 3FB6A 1MLCB 1R3IL 4YIQA 4YHNA 1MCOL 4GG6B 1MWAB 5KSAB 1NBZB 4GG6A 1G7QA 2R0ZH 1NGQH 5KSAA 5A3IC 4X98B 2W60A 1RHHA 1PLGH 5I1GH 3RWGB 1OSZB 1FO0L 1KN4L 4L4VE 4XHJC 2A83B 1WV7T 3TT3H 1KENL 2A83A 2XN9B 1TTGA 2P24B 2CLRB 4HPYH 4WDIA 1U3YA 3ZDXF 5HSFA 2GY5A 1SQ2N 1HNFA 3VXSB 1UACH 4QXTA 1J8HE 4X5LA 5J0BA 1QFWM 4PJGA 1MCOH 4GAGH 1QSFA 1K5NA 3FQUB 4F37F 5IMLB 1CICB 1D5ZB 3MA9L 5H94A 5IMLA 4V3DB 1U8LA 2I27N 1ZWIB 1FO0H 3FQNA 8CGTA 1ZWIA 1T83A 5K59F 2D7PA 2FRGP 3QZWA 5EU6E 4H0HB 2DWEB 4MDJA 3VXUB 2MPAL 3D25B 1N64L 2YD3A 5EOTB 3G5ZA 1VGEH 1H3TA 5L2KA 5EU7C 1U93A 3ALXA 4YH6A 4NN7B 2R2EA 5DTFB 5ESAB 1EERB 1MVFA 4S10A 2F74B 1U91A 3ULUE 5F6IC 3FOMA 4WUUA 3MA9H 3LRSB 2FGWL 4QTIL 1J0JA 3NABH 5E7BA 1WAAE 2YZ8A 3RWJA 3WFDL 4N68A 4N5UA 4RNRB 1ZHLB 4P48A 4QRPE 1NGWA 3VGBA 1EGJA 1ZHLA 4IS6B 5KVFL 1MCRA 1QRKA 1H5BB 4OCYL 4K8RH 1HCVA 1ZT7A 1IZKA 1M05B 1CFSB 1I7TA 1ONQA 5FYLH 1IGTA 1EV2E 2AK1L 4ZYKA 5F7UA 3GUTA 4ZFGH 3SJVE 5FOJA 4EUPH 3RGVA 2IWGA 4Y16D 2FGWH 4U6YB 3NIFF 1P5VA 3TH4T 2NXZC 1T1YA 5IBUB 3GM8A 4HXAL 5F7DA 4RDQF 3CH1B 5KVFH 3ES6B 3UDWC 3ES6A 5C08A 2HTKC 5C0AA 2HT4D 1T03H 2A6IA 4J4PA 3L5XL 1UJ3B 1XCQA 4HLJA 4HIXH 1BM3L 4HJGB 1PQZB 4I0PC 5DURD 1KEGL 4JFYB 4FQXC 1DZBA 3FQXB 5T5FH 2G9HB 4N0RA 4WJ5A 3JTCA 4URTB 3QNZA 1I9EA 5SWQA 4JN1H 4NZUL 1OD9A 3UTTD 1OM3L 2GSGB 4HXAH 3E6HA 4KK5D 4F57L 5DD5L 3WHXA 1JFQL 1ZANL 4J1UA 1J9CT 4OLUL 5DHVB 3C60C 3L5XH 5AZ2L 5J9PA 2UY7A 4E0RA 1W0WB 2ED7A 3U36B 4U7MA 2BP3A 4X6DE 1RK1A 4MJ5B 2VDQL 4MJ5A 1NLBL 1SM3L 3DUSB 3GMNB 4LFHG 2XWBB 1JN6B 1JV5A 1IGYB 2A77L 2HFGL 4F57H 1S7UB 3O4LB 5DD5H 1JFQH 5CJXC 1ZANH 1RZ7H 3QEGH 3LKPA 5JW4R 2I07A 5DVOA 5AZ2H 3EFDH 4P2RD 4PRPD 5FHBL 3BP7B 2NY0B 2EKSB 2K7PA 3BP7A 4LSSL 4OKVA 3WE6B 1I1AD 1YMMD 2HN7B 3LQZA 4MNHB 3L7EB 1JNNL 1NLBH 1SM3H 2A38A 3TVMD 2VLLA 3MV9B 3QHTC 2YEZB 3VWKB 2AEQL 3GNMH 2A77H 3MV9A 5CUSL 5IW1B 4L3EB 4LF3A 4P46A 5JXEA 1AP2A 3NBNA 1FVCB 4M5YL 1PKOA 5AYQA 5CSGA 2PTUA 3DMMA 4K07A 5HGHA 3TJEL 2ERJC 4HUUA 3FB8B 3UP1A 2A6JB 4KJWC 3UO1L 2A6JA 3O0RL 3OKDA 3RTQC 1JNNH 2FL5B 2VUYA 3KYMB 2FL5A 4UMGA 3THMH 2NCMA 4LIQE 3VDCA 4N0YL 1G7HA 2Y4SA 5I1LB 2EDYA 5CUSH 5ICYB 4PRBB 4XAKD 3IVKB 1L9NA 4WUKL 5ICYA 4ZUTB 4D2NA 2GCYB 4R3SA 1CD0A 4ZUTA 4WHYH 1HK6A 4V1DB 4M5YH 1ZLSL 4NO0B 5BOZG 4OZFG 1N59A 3IRPX 4IDJL 1NEZA 5C0CE 1B9ZA 5I1AB 4NT6A 3UO1H 4MCYB 5DK0B 1I3RA 1NGPL 2AW2A 5DK0A 2ZG2A 5KSBA 3WIIH 4XB7A 1I1YB 5GRUH 3GIVA 4P5TD 2HFFB 5DS8A 4Z7WE 4ZUUB 3S9DB 1VEMA 1QD0A 4WUKH 4L4VD 1MJUL 5A16B 4S1RL 3VW3H 1OAKL 1ZLSH 3REVB 1FNGB 1A6WL 5TDOB 1FNGA 5GGQL 4TRPL 1DEEA 5JW5A 3HB3D 5IVOA 4OCRH 3BEVB 5IIEB 2GK0A 5IIEA 5HVGB 1IGIL 4PJAE 4ERSL 3AM8C 1GGCL 1BQHB 3F7YB 4UQ2B 1IAKA 3E0GA 3U46B 3RAJL 4YC2B 3KPRE 1HQ4A 3V0AC 4NKMB 1YY8A 4OQTA 5IW6A 2Q86A 5TE6L 2HA1A 4NKMA 4UZGA 1KT2B 4PJIB 2V5YA 4S1RH 1KT2A 4PJIA 1LDPL 4KUZL 1OAKH 2PNDA 4JLRB 1D5BB 1A6WH 1D5BA 1QHPA 4IOIA 1LO0L 4TRPH 4HWUA 4RX4D 1UM6L 5J13C 4ERSH 4PB9L 3ULUD 3HUJB 3RAJH 2NY5H 3OAYH 1EAPA 3MRMA 3BRDA 5FB8A 4P5KA 1NMAL 4GXUN 4AMKL 4BZ1H 5C0BB 1LDPH 4KUZH 5I19H 1MJJA 1NSNL 3AS0A 4PY8I 4UDTA 1T21B 3HAEA 4AEHH 3OAYK 1LO0H 1AJ7L 4JQXA 3VFMA 5HVHB 2DIAA 4G7VH 4DZBA 1WCBB 1UM6H 1C12B 4JRXD 1WZMA 2RFXA 3V5HB 4ZXBA 4PB9H 1HIML 1MCEA 3V5HA 4KI5F 5E8EB 1KTDB 3KLSA 3U4EA 3S6CA 1KTDA 1XIWD 1XF4A 3RPIA 3MRIB 4HEME 3OKLA 3QPXL 5IBUG 1DN0A 4WCYH 1DFBL 5E4EB 2VITB 1QPPA 3HMXA 1E28A 1NMAH 4AMKH 3T4AA 3QH3B 3HE6B 3CFKB 1FC2D 1XZ0A 3HE6A 1NSNH 1ZS8B 2PXYD 3ZKMC 1N5YL 3EYQC 4RAVA 2YBRA 4JY6B 4X9FA 3ZKXC 5D7SL 4LQFL 5FYLE 3BMWA 1PSKL 2J8HA 3LIZL 4Y16C 4L8DA 2XA8L 5F70A 3GGWB 1HYSC 4ZODA 3GGWA 2WBJB 4P0DA 1A4JB 3QXUA 3EIFA 2WBJA 2XQYG 1MFDL 4AL8L 3I02A 1A9BB 3RBGA 5DJCA 4TNWF 3UBXB 4MA7H 5D1XC 3K8MA 4JO3L 1MQKH 1N5YH 3HUJF 4YE4H 3V0VA 1VFMA 1N8ZA 4OF6A 3SO3C 5D7SH 2O5XH 4JO1L 1VHPA 1GAFH 4OLXL 4FQ1L 1PSKH 4XNUH 3S5LA 2XA8H 3CPLB 5HI3D 5BJTA 3IJSB 1RJZA 3W0WB 5BW7A 1HHIB 4NQCE 3VXPA 1MY7A 4XRCB 3VXMB 4XRCA 4DUVA 1MFDH 4AL8H 5DJZA 4O51B 2X4SB 3PGDB 5ICZB 1MIEL 5C0NC 3H2WA 4JO3H 1AGDB 3IS0X 1A1NA 1SEBB 2CUHA 3BDXA 1WZ1H 5JLZA 2EZ0C 4JO1H 3NN8A 4OLXH 1NJ9B 5DJYA 4FQ1H 2FJFB 4MB5A 5EZIL 1Q9LA 3KNBB 4MNQD 4PDCE 3NMEA 2X4UA 1RFDL 3G5YB 4NNPL 2FHCA 4LCCC 5TDPB 5TDPA 4OZIF 5CGMA 1QEWA 2XTLA 3MYJB 2VN4A 5J7CC 3T0ED 3RWIB 1MIEH 1IE5A 2EE2A 5BV7B 4HJ0D 1RJYA 4LLMB 4L4TB 1UCBL 1PGRB 1ZGLP 2WWKT 1GXEA 4LPCA 4I4WA 4Y89A 4LVOC 5C0GB 1SYVB 1QBAA 3P4MA 5TDNB 4MHHG 1OHQA 2XV6B 1EHLH 1DR9A 1ZVHA 4OT1L 4HUNB 1CD1B 2H32H 3ULVC 3FONB 3SDCD 4QT5A 3FFCE 1VDGA 1RVFL 5GGSB 1UCBH 5JIKA 1ADQA 4H0IA 5EZLB 4MAYA 2AAVA 3JXAA 5EZLA 3RX8A 1HSAA 2GIYA 4JZJB 1R3KB 1S8DB 1R3KA 4N1EA 4KPHL 1UWGL 3S4SA 1FNHA 2FJHB 2XWTA 2FJHA 2OSLB 3CLFH 3MUZ1 4OT1H 2OSLA 3DGGB 3OSKA 2GTZB 5F1NB 1K8DA 2DBJA 2MKWA 4FFWD 4K3DL 2QR0B 2R29L 4KJPC 4XI5D 2ICCA 4RGMC 1GOHA 5KSUA 4LK4A 4IRSA 2ZG3A 2R0LL 3K0WA 3FKUS 4P4KC 3IJHA 3F58L 5I8OL 3KPOB 1BQHG 4KPHH 3ZDYF 1YEDA 3MRNB 4AENA 3MUGA 1G9NC 5BZWB 5ID0A 5KVGL 5DQDL 5BZWA 3O6KL 4PBVC 4M8QB 1F97A 2FEDD 4PJ5B 2V7NA 1T80A 4M8QA 5I66B 5H35A 1A3LL 2J4WL 4U1SB 4IBLT 4K3DH 3QEHB 2R29H 1A9EB 3KPRD 3WLBB 3TYGH 1U8KA 2XWJA 3E2HA 5GS2H 1FJ1B 2R0LH 4UNUA 5DJ2A 1MFBL 4I3RL 4XMLL 3F58H 1M1SA 5I8OH 4GKZB 2P5WE 3MLUL 2KL6A 2Q8BL 2BNUA 5KW9L 5KVGH 2HVJA 5DQDH 2Z92B 1OTTD 3WS6A 1CE1H 3TV3L 2AXJA 1ORQB 4V2CB 1A3LH 3E3QE 2LFGA 5ELIA 3STLA 3RY4A 3MRJB 1WVZA 4PJ7B 3D2UB 3PWUA 1VADB 2OZ4A 1FFOA 1RZ8A 3LKQA 2F58H 4CU7A 1MFBH 4P5MA 4I3RH 5B3NA 4XMLH 1KCRL 4YQXH 3MLUH 2B20A 5FKAB 2Q8BH 1PEWA 3ZYIA 3IS1X 5KW9H 4U05A 4TUJA 1KB5A 2FD6H 5K9OB 3QJFA 1QFPA 2R4SL 3MV11 4JG0L 1N2RA 2DL2A 4F2MB 2NZ9C 1JWSB 1JWSA 4AH2B 4R97C 4CVZB 1NDGA 1E4JA 3DUHA 3C87A 2P49B 4I1NB 3BZEA 3U48A 3QISA 2WBKA 3B4NA 3O6LL 3PHOB 2PCPB 1KCRH 4KVCL 4XZUA 3IFOB 5IB2B 1AFVL 2APFA 3QHFL 2H26B 2ARJA 2YPLE 3TF7A 2CJUL 2H26A 1A6TA 1LO2L 1U8PA 5B21A 4GAJH 2GFBB 3QP3A 4JG0H 3QEQB 5HGDB 1CL7I 3QEQA 3UBXG 3DYMA 5HGDA 5I16A 5I73B 5DMKA 4HKBB 5IB5A 4HX1A 1DVFA 1CS6A 3ZTJH 4Z7VA 3C8KA 3L5HA 3O6LH 1LEKA 2XI9A 3S5LG 3HRZA 3PDGA 3PWNA 4KVCH 1IC7L 2NZIA 3QHFH 5C0EB 3Q0HA 1P53A 2CJUH 2ADGA 4Y4HD 5INCB 3ERYA 3PIQB 1HZHL 2P46B 5I8CA 4J3TA 3BGMB 4NQCD 1YECH 5E8NA 2EDDA 1DQLL 4C83B 3SY0B 2DICA 1JGUL 4GRWH 4LRIC 4PB0L 2K3TA 4K7FA 4NQEA 3DXAE 2VXSL 4G9FB 3IGAB 2X44D 1QQDA 3EJZD 1JHTA 1IC7H 1RIHL 4I18B 1OARL 4U1KB 3FRUA 4U6HB 3V79C 1HE7A 2Z8SA 1FZOB 4I2XE 1HZHH 5IT2L 4PYHA 4I9WE 2EDJA 2ESVB 4G8IB 4LOUD 4QNPE 5C7XL 3MX0A 4BQ6A 3SE4C 1DQLH 4XP9L 1ND0A 3I6GB 3L3DB 1YNLH 4X8JA 2BHZA 1RUAH 3DETD 3GI9L 1H15B 1YMHA 4BSWB 1LO4L 1OARH 3KLDA 2YMXL 1P2CA 5J1TC 3ARDD 5IT2H 4CL7A 3ARGD 1U36A 1WF5A 3T04D 3PP4H 1LDSA 3UTSE 1JPSL 4PRDA 1P9MC 4NHUE 3C08L 2PN5A 1V5JA 4XP9H 5A2KH 2XACC 3JWDL 4Z9KB 5M94B 2DBLL 5L6YL 1KJ2A 2NX5D 4JANB 5D1QA 5IBTL 1YY9C 3GI9H 2DKSA 3OAZH 1FIGL 3SDAB 3SDAA 3MLTA 1K4CA 1JGDA 4XCFL 2YMXH 1ZT4B 1NMBL 3WSQL 3OAZK 3FCTB 4U1GC 1JPSH 4JREB 5AWNL 3C08H 2VRAA 3PWVA 3U6RA 3JWDH 5AD0B 4AQOA 3PWPA 5D2NA 4Z77A 2DBLH 2CGRL 5L6YH 4JM2F 5IBTH 2EEBA 3UJTL 3ARSA 3GMRB 4ETYA 3BOVA 1FIGH 3QNXB 3PJSB 2WANA 4I0CC 4QYOB 5I8EB 3ZTNL 4XCFH 1QLRA 1FVEB 2I9LB 1FVEA 3Q3GB 1W72A 5KSVB 3WSQH 5IM7B 1MAMH 1MREL 1NCTA 3NIGE 4W68A 4FFZL 4XPBL 4LAQL 4XI5C 2WY3A 1EGJH 3KPSB 3KPSA 5CLTA 1WCQA 1U8HB 5I18L 2KZWA 5CHNA 2PO6D 3RL1B 3LQMA 3UJTH 4RA3A 1CXKA 1OAQL 1JCKA 4K3HA 3MUHL 1HKFA 3HLAB 4H8WC 5GISL 3HLAA 4HIHB 4LPVA 2J8UA 3B9KB 2P5WD 1D9KB 1FG9C 3TN0D 1MCHA 1MHHB 5DRWA 2VC2L 1BJ1J 1Z9MA 5HHOA 1MREH 3BH8A 4FFZH 4ODBD 1NMCB 4LAQH 1DQTA 1QBBA 1U92A 4J3VA 3CCHA 4APQD 5I18H 4MQXD 3TFKC 2ZCKH 4CMHB 5CJOL 4E41E 3HG1D 1DJSA 1BIIB 3TA3D 1BIIA 3I9GL 1OAQH 3V5DA 3HZKB 2UVFA 2BOCB 4WV1B 1LE5B 2V9QA 2BOCA 2CR6A 4MSWA 4L4JA 1OTTC 3P0YL 3IDUA 3QI9D 3RWFB 5GIRA 2VC2H 4JFFD 3KHQA 3VFNB 4KROC 2Y25A 3G6JE 2VO5A 3CXHK 3VFGL 2DQGL 1U2CA 2YSSA 2FX9L 3GHEL 4OD2B 3T77A 3H3KA 4NCC1 5BCAA 1BVZA 4QF1B 4KKBC 4QF1A 4PJHE 3MREA 4GRLA 3HE7D 4JPIB 4XCCH 1MEXL 3T3PF 1QFUL 5BS0B 1KIPB 3BWAA 1VEPA 3NPSB 3CUPB 2Y36H 2MCG1 1CYGA 2HT3D 2IALB 3CUPA 3VDAA 1SYSB 1WBZA 3VFGH 4OIAA 1MFEL 4M6OL 2FX9H 5IB3A 25C8L 2EDFA 3VFPB 6CGTA 5IBLD 4K8RC 2NY1C 1A6UL 3DO7A 1A3QA 4M7ZC 1FFRA 2W59A 1JNLL 4S1QH 5L88L 4N0CD 4NUJB 5IV2B 4DGYH 1OGAA 4P2OB 3EOAA 5FF6A 3DSFH 1LILA 1MFEH 4M6OH 1PG7X 4CADA 5CMAB 5T3XD 5CMAA 5CD5D 4TULH 1QBML 1LEGA 4RFOL 4AEIL 3OJDB 3RY6A 4JRYE 3VCLA 3K1KC 2WINB 3OJDA 4UB0H 2WINA 2VTFA 1T3FB 4W70A 4ZTPL 4JM4H 3DXAD 5A1AA 4Y4HC 5E5MB 1JNLH 1Q38A 5E5MA 5KANI 5L88H 1N3NA 1ODAA 1PZUB 5B4MC 2C7UA 5L7XL 4KK9C 3ZE1E 1Z9SA 2JIXD 5I17B 3MRDB 4PJBB 2RCSL 3CX5J 5ITFA 3MRDA 3SDXF 2C3VA 4GW4A 3JTSA 3BDYH 5FIEA 1QBMH 1K4DA 4RFOH 1MCCA 2KPNA 1B4RA 5DDHA 4DK3A 2O61B 3QIWB 4C56E 1S78C 3QIWA 2CDEA 3QWRA 4MXVF 1FG2B 2YZ1A 5K59E 5KVDL 1I8IB 4YBLC 3TJHD 1FRGH 2XICA 3QDGB 4Z76B 1LP9B 2VLME 3QDGA 1JF1A 1F6FB 5L7XH 4D3CL 4JDTH 2BVEA 4DQOL 1QZ1A 3CFDA 5C07E 5FCUL 4OQTL 3UAJC 1KFAH 3AREA 4LEOB 2VLRE 4ZUVB 3TPUA 3ZHDA 4PJXA 4ZUVA 1D5IH 4M1GL 4W6XB 5FO9B 1DBAL 2V5MA 2R23A 4KK6C 4PRIA 3DETC 3QFJB 4DW2H 5IFJA 1CTNA 2F54B 4LEXL 4RBPH 2XZQH 4JDVB 5KVDH 4GG6E 3F7RA 4NO5A 4LHUD 3MNZB 3QUZB 1SJVA 2R9HD 4D3CH 5B39B 3PGCB 1P4IL 4RBPK 4OFKA 4OQTH 4PS4L 1CGSL 3VRIA 4EI5D 1YEIL 2DS4A 2DQTL 2XN9E 1MCPH 4M1GH 4EBQL 1T89C 4EVNB 2Y6SD 3VXSE 2V2WB 5TFSL 4LEXH 3HCVA 4ZAKA 4PP2B 2IFGA 4KKNA 4UU9A 3T0WA 1UC6A 2A6DA 3FOLA 2KQNA 4EN3D 2QHLA 4NNXB 2C4XA 4WFFD 4HEPG 1BD2B 5LGJA 3HFML 5FGBA 4PS4H 1CGSH 3IXTA 5HYJD 3HMXL 1YEIH 2IQAB 2DQTH 1Q8MA 1KNOA 5GGSY 1JWUB 4WU7A 3MRPA 3VXUE 1IRAY 1HH9B 2OJZH 3O3AA 1J87A 5F9WC 1AO7D 4Z5RA 2OL3B 3PHQB 2JK5A 3HAEH 1U95B 4Y7MA 4QEGA 3EOTL 3C5JA 5FKPB 3E6FA 2P5ED 5HYFA 3MRGB 3QUXB 3LPFA 1KXQE 4MD5A 3QUXA 4Y5XB 1G1CA 3QIUB 4WUUE 5BZDA 5L0QB 1X5FA 4QRRA 2VZSA 4J8RB 4BJLA 4ZPTA 4J8RA 3PXHA 1FIEA 4M6MH 3BX7C 4ZS6D 3REWB 4Q97A 5JNYA 3HMXH 3A6BL 2X4OB 5D1ZA 2NY4B 4PJFA 4DN4L 1M6OB 3RZCD 1NFDB 5ADOL 4G8EB 5E2TL 1WWBX 4Y4KA 3QQ3A 4YDVB 3MZTA 4YDVA 2XA3A 3ROOA 4MVBA 2X05A 3EHBC 2E9IA 3QUMA 3TESA 3EOTH 4MS8C 5HHXH 4LLYB 5DZLA 4AJ0A 3X3GH 5BVJA 2IPTH 3TN0C 4C58B 5CIPA 1T2XA 3KHOA 1RUKL 4JM2C 1CLYL 4X80L 4GQ9L 2UWEA 3A6BH 3MA7B 3WKML 4BH8B 3E3QC 4DN4H 5FM4A 5F9JB 1KLGA 1M7DA 3QRFM 2RBLA 2DQFA 1ZE3C 1AQDA 5CJ8A 2Y72A 4HCRA 3ZMRA 3MMEA 3LN5B 4P2QA 3VGHA 3P2TA 3GMPA 3P73A 1RUPH 2AJZA 2R2HA 1RUKH 4MA3B 2YXMA 5J11C 3V6OE 1CLYH 3Q5OA 4GQ9H 4NPYB 4ODSL 4S1SH 2JCCB 1BX2A 2NY5C 3LY6A 1CDYA 4IRJD 4WI3A 3D69B 3QULA 2OM5A 4NC1E 5T1DH 4TQEL 4Z7QE 4Q6YA 3MUJA 5T33H 5HYQB 1QBLH 1G0DA 4NFBA 3MJ9A 3HE7C 3UYRL 1JZ2A 1WLHA 3AS2A 4LPWA 1YPZF 1EFQA 3X14A 3WNKA 3BIKA 4GRWF 4Q9CA 3L6FB 4OF3A 3C5ZD 3OR7A 4ODSH 1OB1A 1FL3B 2FO4A 4QRTA 4AEEA 5E6ZA 1BZ7A 5GJTL 3VI4E 2EECA 1MRDL 4Z8FL 4XTRD 5KS9B 1KYOJ 3O4LE 4LFHD 5KS9A 15C8L 2YWYA 1NBVL 5D93C 3HNTH 1BJ1H 4JRYD 3RVUC 3UYRH 2BRQA 4UTBL 5MI0C 3MLSL 1U8MA 2CXKA 5C9JA 5I1JL 5IHUL 3W11C 3ARBB 3EFFA 1UQSA 2ZUQB 3MV9E 3FT3B 4HK0A 4YNYA 1FYTA 1MRDH 1T66D 4KV5E 4L8CB 4WHTB 3KPPA 5JQHC 5IG7B 1T0NB 15C8H 5EC1B 5IG7A 1NBVH 1ADQH 3U83A 3MV8A 2XPGB 3V4VL 4LSTL 5HXMA 2QQKL 2ZUUA 4MQSB 4QLRA 4ZO8A 3C6LB 4XPFL 2V6HA 3VFRA 2BFVL 1KTKE 1C5DA 1HSBB 1CLZH 1HSBA 2NY7L 2BVOA 1BQUA 5EIIA 4DVBB 3L3KB 4JFXA 4PJGF 1BFSA 4R0LC 1JBJA 4WRLA 1E6JL 2Q76B 1T1XB 4IMKA 4N0FB 1G7JB 4M7LT 4N0FA 2VLRD 1G7JA 4LSTH 1SHMA 4V1DE 1FZKB 1XT5A 3ZL4H 4L9DA 3LKOB 4H1LA 1AXIB 2X4RB 2C1PA 3MGOB 4HLZG 3S8WA 2BFVH 4ENED 5CSZB 1WFTA 4O4YL 1KG0B 5B39G 2NY7H 2PYFB 3EGSB 4NN5C 4WWKD 3JUYA 3VFWB 3EGSA 5BRZA 4KRPC 3SCMB 4R7NB 1NFIB 1YEJH 1J0ZA 4XCEA 4YDJA 4NKDB 3VXQA 3W2DL 3QPQC 4JFZH 2OZ4L 2XN9D 4NQSB 2BVYA 3L5WA 3IB4A 4NQSA 2Z31B 1VPOL 4MXQD 2CR3A 3TO4A 5HGAB 3EDJA 4PRHD 4ODHH 1ZA3B 1NBYA 1OAYL 4LDEB 4ZO7A 1ZA3A 3G6DL 2GUOB 1OAZL 2GUOA 3MJ8A 3HI6L 3WYRA 4U1LA 5C0RH 5DD3L 2YD9A 2CIKA 2A74A 3H0TB 1I7UB 1KB5L 2NY6B 4U31A 4LKXB 4X7SH 5IHZA 5KVEL 2NTSP 2NW2B 2AXGB 3QA3B 4RGND 2V9RA 3W2DH 1NCBL 1DQJB 1TQBC 4PJIE 5IGXH 2B1HL 5D7KD 4PV8B 1XR9A 2JB5L 1VPOH 2GITA 3OMZA 1OAYH 1EEZA 3G6DH 4S11A 3UTZA 4EOWL 4ZFZA 1OAZH 4LARL 5DFVD 4EI6B 3HI6H 4X6CA 3JWOL 5IJKC 5DD3H 4KWUA 5J1SC 3KXFD 3P4NB 2X89A 1KB5H 2GJ6B 3O9WB 1YUHA 4R90L 2GJ6A 1FE8H 2CUMA 1NUGA 4PJCA 2BNQA 4HK3N 2VABB 1NCBH 4UOW1 3CX5K 1TETL 4KXZH 2EEDA 5C0BE 1R6VA 2JB5H 3MBED 5T1LB 4TUOA 1R3LB 4MWFB 5FYJE 2V5TA 4ZS7L 4EOWH 4EJ1C 5H2BB 5HI5D 1JGVH 4LARH 2QL1A 3HS0A 3JWOH 4HMCA 3FB7A 3OHXB 4NWUH 1HHJB 2N1KA 3O2VH 1AXSA 3RZCC 1UB5A 1BF2A 1TETH 4UIKH 2XRAL 5CEZL 1E4KA 3UYOD 4WVRA 5AEAA 4X6BA 2VYRE 4K7PL 43CAA 2IMMA 2VL5B 4XXCA 1S7TB 1GIGH 4ZS7H 3SKUD 3GJFA 1JMXA 1E4XH 2JJWA 1DSFL 1CIDA 1CGWA 4QXGL 1NCDL 4AG4H 4PGEA 3RWEA 4NCC2 5E9DB 1QTYT 3LD8C 5DUPL 4L9LC 1N4XL 3DHMA 4OZ4B 5CWSB 1MHPL 3RQ3A 4CW1A 1TPXB 3O2DA 2Z8WC 4NN6C 3U82B 4QRSB 2OQJA 3V6FA 4IEFB 5CEZH 1N0LA 1HHHA 2NMSA 4LVHC 4Z7NE 3T4YA 1L7IL 3KJ4B 1N5AB 5INDB 1CGTA 1N5AA 1D7FA 2V7HB 4PTUA 1U8NA 1B2WH 3O11A 1DSFH 2EIZB 4GUPB 5EUOF 2EIZA 1NCDH 4GKNA 3W0WE 3H9SD 2FR4A 3VXME 3D6GA 1JE6A 1MHPH 2LTQC 3LKSA 2FYYA 1BF8A 1MHEA 2A1WL 1KJ2L 1INEL 3BH9B 3U30B 3NZ8A 3O4LD 4DEPB 3VXRD 3AFLA 1UM5L 3G6AB 3SKMB 3VRJB 1L7IH 3ARFB 3VRJA 1BOYA 2EXWD 4HUXA 1NH6A 1LK2A 1A6VH 3HRPA 1GYAA 4M3KB 4N0UA 4Y19B 2BRRL 4Y19A 4NBXB 4XTRC 4ONFL 1IILE 2CO6B 2V2XB 3MLRL 1T7VA 1VESA 4POZC 1F90H 4TNVK 4HZLB 4HG4J 4I0PA 2YRZA 4L1DA 4Y2DB 2WM0A 4L3ED 5KSBF 1INEH 4PJ9C 3ZDYE 4FQXA 4L4TE 1P1ZB 2I9TB 1P1ZA 3DV6B 5FO8A 2ZUVA 1YDPB 2RHEA 4HULB 4OF5A 1ZHKA 4FXKB 4ZFFB 1K8IB 4K9EL 1JUFA 3ZKSD 1W72L 3L3GB 2BRRH 4PG2A 2ED9A 5ICXA 3LHPH 3C60A 3EYVA 1CFVH 3MLRH 1LK3L 5AZEH 1U8IB 3ESVF 2VAJA 4D9LL 5BXFB 4K2UL 1S7SB 5BXFA 1TQCC 1GGTA 4R2GB 4M7LL 3RPKA 1UYWH 3U7WL 3UZVB 2V17L 4V1DD 5DJ6B 3M07A 1NAMB 1RUQL 3STZA 1Z6JT 1RSFA 3EOYG 2AJ3A 1U41A 1W72H 5I1HL 4BSVB 5CJXA 1INDL 2XTJB 1IGMH 1EUUA 1LK3H 4M93B 1AGCA 2XY2A 2NNAA 4D9LH 1YJDH 4XWGL 2YKLH 2H9GA 2AK4A 2VXQL 4LPXA 5D7IA 2ICEA 4KI5D 5IVZB 4AIZB 5ESVA 3ECBA 4HGWB 1KACB 1MIML 2VDML 1I1RA 3JV4B 5KSAC 3QJHB 1BFOA 5ESQB 1KXTB 4LLUB 4CJ0A 5I1HH 1GGIH 2G5BB 5DC9B 3VGFA 4WI7A 5DI8B 4PJ5E 2UZIH 3VFOB 4N9GA 4GW5A 3QQ4B 2EXYD 4G6KH 4LCWB 1G7LA 4XWGH 1X7QA 5FYKL 2IF7A 4NC2B 1M71A 1JRHH 2VXQH 3VXNA 1F42A 1HWGB 1S9VB 4KDWA 3NFNB 4OSUH 1IAIL 1CICC 4MXWL 5H37H 1JGEA 1T83C 3IDGB 3LRHA 3RJQB 1QRNB 1XGTA 4KHXL 3D0VB 1IBGL 2ZCLH 4ODWA 3MO1B 3D0VA 3QIBD 4PJ7E 1C16A 1FBIL 2MFNA 3SDYL 3ARWA 3LSOB 3NGBB 1PKQB 5DMJB 2E7CA 1CVSC 2X40A 5C0BD 4NN7C 1FV1B 1RZIA 4JZOB 4Y1AD 3OKEA 2GJJA 1FV1A 5GZNC 1QSZA 5FYJD 5ERWA 2F53D 5CS7A 2GY7B 1U3HA 4LL9A 3SQBA 1WZLA 2O5YL 5D7LB 3GDBA 1UZ8B 4FQJL 1E0OB 5JW4Q 1IAIH 4NYLA 4MXWH 5IF0A 2DI8A 3IKKA 2EDQA 2LVEA 2ZWLT 4FFVD 3QR2A 3AROA 5SWZB 2CKNA 5F3HA 3WNPA 1L0QA 2IH3A 4KHXH 1IBGH 2BHUA 2L4OA 1YN6A 5DHXB 4Z6AT 3QQ9C 4M02A 3TBTA 4PJ8D 5AG8A 2HTLC 3SDYH 2ZOLA 4NQTA 3VFVA 3AM8A 2WWMD 1EO8H 4PR5B 5C0JA 4PGZA 3DI2B 4Q9BA 1AC0A 3TBSB 4PR5A 1LMKA 5DQJA 3RGHA 4NQXB 1WISA 4XHQA 5IROA 1QFWL 4NQXA 3S88H 2O5YH 5HPMB 2G5RA 4FQJH 1A7PL 3VJ6B 1V3JA 3HN3A 1F11A 1OTUC 5CD3A 4J7RA 2VIRA 3QEQE 3ILQC 3EO0B 4QGTA 2VXUL 3TPKA 1HILB 3QG6A 3QNYB 2DM7A 3QNYA 1I8MB 1IT9H 4DGIL 4MAUH 1TJGL 1B4JH 5L8JB 1UJ3C 1QA9A 3D3VD 1ZT1B 4BA8A 1NGXB 1ZT1A 4I3GA 1MNUL 1YZZA 1A7PH 4P3WA 5TPWL 4V3EB 1GGBL 5IVXB 4HH8A 1KIQA 3V6OC 2EDRA 3ZE0E 5IVXA 1JYWA 3WFHA 4U4BA 5ALBL 3GO1L 1F4WH 3CSPA 3QEUA 3VXMD 5C71A 2VXUH 4ZTOH 1T5XA 3WHE0 2D7OA 3OPZL 1I7ZB 4DGIH 4PY7A 4NC1C 3T3ME 3F5WB 3AU1B 2NY2C 4YHML 3GMOA 4G9FE 4NSKA 3ZT5A 1MNUH 5C0FA 3BJ91 3IDIA 4NRYB 4WEBL 5HHPB 4B50A 4WW2A 4NRYA 3UX9B 1P7KB 3CFJA 4KRNA 2W38A 4MD4B 4ZOAA 5ALBH 3GO1H 2AS5M 3F62A 3Q6GL 4MD4A 3QG7H 2ESVE 2AEPH 1DDHA 4DKEL 5HHQA 3RZWA 2D0GA 1OAUL 3OPZH 4Y8DC 3WN5B 4YHOL 5C3TA 4Y16A 2QADD 5HHMD 4YHMH 1MH5A 5HYSB 2NY0C 1IC4H 3MODL 4XP5H 4HLZH 3GB7A 5C0DB 4JO2L 1CXIA 1ERNA 4EIGB 2X4NB 4WEBH 3ZE2F 4QXUL 2X4NA 2WSKA 2V2TA 4DCQB 3AMKA 3H6JA 1MRCL 3Q6GH 1JTOA 4Q6IA 3IDMB 4M7JL 5TQ2L 5I71C 4DKEH 3VWKC 1ULVA 5JHDA 4P46C 1E27A 5SX5H 2XKNA 5JXEC 1OAUH 2YXFA 1REIA 5F7NC 2ITDA 2NXYD 2GT9A 3ILPA 2X7LA 3UTTB 1VGKA 4RGOH 1OQOA 3BHBA 2H8PA 4OLYL 5SX5K 3BQUD 4JO2H 4G7YL 5FFLA 4KKAD 2DKUA 3IT8D 4LCYB 3UZEA 4LCYA 1MCJA 5TQ2H 3BKYH 1MCLA 4M7JH 3GEWB 5IK3B 2WBWB 3BEWB 3BEWA 1HINH 5J6HB 1JIBA 4X83A 5EU5A 1S5HB 4LCCA 5FHAH 3BIAX 3SDDB 3VDBA 3CC5B 4KFZC 4G7YH 4U2YA 2X4PB 2BSSA 4M61A 4U49A 3RIFK 5HHVH 2Z4QB 4R4BB 5JZ7C 4XC1H 4PRPB 4R4BA 4P2RA 2J6EA 4PRPA 3DURA 4CVUA 2HMIC 1ORSA 4PJ5D 1RPQA 3QXDB 1I1AA 1YMMB 2QSCL 3KPSE 4EIZC 1UXSB 4H5SA 5F9OL 1CWVA 3O3DB 3VXOA 1Z0NA 3TVMA 3QUMH 3T3PE 2OP4H 2H3NB 3DRTA 3FQRA 3NCYP 2H3NA 3KPLA 2BCKA 2HLFD 1SY6A 2XXCB 1JZ3A 5E8PA 5CIPH 5B3JF 4KAQL 4J2XA 4HK3J 4GBXD 1AKJB 3TBVA 4M6AA 4Z78B 4Z78A 4YHZH 5HDLA 2EXYC 4YC2C 3MROB 4X6EA 1TZIB 32C2B 3CD4A 4ZUWB 4NZJA 1UM4L 32C2A 3SGEI 5D7JD 4ZUWA 5F9OH 1QNZL 4HCRH 4HG4K 1EFXD 1A7RH 4HV8B 2DLFH 2DQEL 3QO0B 1YYML 4S0SD 1F3RB 3D2UD 3MJ9L 1C5BL 4C54A 1MUJA 3K46A 4KAQH 1ED3B 2EDEA 1XGYL 4Z7VF 2EYTB 3V0WL 1U8QB 2VOTA 5EIVA 4HIJA 2J5LB 5IOPB 2BOBA 4X6FB 2DI7A 1UM4H 2F9BT 1OAXH 4P4KA 1QNZH 1P4LB 1QO3B 3RWCA 4P5TB 1OQXA 3QDJD 1KC5L 4HUWA 1YYMH 1R5WB 5HYIA 2P7TB 3MJ9H 2P7TA 1RD6A 3VD9A 4L4VA 2APBA 3WS3A 3OGCA 3RHWF 1P6FA 1OF2B 4MXVE 4P4RA 5E4EC 4PP1C 1UG9A 3K3QA 5ECJE 4HHAA 4QTHB 3HE6C 3HPLB 4ZNEE 5CZKA 5IB4B 5J6GA 1KC5H 1PVHA 3RWDA 3TH3T 2W0PA 3F7PC 1JPTH 1A2YB 4ZFOL 1FNFA 3RVVC 3WDIA 4N8CL 1X4YA 2ZSVB 5E00B 2WBJC 1B0WA 5E6IB 3HC4L 5I1DB 4RX4A 4XAWH 2ZSWA 3ZSTA 3CMGA 4LQ1A 4HT1L 1RY7B 5FOBB 1SMOA 5FOBA 3MR9A 3WL9B 4J12A 3WL9A 3TNMB 3EO1A 3MRRA 1LO3L 4QHMA 4KRMB 5LWYH 2DD8H 4ONOA 2UYLB 4TSBL 1UENA 2CDFA 3KLAB 4G9FD 3O81A 3ZDZF 3HR5A 5D5MB 4HS3A 4W4OC 3T0DA 5BW7C 2FNBA 5D6CA 2E7LA 3LKNA 1I3GH 3IRZA 1DUYA 4HQQL 4PJBE 3WO3B 4JRXB 1G6VK 2ZCHH 2VQTA 4Y4FB 2ESVD 4HT1H 4JRXA 2IPUG 2UVEA 4XC3L 4UQ3A 1U0QA 1OWWA 3DGCR 1NCNA 1FZJB 5ENWB 5JPNA 1FZJA 5E94B 4Y8AA 5ENWA 4JG1L 1XIWA 1U3JA 5E94A 3SJVA 4H1LH 5HYSG 2CD0A 4XP1H 3ZZ1A 2MQ3A 4OIBA 2HLAB 3N1PC 1J7VR 2RJMA 3IFPA 1TMCB 2HLAA 3QDGE 1LP9E 1NCAH 5EU3B 1TMCA 2PXYA 1MCWM 4CN1A 4XVSL 3TH2T 4LVNC 4HQQH 2IPKB 3UTPE 3WCYA 3DV4B 3LN9A 3I3EA 4MX7B 2X1WL 3HZVB 5BV7C 5F1IA 4ETQA 2F54E 2RGSA 2HJKA 3QDMD 4JJ5B 4JJ5A 1VENA 3NFPA 3O4OB 4GKSB 3B6SB 3BPCB 1KPUA 5CSBA 5EA0H 4XVSH 2VR4A 1G7MB 1EHNA 2VWEE 2OTUB 1RK0A 3K4ZA 3P9MB 3NFSH 1CD8A 3UTQA 5CLWA 2IH1B 2X1PA 1HN1A 2J8UF 3MLZL 3V4PL 2F19H 3BXNA 4MAYC 4NUGL 3HC0B 5GS0L 1BECA 1NC4A 3BZ4A 1QYGL 2OTWA 1F2XK 3KYKL 3QUKB 1IM9A 4Z7UB 3QUKA 5GHWL 4Z7UA 1DQDL 1B0GB 1OT2A 4MJ2A 3H9HB 1BD2E 4KDVA 5SWSD 4IOSD 4Z0XB 2BSED 4YBHA 2AXFA 2E8YA 4U6XB 3MLZH 4G43A 4LLAA 4MNQA 4C55A 4EXPX 4JFQA 4QOKD 4RISL 4NUGH 5GS0H 3CVHL 4HFWA 1QYGH 1K6QL 3KYKH 1HXMB 3D85B 3MV7B 1HXMA 2E3VA 3LCYA 3T0EB 1P9MA 4KQ3L 4MJID 1DQDH 1PYWB 1LEIA 1PYWA 3CK0L 5ISZB 5F88A 4CNIB 4LGRB 3B9KD 5HVWA 3I2CL 1D9KD 1F4YL 5EUKA 1H3PL 4O5LH 1EEUA 3FJTA 1HHKA 3BPNB 2VQUA 5F96L 3O2DL 3KYOB 3IETA 1NFDE 4OIIL 1RMFL 2EDNA 5F71A 3E2HC 1T7YA 4WW1B 1K6QH 3GJFH 5BVPH 1NUNB 3BE1L 3C6SB 3GSWB 3SDCA 5LCVL 1KTLA 3PL6D 4WO4D 4JKMA 4DZ8B 3CK0H 4JFPA 3WS6C 3KS0J 4OUOA 1QSVA 5TQ0L 3GJFK 2M1KA 3OR6A 4KKLD 2HG5A 2QQNH 4EDWH 5F96H 3O2DH 3RUGB 2DQDH 5C0CA 1XH3B 2ITCB 4QHKI 4OCXL 4RA0C 4YUEL 4OIIH 2XFXB 3P9LA 1T5WA 5CGTA 5I1EL 5CP3A 4WEMB 4LCUB 2BSTA 4O9HL 2JJVA 4KTDL 4WEUD 5GGTA 3KYAA 4OGYH 4Z7WA 3MRKB 5LCVH 3UXFA 3QWOB 2DMCA 4H20H 4M00A 4NOBA 5D9SB 5IEKA 1O0VA 1FFPB 3CXDL 4KRLB 5TQ0H 5BQ7A 2JCCE 1EK3A 4X4ME 3ISWA 5CZVH 3LDBC 5BS0D 1YA5A 5IR1A 1IM3A 1HNGA 2CDGB 1Y6MR 4PJAA 2EDWA 3WNOA 4P23B 1O7SA 1T6VN 3KYNB 4KTDH 4Z18A 2KKQA 3BKML 3IKCA 3KYNA 4FXLA 1TJHL 3KPRA 3JWOC 3TF7C 4IHOB 4ELKA 3CXDH 5F93C 4OD1L 3ARUA 3TFKA 4X99B 3PE9A 4X99A 4L29B 5CP7A 3UTOA 4R26L 4L29A 1XGRB 4NDMA 5E5UB 1R3JB 5KANG 5KS9E 1T4KB 3TO2B 2B8OT 1YNTB 1GGYA 5GZOC 3JTTA 1YNTA 2OXHA 2OI9B 4A6YB 2BNRB 4TUKL 3RUGF 3BKMH 3C9NA 4PJXF 3TCLB 3CZFA 1UB6B 1D6VL 2IAMB 1RZKH 1UB6A 3FB5A 3PQYB 4OD1H 2QLVB 4MA8L 4OCWH 5C3LD 3U0WL 3DROB 2R1YA 4R26H 5DGRA 3ELAT 4JY4A 1DQML 1U8JA 3N1GC 2H2SD 4E9LA 3MV8E 2FO1A 1IAOA 3AS1A 2P8LB 3RNKB 3RWHA 3ROLB 2OTPA 3V6ZA 4PJEA 4UI2A 2Y7QA 1D6VH 3CSYA 4FMFA 3OKMB 4PG9A 8FABB 1TZHA 2H1PL 4M4RA 1AHWB 4XP6H 3U0WH 1LWRA 1H3GA 4QHLB 4K3EH 4UDUB 2CKBA 1T04A 1NANI 1XR8B 4LLQB 3SKNB 2YPKB 2OJEA 1HDMA 3O41A 2N7BA 2AKRA 1CU4L 2QTEA 3EAKA 3QFJD 4G42A 4WU5A 3CSBA 3O8XB 4LLDA 2F54D 5GJSH 1JPGB 3QXAB 3V5KB 3GI8L 3RI5K 5TF1L 3KR3L 4U1HA 3UJIH 3F8UB 3WEXB 4EKXA 2H1PH 5D2LB 2DQJH 3RIFF 4TTDC 2P8PA 2OS7A 4HIEB 5KTEL 3PABA 4KZEH 4PGCB 3FZUC 1F3DJ 5DXWA 3IU4L 1Y18B 1JPFB 2BVPB 3GSXB 4RZCB 5B38B 1MF2L 4RZCA 3BAEL 3ALPA 1EEQA 4Y4HA 3UBXI 3I6KB 2IC2A 5D1QC 4MLIA 4Z7OF 4JFDD 2WUBL 4FFYL 2WIIB 5TGBB 1CU4H 4AEFA 1DBML 1T1WB 2YA2A 4NQCA 4OJFL 3O2WL 3SDAC 3O6FD 4PJFF