3BO8A

The high resolution crystal structure of hla-a1 complexed with the mage-a1 peptide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bo8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bo8A01
4OGXH 3QIBB 5I1GH 2NW3B 4UT7L 1S7WA 4HKJB 3QDGB 3PV6A 4KKCC 3MNVA 4ONFL 2A83A 4X9IA 5KS9E 3ULUC 1HCVA 5IJKC 1HH6A 2DWDA 1J86A 4RMSA 3O3AB 5EOCH 1XR8A 2XPGB 2CMRL 4NO5A 5IMMB 4KDVA 12E8H 3CFJB 2DQGL 4P2OD 1FZMA 4PRPE 4LGPB 1F58H 4C54A 5F70A 5E6ID 2CKNA 4G80B 3R06A 1NAMH 3OJDB 5EU5B 2VDPH 4FFWD 3WN5C 5FO9B 5TE7L 4V3EB 4AEHH 2W92A 3MCLL 1LE9A 1U8IB 1TDQA 2A9NL 3SJVA 4YUEL 4WI7A 4OB5L 2WUCL 2XYCA 4MDIB 3EGSB 4ZG1A 3BMWA 4I2XE 7FABL 2RQ8A 1UACL 2D7PA 3FOMB 4IOFC 2VR5A 2DQDH 3NZ8A 1TZGH 3KXFA 3OV6A 3TFKD 4JO2L 2QQKL 3RPIA 2EDLA 3NPZB 3DXAE 5KVGL 4U6XA 3TF7C 4OZ4B 3WFDH 1JHLL 1H5BC 1AGBA 2W0PA 1J18A 2EC8A 3ZKMD 3OKNA 4UT7H 3NN8A 2VN4A 2Z35B 3QPQC 4ONFH 1BJMA 4EXKA 1X6LA 2DQTL 1OAKL 4NDMA 1HN1A 3VD4A 3UJJL 1BAFL 2CMRH 4KJWD 3MMEA 2P49B 5JLZB 4XX1G 1BBJB 1KJ2L 2VC2L 3MV7A 1FPTL 1SMAA 2R8SL 1U8QB 5MP6L 2ICWI 2JLLA 3C5SA 3MJ7B 1KCKA 1JV5B 1MWAB 1RJCA 3DX6A 1RY7B 3VCLA 4P2RE 3I75B 5E94B 3UYPA 5TDNA 2A9NH 4YUEH 3HE6D 4OB5H 1OT2A 1A9EB 4WO4D 2OX5A 4RAUA 1AR2A 5D96C 7FABH 4HPOL 2MQ3A 2DBJA 5KVDL 5CEZE 5IB3A 4OZFH 4JO2H 2JIXA 2QQKH 1UCTA 3ZE1E 1ZS8B 4NZDA 3AGVA 3SDXF 2EYTA 1JHLH 2NY6C 4KWUA 3TIDB 5IMKA 1FNEA 4UT9L 3H6JA 2X05A 4MMZC 5E9DB 3S36X 3LVEA 4OGAD 4C4KO 3EUUA 1FGVL 2DQTH 1OAKH 3TCLA 4EDWL 1QUNA 3FFCA 4NRZB 5D7IF 2BFVL 4YHIB 3W0WA 5C07D 4UAOB 1NGZA 5DMYA 5HYIA 4ENED 1NGYB 1S5IL 1AO7D 1KJ2H 5BO1L 2VC2H 1FPTH 4OUUB 1ED3A 4PTUB 5B22A 3BIAX 3E3QA 1VDGA 2R8SH 1QFWM 3RVVC 5MP6H 4ELMA 1U0QA 5IQ9B 1VACB 2HRPL 5ICXA 4ZFFB 2EXWD 3E6HA 4P3DA 3D25B 1WBYB 1QSFE 4C59B 2WIIA 4UNVA 5EB9A 3HAEA 4HPOH 1K8DB 3SDDA 2CLRA 4EDXB 5CBAB 1MHPL 2C1PB 4MWFA 2E6PA 2EZ0C 4NQTA 5KVDH 4R97B 5L2KD 2IWGA 5I75B 3LS4L 5KSAD 2LVEA 3VXUD 2OTWB 5I1HL 2GHWB 2ATPA 4N0UA 4XP6L 3IRZA 4UT9H 5I66A 1OWRM 3QUMB 3PWJA 1HHJA 4OZHA 1FGVH 4JPIB 1XH3A 4KTEL 4YO0B 4PV8A 5ESQB 1H3UA 4EDWH 1DDHB 4EVNB 5LAXA 3MRKB 4U05A 4UINL 1R3LA 4LIQE 2E7LA 2IQAA 5I16B 1J8HB 3PDDA 3TNNB 1FC1A 2OSLB 3NBNA 3O4OC 5BO1H 4NQSA 1KJ3L 2A6IB 2DM3A 5A3ID 4LSPL 4X9BA 4AT6B 2YEZB 2QADD 4X5XA 5HHMB 3LRSA 4GRMA 2HRPH 5C09E 1TETL 1A21A 5I1CH 3VXPB 4WW1A 3MRBB 1CL7I 3D18A 5DTFA 3UMTA 4BH7B 5SWQB 5JPNB 1P4LA 1WC7B 5HYJB 1MHPH 4R26L 1JI1A 3NACH 1MFBL 1DUZA 1U91B 3QEUA 4AJ0A 5EC1A 3LS4H 1D5IL 3GMRB 5I1HH 1KJMA 3G6DL 5BZDA 2Z8VC 5CILL 2PXYD 3OGCA 2XTJC 4O2CA 4DKFL 4TUOB 4KTEH 2Q3ZA 1MFEL 5HHOA 4UINH 1ZGLA 3VGAB 3ARDC 2PCPA 2R23B 1Q9LA 1UZ8A 4KK6D 5HHXH 1MJ8L 3VWKC 3QWOB 1PAMA 3MJ8A 1WAAF 4Z7NF 1M05A 2L4OA 1DEEA 4G42A 4LSPH 5ID1B 3ARRA 5JDSB 4R96B 1PG7X 5CJQL 1RZJL 1ZAGA 5I1DA 3IYLW 5AD0B 5SWZD 1U8NA 2UWEB 2CKBA 2IPKA 4JN1L 2GSGB 4J6RL 3SDCA 1YMMA 1K8IB 4LNRA 3FRUB 4O2FA 5EBLB 3ROOB 1ONQB 4FQXC 4P2QE 3WS6A 4R26H 5TH2B 2AXFB 4XXDB 1MFBH 1TJIL 3KWWA 4TSAL 4V1DD 5AEAA 1NBYB 5AAWA 3LKNA 3VMNA 3ARBC 1D5IH 1CQKA 3G6DH 5C1MB 2DQFB 2F9BT 3O8XC 5CILH 4MNQD 5EZIL 3MOBL 4DKFH 5J89A 1UJ3A 3BPLB 2E5EA 3RNQA 3IXTA 4FXKA 1MFEH 3MGOA 5E99L 2VL5B 3H9YA 4I0PC 1U93A 1KPRA 1A02N 4PJAB 3T3PE 4I18A 1NDMB 2YMXL 3QIBC 2IADB 3RL2A 3QIWD 3FONB 1MJ8H 1S9YB 4IOIA 4YHNA 5F7DB 4NQXB 1GSMA 2FO4A 5TPWL 4YXLL 3W81A 4HJGB 4YDLB 5CMAB 4WUUD 3D48R 3SCMD 3FFDA 4RA0C 5CJQH 1RZJH 5HPOA 5IR1B 1N5YH 2MCPL 1RFDH 1H9VA 4YFLI 1SJVA 4OZFB 1S7SB 4JN1H 4J6RH 4K3GA 5EOQH 2AK1L 1FO0L 2DL2A 3D39B 5I1JL 3DURB 2J6EA 3ARTA 3I6LE 3HUJF 1KXTB 2ZUYA 1TJIH 4TSAH 1D5BA 2VLRE 4DCQA 2A6JB 2KH2B 3KPQA 3UROR 1BM3H 3U0TB 4WY7L 1HCFX 5HGAA 3RWEB 4BZ2L 4M7ZB 5EZIH 3L3DB 3G5ZA 3WFHA 4M61B 4PR5B 1QD0A 1VHPA 4POUB 1NGQL 1JWUB 3QFJA 5E99H 1KJ2B 3G08A 1AHWB 2JKXA 2YMXH 3M1BB 5IQ7L 3UTSA 4QWWD 5ISZA 2DI8A 1EVUA 5C0BB 4BM7A 4Q9BA 5TPWH 3ZKQD 4EN3D 5DJAA 4YXLH 4L4VD 4XHJC 2WBKA 2AABH 3TESA 3FZUC 1HQRA 3WD5L 3SKNB 4NRXB 1N8ZA 5CAYB 1C5CL 4NO2A 4Y1AE 2MCPH 4JPWL 2V7NA 3GMMB 1R5WB 3STZB 4R6UA 4HDIA 2Z93B 4K3JL 3IDXH 1I3VA 2AK1H 1FO0H 4K3DL 4HKXB 5I1JH 1DBBH 1EBAA 1ZT4B 3BPCA 2FX8L 3GEWB 3RUGF 2GTZA 3AY4C 3TBWB 4EI5B 1LEKB 1AY1H 4KI5F 3MYJA 4OCWL 4RAVB 4WY7H 5ICYB 5E95B 2HN7B 4LF3A 4ODUB 4BZ2H 4JFFB 1AR1D 2OR7A 1ZHLA 3QUZD 1WV7T 4GUPB 5DVLA 4ODSL 4JDVA 1YEJL 3D0VB 5IQ7H 4QXUL 5HVHB 3L5IA 3L3JA 4L4TA 2B4CL 4Q7DA 5FIEA 1UZ6E 1A6VL 1QLRA 1B0RA 1RJLA 4ZFZA 5FK9B 4OZFG 4NGHL 3HE7D 4I1NB 3FT3A 1ZV5A 2NY4B 3P9MA 1X5HA 4KROD 4UAOC 3R8QA 5KANI 1C5CH 4JPWH 4Z76B 4AIZB 2DYPB 3QEQA 4K3JH 4X99B 4K3DH 4FFEX 2C1OB 3WNPA 4AEFA 1WT5A 1QEWB 3MNZA 3WFEL 1AGDB 4ODVH 5TGBA 3DJ9A 1V8HA 2FX8H 1WICA 5DQ9B 1K4DB 4GW4A 4MJ6A 1QPXA 5FDYA 4OCWH 1A8JH 5ALBL 3DECA 4ODXB 5C2UB 2GY7B 4W81A 4RFEA 5H35B 1A6ZB 3BFOA 3IT8D 4KMQA 5EU6B 3TBSA 1FNAA 4X6FA 1KTKE 4R97C 5I75C 2P5WB 1I1FB 2GJ6A 3CH8A 2DM2A 5F9OL 1URLA 2J8UB 1YEJH 5LQBL 4QXUH 5T3XL 4U3HA 4HJ0D 4IIQA 1E27B 5IB2A 1CVSC 1F3JA 2B4CH 2EDNA 1A6VH 3NGBB 1ETZA 2FRGP 5C0FB 4TTGA 4NGHH 3EFFA 4R3SA 1T04A 1RZIA 2F15A 4DOHE 1CU4L 4P57A 4DQOL 1NBZB 1JZ8A 1I4FB 5IIEB 3QPXL 4OTXL 1DLHB 1KF9B 4PRHA 3B5GA 4L5FH 1H3TA 4ZSOE 1PQZB 2EEAA 5BS0B 4NPYA 3SGJA 5EPMA 3RNKB 3LQAC 3BGMB 2BOBA 5JA8B 3SDXB 1P1ZA 3QDMB 1HEZA 3DX8B 3PWPE 5ALBH 1EO5A 4D9LH 4F37K 5GZNC 3WSQL 3QZWA 4EEEA 1JNHA 4JY6B 4MVBC 4OZGA 2CDEA 3DVIA 3FO1B 1FG9C 4QTIL 2HG5A 5IVZA 3KPOB 5GRWA 5C0GA 2EC9T 4YXHL 1CWVA 4MJIE 1YMHA 5MEPB 5D7IB 5F9OH 5ID0B 1K2DB 5LQBH 3G6JE 4HV8B 3NIFE 4OAWA 4MXVE 1SEBA 3T2PA 4FFVC 4HIIA 5JW4R 3QNYB 3VGAC 3VXQB 2YWYA 3VA6A 4GKNB 3N1MC 3OKOB 4JE4B 3P0GB 4WJ5B 1KNOB 1WLHA 2ZSWB 5KZCD 1CU4H 4OM0L 4IRSB 4QOKE 2HLFD 3RU8H 2QQLL 3VFTB 5I8EB 1MJ7L 3QPXH 4OTXH 4AL8L 3PQYE 5DF0A 2VABB 3VMPA 1JRHI 5CS7A 2KKQA 3EO1A 5TDOA 3V6OC 1J1XH 1SM3L 1KEML 3HZVA 2PTTA 1YPZE 3NTCH 1P2CB 2APTA 4PJ7F 3ILQD 3L5HA 4F9LA 5JHDA 2Z8WC 4QTIH 1XZ0A 1TCMA 4U7KA 3VFGL 3WL9B 3V0VB 3BDYL 1FYTB 1QSFD 3G5YA 4YXHH 1LO5B 1JYXA 4PB9L 4BA8A 4LSUH 2WLZA 3LCYA 2X4NA 1AC0A 3H3BC 4QRTA 1NJ9A 3BPLC 4XPHL 2WNGA 1LHZA 4CW1B 1QBML 1BVKB 2DKSA 3FQUA 5D70L 2P8MA 3S37L 1C8PA 4XAWL 2FH6A 1FO0B 4NKIL 4OM0H 2WWMC 3PHQA 4AQOA 1O5DT 2QQLH 4M93B 4XVJL 3D69B 4PJ9B 4WWKD 1A7PL 5KSBA 4YDLC 2Q76B 1MJ7H 2VLKD 4JR9H 3P73A 1EVTC 4G9FE 2FECL 1JF1A 4XP9L 3GRWA 4MZ3A 5IB4B 5IP4A 1SM3H 1KEMH 5CEYB 5KSVA 4B0MM 3RTQA 1TMCA 4DUWA 1JNJA 4WW2B 5C09D 3O2DA 2L7JA 2OI9A 5CJBA 5C9JB 1FCCA 3C60B 3ULUE 1Y6KR 3KPPA 3TCXA 2HJFA 3VFGH 2P46B 3BDYH 5CJXA 4HWBH 3L7FB 5FAAA 1KT2B 4NCDA 4PB9H 1S7UA 2GTWB 1LVEA 3DBXB 4JDZA 4LMQI 3QI9B 2ESVD 4OLWH 1JYNA 4M7ZC 2YPLD 1U2HA 4XPHH 1QBMH 2IMMA 5I1KL 2WANA 5AYQA 1AHWC 3GSXB 3S37H 4YPGA 3AM8C 4XAWH 1XF3A 4PJGF 4NKIH 1GXEA 2F54E 5I18L 3RIAK 5FA3A 5B3JF 1PZ5A 4XVJH 4DFIA 1A7PH 1NC2D 2SEBA 1INQA 1RPQA 1OGAD 3DUUA 2NXZD 1FV1A 3VXSD 1QO3A 1XFPA 3FN0L 1FNGB 1IC7L 4JFDE 1BZQK 1HK6A 4HUMB 4PJCE 5E2UH 1P7QB 1HKLL 1PEZA 2ITCB 5E2JA 5A1AA 2BNQB 5I1AA 3OF6A 4I5BA 4PGEB 2PW1B 1MUJB 5CZVL 5FYJE 4S0SD 4Y4HD 3CUPB 1MHHA 3BPOB 1J87A 3DTXA 3GBML 1F11A 1IGTB 3STLB 4EI5C 1KB5A 4PRPA 1JN6A 4PJXB 4X4YA 3O41B 2NW2A 3HZMB 1P6AB 4AENA 1SYVA 1S9KC 4WTXA 1B6DA 2BVOA 5KTEH 2RIKA 1G7IB 1I1AD 5I1KH 5D9SA 2DLFL 4LLMA 4PRAB 1OOAA 1CFTA 4XT1C 4YHMH 2Z91A 3JUYA 2V5TA 5IESL 5HVHC 5I18H 2AK4E 2GY5A 3RZCD 5EZOL 3L3KB 3MLUL 4KV5E 4LLVB 5JZ7D 1A2YB 1WGOA 3S36H 1F4WL 1T1XB 1TENA 4HLZG 5HGHA 4PY7B 2NY4C 1BX2A 4GXVH 3MRDB 3FN0H 5FO8B 1KCGC 1IC7H 4KK9D 5BCAA 1HKLH 3PABA 3OBAA 1A6AA 2IMNA 3HRPA 5J11B 3I6KB 3RWIB 2BJMH 5CZVH 3VFSB 1VCAA 3KLSA 4N0RA 2VQ1A 2HYMA 4X9GA 5ANMB 4AMKL 3TJHC 4C58B 1FZKA 3ORJA 1A3RL 3WNKA 3HR5A 5HYSB 2NY3D 4P2RA 2I5YL 2JCCA 3HI1B 4RIRA 2EIZA 4XBPA 3D2UD 2IFGA 1I9RL 2DLFH 3CVHL 5F1IB 1JIBA 3BRFA 3KYNA 2NR6D 2V9TA 1MVUB 5IESH 1A1OB 1RQ5A 2OZ4A 5DVOA 4NQCB 1N7ML 2YRLA 5ESAB 1IL1A 2OXHA 3NGBC 3GJEA 3PGDA 4MD5B 5E08L 4Z7UE 1DQLH 4F58L 1KPVA 1PBYA 3DI3B 5I8KL 3NA9L 4RGNB 5F97E 2OQJA 4X6CA 5EZLA 1I8LC 1ZVSB 3AS3A 4NO0D 2X70B 4R0LB 4MGXA 4O51B 1OP3K 4ELMF 5DR5L 1PG7L 2J8HA 3QT2A 5IBUB 1JPTL 1CE1H 4FXGA 4JZOB 3T4YA 3EDDA 5JORA 3PIQB 5KJRL 3PL6B 1BZ9B 1A3RH 1PKQE 2YD4A 5A16B 1VKXA 3DMMA 1G9EA 4PG9B 4AH2A 5FYLE 3NCBB 3KLHC 3MLRH 1X5GA 4C57C 2XWBB 2NQCA 2NY0D 2OMBA 3CVHH 3KLDA 1FN4B 1F4AA 4LLDB 5LJYH 5B3NA 1AQDB 4UBDC 1UWXK 3WJLC 5DQDL 2QSVA 3VGEA 5B38B 5C0RL 1PG7W 3FJTA 5DGRA 1N7MH 1RZJC 2XXCB 2YC1B 5AUMA 1U8MB 1JPGB 1UH2A 2ITDB 3ZZ1A 1S9XB 5E08H 5ACZA 1Q94A 2YSSB 5ETUA 2CIIA 5I8KH 1TZIB 3NA9H 4J8RA 4Z7OE 4IRSC 5HYQA 2AJSL 5HY9B 2XTJE 5EO1A 1JPST 1KELL 5CGYD 2PO6B 5DEZA 5SV3A 4XCCH 3QCTL 4I3SL 1YEHL 2UVEA 2JB6A 3QFDB 4Y5XB 3H9HB 3FHQA 1H3WM 2HT4C 4U1KA 5DR5H 3LKOA 1PG7H 3FQXB 5D71H 1JPTH 1CICD 4PJFB 5DD1L 3TBYA 4M4PA 5KJRH 2IBGA 2VLLB 1FL3B 3O6FB 4RQQA 3CFEA 3BEVA 4F7MB 5JO5A 1Q8MA 4XP1L 5JXAL 3EJZC 5SWSE 1F4XL 4R2GB 5IKCB 3TBVB 1C7TA 1G1YA 4XPGL 5IWLA 3BKML 4NIKB 3GO1L 5C0RH 2H2PD 4KRMB 4Z0XA 4HUUB 4M6OH 1S9WA 4QY8A 3TZVD 2EDXA 2ADGA 1RUAH 2A6DA 2EKSB 1T7VA 2D7TL 5DSCA 3UX9B 43C9A 4G43B 2P7TB 4U1SB 2Q1EA 2D0HA 3RGVA 4GFTB 2VQUA 4XH2A 3PXHA 4DZBB 4D0DB 3IVKB 2AJSH 2IALB 2Z9TA 4M93C 3RPKA 1M7DA 2NNAB 4PJ9C 4NOFA 5IBUG 3B2VH 3QCTH 4I3SH 1YEHH 3K4ZA 5E6ZA 2CJUL 1YYLH 4PFEA 4I0KA 4BYHA 4UILL 5JIKA 1YEGH 3REVA 1IGFL 3CCHB 1NGXA 5DD1H 1BJ8A 1GGIH 2OJEB 4JKMA 4XB8A 2F8VA 1AGCB 1SBSL 3QDGE 4WW2C 2WLYA 1N4XH 2CRIA 3DV4B 1U36A 4UB0H 3C60C 3LKPB 3IETA 1TZHA 1CDBA 3MSPA 4XP1H 5JXAH 5MERA 3GB7A 5I1EL 1F4XH 2B1HL 3PWPD 3ERYA 2X9XA 3S4SA 2AXGA 4XPGH 4P4KD 3RJDA 5BV7L 4PIRF 3QI9C 3BKMH 3SGDI 3GO1H 1MCPL 5TDPB 4P2QA 4XVUD 1EEQA 4WFFD 5HDBE 5IVNA 1FRGL 1EEYA 5LGKA 4NBYB 4NKMB 4MJID 2BNUB 3PWUB 2D7TH 1V3KA 2BSSB 3QA3A 1PD6A 2ZG2A 4Y7MA 2W1NA 3SY0B 1I8KA 2P8PB 1JFQH 3BO8B 1K5NA 4TTDC 2CJUH 5GS3A 4QOKD 4HBQA 4LOUC 4UILH 4W4OC 1S9VB 4AYFA 3FO9B 1OP5K 5EN2B 1IGFH 1EBPA 1BVLB 2VR9A 1SBSH 4P46B 1NFDB 2D7MA 4L1HA 4HPYL 4PJ5D 3RL1B 5TQ0H 4ETQB 3MR9B 3BPOC 4N0CA 1JI2A 3MRRA 1MCLA 5LVEA 5I1EH 2B1HH 2B4CC 4LRNL 3HG1A 2YBRA 5BV7H 1MSPA 2CUHA 1T0MA 4HXAL 4K07A 3T4AA 3QWRD 3CX2A 4HKZB 1XF2B 1MLCA 4JFEE 1CDJA 2Q87A 1CFNB 2YPKB 5B21A 43CAA 1FRGH 1OB1A 4X5LA 4NNYA 4WI9A 3SN6N 2FGWL 3QULB 1LNUB 3VWJB 4MA7L 1DEDA 3MBEB 1QLEL 1AE6L 4OI7A 4K2UL 2MFNA 1CG9A 1U3ZA 5BZWA 4WI8A 1F3DH 4XWOC 1DFBL 4KKLC 4N5EA 3O6ML 4MXQD 3ARGB 1W8OA 4NUJB 3GSQB 2HJKB 5F3HA 4G8EA 4I9WE 3RWFA 4J12A 3G6AA 4XI5D 5E9DE 4HZAA 5CHNB 4TN9A 4ONOA 5J11C 1XCTA 4HPYH 3CVHB 5T1LA 1LK2B 2D7NA 4G9FD 2CUMA 4I0CC 4PRDB 4OZIB 3L9RA 3L7EB 4QO1A 2YOCA 4Y1AA 3PP3K 5EU3B 5MENA 1YQ2A 1HQ4A 5FECB 3Q3GA 5ICZA 5I1IL 2JK5A 4X6EB 4PJ8A 3SKUD 3IS0X 5JXEA 1S7WB 2A0LD 5K9QI 3PV6B 5MI0B 3MNVB 3O11A 1RK0A 1DANU 3LOWA 3MV9A 1C16A 2FATL 1OAYL 2A83B 3KPSD 3RI5K 1HH6B 2DWDB 2YA2A 5HSFA 1V3MA 4FN0A 4MA7H 1XR8B 1QLEH 4HUNB 1QBLL 1AE6H 5K59F 4K2UH 4OCSL 2FEEL 3IDGB 1HINL 1DFBH 1EPFA 5BRZD 3O6MH 3ZKXB 1A9BA 1RHHA 3R06B 4NM8L 3OKYA 3VFOA 5BOZG 4YEFA 4RGNC 3V6ZB 2HKHL 1GOFA 4ISVA 2B39A 3EYSL 4N0FA 3SJVB 1EUTA 4R0LC 3ARVA 4JFDD 4LCYA 1A3LL 2H45A 3NZ8B 1J8HE 5KOVC 3KXFB 3VRLE 3RPIB 4YAQA 4KKNA 4EOWL 3PL6C 5I1IH 1IQDA 4K7FB 4U6XB 1QRND 3QO0B 3HNSL 4CMHB 4G6KL 5J1TC 4KK8C 3RIFF 1JGUH 4G6AD 4XP5L 2DOCA 5HHME 3Q5YA 5EC2A 3ABZA 4J3XA 4CAGA 1FFRA 1E4KC 2FATH 4NDMB 5L8KB 5EUKA 3MV11 3VE0B 2LVCA 4ZUSA 1QLFA 4HF5L 1QBLH 5HYJE 3MMEB 4OCSH 4BH8B 3VXOA 3MV7B 3GM0A 4LHUD 4XXCA 3AS1A 3NA4A 1J11A 4NQED 4D9RE 1VFOA 2R0LL 5I15L 2HFFA 1M7XA 3INUL 5CGTA 3C5SB 3VCLB 4Z7VA 2HKHH 3FAXA 2PO6C 2XY2A 3GI8L 4S1SL 3QQ3B 4QHMA 4Y5XC 2QEJA 2VJXA 4S0TD 4RAUB 2AXHA 3MRQB 5ERWB 3VI3E 1A3LH 3LS5L 2DQHL 1IM3A 2GFBA 2JIXB 4X5WA 2BHZA 5D1ZA 3QQ9C 3TA3D 3FHAA 2CSPA 5HHVL 4I4WA 1S78C 4Q97A 1NGWA 1WWAX 3O6FC 3HNSH 4G6KH 4TNVK 3OAZK 4ZSOA 5IMKB 1FNEB 1G7HA 3UJIL 4P4RA 4XP5H 1ADQL 3S5LB 4NO3B 4OZGF 5J3HC 3L3OB 4R2GC 3V6OE 1A1MB 3FFCB 1FVCB 2UWEE 1FZJA 1MI5A 1U95A 4HF5H 1NGZB 1DQJA 3VXMD 5DJDB 4YWGL 4Z18A 3QUYA 1U3HB 1Z0NA 3CZFA 1P84J 2R0LH 4QHLA 2EDRA 1RAMA 2BC4A 5I15H 5DK2B 1EGJA 3INUH 4M4RA 4JQXC 3BN9C 2D9CA 3T04D 3E6HB 1NLDL 1UQSA 4ZOCA 4NNPL 3LB6D 4P3DB 4S1SH 5IHZB 2BXZA 3HAEB 1QFWI 2W0KA 3SDDB 2CLRB 2J3SA 5BV7B 4PJAE 3LS5H 4MWFB 2DQHH 1RJZA 3DSFL 3RY5A 1Z5LB 2FEDD 3U0WL 2XI9A 4FTVB 1XR9B 4UT6L 5IW1B 4KK5C 5HHVH 4FQ1L 1U8PA 4HUKB 4LKXA 5E8EA 3R0NA 3UJIH 2RR3A 4IMKA 1ADQH 2G5BB 1J0HA 1HHJB 1S7RA 3PWJB 4OZHB 4QTHB 3EYQD 1XH3B 4JAMB 4YHOL 2PN5A 2E7HA 1WZKA 2BOCA 5LAXB 5H37H 1R3LB 2VLMD 3F7RA 3KPRD 3D39E 4G6ML 4YWGH 5JUEL 3EO0B 1KLFA 3EDJA 5DHVA 4NQSB 4C83A 1N5AA 5GGSA 1NEZA 4GKOA 3RWHB 5TJWK 4LLQA 4OIAA 4NSKA 3LRSB 4GRMB 1PX3A 3OGOE 5DJ0A 4MNGB 1GL4B 2KPNA 1NLDH 5J6HA 1F02I 3ZHKA 4NNPH 4ZUUA 1ZA6A 2FSEA 3V95A 3QIUC 5KSBF 5BW7A 3U2SB 2K7QA 4O4YL 3DSFH 2NLJA 2J5LB 1DUZB 4L3CB 2R0WL 1G6RA 5DD0L 4UT6H 1A6WL 3QEUB 4P46C 3IU4H 4FQ1H 4PY8J 5C0BE 2BSTA 1KJMB 3V4VL 5CCKH 4JY5L 5DJCA 3OGCB 3KNBA 1OF2A 2ZG3A 5GISL 5BVPL 4U1MA 4YHOH 3VWKD 5KBNC 1VEOA 2A9ML 1TJGL 5EOCJ 2V7HA 4ZNEE 5I8OL 3DIFA 2CDFA 1CDUA 3TNMA 4X6DA 2PCPB 5IJKA 4V2CB 5JUEH 3V7AE 3PHOA 1WISA 3B2UC 4S2SA 3MJ8B 4P2OA 3P9LA 1M05B 2BVQA 1DEEB 4G42B 1UM6L 4QRRD 5IF0B 3VWJC 3QG6A 4HWEL 1PW3A 3HAEG 1J0YA 3MBEC 5EWIH 5I1DB 4JFFE 5KW9H 1U8NB 1D7FA 2IH3A 3ARBD 2IPKB 3SDCB 3TPUE 3ARGC 1YMMB 5LKNA 4XNXL 4O2FB 4KJPC 2F54A 1IC1A 1T5WB 3O8XD 4LKCA 4E5XA 3RHWK 3LAFA 3MRLB 2R0WH 3K4DA 1KIPA 3VD5A 3KYAA 1A6WH 3CFBB 4ZQKA 4M6AA 4WTZA 4Z6AT 3V4VH 5HJ3A 4JY5H 1OQXA 2DJUA 2GAZA 1H5BA 3BDBA 3CNKA 1UJ3B 1OAZL 4PJCA 3F7QA 4IRJD 5GISH 3QDGD 5BVPH 3ETBF 4FXKB 2A9MH 1TJGH 3KPNA 3MGOB 5T3ZH 5I8OH 1U93B 4I18B 1U9KA 1AI1H 3RL2B 5KOMC 4DGYL 5MI0C 4YHNB 3SKOA 3ZT7A 4N1EA 2FO4B 1X4ZA 4MQXC 4NN5C 1UM6H 5GGVL 4KRPD 3MLSL 4M7JL 4HWEH 1EERB 2P5ED 2GT9A 1QYGH 1HHIA 2ZG1A 4CU8A 1YN6B 5EU6E 1BHGA 4MA3A 3ZKXC 4XNXH 4JGUA 2AK4A 3P0YL 2J8UE 1MCQA 3TN0B 4L3ED 1MLBA 4N68A 1D5BB 4DCQB 1MOEA 1F13A 4K23L 1CGTA 5HGAB 1KCSL 4I8DA 3GRWL 4ZAKD 1BWMA 1OAZH 3WFHB 3E8UL 3BZDA 2XNAA 3KR3L 1T7XA 3DROA 1GGUA 4CMHC 2K3TA 1YNLL 2V9QA 4YHPB 3T77B 5E7FA 3ALWA 1U8OA 1OSZA 2YWZA 3KVQA 5DHXB 5BS0E 3CC5A 5DJAB 4QGTA 4U6TA 3NFNB 1MY7A 3SDXE 3FN9A 5CZKA 1JGDA 4JFED 1HQRB 3MLSH 3QDME 4M7JH 4EUPH 1N8ZB 1MIEL 3MLYL 1U8JB 4IMLA 2V7NB 3JXAA 2CQVA 2IANA 4HAGA 2NZ9C 4XAKD 5D7IE 3P0YH 3BPCB 1GPOL 5DRWA 5IEHB 3B43A 2GTZB 5L2KA 4I77L 3TO4A 1Q9OA 3VXUA 4D0BB 1WFOA 2MQ0A 4E0RB 1WBXA 1PYWB 2VZ3A 4LF3B 3W9DA 1KCSH 3GRWH 4ODHL 2O5YL 5LGHL 4LVNB 4JFQA 1HZHL 3E8UH 4WFED 1ZHLB 2CK0L 4V3DB 4NQDB 3B5TA 4NKDB 5DS8B 1ZHKA 3PP4H 5FUZL 4JDVB 1YNLH 2UY6A 3S8WA 2VSCA 5T1DL 1HHKA 3OHXB 3L3JB 1AGFA 4MQTB 5DA4A 3UBXB 4L4TB 3RDTB 3AB0B 6FABL 3BE1L 5E00A 1XGRB 4D8PA 1B0RB 5MEQA 1RJLB 1PKQA 1Y0LA 4Q9QL 4PREA 1LDPH 1HWHB 5JOPE 2CGRL 1JBJA 1R6VA 1BVZA 4MAUL 4PY8I 1D5MA 4CUCA 5IHUL 1MIEH 3MLYH 4LPUA 1ZGLM 1IAII 1U3HC 3QEQB 4Q9CA 3E3QC 4N5UA 3C5ZD 3OR6A 4WCYH 1S7XA 3MNZB 5TGBB 1GPOH 2V6HA 4RWYL 1UEYA 5I71B 2AVGA 2GSIA 3BP4A 2F5BL 4GW4B 4I77H 4MJ6B 5INCB 2RAMA 2D9QB 2HT2C 1AXTL 4DN3H 3SDDC 5BV7C 4GAYA 2O5YH 5LGHH 5A2FA 4M1GL 1JUFA 1FHGA 1HZHH 3TBSB 4X6FB 2CK0H 2QR0A 3OWEA 2GJ6B 1M6OA 4Z8FL 4JFHE 5FUZH 1MFDL 2BCKA 1TTFA 1JHKL 3GMLB 1D5XA 1J8HD 4IIQB 5IB2B 1F3JB 3ARDA 1MH5A 3BE1H 4HULB 4PRNA 4HMEA 1MAKA 1U6AL 4WGWB 1ETZB 5DMGC 2XKSA 4KJQC 4Q74A 4ORGA 4Q9QH 4TRPH 1DQDL 3SGEH 2CGRH 4WNQA 3EFFB 2VR4A 4LP5A 2RHEA 4MAUH 4R3SB 4JZNA 5HHMD 5IHUH 3UDWC 3U9PL 5CD3A 4P57B 5SWSA 5D6CB 4ERSH 1DTUA 3MRHA 1U41A 4MJ5A 1PGRB 2FL5B 1UEMA 2C3GA 5DK3A 2D7OA 3MO1A 4OLXL 1QG3A 5H37G 4RWYH 3CFDA 4FQXA 1EO7A 4NPYB 2F5BH 5EPMB 4YNYA 1JWMB 1LD9B 4D9RD 3T2NL 4DKAA 1HEZB 2X1OA 1NANH 3GIZL 1AXTH 4FFZL 5C0EB 1EO8L 1HSBA 4P5KA 3QZWB 1JNHB 4M1GH 1NC4A 2J5LC 4G8GD 4JJHA 1FQ9C 4JFOA 5DJYA 5C0GB 5CJ8A 1KV3A 2X1PA 4LGRB 1MFDH 1AP2B 1CVRA 4HZLA 4I0PA 1JHKH 1CLYL 4OAWB 5MEOB 1SEBB 1U6AH 2IFFL 1UWGL 4HIIB 1MEXL 4KQ4L 2ARJQ 4KUZL 2BNQE 5F1SA 5E70A 1B4RA 1TVBA 1T83A 5SX4I 4R4BA 2BVUA 2VH5L 5JTWA 3O3AA 3K2MC 2Q86A 4L3AA 2XPGA 4BK4A 5IMMA 4C56D 1RJYB 3MA7A 4PJXE 1YNTA 5EO9B 4OLXH 2ZUVA 2ZOKB 4G80A 4OBRA 1T2QL 5EU5A 5TDOB 4JVPA 3RAJL 4BSVA 2NZIA 5IB5B 3SDCC 3GIZH 4FFZH 4Y4FB 1NMCB 2ZPKL 4MDIA 3FB7B 3EGSA 2IBZX 5HI5C 2DQIL 1BJ1J 2QLVB 5JHDB 5C71A 1XZ0B 5DFWH 1VPOH 4F2MA 2WMPA 3N1GC 3VXTB 2Z31B 1FL6B 3FOLA 1DQTA 4LQFL 5F7EL 1MFCL 4P9MH 1CGWA 2KUTA 2X4NB 1PY4A 3T09A 3HUJE 1UJ3C 4QRTB 1NJ9B 4NJ9L 1UWGH 1P4IL 3I02B 5ENWA 1MEXH 4KQ4H 1WFNA 4KUZH 5CLWA 4I18C 3K80A 1LO2L 2CDGA 2F53A 5ALCL 5J8OA 2VH5H 3PHQB 1R5VA 3X3GH 3D87B 5T3XE 1S7TB 5JLZA 1BBJA 5KSBB 4OFYA 4P5TA 6CGTA 4P9HH 3OSKA 3ZT6A 3QISA 4JFPB 1KENL 5CKAA 5F1KC 3QUXB 2NX5A 5IV2B 3QZWG 1JF1B 1T2QH 2FZ3B 3ARZA 4JB9L 5DEFA 2XY1A 3RAJH 1E28B 1JV5A 1CXEA 1CT8A 2DKUA 3X12A 5KSVB 2YD5A 5E94A 3RTQB 2Y23A 3GDBA 1TMCB 2ARJA 1LE5B 2ZPKH 3EOBA 2V2WA 1UXSB 2DQIH 3IFOA 3TN0C 4X6BB 1L0QA 1MCJA 1R5IA 3KPPB 4F33A 2HJFB 1DSFL 4JHAH 2ADJA 4NQCE 4JRYD 1A5FL 5D1XB 4LQFH 4GO6B 1S7UB 1ZS8A 4JDZB 1WK0A 4U4BA 2Q6WA 2UZIL 1QHPA 5E9DA 4NJ9H 5C0BD 3ZE0E 1P4IH 4JDTH 4P59L 4LHJB 1OAUH 1LO2H 1XF3B 4TULL 4NRZA 2BNRD 2BXYA 4YHIA 1YQVL 1CFQB 2WBJA 5F1NA 4XNMB 4Y16D 1INQB 3KAAA 3F7PC 4OUUA 1ORQA 1INEL 3DUUB 4N8VA 5GGRA 1KENH 3MFFA 4W68A 4CN1A 1L4IA 4JB9H 5IQ9A 3P3YA 1HYSC 4RDQG 4H0HB 3T3MF 4ZFFA 1XCQA 5I1AB 3TVMD 4I5BB 3MXWL 4PJHB 4Y8DC 3JVGC 4JFFD 4WHYH 2Z8SA 3T0EB 5CBAA 2Z92B 5EU4A 2G60L 2C1PA 3DTXB 1R24A 3BVNB 1CCZA 3V6BR 1F11B 1RMFL 1A5FH 1UZ6F 4XC1L 1GGCL 1L7IL 5DVKA 3LEXA 4X4YB 5DJXB 4JG1L 1GGBL 4LVNC 2VDLL 2NW2B 2AQ2A 2UZIH 3U1SL 4AENB 1SYVB 1IBGL 3A67L 1UYWL 2BVOB 2BDNL 2BRRL 3AMKA 3HTLX 3LKQA 3IFLL 3QUMA 5D9SB 3L5XL 1OTUC 2NY2B 4LLMB 1HI6B 3BEWA 4JPIA 1J0ZA 5E2TL 2Z91B 2VDKL 4TULH 4XPFL 3HI6L 3RDTC 1YQVH 3AB0C 1FNLA 3JWDL 4BQBA 2QL1A 3QRGH 3TLRA 5D1QD 4B5EA 4M3KB 2A6IA 1INEH 4PJFE 1BX2B 4AT6A 3E0GA 5EDXA 4ZPTA 1NCCH 5DFVD 5DLML 4XPBL 3VXPA 3PABB 4BH7A 3TJHD 15C8H 1A6AB 3T2QA 5C8JB 3MXWH 4D94A 2EE9A 5JPNA 5BQ7A 4GAGL 3SDAB 5CWSA 5HYJA 5I71C 2G60H 4ZS6D 4LLAA 1FZKB 1L7IH 1U91A 4FFYL 2MQCA 1DUYA 1RUKL 1GGBH 3GMRA 4GQ9L 4JG1H 2APXA 2VDLH 3HR5B 5CEXB 3U1SH 1G7JA 1IBGH 3A67H 2BDNH 2BRRH 2JCCB 2EIZB 4XBPB 3IFLH 1ZHBB 3MGTA 1RIHL 3L5XH 3ESUF 3ARXA 1RHFA 3QO1A 5E2TH 1RVFL 2DTMH 1BQUA 3HCVA 1G9ML 4HC1A 4XPFH 4E41D 1YN7A 4IIQC 3HI6H 4MQ7A 3VFMB 3JWDH 2EE3A 4JZJA 1IL1B 3SO3B 2R23A 2A74B 1NAMA 3GJEB 4X8JB 1VA9A 4JN2A 3QWOA 1YEFL 2DMBA 2NTFA 5ID1A 2YK1L 1KPVB 3ARUA 4YHYB 5JDSA 1N26A 4R96A 4JM2B 4JFZL 4M02A 4UV4L 5DLMH 4XPBH 2OQJB 1I3UA 4X6CB 3GMPA 2XTLA 5J56B 5EZLB 5C6TL 4FP8L 4DUXA 3QDMD 1MCFA 5CFHA 2PF6A 4K8RL 4NJAL 2QJDA 1J0IA 1K8IA 1DQQA 3FRUA 2D31A 1X5JA 3G6JF 4GAGH 3GBLA 3KLHD 5C0CD 2DLGA 5MHSD 4XXDA 4MXVF 4LCWA 4XGZB 1NBYA 4FXGB 4JKWA 5JORB 4N8CL 1BP3B 1RUKH 4GQ9H 5IOPA 3BP5A 2J88L 4UBDD 4DN4L 3MLWL 3EAKA 3ZL4L 1RIHH 5TF1L 1QFPA 1RVFH 1AD0A 4M00A 1G9MH 4KRNA 2XZAL 3H9SA 1I7UA 2IADA 3UYRL 1PSKL 2BVTA 3FONA 3DHJA 5AUMB 3U79A 1YEFH 5ACZB 1EJOL 5ETUB 2YK1H 4HJGA 2CIIB 4U33A 4OFVA 1NFDE 4RFNB 1CZ8L 4J8RB 4JFZH 4UV7L 5DI8B 1QSEB 2HT4D 5EORL 3N85L 4WIQA 1F4HA 1YYML 4FP8H 3WO4B 3FQRA 1AD9B 5JOPD 1DL7L 3MRCA 4OGYL 4RAHA 1S7SA 4NJAH 5IG7A 1CDIA 4NWUL 3D39A 1LO4H 5FKPA 4U1KB 3LKOB 5DO2C 3TBYB 2A6JA 4N8CH 4Y4FC 1NMCC 1PJ9A 2J88H 4F9LC 1FZOB 4DN4H 3BEVB 2XICA 3RWEA 2YPLA 3ZL4H 1FDLL 5TF1H 2Z31C 3ZYOA 3O6LL 4IM8A 1JWUA 4OIBA 5KVMC 4U1JB 5A2IH 1KJ2A 3DYOA 4MAYD 1LWRA 4ZODA 2XZAH 4M8VA 5DD6B 1PSKH 1OPGL 3BD4A 1CN4A 2X4RA 3MBXL 4QY8B 5DRZA 2ADGB 2A6DB 4GSDL 3QEGL 5DSCB 43C9B 4L8DA 4L8SB 3T1FB 1U58A 4LASH 1EJOH 3BT2H 3RGVB 3I9GL 4RMVA 4G8FB 4XH2B 1CZ8H 2X89D 4PTTA 4UV7H 4NRXA 5EORH 4LLUA 3ULUF 3N85H 4OZIE 1M7DB 3F65A 4YGVB 2XXMB 1YYMH 2H41A 3GMMA 3REWA 4DKDC 3ZKND 2Z93A 4OGYH 3C8KB 1AKJB 3QUXC 3EYUL 4NWUH 4HKXA 3CPLA 5HI4D 2ICCA 3C60D 1HH9A 4LSRL 4MYWB 5BVJA 3REVB 3KPTA 5B3JE 3IS1X 1A4JA 3RTQC 3GKZA 3WUZA 3WFCL 1GVIA 4EI5A 4HWNA 4O5LL 3MV01 1LEIB 1EGJL 4RAVA 5ICYA 3ULSB 4MCZA 1MF2L 1TZHB 4D3CL 1FDLH 5CJXC 5MERB 2BX5A 5D1XC 1I1AA 3U4AA 3S4SB 3O6LH 1NCUA 2AXGB 3O9WB 3H7BA 2MHAA 4B53A 1H0DA 1I8MA 1OPGH 2V2TA 3MBXH 4O58L 4GSDH 3QEGH 4PJCF 3ZKSD 3QA3B 4OCYL 1MFNA 1HSAA 4OKDA 4TTDD 3SJVE 3UPAA 4RX4D 4OD3L 5CIPH 4F8TA 1Q9KA 5DA0B 2QSCL 3HB3C 4Y2DD 2AKRA 5E5UB 1P7QD 4P2YA 1MAML 1JNLH 2BNQD 3KXFE 3F5WA 3BGFB 3WCYA 3F62A 4X99A 1WVZA 3EYUH 2C1OA 3ZDZE 5IM7A 4XCYA 4LSRH 1UT9A 1QACA 1AGDA 1IRAY 2FJHB 5DQ9A 3MOAL 3NCMA 2ZCLL 4LLYB 3WFCH 4U7MA 5L9DL 4O5LH 4K71B 1EGJH 3GMQA 4ODXA 3T0EC 1MF2H 5H35A 5JNYB 1A6ZA 1X6NA 5JQHC 1T3FA 4D3CH 3MRRB 1U92A 4QXTB 2VDNL 2HP4A 4HSQA 1NPUA 4HW6A 3HG1B 2P5WA 3NZHL 2YBRB 1XF5A 3MV7E 4R7NA 1FFNB 1T0MB 1TIUA 2J8UA 1MLCB 4PUBL 1G6RL 2N7BA 4O58H 1OB1B 2NY2C 4MA1B 2C5DC 2NMSA 4F57L 2HT3C 4OCYH 4XWOD 3QP3A 4KKLD 4OD3H 1Z2KA 4HK0B 3QXAA 3RIAF 3LQZB 1XF4A 2IBZY 1JZ7A 3VFVB 1NBZA 2NTSP 1MAMH 2UUDK 5BZWB 5BOPA 3TEUA 1I8LA 2X1WL 3RY6C 3O45B 4HXBL 5IIEA 2ZUQB 3EHBD 5T3XD 3DO3A 1PQZA 3G6AB 2AI0H 5BS0A 4J1UB 3IFPA 3MOAH 2ZCLH 3RNKA 1LO0L 3BGMA 3S4SG 1Z0MA 5T1LB 5F7MC 5FHBL 1EFXB 3LD8B 3FFCE 5J6GA 3SDAC 4UQ3A 4K7PL 4BZYA 2VDNH 5MENB 2P43B 1XIWB 4S1DD 1HQ4B 3KPOA 3Q3GB 3NZHH 5FM4A 2P47B 1Y6NR 5ID0A 3E3QE 4Z7UF 4PUBH 1BWWA 1G6RH 3WJLA 3D3VB 4WU7A 3O11B 3MV9B 4F57H 1F6AA 2HKFL 3BQUB 3QNYA 3BMVA 2XZCH 4NHUA 4GKNA 3QHZL 1U8LA 1KNOA 5CUSL 3SO3C 3T2OA 2D3VA 2QHRL 4IRSA 4KI5D 8FABA 1SYSA 3VA2C 1JTOA 1UB6B 4FTVE 5GRYA 3WE6A 4YHYC 4Y19A 4HXBH 1RHHB 2FIKA 4Y8AA 5DEGB 4JM2C 2I60L 2J2ZA 3U9UA 4N90D 1CICA 4OZHE 1LO0H 1G7MB 4TNWF 4RA3A 5FHBH 2BP3A 4KK8D 3V0AC 4K7PH 3H2WA 4M6NL 1RSFA 4YAQB 3UCRA 1FYTA 3TIEA 4PRID 2YZ1A 1K4CA 4ZUWA 1I9IL 4CVZB 4F7EA 1BD2B 5E56A 3MRNA 4BQ9A 2AQ3A 1BVKA 4MHHG 4MNGE 2HKFH 5HD8C 4DVBA 4WI4A 3QHZH 2ZKHL 2DQJL 1FO0A 3LSOB 5CUSH 2M2DA 3MV8B 5I2IA 4UQ2A 2QHRH 5GZOD 2Z8RA 3MUY1 5JIPA 3VXOB 3U46A 3CIQA 3D69A 2Q76A 3ZTJH 2QTEA 4RFNC 2FGZA 2ED8A 2YA1A 3CAFA 3VGDA 2I60H 4Z7VB 2YD2A 5IB4A 3WO4C 2EDTA 5E2WL 3ES6A 4APQD 3UAJD 4QHMB 4FA8A 3O2VL 5J4MA 1OW0C 1RZ7H 5C9JA 1IM3B 2GFBB 1XGQB 4M6NH 3ET9F 3P11L 4X5WB 5D1ZB 4O9HL 4PPTA 4R2GD 3GI9L 1MCRA 4I4WB 1NGWB 4HMCA 3OXRB 2GTWA 3QI9A 1I9IH 4TOYL 4X7TA 1GZQA 3QHFL 5CIPB 2EECA 4J3OC 5IWLC 1MI5B 3TT3L 1U95B 1YMME 2DQJH 2ZKHH 1T2JA 4CL7A 1FCGA 1DQJB 4IRZL 1P6FA 2WWKT 3BN9D 3QUYB 4JG0H 2YD7A 3KS0H 4L8SC 3CZFB 1CXLA 4YBLB 3BXNB 5JMOC 1ZVYA 1RZKL 4QHLB 3RGVC 5HHPB 3QAZB 1W2KT 3H0TA 4YR6A 3MLTA 3SKMA 2WIMA 1AGEB 1FNGA 5E2WH 1UQSB 5DYOA 1T6WA 3CMOL 2ITCA 4OLZL 5ABDE 3O2VH 1GGYA 4PBVC 1G9NL 4RCAA 2PW1A 1J88A 2YUVA 3CGTA 1MUJA 3C6SA 5A2LH 3P11H 3HMXL 4O9HH 3VXRD 3KLAA 3GI9H 4HJJL 4GRLB 4H1LH 4PJXA 4WFGD 3KPLA 5F9JB 2ED7A 1XF1A 5IB1B 1N59A 5I30L 4TOYH 3HZMA 1S7RB 4HUXA 1LP9A 3QHFH 3O9WC 4OLYL 3OMZA 2DJ4A 3BKYL 4G6FD 4XNZB 2BOCB 3IDYB 4GT7A 5A2JH 3TT3H 1V5JA 2JJWA 1F3DJ 3LY6A 2A2QT 2H3NA 2FX7L 4OUOA 4IRZH 5D2NA 4R4NC 3L3KA 4FABL 4LLVA 1N5AB 5DZLA 1A2YA 4JRXB 4CKVX 1J9CT 1RZKH 4PY7A 4NSKB 2XFXA 1CFBA 5FOJA 3CSGA 1BFTA 3FB5A 5DJ0B 3VFNA 1MCBA 3X11B 1ZA6B 4OLZH 2FSEB 3BGFC 5CBEA 1ZLSL 2EE6A 1G9NH 3BIKB 3JV4B 3RWIA 2NLJB 4ODWA 4U1IB 3S3SA 4OLUL 3HMXH 1G6RB 5ANMA 5H2BA 4K71C 2NPLX 4XMKL 5EU7C 5DJCB 4TUKL 5DRNA 1L6XA 5IFHL 1KCLA 1EHNA 4HG4K 2ZWLT 2X4PA 5HYSA 5I30H 2XQYG 4HGWB 3JWDC 3HI1A 3U30B 4U1MB 1CL7L 4OLYH 1ROWA 3BKYH 1MCDA 2EH8H 2WP3T 4J2XA 4X6DB 2FX7H 3PUCA 2H26A 3IAQA 4FABH 1NBVH 4MA1C 4NQCA 5ESAA 4S2SB 4P2OB 3P9LB 3LV3B 2BVQB 5L2JB 1U8KA 4MD5A 5E6IB 2VAAB 2I27N 3VGHA 2XOTA 4U1GB 5B4MC 2E9BA 2IH3B 2GW5A 4N5EC 4NQDE 2V17H 4HIEA 2ZUQC 2JE8A 1BREA 4LKCB 2X70A 4E5XB 4R0LA 4Y2OA 1NMAL 5DJ6B 2FX9L 3DETC 4OLUH 1KIPB 3B4NA 4L4TE 4CDHA 4ZQKB 4CN4A 2WWKO 1RUPL 4JZOA 1TTUA 4J3VA 4XMKH 3LD8C 5HJ3B 1BZ9A 4TUKH 3MZTA 5EUOA 1U42A 5IFHH 4PG9A 1G9MC 1I7ZA 1NGPL 4CNIB 1SEQH 1XIWC 1CL7H 1NEZG 5FYKD 1IGJA 4CVXA 3QEQE 1E4KA 2R15A 1Q1JH 1AQDA 2VDML 2NXYD 3MCKA 2C4FT 5B38A 5C08A 3P4LA 3WNNA 4WI5A 1UWXH 4YIQB 3SKOB 1VFUA 2YC1A 4MXWL 1JPGA 4KGJA 2A73A 3BQUC 3LEVL 1S9XA 5J06A 1FG2A 2YSSA 4K8RC 2B1AH 1CIDA 1B6UA 1TZIA 2GT9B 1IILE 1XAUA 3QCVL 3U7YL 3SJVD 4LPCA 3HE6B 4MA3B 3TC9A 2GJ6E 4Z95L 4HWBA 1HDMB 2H9GB 4Y5XA 3STBA 3ZMRA 4HLJA 3TYGL 3H9HA 1NMAH 4JEGB 5J0BA 2FX9H 5CZXC 4JQVC 5IBLC 3IDIB 3SQOL 4GG6A 1MLBB 4GW5B 3SKJL 3FQXA 3KXFD 3TA3A 1RUPH 4I3RL 4PJFA 1OAQL 4U3XA 2EDBA 3AAZB 3O6FA 1DE4A 4RNRB 1NGPH 3C2SA 2XNAB 3EYOA 4F7MA 3N1FC 3DROB 2CLZA 3K8MA 5GJTL 4H8WH 4W70A 4BK5A 1JNNL 2VDMH 3VD7A 2MCG1 3EOYG 2VITA 1E6OL 4K55A 1OSZB 1ZKAA 4HUUA 2I9LA 1AO7B 3CXHJ 5D2LB 3CC5B 4MXWH 1A1NA 1NH6A 3LEVH 4G59A 3QH3A 1X7QA 4G43A 3VFUA 3QNXB 2BVPA 2GJZA 3VI3F 4IMLB 4DZBA 4D0DA 4NQVA 3QCVH 3ISWA 4JQXA 4XXCC 3U7YH 5HGBA 2IANB 4WTZG 4Z95H 1N0LA 2PKDA 3TYGH 2ZCKL 5DRWB 3SQOH 2WP3O 5DJ8A 3VI4F 4OV5B 2F58L 2JIXD 4PLKD 5DUML 5C7XL 5L2KB 3TO4B 5DGQA 1Q9OB 1SMOA 1H8OA 3VXUB 5KSAB 2EC9U 3BYYA 1P5UA 1AGCA 1WBXB 1M7IB 4YK4B 4KVNL 4NCC1 2OJZL 2H6PB 5D1ZC 1J1OL 3DX9A 1WZMA 4CDGC 3PHSA 5GJTH 1ZHKB 4YDKL 1FVDA 4ESKA 1JNNH 2YUWA 3W39B 3HI5L 4JGJA 1HHKB 4KKBD 3W0WD 3HNVL 3KPRA 5E24E 3C08L 1VFAB 4PYGA 1A14H 4RRPA 4D8PB 5MEQB 2FIRT 1U3JA 3PNWA 5D7JC 4GOSA 4PREB 4LDLB 4QYOA 2FHCA 4XNYL 2QADB 1D5MB 3DV6A 3I85A 5IROC 2WSKA 4XWGL 4PJAF 1UH4A 4PD4J 1T0NA 3VD3A 3QUYC 5K9JL 5JHDE 1MNUL 3DVFA 3RX7A 4F3FB 4YBLC 5F7KC 3SY0A 2P8PA 1YUHA 1CGYA 2HT2D 1JZ3A 1S7XB 3BO8A 3SDDD 3QAZC 3QIUA 2ZCKH 4JFXA 3EJYD 5F7HA 5E6YA 4YZFF 3D6GA 4JHWL 2F58H 4KDWA 4KKAD 5DUMH 1XGYL 3FO9A 2AW2A 5C7XH 1BZ7B 2GKIA 2HA1A 2FJGB 2FHBA 2ZUWA 4GAYB 3RL1A 1JUFB 1MCHA 2P24B 2OJZH 3QXDA 1H15A 1J1OH 4QF1B 1M6OB 9CGTA 2AEPH 3TJEL 2P48B 4GRLC 4YDKH 4PP1C 4TNVF 5ITBH 5KSBE 3HI5H 3RA7L 1YECL 3HNVH 3C08H 1HILB 3S98A 1WIOA 2HLAA 1CFNA 4PRNB 4XNZC 3IDYC 5HGGS 4WNQB 1KPUA 3QULA 1LNUA 1KXVC 4JZNB 4OD2A 4XWGH 2CO6B 4G3YL 5CD3B 4Z7WB 5E7BA 4LRIC 5K9JH 5SWZB 1MNUH 3MRHB 1MCOL 12E8L 1NCAL 2ED9A 1EHXA 4HC1L 3RVXC 4OT1L 1QA9B 2G9HB 5C92A 2BVEA 3GBNH 1F4YL 1NAML 4C4KT 3A6BL 4JHWH 1MQ8A 4V1DB 5IVXA 1XGYH 2JELL 2YD8A 3CFKB 4WEMB 3EYVB 3GSOB 1HSBB 3CVHA 4P5KB 3U7WL 2FDBP 2NYYC 4JY4B 5KAQG 4PRDA 4OZIA 1XGTA 2XN9D 5DJYB 1NFIB 3UTQA 1BF2A 4KUCF 3TJEH 3PP3H 1I1CA 5HHOD 5FECA 3J7HA 4HZLB 3RA7H 1YECH 4D9QD 2Y36H 2JB5L 5DC0A 2YD1A 3LIZL 3U30C 5DUPL 3JV6B 4WUUB 3SCMB 1TVBB 2W65A 4AK1A 4R4BB 3M17A 4G3YH 4PJHE 5D7KD 2CRZA 4LLWA 2XZQH 2Q86B 3T0EE 1WBZB 3OL2A 4P2OC 1MCOH 1NCAH 3IDGA 4HC1H 4OT1H 5E6IC 3MA7B 1YNTB 3CFIC 4AM0A 4LCUA 4FFWC 5F7FA 1F4YH 2EH7L 5EFIA 5HI5D 3A6BH 2ZSVA 1BQHA 4BSVB 4U1GC 4U31A 2BMKB 3V6ZA 5GS0D 4LIQL 2XKUA 3CZJA 2JELH 1UC6A 4OCNC 3BRGC 3U7WH 3CH1B 2BSRB 4U1HA 4Q0XL 2DM4A 1OD9A 3OKMB 4F2MB 3TFKC 3QHTC 3FOLB 4KAQL 4Z5RA 4OF0A 5CINL 4I48A 3JTSA 1XGPB 4K7FA 4X98A 4TPRL 3QO0A 4FG6C 3ZKMC 4OD1H 2JB5H 3RFZC 3LIZH 2DIAA 5A40E 2BK8A 2N1KA 1BFOA 1VADA 5DUPH 4EN3B 1A64A 5ENWB 4ONHA 2EDWA 5B39A 2KBGA 3SE3C 1ZHNA 5LWYL 2CDGB 2F53B 3VE0A 4KJWC 1R5VB 2J8UF 2AAVA 2D03L 3WNLA 4BH8A 4P5TB 1I7RA 2NX5B 4YBQD 4QRSB 5DEFB 2EH7H 5SX5K 4PJIA 3ZE2E 1T6VN 4LIQH 1CT8B 1UG9A 2JCCE 3X12B 4X80L 4NFBA 3HE6C 1S7QA 3C2AL 2ARJB 1AH1A 4Y89A 3QQ3A 3EOBB 2V2WB 3RHWF 4Q0XH 1S5HB 3IFOB 3TO2B 1R5IB 3MRQA 5DZNA 5ERWA 4Q6YA 4F33B 2ADJB 3QFJD 3QUZB 4KAQH 5CINH 4TPRH 2Q6WB 3BPNB 3UTSD 1JRHH 4L8BB 4OGAC 3OAZH 2EIEA 1DANT 4NO3A 3S5LA 5ISZD 3L3OA 1QFOA 1MCIA 4X6CE 1A1MA 1GZPA 3HE7B 5LWYH 3SEPA 3R0MA 1FVCA 4GAJL 4ENEC 2WBJB 3HN3A 5DJDA 5F1NB 3O0RL 1IZJA 2D03H 3UPCA 3UO1H 1U3HA 2NCMA 1ORQB 5GGRB 4N8VB 2WUBL 3BUTA 1MCCA 3MFFB 3VXNA 4ZUVB 2AV7A 2DDQL 2R2EA 4NUGL 5DK2A 2C3XA 1TITA 2EXWC 4M5YH 5I1CL 3B9VA 2CXGA 4X80H 2RBLA 5EBGA 1XCQB 2Q7YA 2PYED 3C2AH 1TLKA 1CLOL 4J7RA 5IHZA 3QJFA 4GBXD 4ZFOL 5EU4B 2P4AB 5KVEL 1R24B 3OX8B 1P5VA 1Z5LA 3KG5A 3NACL 3TO4C 3WDJA 1P53A 4FTVA 1XR9A 5KSAC 5IW1A 1H8NA 3LEXB 3LHPL 4YK4C 2WQRA 1MHCB 2XRAL 3NCJL 4HFUL 1C5DA 3T08A 1BF8A 4L4TD 3LKQB 2R4RL 2G5BA 1QSEE 3BEWB 4QTHA 4JAMA 3AFLA 5IMLB 1D5ZB 2FHFA 1FGNL 1RZKC 4GAJH 4ZS7L 5FV1L 3NCYS 4NZUL 3F7YB 2O93L 3MXVL 5C0AA 3UDWA 5HHXL 3O0RH 3EO0A 3QEQD 5E5MA 8CGTA 5A3IC 4RGOL 2WUBH 5SV4A 5C3TA 3RWHA 3RGHA 3NIGE 2QADC 2DDQH 1G9NC 1VESA 3EJJX 4NUGH 4ZPTB 2WV3A 3WIIL 3VRJB 1PLGL 4ZDHA 3FQWB 1IM9D 4BQ6A 2OM5A 4MNGA 1CLOH 1X3DA 4W6WB 5BQ7B 5FF6B 4JVUA 3D0LA 4OQTA 4K94L 3U2SA 5CWSB 5KVEH 5F72S 4L3CA 4JHBA 2GJ6D 4DGIH 3LHPH 3MA9L 1DUYB 2XRAH 3NCJH 4HFUH 1Y6MR 3QJHB 2D7QA 4WW2F 5E8DL 1G7JB 4Z77A 3MRGB 2R4RH 3EBAA 1J8KA 3MGTB 4YBHA 1W0WB 4OFPA 2AJXL 3QO1B 3N1QC 1B0GB 2CLVB 4N8VG 1FGNH 3HCVB 4ZS7H 3KDMA 4TVPD 1YN7B 1IGCL 4JCLA 4NZUH 4MQ7B 2J12B 2Y25A 5KZCB 4KK6C 3MXVH 4JZJB 2AJVH 5CP3H 3CMGA 2OR9L 3U36A 1NAMB 2APWA 4JN2B 4RGOH 2NTFB 3MNWA 2K1MA 3HZYA 4PRHD 3QDAA 5IF0A 5DJ2B 3FQNA 5D4QA 3WIIH 1PLGH 3GMPB 1N5YL 4XTRD 3OKDA 5JR1L 1RFDL 3G5XA 1C5BL 1VEMA 2GITB 5EOQL 3QNZA 4K94H 1DQQB 2D31B 5GRVK 1V05A 5IEKA 1T5WA 1WWCA 2R9HD 3OAYK 4I3GA 3MRLA 4LCWB 2FB4L 3CFBA 3MA9H 4L9DA 5IOPB 4ZUTA 1BM3L 3BP5B 5HHQB 2EXYC 5E8DH 1JF5A 1WWWX 3BZEB 1OT1A 3T0AA 1DQML 2AJXH 4BUHA 4KHXL 1AD0B 3IDNA 5DMJB 5I17B 1IGCH 4PJXF 3H9SB 1I7UB 1T5XB 2OR9H 2R69L 3I50L 4PBWD 4H25B 1TVHA 2VLKB 2ZNXA 2DB8A 3SCMC 1FH5H 1T83C 2AABL 4AG4H 5EU7E 4FQIL 1FAKT 3C5JA 5DO2D 4U1NA 1YN6A 1CE6B 4XCNB 1DN2A 3T0XA 5JR1H 3FQRB 1C5BH 2DS4A 2HRLA 3MRCB 3RVTD 3HG1E 3IDXL 5C09B 4EIGB 5C3LD 5IG7B 4YFDB 5K9KA 1DBBL 1V7NL 5FKPB 1OL0A 4F7CB 5ESVB 5GGSY 1I7TA 5GGUA 1ZT1A 2R1YA 3TN0A 3MRMA 2FB4H 3K81A 2JF1A 4MZ2A 1HNFA 4F7TB 1AY1L 4F7PA 2ESVB 4NC1E 2YPLB 4HH8A 3BH8A 1DQMH 2DQEL 4KHXH 1SJHA 2OR8A 3FTGA 2AJZA 2RFXA 5JHLL 5KG9B 4GXUM 4YHPA 3T77A 2R69H 2X4RB 4E42A 5DRZB 4EN3C 2YPVH 3I50H 4TSCL 1NC2B 4Y16A 4L8DB 1U58B 1OGAB 3C6LA 3NFNA 4BKLB 2NXZB 5I0DA 2UVFA 4MNHB 4PTTB 3VXSB 4FQIH 4LLUB 1P4BL 1MCNA 4MX7B 1KLGA 1U8JA 4CJ0A 4P5TC 3REWB 5MENE 2ICEB 3JBG7 2FLBT 3NFSH 3CPLB 1SQ2N 1YY9C 1V7NH 1U3YA 1HH9B 3IGAB 2XQBL 5IFJA 5BVJB 3JVGA 1CFVL 4MDJA 4ODVL 5F9AC 1I1YB 5IEHA 1A4JB 3D1MC 3D3VE 1ADQA 5DVNA 3ZE0F 3MV9E 2AJYL 4Y5YA 4D0BA 4E0RA 3L3GA 1PYWA 4MCZB 4Q58C 3T3ME 3QUZC 4CVWA 1I1AB 3Q6FB 1TTGA 4KQ3L 3DI2B 2EDJA 4NQDA 5FEBA 1YNKL 2DQEH 3H7BB 2MHAB 4NKDA 5DS8A 4UUJA 5JHLH 1H0DB 3BPNC 5CGMA 3MRJA 2Y1VA 1PVHA 2H32A 2V5RA 3RZCB 1I8MB 5EUOF 4P23D 5F7YC 5D93B 2V2TB 3OHXA 3UBXA 3FO2A 3RDTA 1IAIM 4TSCH 1XGRA 5D1QA 3HE7C 1HSAB 4EI6A 1Q9KB 1P4BH 2WBJC 4ZFOB 1Y18A 3C8DA 2AKRB 5FUOL 1BLNA 3OF6D 1JTPA 3F5WB 2DBLL 2C26A 5IM7B 4XCYB 3QDJA 2PTUA 2R0KL 2XQBH 1IARB 1CFVH 4ZOBA 3HFML 4L5FL 2X44D 5IT2L 3GGWB 1O7VA 3Q1SH 5F9WC 4NQUA 4PRPD 5FM5M 1BD2E 5INCA 2AJYH 3LPGA 5FHAL 3GMQB 4D9LL 3FT4A 5HDQL 4BFBD 1T3FB 3IJYB 1U92B 4ZXBA 3MV8E 2M26A 4GG6F 4KQ3H 3BW9A 3BP7A 1YNKH 1NAKH 1XF5B 2UZXB 3VH8B 4R7NB 3P77B 4PJFF 1EIBA 3GMNA 4G5ZH 4HJ0C 5EIQA 3GMLA 2IAMA 4J4PD 1R3JA 4OFIA 1M71B 3ARFA 4Z7VE 4YXKL 3DXAD 1NUGA 3ZTNL 4PJDA 2RGSA 5LG1A 2WW8A 5CD5D 3QXAB 1XF4B 4HS6A 3V7AG 1NCDL 1ZLUK 5FUOH 2IQ9L 3RU8L 5D6CA 2DBLH 1E6JL 5JQ6L 1RK1B 2FL5A 1E4JA 4IS6A 2R0KH 3SGDH 3BWAA 5JIHA 3MACL 3HFMH 5LBSH 2COQA 4N9OB 5C0CA 5IT2H 4BFIA 2X7LB 1J1XL 3IFPB 5DC4B 5E8NB 1JK8B 1JWMA 1LD9A 5FHAH 2EDKA 3O3DB 2YD6A 4P48A 5C0EA 5J6GB 3NTCL 5HDQH 2CK2A 3JV5A 4UQ3B 1MI5E 4P2RD 1HHGA 4MB3A 2NY0B 5AZEL 4QNPF 3ARQA 3WMSA 3LKSA 4LGSB 2E7MA 1ZEAL 1X4XA 2ADIA 1AP2A 4PGCA 4LSUL 3T1WA 3SDYH 1F45A 3B9AA 3D85A 5CEZD 5J1SC 4WU7B 5MEOA 2YN3A 4YXKH 1F6AB 4P3CL 1O0VA 3ZTNH 2BY0A 3RVWC 1REIA 4NHUB 1V3JA 2O5XL 3RKDD 2LABA 4GMSL 1U8LB 2Z0BA 1UCBL 3CLFH 4JZJC 4OF7A 2OMNA 2HLFC 1NCDH 8FABB 2IQ9H 1SYSB 4PJBA 1D6EB 1YDPB 2IH1A 1IC4L 1E6JH 4KTDL 4LSDA 3WE6B 5JQ6H 4Y19B 2FIKB 4JR9L 1RJYA 5EO9A 3MACH 2ZOKA 4NNXB 1W0YT 3U9UB 1CICB 5IB5A 1KBGL 3DHMA 3DMMD 3WJJC 4OKVB 4Y4FA 1QHOA 3ILQC 1JYVA 1IMHC 1KIQA 5HI3C 4NT6A 1YEEH 3FB7A 1ACYL 3ILPB 2VISB 4GMTL 5AZEH 3O3EA 4NHCL 4JPKL 3VXTA 3DVGA 2Z31A 4HWBL 1FL6A 3TIEB 1ZEAH 4F8QA 3UPRB 4JRXE 1K4CB 4HFWB 4ZUWB 1NFDF 4M1CD 1UJTA 4OLWL 4QRPA 4EUPA 3BZ4A 3TZVB 4F7EB 2QV2A 1T7YA 4PGBA 3MRNB 4P3CH 4HIXL 3I02A 5GIRB 1TVDA 4DVBB 2O5XH 1VGEL 4J3SA 4GMSH 3EW3B 1UCBH 5I2IB 3QXTA 4UQ2B 2Y7QB 2HFEA 3U46B 1ND0A 4B7IA 1S7TA 1IC4H 4KTDH 4P49A 2APBA 4JFPA 1NQBA 1K85A 3QUXA 4GKSB 3ZDXE 5IV2A 2MNUA 2FZ3A 3ARED 1E28A 3UTZA 4MD0B 5E2UL 3ES6B 3SO5A 1KBGH 3PWNA 1LE5A 5EO0B 1ACYH 4NM4L 5FGCB 1UXSA 5J1AA 4MS8A 4X6DE 4X6BA 3W9EA 1ZT7A 2NY1D 3K1DA 4GMTH 3CDGA 4NHCH 4JPKH 3A6OA 4P4KB 5D1XA 3GKWL 4Y4KA 4F15B 4X7TB 1MRCL 1GZQB 3MRIB 4OZIF 5FDWA 1YEKL 5KTEL 3CXHK 4HIXH 3CVIH 1VGEH 3EDKA 1L8JA 4WRLA 4YHML 4IJ3B 2X2YA 4Y2DA 3UP1A 1CFQA 3K46A 3U7AA 3S36L 4XNMA 2NXZC 1D9KA 2W59A 4WVRA 2I25N 3WUWB 3H0TB 2HTKD 2CO7B 4YR6B 2YZ8A 4GXVL 3GK8L 1KN2H 3MLTB 3SKMB 1ZVHA 1N6UA 5CP7B 3WV0A 2X5PA 2C3WA 2VDRL 1ACZA 4ZPVA 5DYOB 5D5MA 5AG9A 3BRDA 4PJ5B 4HX1A 2R2CA 2UZYB 1FBIL 2BJML 4NM4H 4PJHA 3C6SB 4BJLA 3T0EA 1WF5A 2Z92A 2VO5A 1OSPL 3KLAB 3BVNA 3MODL 4XC3L 2VIRA 3KPLB 1CD1B 5DJXA 3RP1A 4S11A 4P2QD 3GKWH 2EEDA 1N59B 4MHHI 3IXAA 1MRCH 4HUXB 1LP9B 1I1AC 1YEKH 1DVFD 2F19L 5HDOA 5AWNL 3CLEL 1HI6A 4X0KA 3UTTA 3ZDZF 3RZCC 2H3NB 1QFWL 1OTTD 5D93C 5JZ7C 5D2NB 4XPTL 5L6YL 4PD4K 3HZKA 1T66C 1DJSA 3L3HB 4S10A 2XFXB 1DQLL 3RY6A 3GK8H 2VKWA 3FB5B 3VFNB 4KK9C 4KHTL 1A22B 2VDRH 1KGCE 1RUML 5CBEB 5C2BL 3SBWA 2DQCH 2OL3L 5C8JA 1FBIH 3FMGL 4ODWB 4N0CD 4ZTPH 3SDAA 3RIFK 3T0BA 4PJIF 1OSPH 5JDJA 3MODH 5H2BB 4XC3H 4ZTOH 1OM3H 3F58L 1AO7E 4Q6IA 1CE1L 5D2LE 5DRNB 4MQSB 3I6LD 1A6TB 2DRUA 2X4PB 2E9IA 4JRWA 5CEXA 3MLRL 4H0GA 4PJEB 2VLRD 2F19H 1ZHBA 5AWNH 3CLEH 2MOVA 5EOTA 2G2RB 2NR6C 3KPSB 2IANE 2C4XA 3RY4A 1QFWH 2H26B 1G7QA 5L6YH 4XPTH 3VFMA 3TV3H 3DO7B 2A74A 3ULVF 5BRZB 4X8JA 1U8KB 5L2KE 1YEDA 4N5ED 5IK3A 3VXUE 1PX4A 3K74B 1L9NA 3EYFA 3VG0H 4K94C 4KHTH 4JM2A 3TM6A 2VUYA 4LARL 5JW4M 1RUMH 1KFAL 5C2BH 4UIMA 5T1LD 2OL3H 4HIEB 2F8OA 4XCCL 3ROLA 4QXWA 3FMGH 2H1PH 3S88L 4Y1AD 4JM4L 2ORBL 3HC4H 3F58H 4XGZA 2J1KA 1QRNB 2BHYA 4PJ8D 1X5KA 4TQEL 5EUOB 2VZUA 2LU7A 1I7ZB 4NRYA 4M3JA 5JXED 2NY0C 1JPSL 5AAMA 4KTYA 1IGJB 4CVXB 5DJZA 2WZPD 3HS0A 3H9ZA 4LU5L 4K8RD 4WHDA 3MCKB 4O02L 4KMLB 5C08B 4KVCH 1BFSA 1H3VA 3AUVA 2RB8A 4M6OL 4IDJL 4LHUB 1LMKA 1RUAL 4OZHF 1ITCA 2A73B 4NQEB 1FG2B 3KYKL 3VMOA 3N0PB 4OCLC 2Q8AL 5I8CA 1FAIL 1I1RA 5DI8A 1QSEA 4LARH 1P7KB 2XWTA 1J12A 1KFAH 5CGYC 4S1QL 3PWVB 4APQA 1AD9A 3WLWD 3B2VL 1HWGB 3FCTB 4XB7A 3LPFA 3WBDA 3S88H 1KLUB 1IEBB 4PG2A 3Q6GL 4A2LA 5HYSG 4GG6B 1OW0A 1YYLL 4JM4H 2ORBH 4G8IA 3CDYA 1FNHA 1CICC 1YEGL 3TA3B 3E6FA 3VDBA 1GGIL 3GJFK 5DURD 1CTOA 3NAAL 4TQEH 1N4XL 1UENA 2D4DA 1DE4B 2HMID 1FZOA 1KCRL 4UB0L 2YHGA 1TXKA 1JPSH 2KQNA 1JPFB 2EE2A 3EYOB 3DYPA 4Z7WE 3E2HA 2CLZB 5SWZE 4RZCA 4U1JA 4LU5H 2H2PC 1A7QH 4O02H 3OPZL 4LDOB 2VITB 3VXMB 3AS0A 4JANA 3TZVC 2I9LB 5DD6A 2F8XC 2IGFL 1FFOA 4IDJH 1G6VK 4MMXC 2PUQT 1A1NB 1BQSA 5GSRB 3QH3B 1X7QB 4L8SA 3T1FA 3ZYJA 3BIBX 3VFUB 3KYKH 1CGUA 2BVPB 4G8FA 3DYMA 2GJZB 2Q8AH 3ULVL 1FAIH 1T1WB 2HVKB 4NQVB 4B41A 1ZANL 4RMTA 4WENB 5HGBB 4YGVA 4S1QH 1JFQL 3C8KA 1AKJA 3Q6GH 5DJ8B 4XPAL 3TYFB 1MFAL 2WY3A 1L9MA 2VDQL 3WYRA 3NAAH 3IDUA 1LEIA 4O2EB 5TQ0L 1H3PL 1KCRH 3ULSA 2DJSA 5B38G 2DKMA 1G1CA 1MAJA 2HTLD 3DX9B 2YRPA 3NCCB 4P4KC 1FVDB 3NCFB 3O9WA 3AXLA 4F15C 3KPRB 3OPZH 3ESVF 5FA4B 1WZ1L 3MJGX 3MFGB 2IGFH 2JJSC 5F93C 3PNWB 2W38A 3NMEA 1GC1L 4YC2B 2OP4H 4QYOB 4WHCA 3LN9A 2PNDA 2AQ1A 1O7SA 3DV6B 5TE4L 4IJ3C 3ULVH 4PB0L 1T0NB 3WNMA 2W9DL 2FLRT 1ZANH 3EOAA 4M9PA 2CR3A 4C55A 1YUHB 1JHTB 1TQBB 3QIUB 4KY1L 4JFXB 4JFYA 1DBML 4LPVA 4XPAH 4L8CA 1MFAH 3WO3B 2GK2A 2FJHA 2VDQH 3TH3T 4LLYA 3PQYD 4CGTA 3VFPB 2BHUA 2OYPA 5F7NC 1H3PH 1YC8A 2VUOA 1UVQA 2VLJA 4MB4A 5JNYA 1QZ1A 3QXDB 2F53E 4JQIL 1H15B 5GSVA 4QXTA 3U4BL 1AJ7L 5EZJB 4WV1B 3WEXA 1RD6A 1GHFL 2ZCHL 5L7XL 4OQTL 1FFNA 1AFVH 2FJFB 2Y6SD 2VNCA 2NX5E 1WZ1H 2HLAB 2LAGB 1T21B 2PYFA 1GC1H 1KOAA 2DD8L 4WUKL 3MX0A 4LCIL 1KPUB 4BSWB 4LCCB 4QRRB 3WIFA 5T5FL 2OL3B 4OD2B 5TE4H 5IW6A 1MQKH 4HK0A 4PB0H 5D2NC 2OK0L 1Q0YL 3LQZA 2W9DH 3P40A 2X09A 3FN3A 3IDMA 3VFVA 2D2OA 3LN5B 1NUNB 4ZO6A 4KDTA 2UUDH 4KY1H 5FV2A 2LTQB 1DBMH 3O45A 3ECBA 1KYOJ 2QQQA 4XI5C 1EAPB 3BGAA 5IVXB 1F6LL 4J1UA 4QGYA 35C8L 4PJGA 1NEUA 3RWDA 2DI9A 1EFXA 4WI6A 3MTRA 4JQIH 1XGTB 4NKOB 5T1KD 4IRJB 3U4BH 1AJ7H 3UTQB 4RRPG 1IAIH 1XIWA 1GHFH 4KKCD 2ZCHH 5L7XH 4OQTH 1F2XK 4LAJH 4LSSL 4K9EL 3ULUD 3B9KA 2A0LC 1JGUL 2XWJA 3D3VA 1FE8L 5I76A 1X5FA 5JOFB 2DD8H 4WUKH 4YPJA 4LCIH 3X13B 1JVKA 4KRPB 4RMQA 2DI7A 5T5FH 3BQUA 2W65B 4NN5B 2P5EB 3M17B 2OK0H 1Q0YH 2APFA 4LLWB 3W11C 4RMUA 4DZ8A 1FSKB 1QP1A 2G75B 2EO9A 1EJ6A 4WTWA 1N6QL 4HUWB 1T80A 1UB6A 2L7UA 4AM0B 4LCUB 2F54D 3OB0K 5DEGA 2VE6A 4U6YA 5EFIB 1LDSA 1ZLVH 2ZSVB 1BQHB 4L3EB 4LFHG 4IOFD 4JQVA 4QHUB 2JJTA 2Y4SA 3S37X 3S34L 35C8H 1G7MA 5F3BB 3JTTA 4FRWA 4FG6D 4U1HB 4ZAKB 1J05A 4ONGL 3QPQD 2A77L 4Z5RB 4I48B 3JTSB 4X98B 5FYJD 5L0QB 4LSSH 4K9EH 1CD9B 4G6AC 3RX8A 3QQ4B 2IJ0C 4U1LB 1FE8H 1BFOB 1VADB 2DQGH 4CVZA 2GQHA 4ONHB 1BD2A 2VN7A 5C70A 5B39B 4HUVB 4NN6B 1S7VB 3Q5TA 4JFEB 1ZHNB 4RMRA 1BMGA 1Q72L 1VEPA 5I1LA 5EBWA 3LSOA 3MV8A 1T7ZA 4XNUL 5TE7H 4BZ1L 3MCLH 5GS2D 2VAJA 5B8CB 2L0DA 1N6QH 4YHLL 4GAFB 1QFHA 5BJTA 2WUCH 2QSQA 4OCRL 5E8PB 1I7RB 1ZMYA 4PJDF 4YQXL 2AK4D 1UACH 1W72A 4KXZI 3ALXA 4PJIB 1DBJL 3WXWL 3PJSA 4PGJA 3S34H 5KVGH 1S7QB 2X4UB 5CKGA 3OKEA 1UH3A 2NY6D 5SX4H 4MSWA 1KGCD 4ONGH 1XGQA 3TA3C 5F8QC 3T0DA 4OFKA 2W9EL 1QR4A 3DRQB 5ITFA 2A77H 3RRQA 3ZDYF 1FVEB 4POZC 4X4XB 1W8NA 3OXRA 5FO7A 2CXKA 3UJJH 1BAFH 3FL7A 2ZUUA 4RBPK 5DRXA 3VI4E 1T2XA 1IKFL 5CIPA 1T1YB 3I3EA 3LQMA 2XACC 5EH1A 5D6DA 1GZPB 3PWLA 5D7JA 4NC2B 3TPKA 1IZKA 1Q72H 3QQNA 4HD9A 3VW3L 3RVVD 5HYEA 1AC6A 2AP2A 3QSKB 4XNUH 5DXWA 5IROA 1BQHG 4BZ1H 4LSVL 2IAND 4YHLH 4HMDA 3U6RB 3O6KL 4LCWE 2AS5M 3C5ZB 4OCRH 3BXNA 3VXNB 4YQXH 2AV7B 2R2EB 3MOQA 5GRJL 5HHPA 1DBJH 3WXWH 4N0YL 3O4LA 5FM5O 3HLAB 2EZ0D 3L6FB 1GIGL 1AGEA 3LB6C 3TO4D 2Q7YB 2RCSL 5H94A 4PJBF 5FYKU 1RZ8A 3QJFB 4QEGA 2ENYA 2FEDC 1KTRL 3H9SE 4A6YL 2W9EH 5D7LA 3OKLB 3IU4L 5B39G 4GRLA 2VLKE 5LXGL 5CCKL 2BFVH 5F9JA 1C5DB 1LGVA 4Y5VB 4YZFE 5IB1A 3EYQC 1S5IH 1IKFH 4RDQF 5C0IB 5FYLD 2O61A 3VW3H 5C0AB 1CF8L 3H42L 5GJSL 5HDLA 4LSVH 5BXFB 4JVWA 1TCRB 4LRIA 4YC2C 5E5MB 2F74A 1HOCB 3O6KH 3CX5J 3L95A 4JRXA 2H32H 5KN5A 5GRJH 2ESVE 4N0YH 4ZDHB 2IG2L 2YPLE 3I6GA 5EWIL 1GIGH 1KEGL 5KW9L 3X11A 2RCSH 1TQBC 4XP6H 3S35X 4JKPL 1DR9A 3D0LB 3BIKA 4OLEA 3JV4A 1QBBA 4LEOB 1ZOXA 4G8GB 3QXWA 3WIHA 2XTJD 4U1IA 3F7VA 2XN9A 4A6YH 3S5LG 4FQQB 3V5DA 1OGAE 5LXGH 1ITBB 5JW5A 1WCBA 2GUOB 1KC5L 3FKUS 5T5NF 4Z77B 3ARDD 3VXSE 1HHHB 3TWCL 4HGWA 3P9WB 1KJ3H 4U0QB 1OLZA 4WV1C 1SY6L 5JW3L 1XGUA 1OVZA 5T3ZL 1I8IB 3CDFA 1LO3L 4EZMA 5HVWA 3KDMB 3JSSA 4TUJA 1TETH 4UNUA 1AI1L 1CF8H 3H42H 5GJSH 5SWSD 3U36B 2XA3A 4XRCA 4C56B 4KU1A 4GS7B 2AJ3A 3LV3A 4XVSL 5L2JA 3MNWB 4LCCC 3HZYB 5DMIL 2E7CA 3B8YA 5E6IA 3FQNB 3U4EA 1NDGA 3F8UB 1I75A 2YS4A 4FQXD 5E8OA 1AIFA 2IG2H 2VAAA 1QYGL 2MSPA 2X4SA 1KEGH 3W5MA 3OKDB 4HT1L 3G5XB 3QNZB 4JKPH 2LTQC 2VZVA 1B88A 1NC4D 1XT5A 2EXYD 5IEKB 5DJ6A 4LMQE 3GSNL 4HWZB 3TFKA 3FRPA 4ZUTB 5D5MF 4I0PD 4UIKL 3G04B 2QKIA 1E4XI 1KC5H 4RGMB 2UY7A 3QIBD 3BESR 4IRJC 4PJHF 3TWCH 4CNIA 4DKEL 1A7NL 3K7UA 1SY6H 4YE4L 3V4UL 5JW3H 2WK2A 1LO3H 3IDNB 5IBTL 2AV1B 1IJ9A 1DLFL 4X8XA 1EA9C 1TFHA 3SE3A 4UMGA 4LSQL 5GRUL 5HPMB 5LGJB 4XNQA 1ORSA 3VU2A 4YIQA 4U49A 3CK0L 5D71L 3QBTB 5CLTA 1TVHB 2R1WB 3BZFB 4XVSH 1KUMA 4KRPC 1SVCP 2VL4A 5KSUB 5DMIH 2EDFA 4ODTL 1FLRL 3C5JB 1FSKC 1UB5B 3AMLA 4OGZA 4U1NB 4L4JA 3OTTA 4HT1H 2GCYB 2UV3A 4H20L 3N1PC 2P5WE 2X10A 3HE6A 4WO4A 1HDMA 5K9KB 2H9GA 4PGZA 4PBXA 3BAEL 3MOBH 1I7TB 5GGUB 1ZT1B 2R1YB 3IDIA 3MRMB 3P4MA 4GW5A 3DUHA 4JRYB 3GSNH 3MRFA 1KJVB 1BJ1H 5DHYB 4F7PB 4YDJB 4UIKH 4FHBD 3AAZA 2E7BA 4ZAKC 4RNRA 4DKEH 4WU5A 1A7NH 2UYLA 3BH8B 4YE4H 3V4UH 5IBTH 4LBEA 1SJHB 3FTGB 2AJZB 3PP4L 3MROB 2RFXB 4XHJD 2EDYA 5L0QC 4L29B 1DLFH 4IEFB 1BOGA 3FZUD 4JKKA 2F53D 2BNRB 1ULVA 3AS2A 4LSQH 5GRUH 5C07A 3LZFL 1NCWL 3ZE2F 4E42B 1OD7A 5GXBB 1EXUA 3CK0H 4Y16B 1AO7A 3G9AB 2JCCF 3N50A 1IGML 4OFYD 4P5TD 2VZSA 4YDVB 5D2LA 5F88A 4NN6C 3C6LB 3U48A 1LDPL 2NX5D 4ODTH 1FLRH 1YY9D 3QNXA 1A7OL 1KLGB 3W5NA 5B8CC 3NPSB 1EUUA 1QVOB 3TVMB 2PYEA 1BQLL 4H20H 1JZ5A 1X5LA 5EIIB 4WCYL 3UEZA 4GBXA 4H1LA 3BAEH 5IFJB 4HLZH 3RVUC 4MDJB 2O5ZL 3HA0A 1NGQH 4JM2F 3I3BA 3PE9A 4JCMA 3TPUB 4OV5A 1GOHA 3RZWA 1R3KB 2ICWA 4TVSa 4X6CF 4KJYA 5KSAA 4Y5YB 5F1OB 4DN3L 3L3GB 1M7IA 4NHUE 4I9WD 5E9DD 1U8HA 2H6PA 1CFSB 4ELKA 1C12A 1B2WL 3MREB 2D4FA 4HHAB 4UUJB 5HGDA 5EULV 3MRJB 3WD5H 3W39A 3BYTA 4Y19E 2H32B 3BKCL 3K0WA 3O3BB 4QRUB 4LSTL 3LZFH 1NCWH 5I0ZA 5JIIA 3ULVC 1VFAA 2WBJD 3FO2B 5F89B 1BGXL 2XQYK 3JWOL 4QRQA 5D1QB 1S3KL 1CQYA 1IGMH 1WEJL