3BO8A

The high resolution crystal structure of hla-a1 complexed with the mage-a1 peptide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bo8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bo8A01
3L5XL 5IVXB 1NBVH 4OLZH 4L4TB 3HLAB 4XXDA 4XVUD 5A2FA 5I66A 3RIFF 3ELAT 1QSED 5D1XD 1ERNA 3GJFA 2CXGA 3CFBB 2X4TB 2BNQD 2HA1A 2UZXB 2XXCB 1YEIL 4PJAF 4LSVL 3IDUA 4D9LL 3U0TB 4OSUH 2D3VA 4EN3C 4Y4HA 3QCUL 2BHYA 4POYA 3GJFH 3LRHA 1IQDA 4AT6A 5F1SA 3UAJC 2D0FA 5E00A 1JGDB 4LBEB 1MQKH 4GMSL 4K71C 1GGBH 3M8OH 3IU4H 2C5DC 4Y1AB 1I3RA 5ACLA 3C8KA 4DTGH 1U3YA 3KWWB 4CNIB 2BVOA 3FT3B 1P1ZA 2ADGB 1A4JB 3FO9B 3MV7D 1CICD 2PYEE 3NIGF 4P2RB 3SDXB 3WN5A 2J8UE 1W0VA 2HMIC 1T89C 3TN0A 5I76A 3MBEB 4P5TB 4AM0A 4JY5L 4I18B 3IF1B 3DYOA 3IDYB 3QNXB 1Z0NA 1AFVL 2LVCA 4CADB 4PRPD 4Z76B 4ZAKB 3DUUA 2ZUTA 3MLVH 4HKZA 3Q6FA 1YEJH 3ZO0A 3LKOA 1AGCB 3GMNB 5HYQB 2VDPL 5DJDA 3GK8H 1DQML 1NBYB 4GXUN 3OKNA 5I1AB 1CE1H 1ZT1B 4RGOL 1FVDB 2VOTA 1DQQA 5IT2H 4Z6AT 2UUDH 3QBTB 1D6EA 1P69B 3V52H 5IMOB 3ZHKA 1VGEL 3ARGC 4KRLB 1G7IA 3FN9A 3L95A 4JPIA 4Y16C 3T3ME 1UB6B 5T3ZD 4WW1B 4XNMB 1XF4A 5F7NC 3MRCB 4NWUL 4P2CG 3TCLB 3LV3A 2EE2A 1FZJA 4U6HB 3LSOA 3ZYZA 5AYUH 3QNZB 1T1ZA 4PGDA 4RAHA 1FORL 1CDHA 4Y19D 1IAKB 4GBXD 2P45B 3ARWA 2AJZB 3WFHB 2NX5D 2YPVH 2R1XA 3OB0K 2YA0A 3S9DB 1C12B 2C7UB 5BVPH 1B90A 1Y6KR 35C8L 3MNWA 4HJ0D 4P2QD 1DBKH 2AEQL 3MV8D 2O5ZH 3FQTB 3GUTA 5F9OH 1YJDH 3E3QE 1KCSH 4JN2B 4ZUUB 5I1GL 4Z7UA 1ZHBB 4BH8A 1M7IA 4LCCC 4HJJL 3OF6A 4PJEB 1A6VH 4XX1E 4NBYB 5KS9A 2NY1C 4HUXA 1BFOA 1VFBA 3ZSSA 1JHLH 2HFFB 2HT3C 1OB1A 3GSQB 3MGTB 3O6LL 1JK8A 3QFDB 4JRWA 5C70A 4Z77A 5B21A 1CGSL 2BSSA 3V52L 1HIML 4EIGB 1UQSB 1EIBA 2CRYA 2ICEB 1Q94B 1MUJA 1MHCB 5INCA 4Z7OE 5IMKB 2W59A 3BXNB 4RCAA 2FBJH 1A3LH 1NDGB 4PRID 3DVNA 3PQYA 5BRZB 3G5XB 5CZVL 4IRSA 4M3JA 2QR0A 1HHHB 3IU3B 5SWQA 3NCCB 5C0BD 3DTXA 2D9CA 1CD9B 2D03L 3QHTC 2Z35A 1NLBH 4X80L 5A3ID 2E7BA 3QPQD 1JPGA 3DETC 2X4SB 5L6YH 1NL0H 4NO3B 2DQDH 5BVPL 3U0WH 1IGYB 4P57A 4Y2OA 1DBKL 4B5EA 3IJYA 1INQA 3QIWA 2O5ZL 1A0QL 4PJ9A 4QY8A 2VLKE 4GG6B 3RAJH 2NQCA 3I50H 3ZHDA 2D7NA 4DEPC 1NPUA 4JDTH 4OFIA 3VXSE 4JFEE 1NMCC 3WKML 3FTGA 1K9TA 2D7PA 1N6UA 1FFNA 4NFBA 3U9PL 4G9DB 2B1HH 3BP4A 5J89A 5D71L 3ARTA 5IF0A 3TF7C 5SX4H 5GS0H 4R2GC 1FNLA 2OK0L 1AJ7H 4UB0H 5SX4I 2IBZY 1ZE3C 4LGPB 5FOBA 2P49B 3I9GL 1Q9WA 2LAAA 3BGMA 2W9EL 4HX1B 5FYLE 2G5BA 3QG6B 1A3LL 4P9MH 5TH2A 3QJHA 3NIFE 1SBSH 3DVFA 4GKZA 4W6WB 1J12A 5GS1C 3FB6B 1MHPH 4YNYB 5FB8A 3OAZH 5EORH 4NQXB 1IM9D 1J0YA 5C71A 3G6DH 3PGFL 2XN9E 4APQA 2RCSL 1W72A 4YDIH 1MCBA 3AS2A 2LU7A 1NLBL 1EAJA 3CFEA 2X1PA 1UXWB 3HE6D 4HXAH 4Z8FL 4XCEB 3CFDB 4XB7A 5JXEA 3IKCA 4OCNC 3JWOC 1CLYH 4AQOA 3A6BH 4XCYB 4KKLD 1T03L 2G60H 3PL6B 4BFBD 2VMFA 3PABA 3HNTH 4N5EC 4KPHH 1V7NH 1NLDH 1M7XA 1BAFL 3PHOA 2JKXA 2GEEA 3FONB 1OTUC 4JFOB 3FQNB 3QCTL 3RDTB 1KIUA 3NPZB 3TVMC 5FGBC 5EC1A 1QRNB 1TVBB 3DUSA 5FAAA 2JCCA 2YBRA 3MRMA 4KZDL 3SN6N 4G80B 2UYLA 3BDBA 3MLTB 4HAGA 1PY4A 4UBDC 1QFUH 3BP7B 4KMTH 4O9HL 5C0ND 2OQJA 4OF0A 4WWKA 5ESVB 3EYQD 2W91A 4UT6L 4D9QD 2V2WB 3BRFA 4R7DA 4K07A 4B7IA 4MS8A 2JJTC 5F44A 3C8DA 5DK0A 1I7RB 1JHKH 2IFGA 1JHTA 5E6ID 1X5YA 1MHPL 2AEPH 4Q9QL 1UXSB 5E8OA 5T1KD 5EORL 3MXWH 5C0FB 1A1MA 1BLNB 5BW7A 1AXIB 3NMEA 4UTBL 3CH1A 3QIUD 4C56E 1NAMA 4BQBA 4CVZA 4KMQA 5EFIA 3SCMA 1DANU 2VLJA 2VDLH 4XHJC 5FM8A 2DD8L 3HE7D 2ZCHH 3WIIL 5FO7A 1HH6A 3GBMH 4HXAL 3VFOB 5C0EA 3D3VE 5EO1A 5GJTH 4GRWB 1B88A 4G43B 5B3JF 1A4KB 3O4LE 1D9KC 1NAMH 2KPNA 4NO0D 2Q8AL 5B4MC 1P4LA 3MLYL 1S7UB 3QUYA 4HWBL 4KPHL 1V7NL 4RGNC 4UIMB 1WBZA 5DJCB 4KZEH 2ZSWB 2ADJB 4OB5L 1QO3A 4V2BA 3EYFB 4U0QB 1C1EH 3WBDA 2XG5A 1BFTA 2IQAA 5DA4A 2V6HA 3SGKA 1JNJA 5FECA 5IV2A 5SWZB 2COQA 4QHMB 4PY8I 4EBQL 5JO5A 4EQ3A 1D5XA 4YGVA 4IMLB 4KMTL 3DV6A 3I2CH 4YGAB 4JHWH 4HCRA 4S10A 1OAZL 4W70A 5TE6H 4U1KA 4NJAL 1U9KA 2XTJC 4XNUH 1BMGA 4Z0BL 5EU6D 2QKIA 4BZ1L 1NCWL 5D1ZD 4UNTA 3OAUH 3CUPB 3OKKB 2AEPL 4X5LA 3PV6A 1IMHC 4LDEB 4HCRH 4LCUB 2YEZA 4J3SA 3SJVD 3AROA 2X4PA 2WINA 3MRQB 3Q6GH 4XPHH 1MCIA 4QXGH 3BWUC 3RVVD 1F6AB 3DGGA 5HI3D 1JUFA 2W38A 4X9FA 1ODAA 2XRAL 3GBML 3C5ZD 4CW1A 2IFFH 3LH2H 1EO5A 1EK3A 2O5XH 3WE6B 3L5IA 1JWMA 1R3IL 1ZLUH 5GGTL 1FNSH 3ARBB 1ETZB 3UDWC 2OI9B 2VWEC 3W81A 4WHTB 1YUHA 5C1MB 2DLIA 2HKHH 3QHFL 4NSKB 5HGHA 5BZDB 4JFPB 1YDPA 1KULA 2J8UF 3MLWH 5IWLA 4S2SB 1EMTH 3WSQL 4GAJL 4HEME 2EYRB 2WQRA 1CCZA 1IL1A 2FX9L 3KLAA 1BREA 2HJFA 2WANA 2XOTA 4U1NB 5DJYB 4JREB 5IVNA 4JKLA 3ZE0F 1HQRB 4LFHD 4JHWL 4FQ2H 1ZA3A 3V5HA 5L2KA 1A7OH 1L9NA 4MNGA 4YAQB 4AIZB 3HMXA 1WT5A 5LCVL 4WEUD 3QI9B 1U92A 5L0QC 5FOJA 4GMTH 1KTDA 3MRFA 2DKUA 1S9YB 5F1IA 3OAUL 4WI2A 2XT1B 5MEQA 2AV7A 3FHQA 1KPUA 4YUEL 5EZLA 5DK2A 4PJHB 4TSAL 5T1LD 2DMCA 2HJKA 3HMXH 3VA6A 1U58B 4JVWA 3T3MF 4DKEH 5J11B 3P3YA 2NXZD 3ULVD 3O2DL 4WO4C 5I2IB 1JNHA 3GZKA 2VKWA 2GI7A 2VLLB 1CZ8H 1G1CA 2IFFL 5DD0L 4M1DH 1HHIA 2V5MA 2O5XL 4FFEX 2CRMA 4QRTB 2VSDA 2F53A 1VKXB 4WY7H 3FFDA 3HS0B 5K9KA 3VGEA 1W8OA 1KT2A 1U3HA 4LCWD 2V2TA 4NQVB 1RQ5A 5C0DA 5ALBL 5TQ0H 2WIIB 2E6PA 2VYRE 4LLQA 1R3HA 1UM4H 5FUZH 2YA2A 1DDHB 2P8PA 5K93A 1TIUA 2O5YL 5IROA 3GMLB 5IK3A 5EZJB 2CR3A 2XQBH 1CLZH 2AJYH 2DM3A 4LMQE 3PWNB 1HH9B 4NFDA 4RFNB 1Q1JH 3IDXL 5EU7C 4KJPC 4OCSH 1FZKB 1LK2B 2AI0L 5F6IC 3DSFH 3C6LC 3MLZL 1WCQA 3VFSB 4ZUSA 4LLMA 4MYWB 1I1AB 3X11A 1VSCA 1RD6A 1SBBA 1YQVL 2WV3A 1S9WB 3U6RA 1I8KB 3ARPA 4GMTL 4PJ7B 4X98A 3C2SA 1ZHLB 1HWGB 5E99H 3VD5A 4Z7OF 4F15C 1TVDA 5D5MB 3DXAD 1FJ1A 3KPRD 4OT1H 4CVXB 3W39A 1A7RH 1YQ2A 3BPOC 3SO3B 5J6HB 1VEPA 1UB5B 1XGPA 2VN7A 4PRBB 4ZSOB 1CT8B 5CMAB 1ND0A 3WFBL 4BQ6A 5ISZA 3NCMA 3V5KB 2A9NH 2DIAA 4KK6D 4NZUL 1HILA 3IVKA 5GJSH 3RPIA 4YJZL 3B9VA 2FH8A 4P2OD 4P2YA 2NY6D 3H7BA 2JIXA 4IMKA 3GSUA 3OJDA 4MJIB 5FUZL 1NC4D 4BA8A 4FQ1L 1XZ0B 1W0YT 3ARFA 1PEZA 3L3DA 4OZFA 2MTPA 2CLRB 2XQBL 4PJGF 4OFPA 1J1OL 2HRLA 5ADOL 1Q1JL 3TNNB 4LCYB 3FQRA 4H26A 5CJXA 4PRDA 4HK3N 1JVKA 2X4NA 4EN3A 4YHLH 1F6LL 4OZFH 3HI1A 1P7QB 5SWSE 5C0JB 3ET9F 4C83A 4Q6IB 3AB0C 3DX6A 1ZTXH 1QBMH 3BD3A 2ORBL 3PDDA 5IQ9A 2MCPL 5GQBA 4CU6A 4EVNA 3QDJD 1AGDA 2AGJL 3I6LE 5E99L 1G9EA 5FF6B 3VWJC 2VLRD 2NCMA 5KN5B 4X6BA 1A7PH 4FP8H 4CRPA 4OT1L 3ESUF 3V6BR 4G8GA 4PJIA 3SHSA 3NIFF 4KKCC 1X5XA 4EDWH 2FX7L 2VUYA 5ACZA 5TPWL 1H3PH 5GHWL 5KZCD 2FO1A 5DUBB 4RIRA 4WUUB 4OV5A 1Z9SA 4ISVA 5CLTA 1R5IA 4ZO7A 2BY2A 1FDLH 4LLVB 1NC2D 1OW0A 3RWGB 4DJMA 2A9NL 4NQCE 4LEOB 3MRIB 4JFHE 4MD4A 1XGTA 1SM3L 4HXBL 1MJJA 4WI4A 3B83A 3LOWA 3SOBL 1JPTH 1AD0A 3W0WA 1AGFA 2WBJC 1MCWM 2BJML 3OKLA 2F8OA 3MYJB 1KBGL 1NCUA 2QSVA 3GJEA 1BZ7A 2BSTA 3Q48A 3I02B 3IDMB 4FXGB 3G08B 1I8MA 3VXMB 4YHLL 3JTTA 2YD4A 3TIDA 1MF2H 2P24B 1ZANL 5H8DA 2VXQH 1ROWA 2AJUL 1QBML 1SJEB 4X4ME 2BRRL 1C5CH 2X4QB 4OUUA 1I7UA 2CDGB 2YD6A 2DQJH 1BBDH 2NMSA 3QULB 2NXYB 5JW4R 4O2CB 4NQED 4JKKA 4NQUA 2WIMA 2P44B 4FP8L 4DGVL 1A6TA 4XCCH 3SDAB 2GJ6E 4JZJC 1OOAA 4QTHA 1C08B 4EUPG 4WGVB 5H37G 1X9QA 3MACL 4EDWL 2D0GA 3H9SE 3MO1B 3U4AA 1E6JH 3NCJL 3K4ZA 4WFHE 1H9VA 1Z2KA 4P3CL 5C08D 1I1FB 4KI5D 5HHMB 1FDLL 1G7JB 3MNZB 3TYFB 1JNNL 5KJRL 2OTPA 2F5AH 3KJ6H 3VXUB 4ZDHB 1FFOB 5TE4L 5FM5O 4LCCA 3KPPA 4KQ4H 3V8OA 1RJLA 5H35B 3MFFA 4PY7A 5DUML 4ORGB 3DOSA 1JPTL 4HIIB 3BE1L 4JB9L 5E5UB 4E9LA 3IDJA 1FNEB 1JIBA 1I4FB 4ODWB 5GRVK 3ROOB 2X9YA 4BFGA 3HUJB 3CPLB 1DUZA 1FYTA 1A14H 1JZ8A 1PG7W 2NPLX 3O2WH 2YPLA 4M43H 4X99A 4O4YL 4N0YL 3MRJB 1DE4A 3AREC 1RIUH 5FA3A 3O45A 4NHUA 2DB8A 4NN7B 3DBXB 4KKNA 5GISH 4QHKJ 5F9JA 4ODXB 2NTFA 3MJ6A 4Z7NE 1KLGB 1KC5H 5GSVB 4Y4FB 2DQJL 4NKDB 3L3GA 2CLVB 2HT2D 5FGSA 5J12C 4O51B 5D72H 2EO1A 2HJLA 3VXOB 5IVXE 5BJTA 4XCCL 4XBPA 1EZVY 4L4TE 4JKWA 1E6JL 1JN6A 1Q9KB 3QIBC 5BXFA 4AIOA 2FZ3A 1GAFL 3RZCD 3PDGA 3DGCR 5C0GA 4X8XA 2A9MH 3MA9L 5L8KB 2EE3A 3LKQA 3QYCA 4V1DB 3CK0L 3K2MC 3H9HA 2FJHB 1UWGH 4DKFL 1NGWB 1EDQA 1EHLH 3GJFK 4I0PD 2P7TA 3BKYH 4NT6B 3TF7A 3BP6A 5I1KL 4JDZB 5ALCL 3OAYK 5JHDB 4Y1AE 5C0CD 3N1MC 1YEHL 2J4WL 1NCAL 2OTWA 4PB0L 4XXCC 4PDCE 3QQ4A 1LE5B 32C2B 4P2RE 3SDXE 3U7YL 4E42A 5I15L 2E9JA 2Y5TB 1YY9C 3BWAA 1RUAL 1KB9K 5DHYB 3QEQD 5C9JA 1UCBL 5GISL 5IHBA 5GS1A 3HZKA 1MEXH 1RZFH 4M6OH 4Q9RH 2PXYB 1RIVH 4M4PA 4M1GH 3C5JA 5ICYA 1S7XA 3F7VB 1IAOA 1HEZA 3N50A 3JUZA 4GXVH 2XWJA 4ERSL 5GZOD 5EC2A 1INDL 4MLSA 4TOYH 2AK4B 3GMRA 4XAKD 1D5IH 3MJ9A 1UM6L 2P42B 3IJHA 4M5YH 5J1SC 4NUJB 4WIQA 2X4UB 4K9EL 1EERB 4M48H 4ZG1A 3BUYB 3MV11 4X5XB 4N5EA 1Y6MR 4PV9B 2J5LB 4OZGA 3H7LA 1MFAL 5CCKH 4UQ3A 4GKOA 3MLRH 3MJ9H 4WFGE 3ULSA 5FGBA 3BZFB 4MXVE 1EHLL 4I5BA 1B0WA 5JTWA 5BZWB 2QADB 4MA3A 4OI9A 1PZUB 2B4CL 4P9HC 2BRQA 3C8HA 2BVQB 1VEOA 1NCDH 4U6XA 4X7EC 4RRPA 2A1WL 4TULH 3FN0H 3INUL 3TO2A 5KSVB 1N26A 4ZUTA 1MFCL 3EDDA 5CEZD 4LL9A 3ZDXE 5EWIH 1QVOA 4PRHB 3MC0A 2R1WA 3BAEH 1SVCP 1RV6X 1KSRA 2VL5A 1REIA 2P5EB 4M6OL 4Q9RL 4ZO8A 3F12B 5GGSY 5I8CA 4PJEE 3PDOA 3L5JA 4MLIA 4F7EB 4WV1B 5JDSB 1QKZL 2IGFH 4YZFE 3QWRD 1JE6A 1UH4A 1LEIB 4Y89A 1T83C 1I85C 5F7DB 3P4MB 3RL2A 3BT2L 2CK2A 4LK4A 3O41A 2YRPA 5ABDE 1X5JA 4M5YL 5FYLL 3HR6A 3QA3A 4N0FA 2DI7A 4N0CC 1WAAA 4ELMF 1LD9A 3RHWF 4JG1H 5BRZE 3CSYA 3QDGA 4JCMA 1BOYA 3BMWA 3TN0D 4FMKA 5GGVY 5LGJA 2EE6A 3MRDB 5IFHH 4F3FA 4KRPC 3O3EB 1H8NA 1DSFH 3AM8C 1TCRB 5D7IF 4Y4KB 1NGPL 2ARJA 4MVBD 5GGSB 4K3DH 1INEL 2FB4H 5IFJA 1H3VA 4EUPB 2LABA 3VRLE 1PEWA 3ZTNH 4TULL 4BSWB 4OUOA 5EWIL 3CSBA 5DDHA 3IJSA 3S4SA 4GG6E 4JANA 5I1JH 3C60D 4NC1C 2YD8A 2FBOJ 5GS2H 3AXLA 3MQIA 4OCXL 1WFUA 2R4RH 4G9FE 2E7HA 1TETH 2I60L 1DBMH 2YR3A 1HWHB 5GIRA 5MENB 4KTEL 3BIAX 3TPKA 1HNGA 1U8NB 1SVZA 5KSAC 1KB5B 1ITBB 2DTMH 2DLGA 2K9UA 3CMOL 1OP3H 1JWUA 1FLRH 1LE9B 3IXAA 4NGHH 5TGBB 3NAAL 3IDIA 5IW1B 4M8VA 4HQQL 3RWEB 5I73C 4WHDA 4LRNL 5FO8A 4LCWB 4JFFE 2VH5H 2H6PB 4WENB 3H0TB 2IAMC 1CFBA 5FHAL 3TA3D 3V6ZA 3O11A 5T33L 4LSRL 3W11C 2C3XA 3R0NA 2CQVA 2FLRT 4EDXA 1DSFL 4RQQB 3MJ8A 4KJWC 1PLGL 1IGTB 4K3DL 4G8FB 4YFLF 2F15A 4HLZG 2FB4L 1CFTB 4NNYA 3T8XB 3K4AA 4G5ZH 3ZTNL 1MIMH 1RIHL 1UVQA 4DCQB 4DAGL 2CO6B 5IESH 2BMKB 2VABB 3RY6C 3GI8L 5F88B 3GB7B 1N59A 3QRGL 5I74C 3GSXB 3DMMB 5I1JL 5IB1A 5FIEA 3B9KC 1JPSH 1P7KA 5I1LB 2FD6H 3PWPA 3LIZH 1TQBB 3X12B 3MJ7A 1GIGH 2YD7A 1KGCD 1HZHH 2Q8BH 1TETL 3V6OE 5DEFA 1DVFC 3UJTH 1DBML 3G5ZA 1QRNE 1BECA 1FGNL 1CGUA 1FAKT 3PQYD 2E5EA 2Y9RT 1D5ZB 4X6CB 1GHFL 1XF5A 2GAZB 3O3DB 2ADFL 4PGCA 4XZUA 4ZMAT 4MAYD 2HN7A 3OZ9L 1N64L 2NZIA 5KVFL 4M7ZC 5ID0A 4I2XA 4OCYL 1CTNA 3G5VB 3P9MB 1DQLH 1AD9B 1N8ZA 3KXFA 3F7RA 2WK2A 4XVTH 4FFYH 5FKPB 2NY3C 3ILPA 1DLFH 1RULL 3UZVB 4MDIB 4JVUA 4P4KC 5IUSA 3BPLB 3OPZH 2OJEB 2GUOA 4U7KA 4FQXB 3SGEH 2HT4C 3WKNA 1MJUH 4A6YL 3ZL4H 2DBLH 4G5ZL 2BX5A 4FHBD 3SGEI 5KAQF 1FG2B 2XZAH 3W9DA 4X4YB 2WP3T 5IESL 4GRWE 4HUKB 1AXTL 5FA4B 1G9MH 3LPWA 3VGAC 3F62A 3WLBA 3HPJB 3QXDB 1RU9H 1BD2B 4U1LB 5EUOB 5HYJD 4JR9L 2HFTA 3WUWA 3CNKA 5DQ9A 3K8KA 1WFNA 5DQJA 5C0RL 2Q8BL 4FNLH 4H5SB 5M95B 1IC7H 1VFAA 3T1FA 3I3BA 3WO4C 2NW3B 1G7QB 5SWZE 1PG7X 5D1QA 4U7SA 3MRGA 3RJQB 2G9HA 3DX7A 3GMPB 1GC1H 1WLHA 1A6PA 1CFSA 4Z7NF 4GAGH 5CIPA 4G3YH 3T0EA 3EFFB 4ZQKA 4D3CH 5KG9B 2C3VA 4JZOB 5IVXF 1RZIA 1KCRH 4XMLH 3CVHA 4BFIB 4BJLA 4IHOB 4G6AD 3RY5A 4PJFA 5JXED 5CIPH 1AY1L 5DJ6B 2V9TA 2OJZH 1DLFL 3PHQA 1UT9A 1I3VA 1KPRA 1NGZA 5DGRA 4PR5A 3QDMD 1HI6A 1S7QB 1MJUL 1P4IH 4Q9BA 4DVBB 1BX2B 3CVHH 4JFYA 5K9OA 1Q0YH 2C4XA 4NCC2 5DZNA 5C3TA 3OKDA 4LSUH 2EC9U 2XZAL 4YDJA 2Z8RA 1F6FB 3VWKD 4Y2DA 4PJ5B 4LAQL 4GW1B 3PP3H 4QCIB 2ZSVA 2R8SL 2ADIA 4OLVH 3WO3B 4L5FL 4QRRD 4QLRA 2IG2H 4LLAA 3VWJA 3VXQB 4WGWB 3FKUS 2ATPA 4FNLL 4OTXH 2EDLA 1YEFH 1EVTC 2PR4H 4BSVA 1JF1B 2BSRA 2E6QA 4OFVA 5ERWA 43C9B 4MS8D 4FQIH 1QLEH 3QUZA 5JR1H 4HIXH 4O2EA 1MELA 1P53A 3B8YA 5F70A 3T04D 2R2BA 5C08B 4NKMB 3MX0A 4OLWL 2KZWA 1HXYB 3ARSA 1EHNA 2V9RA 1CDIA 5B38A 4HG4K 1I8LC 3F5WA 1N6QL 3TCXA 1PYWA 2ESVA 5T3XE 1TPXC 1QSFA 4JRYA 4AEHH 2BERA 1E28A 1IC5H 5E2JA 4L3EA 3BW9B 4MA1C 3ARDD 4QOKB 3MRPB 3E3QC 3HNSH 2OJZL 2HFGH 2R2EB 1F3RB 4OCLC 2IANA 3HPLA 4PJHE 5LBSL 2WBJA 3Q5TA 3D1MC 1FVEA 1ZHKA 5ENWB 5IGXH 3JZ7A 1EAPA 1Q0YL 4R4BB 3P11L 5T1DH 1D6VH 1XIWA 4JVPA 1QA9B 4U1SB 4MXVF 2CJUH 2H26B 4P46D 3WEXB 1I7TB 4PP2B 4GRLB 2HAZA 3HI5H 4FQCL 2VLME 4MZ3A 4KXZH 5D2NA 2BK8A 4MX7B 2CKBB 5FCUH 4JY6B 4LDOB 1BP3B 5JXAL 4K9EC 4NHCL 4KXZI 1N0XH 4JQXA 4WTWA 4ZXBC 5ILTH 2PR4L 3NFNB 5LAXA 5CHNB 2IALA 1RK1A 1KNOB 2NYYC 1J0HA 3RKDC 4F57L 1QLEL 3BN9D 4U31A 1MJ7H 3PXHA 4DN3L 3P2TA 4QHNB 1N2RA 4IRJC 5EOCL 4E41B 4PJEF 4RZCB 3RTQC 4WNQB 2B4CC 2EYTB 3NCFB 1XCTB 5DEGB 3G6JF 3LEXB 4YZFF 1CGVA 4PP1D 4WTZA 2IBZX 4JFZH 2C4FT 4PJ7E 1IC5L 3IXTB 1HDMA 2J7LA 3STLB 2AKRB 3JBG7 2HFGL 3IYLW 3QEGL 5CGYD 5D5ME 4FQQB 1F58L 1D5MB 4RAVB 5D7SH 1A2YB 1QD0A 2I26N 5A43C 2V7HA 2Z0BA 3AREA 4XP6L 4ZSOE 2CJUL 3RGHA 1B4JH 4JM2B 4H1LB 1FL5B 1P9MA 2LU3A 4MQ7A 2EZ0D 2PN5A 4JRXA 4XC1H 5E7FA 3BP5B 3V0VA 3K46A 4OM1H 1Z5LB 1WVZA 5E5MB 5DVNA 3UPCA 3VRLF 4CAGA 2VQ1B 3RWFA 1DBJH 3UTTA 4MJIE 3SDYL 2CR6A 1OF2B 1MLCB 3CIQA 4DZ8A 3VFMA 5CILH 4OZHB 1I7ZA 4PIRF 4HZLA 3K2UL 4UDTA 1J8HB 4GG6F 1ZWIB 5BS0A 1U91B 5DI8B 2LTQC 2WUBL 4QXTA 3UTSA 5DK3A 5HHOB 2H2PC 3MV9D 3L3KB 3N06B 5MI0B 3G6AB 4QRPA 3FT4B 1T20A 4HGWB 4X4XB 4I3SH 5DS8B 5HGAB 5IQ7L 4Y19E 4ZS6D 3S37L 5F21B 2EICA 4HW6A 4KQ3L 2R1YA 2E7CA 4M8QB 1DBAL 1T2QH 1KJVB 1U3HD 1T22B 1EUTA 5IIEB 3TYGH 1WEJL 4PG9A 3VGHA 5F1OB 1A6ZA 3RGVB 3FB5A 2ED7A 5AWNH 4XXDB 5I66B 1W2KT 3PNWB 2LVEA 5DD3L 3NVQA 1X7QA 2UY7A 3GJFB 5JOEA 2A6JA 1XF2A 3VG9C 1EV2E 1CDGA 3G9VA 5I1DA 4PJCE 1DBJL 1U95B 3L6FA 5I8KH 4Y4HB 2WSKA 4LRIC 4YDLB 4X5WB 3OXSA 2DWDA 2EO9A 5IB2A 3LHPH 5CILL 1NANH 1IQDB 4AT6B 2PO6D 5E00B 2FL5A 1T21B 4AEFA 1J1PH 4KY1H 3SBWA 1EEZA 3MLUH 1NANI 1CXLA 3T09A 3C8KB 4NN5C 3P0GB 1P1ZB 4YC2C 3VXME 4JQVC 3O6FA 5HD8C 3TC9A 1W0VB 2YN3A 4F9PC 2VIRA 2FHCA 4LASL 5I76B 1JGUL 4I3SL 4AM0B 3CXDH 3D0LB 2IWGA 2NR6D 1I9IL 1M6OA 4JJHA 4ZOBA 4HKZB 4KV5F 3O2VL 3LKOB 4QHKI 3B2UC 3RBGA 4WI3A 1UADC 4WEBH 4M7KL 5DJDB 1FIGH 4QWWD 5D7LB 1S7WA 6CGTA 3OKNB 4ZPVB 3N0PB 1DQQB 2BDNH 1IM3A 3DRTA 2DQGH 5HHME 5C07A 5AG8A 2HLAB 4OBRA 2DI9A 4L8DA 3U2SB 3VXNB 1D6EB 5ADPH 4WU5A 3VXUE 1SMAA 3QNYA 1IT9L 1UKTA 3IB4A 5JMOC 1G7IB 4OD2B 3QUXC 3TZVA 2DQCH 1HSBA 1PG7H 3L95B 4JPIB 5FYJE 4MAUL 4EN3D 4GRWF 1XF4B 4NPYB 3EYSH 4BM7A 4QF1A 3RIAK 1LDSA 4S1SL 3LV3B 4CVUA 3AS1A 1FZJB 3UAJD 1H8OA 2I9TA 3HUJE 1T1ZB 3QEUA 4PGDB 2BVYA 1RUKL 2YK1H 1TZGL 4QRQA 4NN6B 1KN4H 2Z4QA 2R1XB 1IAIM 4JFQA 4N0CA 5C09A 2AERT 3RWIB 3G04A 2HMID 4LPXA 1LO4H 1CIUA 2DICA 3LPGA 3MNWB 3LKPA 3CXDL 1MIEL 3GUTB 4UAOB 1D7FA 5E9DD 1QRKA 4Y8AA 2CXKA 3QPXH 4L4VD 4Z7UB 4BH8B 2XWBA 2IPKB 4W68A 4J3VA 4U6VL 4YE4L 5JW5A 3SDCC 2VXSL 1FIGL 1FC2D 3O9WC 1Z6JT 4HUXB 1VFBB 1S5IL 1U6AL 3ZLQC 2DQGL 1OB1B 3W0WD 1RFDH 3DHJA 4RAUA 2DQIL 1RHHA 1ZEAH 1U8HB 2ZNXA 4ZNEA 4Z77B 2BSSB 4V1DE 1ZLWK 3ARGD 4HKJA 1N0LA 5INCB 2EKSA 1PG7L 4YO0A 4NNXB 5ETUA 2JLLA 4Y16D 2R29L 3BESR 4PP8C 3O4OB 3DSNA 1X5ZA 4IRSB 5JHDE 1SJXA 1WGOA 2QR0B 4UIKL 5HYEA 3HZYA 1XF3A 2NY4B 2Z92A 4L1DA 4HUWA 5SWQB 4P23C 3DTXB 2YK1L 2HFEA 1AR1C 2VDMH 4LNVA 2HWZL 1F3JA 4F7CA 3FQWB 3V5DA 5IBTL 4WRLA 3NGBB 1J87A 1JPGB 3UPRA 1LO4L 4RBPH 2V5SA 2ENYA 2BNRA 1JGVL 5D2LB 5DA0B 3BQUA 4NC2B 4P57B 4FZ8L 3IJYB 1INQB 3QIWB 1DR9A 4PJ9B 4QY8B 3V4PL 1CI5A 1NCNA 5AYQA 2R15A 1GZPA 1QLRA 2AK4E 1YMMB 3FTGB 1FFPA 4YBQC 1Z9LA 2AXFB 1WZMA 1FFNB 2XA3A 4CVWA 4BELD 4S1RH 2NY1D 4LAJH 3O8XC 1NFDB 4BKLB 4N90D 4G7VL 4ZFOL 1MI5B 2HT3D 3MA7A 4JFDA 4PJHF 5CSGA 1A8JH 3D0VA 4FFVC 5F3HA 1WTGT 1MWAA 3GO1L 3OBAA 1FYTD 3LS4H 4ALAH 5FOBB 5C2BH 1Q9WB 2YPLD 4F37K 3BGMB 3N1QC 4FMFA 4MNQB 4R96A 5GRJH 1MLBA 3GFUA 2G5BB 3RVUC 3DHMA 5HHPA 1IZJA 2RAMA 2BVTA 4KROC 1KELH 4GKZB 1MWAH 5FB8B 2NY5H 1T1XB 1LDPL 3MV01 4G7YL 1V7ML 3IRZA 3MZTA 1TCMA 3FOMB 1JYVA 5JA8B 4APQB 1X5HA 3WL9A 3KJ4C 4KI1A 4YLQT 4D0DA 3WFDH 5KVEL 6FABH 3CFEB 4GW5A 4XBEH 1L8JA 1E4WL 3DETD 1ZGLB 3IKCB 5DSCA 3CDCA 2P5EE 3OR7B 4OD1L 3HKFA 3PABB 4P4KA 4G59A 2A77H 3OSKA 3BPNB 3TPUA 4PJDA 4OCMC 1YN7A 3PHOB 4ZFZA 1C7TA 4M4RA 4HMEA 5CUSL 1NCCH 5T5FH 3QG7H 5JUEH 5EC1B 3S8WA 4PJ7F 3QT2A 2YBRB 3MRMB 1DP0A 5FHBH 1MH5B 4R2GD 4JPWH 3LEYH 3LCYA 5GRUH 3TBVB 5D5MF 2P46B 5E2WL 4YHPB 1IEBA 2OQJB 2LE9A 4WWKB 3DUHA 3KDMA 3VMPA 4MJ5A 3GMMA 4IIQC 4JHAH 3VFRA 3A67H 5GRJL 1AO7A 1Q0XL 1TZIA 4KTYA 5E8PA 5DJ2A 5FO9A 5DGQA 5IB3B 3RWJA 5DK0B 1JHTB 4YDKH 2PNDA 3BH9A 3BKJH 5IJKC 1QBAA 3W5MA 3CH1B 4H20H 15C8H 1NAMB 2YMXH 3C2AH 4OZFG 5EFIB 3SCMB 2VLJB 1RUQL 2IBGA 1IGMH 1KLUA 4AENA 1MJ8L 5E1AA 4XBEL 5GSRB 1HH6B 3DURA 5C0EB 1T0PB 2Q86A 3HAEA 4GKSA 1HYRC 4QXWA 4PUBL 4YIQA 2FO4A 3CC5A 2NY0C 3K8MA 4OF5A 1P4LB 2A77L 2OR9H 2F54D 3HRZB 4N5ED 3QUYB 2VQTA 5MENE 2XIDA 3QXTA 1BIIA 5CGTA 1WBZB 2DM4A 1OTUD 3IFLH 4J4PA 1QO3B 5IM7B 3HAEH 4YFDB 3TVMD 5T5FL 1S7TA 1BQLL 2IQAB 3EYOA 5FHBL 5FECB 5IV2B 1ZSDA 43CAA 4EI5B 4UBDD 5JO5B 1D5XB 4YGVB 4LCWE 3V7AG 3DV6B 3Q5YA 1IKFL 4MXQA 2A38A 4JHAL 3A67L 5DJXB 1AHWB 3SDDC 3GHEL 5E94B 5CKGA 4JG0H 3K80A 3VRIB 4ENEC 4YDKL 3MRRA 1PQZB 1T4KA 4H0IA 3DECA 3PV6B 2J12B 5AZ2L 1Q9LA 4HS8H 2YEZB 1KEMH 3TO4C 3WIFA 2X4PB 4ZOEA 2WINB 1NSNH 1R5VA 1A3QA 1S3KH 3R1GH 1MRCL 3MRKA 3G9AB 4UV7L 4XHJD 1IGML 2JJSA 4HPYL 1OTTC 1A6WL 1T7WA 2E8ZA 4CW1B 4HT1H 3E3QA 3R06A 4LPTA 4LSTH 5J1AA 4I3GA 1BVLA 1D9KD 1MVUA 3STZA 5IEKA 5B4MD 2GK2A 3KPRE 3QISA 3MR9A 1U42A 2UY6A 2C26A 4RGND 2P5WA 1YUHB 3DPBA 1C5BH 4JAMA 1NFIB 3F6LA 5HGHB 1YDPB 2MHAA 4BUHA 4X6CE 1XCQA 1HXMB 2YD2A 1K8DA 2B2XH 4OAWA 1IL1B 3DVIA 1EGJH 1HHGB 5I30H 4Q0XL 5DRZA 1ADQA 1GPOH 4YHKH 2HJFB 1D5BA 4FZEH 1EZVX 2EDTA 1YEEH 1XAUA 4PYGA 1OLLA 5DRWA 4EXPX 2ILLA 4DGIH 1G1YA 1DN0B 4ZXBA 3U1SL 3V5HB 2GKIA 5L2KB 4MNGB 3FFCD 2HKFH 5DVMA 5JORA 1ADQH 1H5BC 4DN4L 4WFED 2XTJD 1LQVA 4JG0L 1U92B 2A6IA 3OGOE 4E0RB 1JZ5A 3UYRL 4LSDA 5F1IB 2AV7B 2BNUA 1KPUB 1LILA 3MODH 5DK2B 5C6WH 2HJKB 3VDAA 1S3KL 1QSEA 5D1XA 1EA9C 2BNQA 1JNHB 3CDFA 3DO3A 4HS6B 5F7YC 3N1FC 1FL3A 3HB3C 1BD2E 3JTSA 3QDJE 5EUOE 3HUJF 5DEZA 4LARH 2H2SC 4PJGA 1CGYA 4S1QL 5JIKA 3VXSA 4QT5A 3ZYOA 2F53B 4F9LC 3E2HA 3FB7A 3EBAA 5MP6H 1KT2B 2R2CA 4NQDA 5C0DB 2GCYA 2LFGA 4GSDH 1R3HB 2CIKA 2P8PB 1U8IA 3REVB 2OSLA 4X0KA 5DD1L 4EI5A 1EGJL 4KHTL 1QR1A 5F7UA 1W0WA 5T3XL 1EHAA 3MV7A 1CICA 2EDFA 1NUNB 2JJWA 1ACYH 1UYWH 4K7FA 1JPST 3MBEC 4P5TC 4DGIL 4I18C 4ZUSB 4LLMB 3IDYC 2J6EL 3S3JA 2CSPA 2G75A 4XCNA 4ZAKC 4TTDC 3U6RB 1A1NB 3MMEA 4X98B 3ZSTA 4Y5YB 2OMNA 4NO5B 2H8PA 1OAKL 2VZOA 4MD5A 1JV5A 1SYSA 2B8OT 3OKMA 1OQOA 1H3TA 4NBXB 3RU8H 3W39B 1CF8H 4DUWA 4PJ5E 4UNUA 3RI5K 1E0OB 1FGVL 2VUOA 1Z3GL 4D0CA 4WO4D 2NY2B 3VCLA 4G6ML 3PP3K 3VFPA 3P30H 4MNHA 1P4BL 5HHNA 3FO2A 4N9GA 5HGBA 1U8OB 3NABH 4QXUH 1YYML 3WD5L 1TQCB 4S1DC 5ISZB 3IVKB 4BH7A 4OCRH 3LMJH 4P5KA 2CH8A 4XGZA 3RPIB 4M6MH 5F96H 1E4KA 3TESA 2AEWA 4OGYH 4HUMB 3BD4A 2JIXB 3JVGC 3OJDB 3LEVH 1DQDL 4GBXA 1KPVB 2R0ZL 2VNCA 3OL2A 1R0AH 5C08E 4YHYB 5T3ZH 4XT1C 3ARFB 1KJ3H 5L9DL 1B6DA 1FPTL 1EEYA 4OZFB 3L3DB 5IFAL 2EIZA 3BGFB 3DNKA 5EUKA 3T0XA 4P4RA 3GBNL 4R97B 5I8EA 3O3UN 3P73B 2W92A 3ES6A 4KJPD 4H26B 3C6LD 3HMWL 4P2QA 4QNPE 5BV7H 2BOCA 3KPLA 2X4NB 3MV8A 1EO8L 4DW2H 4QOKE 1OT1A 2FGWH 1CN4A 4LRIA 3RWCA 4M1CC 3HI1B 3L3JA 5TQ2H 1QFOA 3GKWL 2YA1A 4X7DC 4C83B 1S7VA 3DX6B 3ORJA 5IQ9B 4EVNB 1ZA6A 4G8EB 1NAKH 1AGDB 2Y1VA 5EN2A 4ONFH 5F3BA 3HG1A 1RZ7H 5CSBA 5E0QA 3SE9H 2IH1A 4X6BB 1SY6A 3TM6A 1CF8L 4G8GB 4JQVA 4PGEA 4NP4H 3FRPA 1O5DT 2VXTH 5GGUA 4O2FA 3TBYA 4F9PA 5IMMB 4AMKL 4OV5B 4RIRB 1A5FL 4ISVB 1R5IB 2DYPD 4QXUL 3QWOA 1SY6H 2OBGA 4OQTA 4J23A 1FH5L 4PRIA 1IEAA 1T04A 2PYEB 4FXKA 1CXEA 2ITDA 3VRJA 3BKML 4PGJA 4M6ML 4K7PX 4MD4B 3VXTA 3VJ6A 2FEEL 2YXMA 1BFVL 1RZKL 1A6UH 4F2MB 3N85L 3ESVF 4OQTH 5CJOH 4E41E 1KJ3L 1QBLH 4FFZH 1MREL 2J88L 3OKLB 3TEUA 4K3GA 3ULUF 5FV1L 3GJEB 3O3BA 1BZ7B 4FFWC 3GIVA 4UOW0 3QUXA 2AK1H 3S36H 5BV7L 1I8MB 1PSKL 4DW2L 4M6AA 4L4JA 2E9WA 4YH6A 2FGWL 4ODBD 3JTTB 1OAQH 5TQ2L 3TIDB 4ZUVA 5JPMA 5C0CE 1JFQL 1IGCL 5TF1L 2JB5H 1UWEH 3LQZB 4OM0H 1PVHA 5EU5A 1BZ9A 1Z0MA 2NNAA 5B8CB 4ONFL 4OUUB 1I7UB 5EO0A 1G9NL 4DGYL 3VWJD 4M61B 1A6TB 3EKCA 4QTHB 3MOQA 4KKCD 5EIIA 3RY4A 1GGTA 1ZS8B 3HZMA 1KCKA 2UZIL 3VFWA 5DQDL 1FBIH 2VZUA 1QEWA 3BKCH 1Y0LA 4PB9H 1KIPA 5F8RC 2X70A 3TT3L 5EBGA 3S4SG 5BVJA 1T0NB 2BVEA 4PJ8B 1U8LA 4IEFB 1MCPL 1FVCB 3H42H 2QHRL 3KPPB 4WEMB 5DO2C 4YXLH 1IM9A 3P9WB 5LGHH 3S35X 1J8HE 1YNTA 3K3QA 1VFMA 3BEWA 1A6UL 3O9WA 5DFWH 3CLFH 1GJIA 1VDGA 2WQ8A 4NZJA 1FCGA 3IDJB 1U8MA 2WBJD 3ECBA 1DUZB 5HYSA 3KYOA 2AJSL 4X99B 3IKKA 2AK1L 1DE4B 3KS0J 3PL6C 3EZJB 1MFEH 4JN1H 1A47A 2ZOLA 5FA3B 1A1OA 4NHUB 1OAQL 4DVRL 1I9EA 2DQUL 5F9JB 2Q20A 1UWEL 1RJCA 3RDTC 5IB4A 2NTFB 4UV4L 4P23A 2Z31B 3EJZC 3V6OC 3GNMH 4PD4J 3H6JA 5LXGL 3C08H 3I3EA 2BVPA 4KVNL 3L3GB 5KVDH 3SE3C 4I3RL 2HJLB 4K23H 5BJTB 5E7BA 3K81A 2JELH 4ZO9A 4NNPL 3KLHC 1LVEA 3BMVA 7FABL 3U46B 4CN6A 2UVFA 5FYJL 3ROLB 2FZ3B 4G6FD 3HC4L 3OKEA 5C0GB 5SX5H 1X4YA 2K1MA 4KHXL 3RA7L 3ZKXB 1U3ZA 2FATH 1I9RL 4R8WH 5E6IA 5DT1L 2CIIB 1Q38A 3H9HB 1F97A 3LRGA 5SV3A 2Y25A 3C09B 5T1KA 2D7TH 2P7TB 1MPAL 3GEWB 3QIUA 4M93B 1M1SA 3BP6B 3CLFL 1B6UA 3HE7A 3ZHLA 1QHOA 1G6RA 3FO0H 1K4DA 4J8RA 1SEQH 3QQ4B 1AC0A 2OMBA 1N5AA 5ITBH 2QHLA 4X6CF 5D8JH 3KNBA 3ARED 3BD5A 5LKNA 3BWAB 1MFEL 3NN8A 4XMPL 5C9JB 5E4EB 5J13B 1G6RH 1GZQA 1UEMA 3RP1A 3HZKB 3V79C 2HLFC 4ONGH 2J8OA 4K94H 3JV5A 4MJ6A 5DJAA 3C5JB 3GNML 5C0AD 5ICYB 1NMAL 4ELMA 3D39B 2EH8L 1IAOB 1KENL 1ZHNA 3C08L 3NACL 4NC0B 2JB6A 5JPNA 3FRUA 2XWJB 1JGLH 3UTOA 5EBWA 3J8F7 5EC2B 1A6AA 1OTSC 3DX9B 1UEYA 2QSCL 4ZFGL 4P3DA 4WFFD 4UTAH 5ESQA 3IJHB 5BS0D 5D7IA 3QUMA 3KYNA 3QIBD 1LNUA 1TTGA 1WWAX 1EH9A 3FT2A 4HH8A 5F93C 3EYUH 4FOMA 1A22B 3EIFA 3UTSD 4OZGB 5EU6A 3RWHA 1FZOA 4PV8A 4UQ3B 1HSAA 1B2WL 2FATL 2HG5B 4LVNB 3WUWG 2B1AH 1UA6H 3Q2CA 3QUMH 4QRPD 1J0ZA 1XGRA 3SKOA 4I5BB 4Q2ZA 3SJVA 5EUOF 2SEBA 2PCPA 4HWUA 4MA3B 2FDBP 4OGXH 3H2WA 3X3GL 1OCWL 3M1BA 3NTCH 1OPGH 4U6XB 3O81A 3C5ZA 1SJHA 3GIZL 1AXSA 2MMXA 4Z78A 2W9DL 1XR9B 5I1CL 3A6CH 3TO2B 5D8JL 4ZUTB 4HUUA 3NBNA 1YY9D 3IFNH 1AP2A 1GXEA 5EOQH 3ARBC 1LWRA 1FP5A 2OI9C 4XRCA 4LNRA 5DURD 3OGCA 2R1WB 2VL5B 1D3CA 5IW6B 5JOFB 3FCTB 4Z7UE 1UJ3A 5L2JA 3LRSA 4K94L 3P40A 5I8CB 3MRNA 3PDOB 4KWUA 4LKXA 1WWBX 5FUOH 4ZS7H 1JGLL 4LQ1A 3I6GB 2GYSA 4QO1A 4U3XA 4JREC 3RL2B 4RA3A 1XGYL 1SEBA 5DHXB 3MLSH 5I1EH 2XNAA 5FYKD 3QA3B 4XP5L 3QAZB 4LKCB 4MA7H 2QLVB 5J7CC 3QI9C 3V4VL 1LD9B 4GQPH 4UT7L 3CSYB 5H37H 3QDGB 1CTOA 5I19H 4WI8A 5LGJB 1QUNA 3B2VH 2VZ3A 4F3FB 3BO8B 3TFKC 1P5VA 5T1LA 3JWDL 25C8L 3EDJA 5KSBA 4AH2B 2FR4A 1T1WA 3WIHA 5J11C 2K3TA 5ID1A 3NTCL 4YHIA 5HHXH 1PZ5A 4QTIH 1DTUA 1CU4L 3RNQB 3QHZL 5CEYB 2B0SL 2QSQA 9CGTA 3L3OB 5D2LE 5B38G 3MOAH 5EOQL 3WIHH 5DDHB 3IJSB 1RZJL 3O0RH 1F2QA 3ULVH 5C07D 3D87B 1X5IA 4S0SD 4JANB 4L9LA 3AXLB 2AXGB 5I17A 1B0GB 2CMRL 2FNBA 4QNPF 2B5IB 5DVKA 3EDFA 3EUUA 1FHGA 5JW4M 5FUOL 4ZS7L 5E2UH 1NFDE 4R90L 4X8JA 2IPTL 4J3WA 1MI5E 4LPYA 4XPAH 4OGZA 4G42A 4RFNC 3S98A 1FFQA 1FO0A 4MQSB 1LO2H 4G6KL 1JWUB 3MLSL 1N7ML 1I1AC 3IDIB 4FG6C 4K7PH 4MNQE 4N0CD 5FO8B 1YECL 1KEGH 1BIHA 3IGAA 3LPFA 3QO0A 1FO0H 2V2XA 4IOFC 3O11B 5I19L 4NBZB 1BM3L 3CH8A 2DF3A 3EW3B 3G5YA 4L3CA 1AGEA 4KRPD 2BFVH 3OR6B 1AIFA 3J7HA 3SO3C 5FKAA 4LHUD 1EFQA 3WFCH 4NNYB 3P77A 2ZOKB 1JMXA 4RMSA 3CGTA 4HPOL 3IDNA 4EOWL 1H5BA 3MOAL 3OJMB 2NY7H 5GGVL 4WTZG 1ZXQA 4P2OA 1CE6A 1KB5L 5IB1B 1F8TL 4LIQH 2EDWA 3PWPB 4C54A 1K8IA 3MJ7B 1NC4A 2EH7L 1NDMA 4XPBL 3U7WH 4LPCA 5IVXA 5DEFB 4L4TA 4PLNC 3G5ZB 4RMRA 4MSWA 2JCCE 2WWKT 3OQ3B 5E2UL 3O6MH 3CFBA 2X4TA 5KSAD 4PGCB 1XF5B 4XZUB 5GS3A 1TFHA 2RR3A 4A2LA 1TTUA 3GHBH 4JO1H 2HN7B 3UXFA 3DI3B 1J5OL 4D0BB 4N8CL 2BSED 1S9VB 3U0TA 2YRZA 4TQEL 1UFUA 4W4OC 4LU5L 4RGMB 1OP9A 3IAPA 3PWUA 4I2XB 4F9LA 3TJHC 5BQ7A 3X14B 1YPZB 1WF5A 2EDRA 4Q6IC 1C8PA 1OGAD 1WZ1L 2D31B 1JGDA 4DQOL 1K2DA 1N8ZB 3KXFB 2Z8SA 4X7TA 3QXAA 3W11D 5HVHB 3ILPB 2VLRA 2XY1A 4JQIH 3UJIH 1LO0H 1K6QL 3FJTA 3KWWA 4CNIA 3P4NA 3FT3A 2GUOB 2ZG2A 4KJWD 2VLJE 3LD8B 1L7TH 4OKVA 4HULB 3L1OH 4OZHF 4PFEA 1DUYA 4ZD3H 3W9DB 2DTSA 1G9NC 4H8WL 3ZDZE 5CGMA 3LAFA 1NC2A 3WHE1 4OLUH 3LKSA 4L29B 4ZAKA 4Z76A 3V8CA 4OJFH 4P59H 2NY7L 5B3NA 4X9BA 3WLBB 4XNZB 1TJIH 1AGCA 1X5LA 2UZYB 2V7NA 3B9KD 1ZMYA 2XZCL 1J7VR 5DQ9B 4YXHH 2C1OA 5A2JH 5DQJB 5I1AA 1FVDA 4I77H 1L7IL 1DVFD 3V0WH 3T1FB 4EI6A 5JA9A 2Z93B 5F1NA 5HGGS 3O6ML 1CK0L 1MOEA 5D1QB 2HVJA 3MRGB 2G9HB 3W82A 5DRXA 3DX7B 3VXPB 5MHSE 1CFSB 5CIPB 3T0EB 2DM2A 3D85D 1A9BA 4Z7WA 4WW1A 4XNMA 1JYNA 3MREB 3S35L 2GJJA 2VISB 1IKNA 1RZIB 2WWMC 3QNZA 3T77A 4OLYH 3CVHB 3PE9A 4PJFB 3X3FH 2NXYC 2NY3D 2H1PH 3PHQB 4H88H 4MGXA 2AJZA 3TBWB 1KTLA 4P4KD 4M03A 4RWYL 1EBAA 1KPRB 1NGZB 1DFBL 4X7SH 3SDAC 1T6VN 4PR5B 1HI6B 1ORSA 2HT4D 4ZUWA 2HVKB 3PGDB 1L7TL 3F58L 4JFYB 1QFWL 1ITCA 2PTVA 2QQLH 3OKDB 4ZD3L 4YDJB 4UILL 3H9YA 3UTZB 4NWTL 4Y2DB 3UMTA 4ZUUA 1H3UA 5DC4B 5FV2A 4OJFL 4HEPG 4P59L 5JLZB 2ZSVB 4CN1A 1TJIL 1MCQA 5K59E 4LSSH 1JL8A 2C4FU 5E56A 2DL2A 3OV6A 4YXHL 5D70H 4XWGH 3G6JA 2ATPB 1CD1B 3MXVL 4TUKL 4I77L 1RZGA 1LK3H 3GSQA 1F42A 3MGTA 4BSVB 3KHQA 2BSRB 4MA8H 2HH0L 4IDLA 1LHZA 1QPXA 5ERWB 5C8JA 2QQKH 1FN4B 4K2UH 4EIZC 4UI2A 3QUZB 4JO2H 4RMTA 1UQSA 1X5AA 4O2EB 1Q94A 1A7NH 3TGXA 3U30B 3KPSB 2NLJA 2BOBB 4LLYB 4GS7B 2R2BB 3GSRB 3C87A 3WFEL 1NDGA 5L2KE 4TVPD 5BRZA 4MNGE 4NN7C 5B38B 1ZLVH 2ESVB 4JPVL 4KU1A 1QSFB 2Z91A 4JRYB 4OZ4B 5F7WC 3CDGB 4XTRC 2N4IA 2B20A 1EFXD 4L3EB 4Y4FC 4XP9H 5E08H 1QBBA 1C7SA 5DJ0B 4H88L 5EDXA 4FQJH 2IANB 3OWEA 2CGRL 2OP4H 1FVEB 4F58H 1ZHKB 2X4SA 1GGIH 3HFML 3RNKB 1EAPB 5LG1A 3LDBC 5EZOH 1EBPA 1XIWB 1TNMA 4FABL 5JNYB 3FN3A 4GG6A 4M6NH 2W9LA 4AJ0A 1EEQA 4K8RC 2F53E 3LQAH 1QQDA 4G6JH 2WUCL 3CFKA 5D2NB 3NCYS 4LSSL 4GFTB 4HLZH 4I0PA 2ED9A 3PHSA 5D70L 4XWGL 4LHQB 3CZJA 4NUGH 3VFVA 1WFOA 3MNVA 2IALB 2PYFA 1Q9OA 1CXFA 2DQFB 2QQKL 2AQ2A 2R0KH 3K8LA 4MCYA 3UO1H 1A7NL 4JO4L 5FDYA 4Z7UF 1OY3B 4R0LA 3QEQA 5F7LB 4K55A 5F97E 2GJ6B 4HC1A 3SE4A 4I4WA 4HKXB 4C58B 1CDYA 5HDOA 1P6FA 3EOAB 1S5HB 2IH3A 2XZZA 2F5BH 4LEXH 3TT1L 4QRUA 3UC0H 4NQXA 2PXYC 1MRDH 1HOCA 4HUNB 2A83A 1HDMB 4HBCH 5KSUB 2CKNA 5DHVH 3I84A 3P4OB 2V5YA 4FQJL 4HC1H 3ISWA 3LB6C 1UXWA 1XFPA 2E9BA 5J6GA 2P5WD 4W6XB 4XCEA 1GGIL 3CFDA 5JOPE 2V7HB 4W81A 1VERA 4J3UA 4I48A 4M6NL 2J5LC 2EEAA 5ISZE 3FONA 4MQ7B 4JRXB 3LQAL 3U9UA 3V0VB 3V6OA 5FCSH 2E27L 4WCYH 4HGMA 2AS5M 1QRNA 2KH2B 4R26L 3RWFB 3JXAA 2QADC 4EZMA 3UTTB 4ZXBD 5I6XB 1HKLL 3MLTA 1JRHH 5D2LF 2NYYD 3RKDD 3BP7A 1I7ZB 1H3XA 1SJVA 1J05A 2QQQA 1JRHI 4UDTB 4BQCA 1CLOL 4QRSA 1OSPH 3UO1L 4M62H 3TBSB 3JWDC 5J8OA 4IRJD 3WXWL 4XNQB 3RTQD 3WNPA 2AJVH 2UV3A 1F00I 1NFDF 5DFVD 1UXSA 5D96B 4L8BA 3UC0L 2H32A 2F58L 1T20B 1MRDL 1BLNA 4H0GA 2Q3AA 4HBCL 3U79A 5CEZH 2VLKD 1JNLH 2XPGA 1BFSA 4WV1C 3ULUC 5JIIA 1HHJA 3N1GC 1RZJC 3VXSD 1BEYH 3QWRA 4JFED 5CZXC 2R1YB 2MOVA 4OV6F 4G8GE 4PJIE 3VFOA 2H32H 4NQDD 1XR8A 1FZMA 1A4KA 4PG9B 3V7AE 4OKDA 1A6ZB 5GRVL 3GSNA 4U1GB 5AAWA 1S7UA 4EI5D 2OR8A 3RWDA 3D2UA 4NRXA 5DJCA 2ZSWA 1N4XH 1XF2B 4XPFH 2E7LA 3GGWA 4WW2A 5FYLD 4Y88A 2ZCLL 3GSWA 5I1DB 1UM5H 1HHKA 3GSNH 1U8KA 4NM4H 3BGAA 1M7DB 4Y4KC 2KBGA 4MVBA 2BCKA 3OXSB 2DWDB 1GVIA 1K3ZA 2DLFL 5E5RB 4YPGB 2FL5B 1OSPL 1OT2A 2XN9D 2YWYA 4AL8L 2R39A 1A21A 4YFEA 3CFCH 1FC1A 3PWJA 1NBVL 4CKVX 4OLZL 3V95A 3O6FB 2H2PD 1E27A 3C60A 2F9BT 2AJ3A 4AIXA 3KS0H 4K3JH 5HJ3B 1G7LA 4Y5XA 1X6NA 3MRQA 4OSUL 4Q7DA 1FV1A 1M6OB 1BEYL 4WWID 4UDUB 5C6TH 1GSMA 2OX5A 1CL7H 1MQKL 4PRAA 2WNGA 2R56H 1GGBL 1S7WB 3M8OL 3IU4L 1F4HA 4KK5C 4R3SA 1CL7I 3DRTB 4DTGL 4LLWA 3BYTA 4L8DB 4NSKA 4XB8A 4WU5B 3TA3A 3HAEG 4S2SA 3TZVB 2EYRA 2H45A 5B39A 5GGQH 1UM5L 2A73A 2PUQT 3VFNB 2YD5A 4PJXF 5IB5A 1G7HB 4KH2A 5C3LD 3MLVL 3U36B 4QF1B 5F8QC 4YHNA 1YEJL 3P0VH 3GM0A 2I9TB 4HJGA 3NA4A 4JLRB 4C56D 1BHGA 3GK8L 3HG1D 4TRPH 3F7PC 4FRWA 2VR9A 2YPLE 3FZUC 3CFCL 4QRQB 1CE1L 5DMJB 2Z4QB 4JFQB 5IT2L 1RVFH 5C09B 4NHUE 3DMMC 3G04B 3D3VD 3L7EA 5HD8D 3VI4E 4UINH 1S78C 3IFPB 1M05A 2LV4A 1TQBC 3O4LD 1CGTA 4H8WC 3KR3H 2GK0A 3VFTA 1JF5A 1A9EA 4M7LH 2J6EA 1CYGA 3LKPB 4XPTH 3MOBH 4ZFOB 2YD3A 3TV3H 1CQYA 2BY1A 4ODTH 1AKJD 2Y23A 4OF8A 4NCDA 3ABZA 2XWBB 4MAYA 3B2UD 5AYUL 5KOVC 2C3HA 3DVGB 2R56L 2HYMA 1C16B 4QRTA 3S5LA 2JE8A 4LQFH 3REWB 2YPVL 4MMXC 1VKXA 4RAUB 1RHHB 3OG6B 5L7XH 3PIQA 5CBAA 5E8EA 4WHYH 3HCVB 4HKJB 2EKSB 3QUXD 1ZLSH 4J12A 4YO0B 1RZ8A 2X1XR 3BPLC 5JHLH 3B5TA 3CU7A 5F9OL 1YJDL 4AY0A 1KCSL 2MJWA 4FQXC 1J11A 4TUJA 4XX1G 2F8XC 2IF7A 5HY9A 2EXWC 1F4XH 3HZYB 1LK2A 5ITFB 4U49A 4G9FB 4HUWB 4JZNA 5K59F 1MY7A 1A6VL 3O6KH 3NZHH 3UTQB 4R6UA 5FK9A 1S9WA 1JHLL 3V5DB 2CDFA 4ODVH 3M17A 1RVFL 4NDMB 4C4KT 2XQYG 5HYJA 4UINL 3UPRB 3WS6C 2BNRB 2XXMB 3BQUB 5D5MA 1YNLH 5D6CA 3D39E 2Q1EA 1YYLH 2FBJL 4Y5VA 4JFFB 3TV3L 5D9SA 3V4UH 1JYXA 1GZPB 2VL4A 4GQ9H 1QLRB 3OHXA 1FFPB 4FTVA 4ZSOA 3EO9H 2OYPA 4N1EA 2MKLC 3SDCD 5GPRA 3OTTA 4XCFH 2F74A 5EG6C 3O9WD 3RZWA 4I8DA 4M5ZH 5IR1B 3EHBC 3MA7B 4JFDB 5DD6B 4D8PA 1T7ZA 3D0VB 5F3HB 1MWAB 1FAIH 4OZGE 2FJGA 3QXWA 3ILQC 5L6YL 1NL0L 2YKLH 4JKPH 2DQDL 3U0WL 1XZ0A 4R96B 1MLBB 1W72H 5AG9A 3OX8A 3RVTC 5FGCB 3RRQA 3QDMA 3RAJL 3I50L 2CRIA 4JDTL 2ERJB 1F4XL 3TNNA 1KYOJ 4LCYA 1MRFH 2ZUXA 3ARXA 4P23D 5GRYA 1PD6A 4P99A 4KAQH 4UQ2A 4W4OA 3VWKA 1NMBH 2B1HL 4G8IA 2P43B 1AR1D 3WL9B 3LZFH 1IJ9A 4D0DB 5GS0L 2H41A 2ZKHH 4RISH 3CDYA 4Q6IA 5F71A 3BSZH 3W5NA 5D93B 2VDNH 1AJ7L 4UB0L 1CFQA 1G0YR 4GKNA 4QRRA 5DSCB 4HGKC 3TBTA 4Z7VA 5TJWK 4V2CB 3TPUB 4P9ML 5KANI 3AU1A 4PJDB 1YN7B 1SBSL 3V4UL 4ZFZB 4OLXH 3TWCH 1L9MA 3IAGC 5DUBA 4WUUA 4YBQD 3G6DL 5C2UB 5F1KC 3O8XD 1TJHH 4YDIL 4FQLH 1FNFA 1FE8H 4FFVD 3P9LA 1WIPA 1WAAE 1IEBB 3VD4A 3KDMB 3ARDA 5HBBA 3GMMB 1CLYL 3NIDF 3QDGE 3A6BL 4XI5C 2VZSA 2ZCKH 1AO7B 1W72L 2G60L 3L7FB 3RVUD 5E8PB 5FO9B 3QSKB 1RK0A 3HNTL 5HI5C 3RWJB 4KROD 3MYJA 1NLDL 3VU2A 4Z95H 2P4AB 3ZE2E 3BH9B 5HXMA 3P0YH 4I13B 3VXMA 4P46A 1IE5A 4QHLA 4XPGH 5IBUG 3NH7H 2ZKHL 4AENB 4GRLC 3T1WA 5E1AB 1A3RH 4ODSH 1SJEA 2BVUA 2VDNL 4NZRH 1QFUL 3DURB 2X4QA 1RUPH 5L88H 3HAEB 4GKSB 3QULA 4HFUH 1ZT7A 4O2CA 3T2NH 1BJ8A 3TJEH 3EGSB 1JWSA 1TJGH 3OJ2C 4YIQB 2FO4B 5J3HC 3FQXB 3B43A 2VSCA 5GGRA 2GSIA 1OGTA 3EJYC 1WBYA 3UBXA 1JHKL 2YPKB 5ANMA 3MXWL 2DQEH 1S7TB 4L3AA 3MNZA 3TYFA 4HF5H 4M7JH 5D6DA 4X6DA 2BY0A 1ZSDB 2VDLL 43CAB 4OFKA 1FFOA 3FRPG 5I18H 2AJXH 2ZCHL 1IGFH 3NFSH 5DD5H 1EO7A 2PW2B 5GJTL 5A2IH 1TTFA 3UBXI 3VXRA 2A74B 4HIIA 2IQ9H 5SWSD 1NAML 3R8QA 1TMCA 1FNEA 1I4FA 2JF1A 2VAJA 2HTKC 4YHMH 3L3HB 4KZEL 1XGUA 1Q9LB 2EEDA 1C1EL 5D7KE 5E8NA 2OZ4A 5HSFA 4LVOB 1MHEA 2IADA 4F8TA 1R5VB 3DBXA 2EDHA 3MRKB 4JM2C 3NH7L 1H0DB 4YR6A 3DO7A 1U8PA 3T4YA 1A3RL 2VITB 2APWA 1YC8A 5GSVA 4BZYA 5L88L 1RUMH 3I2CL 5DJZA 4HFUL 3S96A 1GOFA 1UACH 3R06B 3PWPE 3ZKMC 5J1AB 2GFBB 1TJGL 5TE6L 1MVUB 2NY0D 4NQCD 3STZB 5IEKB 2D4DA 4NKOA 4UOJA 3MR9B 4XNUL 2ATKB 1OLZA 1NGXA 2WLZA 4TSCH 3FL7A 4JAMB 2MHAB 1KFAH 1JI1A 1Q9KA 1XCQB 5D7JB 4MJ4A 4HCRL 1JZ3A 1MAKA 2DQEL 4IDJH 2H9GA 4OAWB 3Q6GL 2CRZA 4XPHL 1D5BB 4HIJA 3MV9A 4QXGL 4I2XE 5MI0C 5I18L 4U7MA 2FJHA 1U8JA 2FHBA 5DRWB 1YPZE 1NGWA 2XZQH 4TNWK 1SYVB 5I9QB 3LH2L 3RL1A 4WUKH 3KXFE 4YDVA 3WDJA 1C5DA 2EECA 4MWFA 4S11A 5JHDA 4J1UB 5JORB 3SDDD 1ZVSA 2PTUA 1FNSL 4Y7MA 2A6IB 4GW4A 1II4E 2WY3A 1NH6A 3RIAF 1F3DJ 2APVA 32C2A 2HKHL 4ENED 4YHML 4Y8DC 2BNUB 3MUJA 4B7LA 2Y5TA 3MLWL 5EU7E 1EMTL 4PRNB 1EJ6A 3TO4D 2Z8WC 3RGVC 1T3FB 5H2BA 1QSEB 5D1XB 2RQ8A 5EO9A 1R3KA 1OTTD 3H9SD 5HYSG 2R23B 4HIEA 2BNQB 2PXYA 2Q76A 1FL3B 4WFHD 1KCVH 3BN3B 1EX0A 3F7VA 3JTSB 4YXKH 4LVHB 2FIKB 4FQ2L 4PJGB 2P1YA 4NRYA 1A7OL 4Y4HC 2X09A 4W4NA 2GT9A 4QT5B 5IVZA 3ME0A 4YDLC 4GXUM 3E2HB 1UZ8A 3FB7B 4ZNCD 2PO6A 4NQDB 5HVWA 2GCYB 3ARRA 3HA0A 3RPKA 2CIKB 2DM7A 3I3DA 1IGIH 2OSLB 2RHEA 2ZPKH 4X0KB 4HK0A 1YMHA 2D0HA 4PV9A 5F7EH 3T0EE 4PS4H 5CBEA 1QR1B 1L4IA 4U05A 3HMXL 4L8SA 3MV7B 4DKEL 1CICB 1FLTX 3SQOH 5DLMH 4K7FB 1OM3H 1CZ8L 4M1DL 4DZBA 5E8DH 5BZWA 4PJFE 3SO5A 1TVHA 4PRPB 2G75B 4XCNB 3WJJC 2OS7A 3DYMA 1RURH 2BVQA 1AQDA 1VESA 4WY7L 2D4FA 1RAMA 1KN2H 3L3IB 3MMEB 4WI7A 4DKAA 2H8PB 5TQ0L 3B5HA 4MD5B 1JV5B 1SYSB 2ZP0T 5EU4B 1UM4L 1V05A 1NEZG 2KQNA 3DV4A 4PRHA 2FCBA 4L4TD 3UROR 1I9JH 1CLZL 1CDBA 2AJYL 2BC4A 3VCLB 4NCC1 4ONHB 3HB3D 3DX8A 3F12A 3VFPB 4D94A 2O93L 4MNHB 4OCSL 5HHNB 3FO2B 3DSFL 4N9GB 5HGBB 2YZ1A 4F7EA 2H2SD 1EEUA 5GRZA 4WV1A 5JDSA 4O5LH 1MFNA 3GMOA 1MAJA 1NGYA 4P5KB 1LEIA 5HPOA 1PX3A 3P4MA 5F89B 4RMUA 3KYMB 3C9NB 4Y19B 1RMFH 3KPSE 4GBXB 5BV7B 4Y1AD 1CFVH 2NX5B 2R69H 4YHOH 5TDOB 4NN6C 3GM8A 1YJDC 2VDRH 2EIZB 1A7RL 4PBVC 4P2RD 5IBUB 5EUKB 4P4RB 1T89A 2ESVE 5DLML 5I8EB 3V2AR 3CFJA 3MRDA 3ES6B 3MBED 3N9GH 1QSFE 4P5TD 3NZ8B 4JRYE 1GOHA 1OM3L 1ZLVK 4P2QB 4F37F 2BOCB 4N1CA 4OIIH 4L3EE 3MV8B 1P84J 4UAOC 5E9DA 3SY0A 4ZAKD 5GGSA 4C55A 2IANE 3NFPA 4ORZC 2KDGA 4L4VA 4TTDD 5GJSL 1HKFA 3D18A 4LCIH 1ZA6B 4BSWA 2AXJA 2H3NA 4UZGA 5IMLB 1F90H 3MRLB 4PJCB 1YEDA 4ACPA 4BSJA 1YEKH 2YXFA 1WJ3A 2IH1B 2YHGA 4GAYA 1GGCH 5C86A 3KPMA 3I75B 5HI4C 3S88H 4PGEB 5KVMC 1I8IB 4N1HB 5I8OH 2XA8H 4B41A 1RJZA 3TBYB 4O2FB 5A1AA 3ARGA 4I1NB 2HRPH 5D2NE 3FMGH 3VFUA 4WVRA 2VXUH 4Y16A 2V17H 4BYHA 4MB5A 5MENA 3QWOB 4PRIB 4S1DD 4O5LL 4AG4H 1IEAB 1T04B 4FXKB 4P48A 2ITDB 3O4OC 4IRSC 5DFTA 1ZTXL 2NY4C 3VXTB 3VJ6B 5C0BB 2E3VA 5DUPH 3HZVA 5TGBA 2C3GA 2FX8H 5IW1A 4TVSa 4ZPTA 1CFVL 4YQXH 1A7PL 3BZDA 3BIKA 3GRWA 2H6PA 1YZZA 1J0IA 2AVGA 3NGBC 1FNHA 4LFHG 5HPMB 1H3PL 2QQNH 2RIKA 1BBJB 4OIIL 4IBLT 5TE7H 3DYPA 3QIWC 2W0FA 4PJ9C 2DRUA 5GS0C 4M1CD 3GRWH 4IS6A 4ZUVB 3LN9A 5JPMB 1X4XA 2X2YA 4M9OA 3FO1A 3T8XA 1CFTA 1VENA 1X5GA 4PGBA 3KYAA 3IFOA 5EU5B 1BZ9B 4KUZH 4Y0GA 1WAAF 2NNAB 1BVZA 1I3GH 5EO0B 1F45A 4JO3H 5F88A 3VG0H 3GB7A 1OP5K 2K7QA 1U3JA 2R0WH 3GSXA 3MUZ1 3GKZA 4OFYD 3DMMA 4KUCF 2UWEA 3QWQB 1JJUA 2Y72A 3VFWB 4JRXE 3X12A 2YC1A 1FRGH 1Y0LB 3FMGL 2IPUG 2VXUL 2X70B 1LMKA 2Y36H 3UTTE 3OMZA 1B9ZA 4AG4L 4JFXA 5BVJB 5BRZD 2VAAA 1MF2L 1CVSC 1U8LB 5HHVH 2GAZA 3O3DA 3D25A 2VXQL 3WXVH 5I0ZA 1IM9B 3QRFM 3WLWC 1C5CL 1YNTB 4PLJC 1QLFB 5BS0E 1S9XB 1BBDL 3BEWB 5DUPL 4APQC 1WC7A 3O9WB 2CUMA 4RFEB 1U8MB 5TFSH 4U1JA 3PP4H 3UTSE 5IVOA 3HE6B 4UT9H 2Y7QA 5HYSB 3QDHA 4FFWD 1MFDH 3KYOB 4XP4H 5FKPA 1IFHH 1LGVA 3ZKSD 5CZKA 5TE7L 2ZOLB 5KAQG 1A1OB 3BPNC 4LLDA 5MEOB 1LP9B 3KJ6L 2F5AL 1KXVC 2X89D 5E2TH 2DDQH 3T2PA 2P8MA 4HHAA 4Q58C 5IB4B 1PKOA 4KUZL 4P23B 4KQ4L 4X4YA 1WV7T 1I3GL 4I9WE 2BVPB 3FQUA 2QBWA 4KGJA 4D9RD 4TNVK 2JTDA 4H25A 1QYGH 5FA4A 3QQNA 4LSQH 2CLZA 3CXHK 3QXDA 4OZIA 5EUOA 2RFXA 1T5XA 4PG2C 1A14L 3KPQA 4WWKC 3WS6A 2X1OA 3O2WL 4M43L 4XC3H 1VGKA 1HQ4B 1U93B 1RIUL 4U2ZA 2NW3A 1G7QA 5E6IB 5HHVL 2E8YA 5T1KB 3CSGA 5DO2D 3BVNA 1KC5L 5BW7C 1F4YH 3QIUB 3W2DH 3MROB 4HG4J 3SCMC 5FYKE 1U36A 5D72L 1FL6A 3HE7B 4JZOA 5FXCH 4KKAC 1G6RB 1F13A 3K7UA 4UT9L 1K4DB 4J8RB 3K1DA 4L1HA 4IHOA 3HR5A 2M2DA 1MFDL 5JQ6H 1N5AB 1IC4H 2UUDK 3PL6D 3KNBB 4I0KA 4JGMA 2DN7A 4NO0B 4U1IA 5HGDB 2F54A 3QUYC 2K7PA 1S7QA 4KROB 2A9ML 4GLRH 1YEGH 4UUJA 4DVBA 1BX2A 1KIQA 5E2TL 4Q97A 3VFGH 3RDTD 1UWGL 3JWOH 4GLRI 3TVMA 1YPZF 3EJZD 3QH3A 4MJ6B 4YBLB 5DJAB 5EU3A 4ELMB 4PD4K 2Q87A 1QRND 3BKYL 2FIRT 2JB6B 3EOTH 3SGKC 5JPNB 4GW1A 3FRUB 4CBPA 1QYGL 2WP3O 5EBWB 4UU9A 1GGUA 4IOSD 3JV6A 1TENA 2X1QA 5LGKA 5A16B 1ES0B 4RX4D 3HN3A 1KXQE 3S7GA 3KLHD 4P3DB 3WV0A 5ESQB 3NCYP 5BO1H 3QUMB 3KYNB 1LNUB 3ZKNC 1AHWC 3FT2B 1JF1A 3EOBB 1A7BA 1KJ2A 2JJTA 1NBQA 1HN1A 1JGEA 1UKQA 3QXUA 5EU6B 3RWHB 2XI9A 2B7DT 1HSAB 4JJ5A 5D1ZB 5C7XH 3DWTA 1MEXL 1G7MA 1RZFL 1RIVL 4NKMA 1XGRB 3SKOB 5ESAB 4D2NA 1IQWH 4Q2ZB 4M1GL 1I1YA 3SJVB 1PDKA 1HXYA 1H3GA 2PCPB 2DKSA 2X4OB 4GXVL 1KJ2H 3M1BB 3WNNA 4TOYL 1OD9A 3C5ZB 5C09E 4C59B 1D5IL 1AXSB 1V5JA 4Z78B 5AZEH 3MRPA 4KTDH 4FQHA 3BH8A 2R2EA 1D9KA 4HUUB 1V8HA 4M48L 1AP2B 3GBLA 4XRCB 1IARB 5FGRA 1YEGL 3OGCB 5BOZG 5CCKL 2HLFD 3D2UD 3MLRL 4R4BA 2DS4A 3MJ9L 3VFGL 1R3LA 1UJ3B 4MB4A 3LRSB 5HHQB 5IWLC 5L2JB 3QXVA 2OL3A 3MRNB 4LKXB 3WEXA 4NJ9H 3UTPD 4PJFF 1I7TA 1JZ6A 12E8H 3QP3A 2NW2A 4NZTH 5SWZD 4GRLA 1FSKB 3RI5F 1OTSD 2WMPA 5BOPA 1NCDL 2X05A 2CKBA 4NC1E 4ZNEE 2ZUUA 4MCZA 1SEBB 2OL3H 3FN0L 4Z5RB 1RJYB 2XNAB 3FFCA 1CDUA 1E4XH 1KNOA 3QQ3A 2HP4A 4WU7A 2DMKA 1E4XI 3BAEL 4K7PY 1BJ1J 2EC9T 3RX8A 4GO6B 5T1LB 2P48B 1OAXH 3CVIH 5KSBB 1KCGC 2C3WA 1XCTA 1T1WB 4R4FH 2NXZB 3S34H 3UYPA 2IGFL 4TPRH 4GJTB 1FQ9C 1QOKA 3MLXH 5CEXB 5JIHA 4N8VA 4Z7QE 5F72S 1PZ5B 2VE6B 3HNVH 2ZUYA 4KTDL 1OAYH 5IHLB 2BNRE 5J4MA 4IRZH 2BHUA 4OF6A 3C5SA 3QO1B 3ARBD 2R9HC 3UDWA 2DOCA 3BDYH 5DVLA 4RAVA 4J3XA 4JG1L 4L9LB 2ITCA 4X6FA 3OKOA 3QZWA 5I17B 5IFHL 3L5XH 1ZVYA 5IROC 2I9LA 3OAZK 3CCHB 12E8L 1FL5A 4NZTL 3HHRB 5FM4A 2VR4A 4MD0A 4GT7A 4JFDE 2EYSA 1FO0B 5IHZA 4LPUA 1XEDA 4LSVH 4D9LH 1IAIH 3VD7A 2XFXA 4M7LT 1DEDA 5T3XD 1IAII 2DIBA 3QI9D 4OZHA 4CMHB 5CSZA 4ZYKB 2XWTA 5FGCE 3IGAB 1ZWIA 3ARZA 4Y5YC 3QO0B 1P5UA 4GMSH 3T2QA 5DI8A 5B3JE 3Q1SH 2D2OA 4F7TA 1NCTA 3G5YB 2R4RL 3TFKD 4L3CB 1AGEB 3KPOA 3DXAB 3KPRB 5TDNA 5HHOA 3ZDYE 1AIFB 2E7MA 4OGAC 4WO4A 4TPRL 5FKAB 3WJLC 2NY2C 2DTML 4X4XA 3P77B 3H8NA 3HNVL 2VRAA 4JY5H 4CL7A 3KPNB 4HKBA 1FLRL 1AFVH 3IDNB 1TQCC 4NGHL 3IDGA 1JPFA 4GAFB 2BHZA 3TPUE 2VH5L 4P2OB 4PJDE 2NY6B 2VDPH 4IMKC 1DQMH 2GIYA 3PUCA 3RUGB 1NC4B 2EXYC 4RGOH 3RGVA 1NDMB 2X6MA 2ENSA 4R7NA 3OB8A 4YHYC 3ARFC 4U2YA 3PNWA 4MSWB 3BGFC 1CLCA 4PREA 1VGEH 4R97C 3QJFA 5CJXC 3C6LA 1MIML 1IAIL 1U95A 5DC9B 1I1AD 4FG6D 4X5WA 3E6FB 3PWUB 5IOPB 1AO7E 4NWUH 5BQ7B 5E4IA 3SKNB 1T21A 3QDJB 1K2DB 4IOFD 3OAYH 1FORH 1JPSL 1LO5A 3MCKA 4X7TB 2FD6L 3QXAB 5K9QG 3Q1SL 4Z0XA 4LGSB 3LIZL 3ZMRA 1GIGL 1KV3A 2VLRB 1HZHL 3ALWA 3UJTL 2GJZB 3P4NB 4V3DB 4TVPE 2LAGB 3VGDA 5DYOA 4OKVB 5KZCB 4FTVD 35C8H 1DUYB 3VGBA 2OTUA 3MJGX 2AEQH 2DYPA 1KIRA 3D0LA 3BPCB 5EIQA 1NC2B 1OW0C 3WJJA 3LKSB 5JZ7C 5I1GH 5KTEH 3ZE0E 3R4DA 1U0QA 4HJJH 1DQLL 2V7NB 4XVTL 2C1OB 4FFYL 4MJID 5D7LA 4ZPVA 4BK5A 3O6LH 3OPZL 1PKQA 2HLAA 4HFWA 4EI6B 5F1NB 3U2SA 1CGSH 3VXNA 1HIMH 2HVJB 3ZL4L 5DRXB 3JTCA 1S7RA 4OD2A 2DBLL 5KW9H 1L6XA 1A9BB 4PLKC 4Z7WB 4P5MA 4NPYA 5CZVH 1P7QD 3TJHD 1G9ML 2GITB 1ZLUK 3T77B 1RU9L 3VMNA 5B8CC 2N1KA 5J56B 3CFIC 3SDXF 4NQEB 5EBLA 4DOHB 2D03H 1KTLB 1IC7L 1F3DH 1YY8A 3LS5H 4X80H 1CFNA 3RWIA 1ORSB 4ZUWB 2Q6WB 3B9DA 4YBHA 1MHHA 1TDQA 1UGNA 4KGLA 4WUUD 1OHQA 4ELKA 1GC1L 3KLSA 4GAGL 4G3YL 1A0QH 3CZFA 4PJ8C 1BOGA 4D3CL 5KTEL 1GOGA 3WKMH 2IPKA 2EDEA 1KCRL 2P5WE 4XMLL 3GSVA 2YUXA 5IKCB 1PGRB 3U9PH 2FEDC 1F11A 5D71H 3G6JB 3UPAA 5I71B 1RZGB 2FECI 4U6YA 2OK0H 1U8HA 3KPTA 5C8JB 5HYIA 3BRDA 4WTXA 5LQBH 1P4IL 3CVHL 3I9GH 2NLJB 5KW9L 4X9HA 2W9EH 4LSUL 4NNXA 1ZT4B 2GY7B 3VXMD 1OWWA 3ARQA 3K0WA 2WWMD 3S3PA 3SE8H 4OLVL 2Z91B 4OD3H 2Z31C 3WHXA 3PGFH 4PJBB 5B39G 3MGOA 2RCSH 2NXYD 4PTUA 2IG2L 1PAMA 4QHUA 4OTXL 4HWEH 1YEFL 3LS5L 3FQWA 3SDAD 4JZJA 5A2KH 3ZDXF 3HI6H 4FQIL 4NOBA 4Z8FH 1QSEE 4MQXC 5JR1L 4HIXL 2M8XA 2BNQE 5D2LA 3MUGA 1T03H 3CSPA 5I75B 3RZCB 5HHMD 5L8LB 4PJGE 2O61A 4XVJH 1BAFH 3VXUD 2W60A 3ZKXC 4KJQC 2Y6SC 1YMMA 3QCTH 1QQDB 5E24E 3CFKB 3L5WA 4LLUB 3C09C 5MERA 4AEHL 2AXFA 2KUTA 2FECL 4NQDE 4I0PB 4HDIA 5FYJD 1UWXH 4A2MA 4JM4H 1QFWM 4KZDH 3VXRD 1NFDA 4M93C 4BKLA 3HNSL 3VFVB 4KRMB 4YX2H 1MI5A 5J06A 3MNVB 5C0CB 1M71B 2PYFB 4PJAA 1Q9OB 4J7RA 4O9HH 3MV7E 4WHYG 5LQBL 1IGJB 2EIBA 3PWVA 4MCYB 3UP1A 5IGXL 2P47B 1TNNA 3RVXC 4MNQA 4UT6H 5T1DL 2V9QA 4R0LB 1D6VL 5DHVB 3S5LG 3QEQB 2CO7B 4I4WB 5E4EC 5J13C 2Z9TA 3GI9H 2IH3B 4PRPE 4Q9QH 3IETA 3HI5L 1T1XA 2P8LA 4QRUB 3SE8L 4OD3L 4F8QA 4XTRD 3D9AH 1HOCB 3FOMA 5C0AA 2A83B 3KVQA 2CDEA 4Y4FD 5FCUL 4UTBH 3IS1X 2APBA 1P2CB 1N0XL 5ILTL 4HWEL 2DD8H 4HMDA 4HWBA 5CINH 4O58H 3WIIH 2LU4A 3HI6L 1HCFX 4NKIH 5J6GB 4Q74A 1LEKA 1ZGLA 2X10A 1WCBB 1MJ7L 3OR7A 3QIBA 4QGTA 4QEGA 2Q8AH 3PJSB 4NQSA 3MLYH 4I48B 4HWBH 4XVJL 1M4KA 4IJ3B 5T3ZE 4V1DD 4HBQA 4K8RD 4LVNC 4OB5H 3WCYA 3U9UB 4Z7QF 4JFZL 1S9KC 4R9HA 4JM4L 3MTRA 3QFJA 3MYZA 4X6EA 1KLFA 4YX2L 2NZ9C 1MH5A 1DEEA 1VHPA 2ZUWA 5JHDD 3TBVA 4EBQH 2NX5E 1PX4A 4XXCA 3RBSA 5IEHB 4YHPA 1J05B 4PG2A 4QRSB 5D7SL 3AUVA 1OAZH 3E6HA 4IM8A 4RSVA 4J2XA 2DJ4A 4NJAH 5DMKB 2CUHA 4P2QE 4Z0BH 3SKMA 5IB3A 3MV8E 1B4JL 3GI9L 4BZ1H 1NCWH 3BEVA 5HVGB 1WISA 4XC1L 4L8BB 2H32B 2PXYD 4OM1L 3D9AL 3P4LA 3HG1E 1ACZA 2XPGB 5GGTA 1HHJB 3LB6D 5CINL 4O58L 4OQ1A 3TH4T 2AK4D 5GSRA 3SPVA 2XRAH 1CS6A 4NKIL 2VZ1A 4PJXA 1XR8B 5KANG 1R3IH 3E1F1 1FZMB 3GSNB 5B22A 3QAZC 5GGTH 3HRZA 1I3RB 1ORQA 3RWDB 2BVOB 4PRIE 3ZDYF 3QHFH 3D2UB 4NRXB 3WN5B 2ED8A 1S7SA 5IM7A 4JDVA 3TN0B 3WSQH 4GAJH 1EVUA 3GGWB 3F8UB 3NCBB 4WW2B 3GSWB 1UH3A 5FYKH 1HHKB 2FX9H 2QADD 5C0BE 1ONQA 1AI1H 1U8KB 2L7JA 2BCKB 3BISA 3DUUB 3Q6FB 4M9PA 2HTLC 1T2QL 4PJDF 2WM0A 3ERYA 3TYGL 5DJXA 4DUXA 1AHWA 4DKDC 5LCVH 4P9HH 5E94A 3PWJB 4PRHD 1NFKA 5AWNL 2ZUQB 3O2DA 3VRIA 2A6DA 1E27B 3C60B 1PQZA 2AJ3B 4HUVA 1BPVA