3BO8A

The high resolution crystal structure of hla-a1 complexed with the mage-a1 peptide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-1 alpha chain
publication title Conformational changes within the HLA-A1:MAGE-A1 complex induced by binding of a recombinant antibody fragment with TCR-like specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2007-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bo8A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bo8A01
4JPKL 4Q2ZB 4D0DA 4FG6D 3ZO0A 2ZUYA 1ZLWH 5CZKA 5D1QA 1BQUA 3CFDB 4FFWD 4JG1L 4GRWE 2PXYD 4PJBE 3MV7B 5I1LB 4TULH 2YD5A 3TFKA 4ELMA 1ZOXA 4YEEA 1A9EB 2DQJH 5I8OL 1BFOB 4NO3B 2BK8A 3SKMA 5DJ8B 4K71B 2Z91A 1N4XH 4D0BA 1UWEL 5F3BA 4UT7H 2A77H 4PP1C 5L8KB 1R3JA 3H9SB 4QOKE 2XTLA 1A6ZB 1H3TA 3ARBB 1Y0LA 4NWUH 3NCCB 4KVNH 2NY7H 4QYOB 1CICC 5HYFA 5JPMA 4KHXH 4MXQC 5MEOB 2NZIA 4OZ4B 1DZBA 1UM6L 1EEZB 2FJGA 5FCUH 3BZEA 4KJPC 2VWEE 1OTTC 2X89A 3ARSA 4ODXB 4NUJA 2AK4D 5HDQH 3S9DB 2OXHA 4NSKA 1LHZA 3FFCB 3NCMA 4XTRD 1N7MH 4PJ7E 3ZKNC 1FQ9C 2YK1H 4XWGH 5DC9B 3TBYB 5FHAL 3MOAL 2DD8L 3V4VH 2VAAA 1Q9WA 2YZ8A 4XCEA 5GRUL 3VXRB 1RZJL 3BO8A 4U6VL 4PGBA 4IBLT 3SDDD 2P44B 4DFHA 4HCRA 4JHBA 4ZFGH 3BDXA 3O3AA 3VWJC 4PTUB 1AGBB 1EFQA 1OD9A 1N5AA 1JHLH 1Q0XH 4GBXA 4O9HL 2PO6A 5C0AA 4ZO9A 4IJ3B 2BHUA 4Z0XB 2MSPA 3CFDA 1WCQA 2GCYA 4XNYH 5C0CE 3PHOB 4JKKA 4OM0H 5I1LA 1OM3H 3MBED 4D9LL 2YSSB 5KW9H 2P46B 4APQC 5DQ9B 1N6QH 1MJ7H 2NR6D 3DVFA 3MUY1 3O4LB 2NY3C 4YK4B 2XRAL 2YUZA 4XP1L 1JYWA 5C0GA 1TMCA 4J3TA 4OZHB 4XH2A 5IJVB 2DQGH 4Y2OA 3ZMRA 2BNQA 3FOMA 3FQNB 3OAZK 4J3UA 1AHWB 4JFZL 3T0EB 4PPTA 3AAZB 4Z7UA 2W0PA 3B6SB 5DSCB 4RGOL 2AJXH 4HPYL 1ZHLB 2XACC 3ZT6A 3S8WA 4QRTA 1IGJB 1KN2L 1P7QB 4JRXD 2YKLL 2YPLE 2JLLA 3EOAA 1BGXL 3OX8A 3UBXI 4JVWA 1NLBH 5K9OB 1MFDL 5F88A 3T0DA 3ZKXB 4FQXA 4U1NA 3ES6B 5A1AA 2XKUA 4DKAA 3RI5F 3RIAF 3TO2A 2WANA 3VXRA 3MXWH 4O5LL 3BUTA 3BESR 1BFVL 5J6GB 3MO1A 4JCLA 2IAND 4PJGE 3ZYIA 2D4DA 3KXFB 3SBWC 2X70A 1B90A 3CVHH 4KJQD 2XWTB 1NFIA 5DEGA 5KSAA 2F54E 2EEDA 3PHOA 1KUMA 1FZJB 1J1XH 2GFBB 4WW2A 3TBSA 5INCB 3FONB 2XNAA 2IPTL 5FF6A 5JHDB 3QISA 1PY4A 2FGWL 3QEGL 4HXAL 2LAAA 5I66A 4XBGB 2JJTC 4ZOBA 5I1CL 5CEXA 3MJ9A 4ZQKB 3RTQC 4OLVL 1OT2A 1UJ3C 2P4AB 3VDBA 2OS7A 3VXMB 4WWKD 2H9GB 3EYQD 5F44A 4G6AD 4KQ3L 1A7PH 1BX2A 3LRSA 2CIKB 4NOBA 4OGYL 4X4YA 3C60D 4Q9QH 2LU3A 1JGDA 3RHWK 3PG2A 4F7CB 5FGBC 1TQBB 4ZPTB 3UJTL 4QRUB 1H3XA 4UIMA 1K4CB 2Z31B 4K7PY 3PWPB 1J5OH 2JB5L 2ICEB 3B9KD 1EAJA 4PJAB 5K9OA 1GGTA 4KI5E 1M71B 3PP4L 3D48R 1WZLA 1JF1A 3BZ4B 2BMKB 2XWJB 1O0VA 1ADQA 5F7DA 1MHPH 2NZ9C 4H8WL 4B7IA 2AI0H 5DJAB 3VFRB 4UDTA 1J05A 1MPAL 3W11C 1KT2B 4E9LA 4L3CB 3HUJA 1XGYL 1FSKC 4IRSB 4NBZB 2ENYA 1NDGB 3EJYC 1I8KB 4UMGA 1BJ1J 1H15B 1NCBH 4ODTL 3WS6C 2HVKA 1FGVL 1KTDA 1QYGH 4JM2D 5D5MA 3MFGB 1FZJA 2R9HD 1JPST 3QFDB 4HQQL 4U7KA 5I75B 4YXLH 3KYKH 4KUCD 4PRAB 4M1GL 4XBGA 4GRLD 4KROC 3PIQB 3SOBL 3WFBL 4H88H 4JHWL 4X99A 1D5XB 3CSBA 4P2OD 1T0NA 2Q76A 5IFAH 5BO1L 3I75B 2CIKA 1SMAA 1UM4H 4JVPA 3OKOB 3DX6B 4Z5RB 3B9VA 4HGWA 1X3DA 5BMFL 5EO0A 4MJID 4K7PL 2CLVB 4X9HA 8FABB 4JFEE 5JW4N 1OCWH 1TCRB 1EO8H 1K4CA 1DUYA 1IM3B 5I17B 3O45B 3TM6A 5I0ZA 4PJXA 1BBDH 1R0AL 4LNRA 1MAML 3LS5H 1A3RL 5TDNA 2ICWB 3OB0H 3PL6A 4C59B 3MACL 4KTDH 2MFNA 5GSRA 3LQAH 1RUQL 5B38B 5C0FA 3O4OC 1CIUA 2D03L 3VFRA 3D0LA 2HG5A 1I9IH 2I27N 4L3CA 4KY1L 1UH2A 1R3LA 4HWEL 1I8KA 4J12A 3LVEA 4PJEE 3KDMB 1CFSA 3PDOB 3PNWA 2GSGA 1U8NB 4OD1L 5I8CA 5C09D 3QFDA 2NX5A 1AE6H 2ZKHL 3QHFH 3V4PL 1P5UA 2WNGA 4G42B 5IW1B 2N7AA 3HKFA 4WFGE 1G0XA 3VGHA 1EEQA 3QNZA 5EBMA 4G8FA 1S78D 2CD0A 1U92B 1QRKA 4L9LA 1TJHH 3SGJA 4JM4L 2W9EL 3RWJB 5JOFB 5KVEL 3GIZL 8FABA 3P9MA 5ABDE 5BS0D 5J4MA 3JTSB 4QTHB 5C6TL 3O45A 4UT6L 2A83A 3UTQA 1R5VB 4O58L 3C2AL 4Z7QF 2EO9A 3QCTL 3LKQA 2RFXB 2FJFB 5I15H 2VR5A 3GB7B 4TUKL 4RWYL 4YHZL 3BKML 4C4KO 2HT4C 3GI8H 5HSFA 4HK3J 1RU9L 3P4OB 1T66D 1J0ZA 2Q6WB 4QOKA 1P4LA 4ETQB 1QFWH 3QAZC 3ARGD 1JV5B 5IG7A 5D2NB 4V1DB 4KRPB 3KDMA 3UTOA 2NY0B 5FECA 3LKSB 1OTSD 1MQKL 4M3KB 5KANI 5SX5H 4QHKI 2FECI 5C0ND 1FNGA 1TVBB 3E6FA 3P0VL 4MNHB 4DGYH 1D6VH 1PDKA 4PJ7A 5T5NF 5F9JA 1T80A 2XA3A 5FUOH 1OWWA 5EZOH 1P6AB 4LCWE 4DQOH 4G42A 5FM5O 4U1MA 2F53D 4RQQA 4M7LH 4KMTH 3MYZA 2H32A 2CKBL 1HSAA 2AKRA 1NAMA 4Z7WB 4PJDE 5IB4B 1A6AB 1CQYA 3QJHB 4XNZC 1FYTD 2YD6A 2DQEL 3GRWA 4I48A 4WI7A 5IV2A 1ONQA 3WV0A 2UUDH 2D7TL 4MAYB 3PJSB 3VXUB 3HMWL 5C0CA 1FO0L 1YPZE 4IRJD 2G2RB 3ZHKA 1PKOA 1A2YB 5T5FH 5ID0B 4IHOA 5JXAH 3EGSB 3QCUH 4ZUUB 1GGCH 2EDWA 2ICWI 5EN2A 3F6IA 1N5YL 4QF1B 1V05A 1SEBA 2EDDA 5DHVA 3NACH 4OCMC 3ZKQD 4X7FC 5JDSA 2PYEB 2Z92B 4P4RB 5E08H 2ADGB 3QNYB 4WO4C 4HK0A 2HMIC 2ZCLL 3MRJB 2WLZA 1VADA 4M6ML 4GS7C 4LKXB 2YPLA 4HCRH 1JMZA 3ULUF 1PG7L 2VZ1A 2DWDB 2GEEA 2C3VA 5L2KD 4JAMB 4ZUWB 5IFHL 2ZOKA 2ZCHH 1KB5A 4MCYA 1ZWIB 4AG4H 1LK3H 4ZSOE 5D7SH 4XNUH 5E7BA 1WBXA 3ZT5A 1S5IH 3HLAA 2D31B 4N9OB 5J3HC 5DRXB 5GS3A 5KN5B 4TQEH 5BCAA 3QUYA 4AEIH 2WY3A 2NY5H 1FNLA 3QEQE 4LHUG 4FRWA 5T1DL 2GIYA 1OF2A 2OR9L 2SEBA 3BQUA 5IJKC 1IBGH 2NY1D 3FOLA 4HXBL 1JNHA 4ODWA 2OR7A 1AXTL 1VPOL 2F54A 3BVNB 1TPXB 2GYSA 5DJZB 3CGTA 5KVMC 3C09C 3BZDA 4IMLB 1A2YA 5CEZH 1EMTL 2J5LC 3OV6A 2BRQA 4XCCL 1R3KA 3M45A 2APXA 3BP6B 4X0KA 2XPGA 2YRLA 2DQFB 5JUEH 2C9AA 3HTLX 2G9HB 3P73B 4DK6A 4MS8C 3MR9B 3ME0A 3O41B 3QDMD 2O5YH 1ZA3A 3HMXL 4BZYA 3P40A 2H3NA 3GHBH 1LWRA 5DK3A 3PWVB 3ARFC 2FYYB 3RIFK 1NAKH 3ROOB 4NZTL 1ZXQA 4HJJH 3WIIH 4HG4K 1Z2KA 5DMYA 4F57L 3ARDB 2DYPA 3ZE0F 5ADOL 3K81A 5DRZA 1DFBH 1G7HA 3KPRE 4FXGB 2RJMA 4F8QA 4OBRA 4XCFL 3ABZA 5E1AA 2QR0B 4FZ8H 1CZ8H 5DD1L 2LABA 5C2UB 2D31A 2KUTA 5ITFA 1C12B 1R3IL 3E3QE 4HW6A 3W0WE 4C83B 1UB6B 4A6YB 3F7PC 3MJ9H 2BOBA 4UILH 1J0HA 4POZC 4HDIB 4MD5A 4QHNB 2EH7L 3EAKA 4PJ8D 2CR3A 5A2LH 2VXUH 3QIWB 4Y5YA 2QLVB 3LB6C 3Q5OA 2EH8H 1IEHA 3TT1H 5EPMA 4H26B 4NDMA 4I77H 5D4QA 4OLXL 5DJZA 5FYLL 1HINL 2IAMD 4AIOA 2O5ZH 4AQ1B 5DMIH 1Q72H 4K9EH 2AXFA 2EC8A 1MREL 3SGKA 3NABH 5IM7B 2XI9A 1E6JL 2HJKB 3BE1H 4N5ED 4HKXB 3V0VB 1PZUB 4YXHH 5EU7E 3MGTB 2AXGB 1IC4H 4HH9B 5E9DD 3V7AE 3MR9A 2RR3A 1TZGL 1IM9A 1ADQH 2FO4A 3BUYA 5GGRY 3SJVD 3TVMD 2VLKB 4OZIE 4OCXH 2XN9D 3EDJA 1H5BB 4OCSH 1GC1H 2H2PD 3VRIB 2EDQA 2VABB 1VENA 4JFEA 2HA1A 3ROOA 4OM1L 2EC9U 4GXUM 3T1WA 1MQ8A 4NCC1 4RFOL 5EU5B 3K2UH 4PJ9A 2VTFA 1FFOB 3MLXL 4K8RL 4WUUD 2KZ1B 5EBLB 4N5UA 5GQBA 4JQVC 5L8JB 1RUML 5GRVL 2DRUA 4MD0A 4Z8FH 2NTFA 2QR0A 2VXVL 2VOTA 5I76B 1NMAL 3GMRB 4PRNB 1F4XL 2ICES 1RPQA 1YY9C 3MA9L 4DCQA 1UB6A 4A6YA 5CMAA 3WXWH 2NW2A 2VLMD 4WUKH 5F8RC 1EHNA 2H45A 4W6WB 3QRGH 1V3LA 4M62L 3TBTB 3LAFA 1WZMA 3NCYP 3QUMA 1T0MA 1DEEA 1TTGA 5EO1B 2HFGL 3VW3L 4PJEA 2WIMA 2Z35A 1S7VA 3MLWH 5EU4B 5ICYB 4ODUB 5C08B 3BPCA 4FQIH 5GRJL 4I18C 2ZUXA 3O3DA 3K4AA 4YHKL 1MUJB 2HJKA 3TV3H 1OAYH 2EKJA 5DJCB 4UB0L 2Q20A 1TZHA 4R96A 1MCBA 4XHJD 3M8OL 3V6BR 2VLKA 1N59A 1H5BA 3V0WH 2O5XL 1E4WH 3MQIA 4OQTA 5ICXA 3RVTC 2DN7A 2YA0A 4FXLA 3P4NA 1I3GH 5B8CB 2R4RL 1U95B 2APFA 1MCEA 1Z3GH 4K3JH 5L7XH 4PFEA 1T7XA 4JGUA 1KLUA 3DWTA 3R0NA 1S7WA 3BH9A 3PWLA 5EBLA 3FN3A 3ILPB 1R6VA 4PBWD 2OI9A 5MI0C 4J3WA 3HG1E 3B2UD 3NCEB 5BQ7B 4NNPH 1KIQB 3E1F1 3VGAC 2PYFB 3WUWG 1TIUA 3MRFA 2EEBA 1T7WA 1HHGB 3GKWH 1D5BA 2P49B 2P24B 2QADB 5JPNB 5EO1A 5B21A 1XGUB 1HWHB 1GAFH 5JIHA 1GCFA 3QUXA 3F5WB 1QNZL 5EU4A 1BFTA 3TO4C 5LAXB 1MF2H 3U0TB 2XA8L 1MFAL 2VIRA 5C08A 4KHTH 3NTCL 4GRWH 3JBG7 4XX1E 3ALXA 4HKJB 2XQBH 3RNKB 1NFDB 5KSUB 4LCWA 2GAZB 5D6CB 2GKIA 5IBLC 3KYOB 1BBJA 4JFHE 4L3EE 5F7KC 3CMOL 3Q48A 3RDTC 4LLQB 4ZTOL 2A6DA 2IADA 5DUBA 5E00B 1PQZB 4C55A 5IB3A 4PJDA 1UA6H 2YZ1A 2IANE 1JVKA 4PREB 1HYSC 2LQRA 1XFPA 2OL3B 3DURA 3MJ8A 3CFKB 4QGYA 4U0QB 4PJFF 3VFNB 1NBZB 2BXZA 5D70L 3REWA 1KIRB 1ZT1B 3C5JA 4PRID 3JUZA 2FZ3A 1WWCA 2VZVA 2EDEA 5DQDH 4XCNB 1JN6A 3BIAX 3WJLC 3QO1A 1XIWD 3ILQD 3HE7A 1EO5A 2Y06H 2FR4B 4UV7L 3WN5C 2PYFA 1HHGA 3T65B 5CIPA 3U9UB 1NEZG 2OZ4A 1KJ3L 1A14L 2F8XC 4QT5B 4ZO6A 1XMWA 2YUXA 4XP4L 4P5MB 2H32H 1I8IA 1NAMH 4XMLL 5EWIL 1FZKB 3LQAC 3F5WA 3QYCA 1XGRB 1BWMA 1EZVY 2R8SL 4WGWB 5BZWA 1BM3L 3U30B 4LGSB 1WGOA 3GRWH 3U7AA 2MKWA 4KZDH 2ADFL 4PS4L 1UM5L 5ERWB 2KL6A 4M7LT 6FABL 2HTLD 4ZSOA 3RNKA 4DTGL 2NY4C 3KLHD 3JV4A 5KSUA 4XVTH 1WCBB 3LN4A 1P6FA 4JRYB 3KVQA 4P59H 5I1AB 5E00A 2V5SA 1MJJA 4M8QB 5DHVH 3KHOA 1E0OB 3GSOB 4F3FB 1B6DA 5T1LB 5JQ6H 2HVJA 3SDAA 2ZP0T 3GMLA 3MRBB 4JLRB 3IFPA 2W9DL 4G9FD 4WTZA 3U82B 1A1MA 5DI8A 4QRRE 5DK0A 3R8BB 1JP5A 4KWUA 2WBJC 4AM0A 3CX2A 1DEDA 2FIKB 5KSVA 3NAAL 4M93C 1ZVYA 3RVXD 5CJBA 3BD3A 1IGIH 2XTJB 1KB5H 5GS0D 1V3JA 1WC7A 4PG2A 1WZKA 1AD0A 3NCBB 4Y4KD 3KPQB 1KEMH 3O11A 3U9UA 4NQEE 5EU3B 2R1YB 4BH7B 5B39A 4BKLA 1CLOH 3G08B 4M6NH 2VDLH 1NCCH 4MJIE 5CHNB 4Z7VE 5D93C 3QIUA 3THML 5I2IA 1IAKA 5EOTB 1U8PA 2PXYB 2YD8A 5EUKB 2UY6A 4KQ4H 2G75A 4HC1A 4LEXL 4XXCA 4XP5L 3NMEA 4JHAL 1A7BA 1MY5A 3I6GB 3KPRA 4UTAL 5JORA 1KC5H 3TPUE 5ERWA 1E4KC 3EDEA 3H6JA 3BEWB 3DBXA 4X8JB 1AO7B 3E3QA 1YEJL 3W0WA 4HUMB 3RWFB 2NW3B 1CVSC 3BKCL 4X8XA 4HLJA 3W5MA 4NFCA 4LCYB 1P7HL 3TFKC 1BZ9A 3ZYZA 4L4VD 1T04A 3LZFH 4EN3D 2AK4B 3P2TA 1NCWL 2YD3A 4ODVL 3WHXA 5C09E 1SJXA 3TBWA 3X3FH 3RFZC 2OXGA 2EDFA 3DMMD 2CKNA 2JKXA 1ODAA 3MLUL 4U3CA 1HILB 1ORQB 5DUPH 4LRIA 1QO3B 3DGGA 4FFVC 1YNLL 5BV7H 1JNLL 3KYNB 3SO3B 2DJUA 2UVFA 4Y4HD 2E9JA 2V5TA 3R1GL 5CBEB 1KJ2L 1IQDB 3FO2B 4OZIA 3TLRA 1AI1L 1CDUA 5SV3A 4XVUD 4HIIA 5LG1A 5BS0E 2PXYA 3MBEB 3S37X 1NGXB 4MXWH 1CGWA 2VLLB 3MLZH 3FO9B 1JI2A 4MYWB 4U1JA 4OV5B 3LQZB 1BQHB 1G7MA 2Z8VC 4UUJA 5GJTH 2F5BH 4V2CB 3FCTA 3VE0B 1JWUB 1Y6MR 3ZLQC 1CD0A 2NW3A 5HI3C 1FL5B 4NZUL 4GBXC 3DYOA 2PO6C 3P3YA 5E2WH 5IFJA 1INEL 3V5DA 2AJSH 4H0IA 2Y7QB 3X17A 3STLB 4PLKC 2F19H 3WHE0 4JRXB 4H5SA 5L6YH 1KB9K 4JPVL 1AGFA 4R90L 2AK4A 35C8H 5FYLD 5GXBB 3V5HA 2J2ZA 2NY5C 1EK3A 5TQ2H 5KAQF 1R24B 3HAEA 3VFVA 3DETC 4MWFB 3ZDZE 4G7YH 1K4DA 4U05A 4H25A 1QO3A 1WBZB 3KS0J 2F53E 3IXAB 2PCPA 4QXGL 4L4TD 4UNUA 3VA2C 3MRIB 5F7YC 3SDDA 3HI5H 3C9NB 2J3SA 4YFLF 5IMMA 3OR7B 3EJJX 3P30L 4U1SB 1F8TL 2B1HL 4NQXB 5FXCH 4A6YH 3A6BL 1FYTE 4ZPVA 1YEDB 4ZXBB 3QUMH 4FQXC 1OTUC 3WD5L 2MCPH 2CUMA 4ZS6C 3MV9B 3O2DL 3ERYA 3VRJA 3DX9B 3E0GA 3MBEA 1NGXA 4O02L 2Y5TA 5E8OB 5CD5C 1LO5B 2DM3A 2AJVH 5EU6B 3GSRA 4RSVA 4X98B 2FB4H 1RJYB 3N06B 1X5FA 3O8XD 4FQ2H 3AM8A 1YQ2A 1I1AB 4X6CB 1U91A 4CADB 1DQJA 4OZGB 4OCWH 3WFHA 1YEGL 5KSAC 4OCYL 4JRXA 4JN1L 3HC3H 4WW2C 4HKBA 4M02A 4U7SA 1HKFA 1H3GA 1C5DB 4UU9B 4R2GC 4JG0L 1BOYA 3VI3E 5L2KE 4RRPA 4OQTH 3ZKMD 1C16B 5AWNH 3VFMA 1KPVB 4LEOA 3GSXB 1SYSB 5HGDB 3T4YB 5KAQG 1R24A 1ZANH 4MWFA 3WCYA 4GAJH 4TPRH 1MSPA 4NRYB 4WI6A 3AXLA 5FDWB 1RULL 2WWKO 4L3EA 3Q1SL 1MEXH 4MXQD 3MRIA 1IAIM 5KSBB 4Y8AA 1KN4L 3RNQB 1IGTA 3MRQB 1UWGL 4LSUH 2C3WA 4LCCB 2LFGA 4XWOC 5IWLA 1TJIH 1FIGH 4HF5L 2IANA 2DLHA 2HTKC 4I3RL 4K9EC 1UT9A 4IRZL 3VFGL 3G9AB 4JFQB 1U0QA 3T3PE 3QUZC 5EBGA 2ZG2A 1YEKH 4OFDA 4MNGB 5KJRH 4POYA 5I1KL 1Y18A 3DX9A 4NHCL 2DQIH 3RU8H 2EDRA 5T3XE 1HH6B 5HHMB 4KGLA 1BQLH 3VG0H 4YIQA 2Z8SA 3DO7B 4GRLB 4HIJA 4LVNB 1RZFH 5E95B 2YMXH 3BD5A 4YBHA 3DARA 2X4UA 4WWKA 1T5XB 5TGBA 4P2OB 5GZNC 3MLVL 5AD0A 4X6CA 3QDME 4LAQL 3DHJA 3GBNL 4N1EA 1GZQB 1UXSA 3C60A 3BPNB 1QSED 5HGGS 5AAMA 3WBDA 4APQD 4DJMA 1B88A 3U46B 1TNNA 3PXHA 2VDPH 2X1PA 4UU9A 2NY3D 1AQDA 4LDEB 3B9KA 4M00A 5FKAB 2B20A 5KS9E 5C70A 2EDJA 1KPVA 4ZNCD 2VL5A 4NFDA 1F5WA 4ZUTB 4ZD3L 1PEZA 1U8OB 3JV0A 1QZ1A 2VLJD 1CN4A 1C1EH 3L6FB 4LIQE 2EIBA 4YFDB 3GJFK 4HBQA 3WEXB 4RFEB 3V8CA 4LCCA 1WAAF 4UT7L 1EIBA 2A77L 3QH3A 5CIPH 2OZ4H 3D18B 3MMEA 1OY3B 2CLZA 3L3GB 3ET9F 5CSZB 2FIRT 4KVNL 4JM2A 2NY7L 3DYPA 3PL6C 4UINH 1N0XH 4HWZB 4KHXL 4PJHE 5TE7H 1HH6A 4K94H 3BXNB 1KJVB 4ODSL 5HVHC 2R69H 5FCUL 4I4WB 1KULA 4QNPF 5HDQL 5LGJB 5I18H 1ROWA 1NKOA 4X6FB 1M7IB 4QHKJ 4LLYB 5BRZD 5E9DE 1A9BA 2YK1L 4XWGL 4FQ1H 4JO1H 2PTTA 1X5AA 2XN9E 4JY5H 1JYXA 3MRDA 3ZE1F 4M6OH 4MJIA 4Z7VA 2RQ8A 5I8EB 5FUCE 3VMOA 4ZFGL 4B7LA 1KEGH 4OLEA 5J13B 2OL3H 5JO5B 1FNSH 1Q0XL 5L2JA 3TPUA 1T1ZB 4NKDB 4WUUE 4KKBD 4OM0L 5CSGA 1OM3L 1S7RB 4L9LC 5KW9L 2AK1H 3S35X 1S7XB 2H1PL 3JTTB 3L6FA 3OL2A 3BZFB 1N6QL 4HZLA 3SGJC 1CGXA 4X83A 4UOJA 1BVLB 1XF1A 2BSTB 4NWTL 1KXVC 4OKDA 3FAXA 3BYYA 3PE9A 2LAGB 2ZG3A 3ZDYE 5IQ7H 2DQGL 1EFXB 1QLFB 2ICWJ 4L4JA 4WTWA 3WO4C 5KZCB 4ELMF 1RQ5A 3VXSD 1LILA 5C09A 2NZ9D 2VSDA 1KJVA 4KV5F 4NN7C 5B4MD 3W11D 1NLBL 3FQTB 4HC1H 1M7DA 1FVCB 3CUPB 4Y2DB 2Z8RA 4DWHA 3EJYD 2BXYA 3GSNB 3O6FD 1YDPB 1CT8A 4UAOC 4UQ3B 3MV11 4GQPH 4AT6B 2VWEC 1JIBA 4U6TA 3MXWL 3GSUB 4MSWB 5A2KH 2QQKH 1UG9A 1IC1A 5BS0A 1E27A 4F9PC 2BY0A 3LDBB 5E6IA 4XRCB 1FGNH 1B4JH 3FQRA 2GTZB 3K3QA 3HFMH 5JR1H 5JO5A 3CVHL 3OKEA 4NQDB 4EIZC 1T1ZA 3R06A 3RX8A 4FMFA 4UT9H 3ZE2F 2VXQH 4OF8A 4S1QH 2VLRE 1H0DA 1ZA6B 1K8DB 1HHIA 3FQWA 3VXNB 4PRHD 1S7XA 4LVOB 1OAQH 3RWIB 4JFFD 3TIDA 4E0RA 1IGFH 2IFFH 3HRZA 1D3CA 3C5ZD 3UJJH 5L88H 4L1HA 3ARGA 1Z9SA 5HDBE 4JCMA 3DOSA 5ANMB 5E56A 1QLFA 3RWHA 3UTPD 3QG6A 1A7PL 1XGQB 3FT3B 3BP4B 1NJ9B 1G1YA 3MRNA 3D39D 5E94A 1HHKB 4Q9QL 1CFQA 1KYOK 3OKMA 2YD7A 3HZKB 2HWZH 4PGDB 2I5YH 4MNQB 2R2EB 2YXFA 2DQUH 1FVCA 3OKYA 1I75A 3SDCD 2F53A 4XB8A 5C0BD 3RWGA 2D7MA 5CP7B 4L8CA 5EUOE 1LDPH 4ENEC 5J9PB 3DI2B 4NO5B 5D6DC 2OTUA 3N85H 1HH9B 1F6AB 5AZ2H 1RY7B 2WV3A 4U6XA 1MHPL 3G6DH 1FYTA 1UGNA 2AI0L 3GSUA 5D1XD 2NY1B 4H1LA 3ARTA 2R15A 1V7NH 2VR9A 1T1WB 3PGDA 1I7RA 3W9EA 2ERJC 4IRJA 1JGUH 5GRWA 4PJ5B 2EE9A 1NCBL 2D9CA 2K3TA 4KMLB 1XF4B 3KPPB 1QYGL 3QUYC 1FBIH 3GSQA 3U6RA 1S7QB 1MNUH 5EFIB 3IB4A 4YXLL 3KYKL 3NCJL 5F9AC 5HYQB 3BQUC 4O2EB 1LP9B 1D5ZA 2IALB 4Z76B 4PY7A 4H88L 2PNDA 2P8PB 3RX7A 4DN4H 5GZOD 2CO7B 1U58A 5HI4D 1T1YA 5IFAL 3QUKA 3WFDL 5CINH 3BP4A 5C3LD 3LKPB 5L2KA 1HHKA 2JIXD 5F6IB 4AH2B 5DRWB 1WT5C 5I6XC 4CL7A 3F7RA 3DTXB 4RMTA 1KG0B 2QQNL 4OZHF 1FFRA 2R2EA 4MA8H 4AJ0A 3QDHA 1BBDL 5CP7A 3HI6H 3GJFB 3QEUB 4ODHH 3TBVA 1MIEH 4GKZB 4JFDD 4KTDL 4NKIL 3LQAL 3ULSB 4XMKH 2VXSH 4R4NC 2DL2A 4BFGA 1IC7H 4G9FE 4JFYA 5FO7B 1HXMB 1G6RL 4KI5C 1OP3H 4HEPG 1I9IL 4E5XA 3HS0B 5BV7C 5I8KH 4I0CC 1DBJL 3WFCH 2DMKA 5ESQA 4QXUH 1PZ5B 4I3SH 4WGVB 2BJMH 4OD3L 3T8XB 3L3DA 3PV6A 3OG4B 2N1KA 3QHFL 4RGMC 3QDMA 4FTVD 3MRLA 4UQ2A 5HYQA 3SJVB 2HFEA 4Y5YC 3TVMB 4EUPA 1CFTA 5DGQA 3PQYD 5E8NB 3S88H 5SWZD 4UDUB 4NHUE 3OF6D 5HVFB 5E8DH 4L8SB 4XI5D 5E70A 4EDWH 4XCYA 4DOHB 1PLGH 4LDOB 4JDVA 1TJHL 3N1GC 1IGYA 7FABL 5KS9A 4AH2A 5DRWA 1KXQE 1HSBB 4ELKA 4K2UH 1XH3B 3PXJA 4WO4D 4YHIA 3OBAA 3DTXA 2HMID 1DANT 3FZUD 4M7ZC 4G7VH 5I15L 3LMJL 1QBLH 3GJFA 1HI6A 5IEKA 3WS3B 5DC0A 2BVQB 3GI8L 4PJ8A 4GW5A 2CIIA 4XPGL 2W92A 1FVDA 1EDQA 4PJ9C 1V3MA 2J1KA 4L4VE 4PJAF 1QFWL 3QEHB 1EERB 3L5JA 4F7PB 4JZJB 3P0YL 3RGVD 4PJHA 1K6QH 3VCLB 1TFHA 2IAMA 4GUPB 1KSRA 3D2UD 2JK5A 1G9EA 4LLDB 5DVNA 1X7QB 3HC4L 1LO2H 2FX7H 3GM8A 2QHLA 4N5EA 4DGYL 4M7KH 1D6VL 1NBYA 1U3ZA 4LSPL 5FUOL 5E9DA 4YJZL 4EOWH 4YDKH 2XKNA 4PRDA 5EZOL 4DQOL 4LLAA 3SJVA 3T3MF 2FX8H 3TVMA 4W4OA 5AUMB 2XN9A 5E8NA 3W2DL 4ESKA 2J88H 4KMTL 4N0YH 4L8SA 3VRLE 3QWOA 4BQ6A 2VDOH 3GMQA 2W65B 5DGRA 4RAUA 5E2JA 3NFNB 5E2TH 2JF1A 1UQSB 5ETUB 1BWWA 2OQJB 4WUUA 1XH3A 3IFOA 3KPSE 4X5WB 2GK0A 2BC4B 1I8MA 1IZJA 4PLJC 5C6WH 3F7YA 4OFVA 4OCRH 3ARFD 1DR9A 4GOSA 4NKQB 3WS3A 5F97E 4HSQA 1AIFB 3NACL 2W60A 1VERA 5LBSH 2FX9L 3JZ7A 1OQXA 1I7TB 5DEFB 5E08L 5IMKB 1UC6A 1DBBH 1ES0A 2FEDD 2NXYB 4WI9A 5EZJB 2OI9C 1CQKA 4J1UB 5D71H 4HCRL 2P8LB 5HD8C 5MEQB 2V5RA 4CAGA 5K33A 5DURD 3MOBH 5HJ3A 3IU3B 1NLDH 4MA3B 3B9EA 4X4XA 2Y23A 1UCBH 2ZCHL 4L4TE 4ZDHB 5SWQA 2V5YA 2EYSB 4AG4L 3LB6D 1LK3L 2UWEB 2ITCB 5D7SL 4XNUL 1FC1A 1CFNB 1S5IL 3QUXC 4EI5C 1MLBB 3NPSC 2FL5A 2ZUQB 4POUB 1QKZH 4TQEL 4TYUA 1I1RA 4AEIL 3RA7H 2NY5L 2ESVE 3FT2A 3M07A 2DMCA 4PRIB 4PRPD 3DVIA 5EO9B 3BOVA 3H3BC 3NFNA 4HKZA 2X7LB 4GMSH 1IBGL 2OQJA 3U4EB 1PEWA 3I50L 4OUUA 1FVEB 4S0SD 5GRVK 3U0PB 1A6WL 2VLRA 4H0HB 1XIWB 5E0QA 3EYSL 1RIHH 4PJIE 4BSJA 4F58H 4MZ2A 1G7IA 5D72H 4X7TB 5CEZL 2XFXB 2DI7A 1QBAA 4JREB 5IEHA 4X9GA 3UYRH 5TDPA 5F1OB 4NO0B 1HKLH 4I3GA 1T7VA 3GHBL 4WEMB 4FQLL 1T7YA 1YY9D 2P8LA 3CFCH 3HE7C 1NAKL 4AQOA 5MEQA 1EVTC 1NC2B 4HJJL 1S5HB 3C08H 2NLJA 3TN0D 2CKBB 4GXVH 4J8RB 4LPXA 4RAVA 5EUOA 3SPVB 1MRFH 2EYSA 2ITDA 3CC5B 3BSZH 1KJMB 3NZ8A 3G6JB 1I3RB 2BVOB 4M48L 1CZ8L 4K94C 5BOZG 5T1KB 1NPUA 4Z6AT 1MLBA 4TVPD 2IQAB 3MJ9L 4UILL 5L0QC 4I5BA 1F4HA 1FO0B 5E2VH 5AYQA 4XPTH 4MQSB 5IT2L 4PRIA 3QPQC 5GGUB 1DN0B 2VXUL 3EOYG 1QEWB 2X7LA 5A2FA 2C7UB 2BDNL 1AFVH 3I6KB 3TT1L 5J11B 1Q9OB 1JGVL 4HMDA 4I77L 4CDGC 1XIWA 3Q2CA 3BPLC 5IHUH 2V17H 3AVEA 4AZ8A 32C2A 4CUCA 2O5ZL 3SDAC 1GGIH 1Q72L 4K9EL 4E41D 4X7TA 4Z7WF 4XPBH 3NABL 5FO9A 1AR1D 1QQDA 1WISA 3BE1L 4UOW0 1P4BH 3VXTA 4CU6A 1QSEE 4YXHL 3FO1B 1IC4L 4JPKH 2IMMA 5K9KA 1ZTXH 1ADQL 5A16B 1IGCH 4OCXL 2X44D 4OCSL 4XNMB 1OHQA 4AEEA 5ILTH 4G6KH 4WHTA 4R3SA 1BF2A 3CFJB 4QEGA 1CGTA 3QBTB 1D5MB 1I85A 5FA4B 1V3KA 3O2VH 3UMTA 2XG4A 4HG4J 2VLJE 3VGBA 2DB8A 3RBGA 1JBJA 3WNKA 4UNVA 3RHWF 3G5XB 3QIUC 1SYVB 4Z8FL 3V5KB 2KBGA 2Z9TA 15C8L 1JHKH 1RK0A 3WXWL 4G9FA 4X80H 4XXCC 3S34H 4WUKL 4Y16C 4D8PB 3QRGL 3QQ4A 4ALAH 1NGYA 2IQ9H 3KYMB 4OD2B 1DN0A 3FTGB 2V2WB 5HHOB 2VDNH 1GXEA 3BKJH 3MLWL 3E3QC 3I6KA 3SKNB 4WFFD 5IESH 2P5WD 1UVQA 5DJDA 5SWSB 1YECH 1HYSD 3HE6D 4FQIL 4KDTA 3UPCA 5BW7A 3MFFA 4Y4KA 4Y4HB 3CDCA 4MXVE 3UTZB 5BRZE 4YHNB 3O3BA 5IOPA 1P4IH 1UWXH 3BIKB 4NHUA 1OAYL 2FD6H 2B5IB 3HPLB 4NN6C 1NANI 43C9A 5IHZB 3H9ZA 3QDAA 4EEEA 5DJ2B 1QR1B 1PKQB 1BLNA 1E4WL 2FO1A 3LKOB 4H20L 4LRIC 1NBVH 5DFVC 2VITA 5EU7C 3QFJB 4LLVA 1L0XA 1FL3B 4K3JL 3OJMB 4ONGH 5DYOB 2XV6B 1KOAA 2E3VA 4XP1H 5GIRB 5I1IL 1YMMD 5JW5B 1MCOH 2DM7A 1QLEL 1OAKH 2XXCB 5CZVH 3RAJH 3EZ8A 4NNPL 1J8HD 4YO0B 4Y1AD 2Q86A 3NVQA 3RY6A 3W39B 2B1AH 4K7FA 4RGOH 3GKWL 4OTXL 4XVSL 4EUPH 1FFPB 1W0VB 5B3NA 4L4VA 5LQBH 3IDIA 4PGJA 2AJ3B 5E8EA 3QULB 2NY4D 4D8PA 4EN3A 4HK3N 4OD2A 4AEHH 3FTGA 4YLQT 1JWSA 1GAFL 2GJZA 4MQ7A 3UXFA 3DMMA 1SHMA 4RFNB 5C9KA 4XMPH 1JE6A 4Y19B 1DBKL 2YPVH 3MRPB 3QI9A 4KRNA 1WFNA 4KHTL 3CDGA 4HGKC 5H94B 2X9XA 5F9OH 3CCHB 3UTZA 1S8DA 3CFEA 2XQBL 3DVNA 5KBNC 2AVGA 2N7BA 2VXTL 3DO3A 2VISB 3GMOB 3KGRA 2OBGA 4HJGB 4LIQH 1YNKH 3GJFH 3RZCD 5LVEA 2AQ1A 5FA3B 3OKLA 4G43A 2MPAH 2K7QA 3GGWA 5CGYC 1UA6L 2H6PB 3LOWA 3SQOH 2ADIA 1QR1A 4DZ8A 4PJCE 3G04A 3EYUH 1K3IA 5HGAA 3WIFB 2CDGB 3SDDC 4XNQA 3QEGH 4HXAH 4MX7A 4U1GC 1G7JB 5DQDL 1FFNB 1QVOB 1WFTA 2ZOLB 2E7MA 1ORSB 1CU4H 5FFLA 2Y06L 1HCFX 3FB5A 4YDVB 2A6JA 5D8JH 2W0FA 3H7BA 3QQ3A 4F7TB 4UIKL 4NRXA 1FZOB 4RDQG 3D39E 2BCKA 4M9PA 5BVPL 1HZHL 4R6UA 1NAML 5CD3A 2COQA 3AM8C 1F58H 5K9JH 1DVFD 4NC2B 3B5HA 3GRWL 1WBYA 1CICB 5GGRB 4KZDL 4L4TA 4XAKD 3FRPG 5DR5H 5DUMH 3U36B 3CCHA 5GJSH 4U2YA 5FKPB 3GNML 2NMSA 5KSBE 4XVTL 2VISA 3GMOA 1K8IA 4P59L 1RURL 1PJ9A 4MMXC 1W0YT 4Q9BA 1HHJB 1E6OL 2ESVA 2CUHA 1H8NA 4RIRA 5JQ6L 1BZ7B 1ZKAA 2R1WB 1IVLA 2YWYA 2PTVA 4LHUB 4BQ9A 5IBTH 1FRGH 3WIFA 1G84A 1A6VH 3VWJB 2J4WH 1YY8B 3DXAB 3VXQA 4PJIA 3O8XA 3WMSA 3IDNB 2GITB 3ARED 5IWLC 3MNZB 5CLWA 1G7JA 4JHWH 1IGIL 1QVOA 1OLZA 1HQRA 3MNWB 4IOIB 1KB5L 5BO1H 1HXYA 2CJUH 4KJYA 4APQB 4I9WD 3VG9C 2D9QB 1KEML 1FZOA 2NY3B 5I9QC 4M6NL 2VDLL 3KJ4C 5TH2A 4YXKH 4WWKC 1EUUA 2WBKA 3EYQC 4O4YH 5HI3D 4G6AC 3BGMA 4OAWB 1MAMH 1A3RH 3SY0B 1MH5B 2C1PB 4RZCA 4PR5B 4OFYD 1RZ8B 1KCRH 3C60C 3LHPL 1KC5L 2APTA 4MXQA 3IGAA 1RUQH 3MOQA 3HHRB 3NPZB 5I74C 4JFDE 3H0TA 2D03H 3B9KC 4WNQB 3E2HA 3UTTB 2MOVA 3VFOB 3ROLB 5EC2A 4S1SH 3EJZD 5IIEB 1GSMA 2AJZB 3KPLB 4OD1H 3CK0H 1NFDF 4X7DC 1TVDA 3LZFL 4CVXA 3MROB 2NXZD 4P5TD 2W0KA 3X3FL 1LMKA 5JNYB 5J1TC 4BFIB 3CDFA 3FFDB 2BNRB 3CXDH 2C4XA 4FTVE 4Y88A 3MGOA 1OTUD 2H26B 5DUPL 2CRIA 3PQYE 1BJMA 1QSEA 4NYLA 5BV7L 4JM2C 2A74B 5CD5D 5EC1B 2R9HC 4RAHA 1D5IH 3IETB 3TCXA 2W9EH 3RTQB 1UJ3B 4LP5A 3V79C 5BZDA 3J7HA 1ZLVK 2BY1A 4UT6H 4O58H 4PP2A 1I7UA 3KPNB 5CBAB 2DQDH 1L4IA 4RWYH 1J88A 2DLEA 2D4FA 3NIDF 1RZGA 4HUUA 2VLJA 1RZ8A 3DV4A 3GZKA 2BHZA 4S11A 2WIIA 4BSVA 4HD9A 4R2GD 3ALWA 4KVCH 3RIFF 1J1PL 1RIUL 1L0QA 1REIA 2QQLH 5ID1B 2EXWD 4C56D 2R1XB 3VFOA 5E2WL 5JXED 2X41A 2AJSL 3VXSB 2F19L 1MQKH 1F3JB 2R0LH 3QDGB 1HHHB 3ALPA 1A7RL 1AGEA 4JFPA 1FSKB 35C8L 1ED3A 3NCFB 1AGCA 3Q3GA 1Y6NR 1YNTA 3CX5K 1BEYH 5BRZA 4N8VA 4R26L 5CFHA 4HS6B 2OMNA 3QUZD 4N8PA 1MJ8H 2X4PA 5D7IE 4G7YL 4M5YH 3VJ6A 3E6HA 4WTZG 2V7NB 3HI5L 1UJTA 4HS3B 4Y4FC 1MVUB 3IETA 1CGUA 4KROB 5JMOC 2DQEH 1ZAGA 4F37K 4Z7OE 2OJZH 3HMWH 5JTWA 3HCVA 2VE6A 5F89B 1RK1B 3KPNA 4NNXA 3QUML 3B2VH 1U42A 2MCPL 3VA6A 1S78C 3UPRA 1QFUH 1T0PB 3O9WD 4PRHB 1MHCB 4NZRH 1BIHA 2YPKB 4JFFB 1AD9A 3VD5A 4DZBA 2R2BB 5DA4A 3WIHA 4J2XA 1EAPB 2FB4L 5GS0H 5B39G 1AP2A 5E6IC 4FQ2L 2AEIT 4HIXH 3MRRA 1CE1H 4HIHB 4G9DB 3WUWB 3VXSA 4OCWL 1BECA 1ZT4B 2EYTB 3HC3L 4JE4B 1AGDA 2DI8A 2P5ED 3B83A 4PTTA 4IOFC 4OQTL 1T22B 5AWNL 5IROA 4BZ2H 3GK8H 5C0BB 3ARGC 3L5IA 4NKMB 1KJ2B 3O6FA 2KH2B 4X7EC 5DC4B 3O6KH 4QCIA 1A6UH 2YBRB 4GAJL 1UZ6E 2ARJA 4TPRL 4N90D 3L3KA 2ILLA 1OTSC 1XF3A 1EBPA 3PL6D 1CE6B 5D2LE 1MEXL 3QHZH 2V7NA 3IXTB 4ERSH 3RUGE 5HGBA 3P11L 1CGYA 4K3DH 4PRPE 1TJIL 5GGTA 4HXBH 2GI7A 1AXTH 1LEKB 1VPOH 2QHRH 5DRNB 5HHPB 1FCGA 4PJCA 1VKXA 4JGMA 4P5KB 5H35A 1FV1B 1YEKL 1OP5K 5KJRL 4Y89A 3IFNH 2DQIL 1EMTH 2R39A 4PRHA 3VG0L 3JV6B 3ZL4H 4JFFA 3VFUB 3C5ZA 1U3HA 1P2CB 1G7LA 2YMXL 4CMHC 4HUWA 1KIUA 4XNXH 5I1JL 5MEPB 4YQXH 3ZZ1A 4YH6A 1ZK9A 5BVJB 5DA0B 1AXSB 4IRJC 4Z95H 4HIHA 1DBAL 1M05A 1ZLSL 5CJOL 3D39A 3WUWA 1VSCA 4DUWA 1NEZB 4F57H 2EDBA 5ADOH 4FP8H 2VDPL 2E6PA 3GSVA 3BIBX 3QAZB 4NC0B 3DUUB 3MRCB 1T22A 2C3XA 4IOSD 3SDCA 4OV6F 5DMGD 5C0BA 2WUCH 3BGFC 1QFPA 3IVKB 1EEYB 5AG9A 3DROB 5T1MA 2V9TA 3QXTA 3L7EB 4D94A 1NCAH 3JXAA 1ZVSB 1A5FH 2EH7H 2IH3B 5IF0B 4TVPE 5D1XA 4M7JH 1LO0H 5J7CC 1A4JB 1V5JA 1XF2A 4GW1A 1JK8B 1S7SB 5IVXE 1T03H 3HAEG 4KAQH 2OZ4L 4NN5C 2NY6D 1FV1A 5H2BB 5D7LE 4WV1A 3BHBB 4XNZB 2XWBB 5TE7L 5DT1H 4K94L 2UZIH 2OSLA 2R69L 4ZFOL 3Q6FB 3ECBA 1F13A 3F58H 1TTFA 2XICA 5SWZB 3NA4A 3N0PB 4YHOH 1HOCB 3CD4A 4GRMB 1RJLB 4TSBH 1OL0A 4M1DL 2EYRA 4JKWA 4XZUA 3VI4F 3GSWB 5FYJU 4JO1L 4CGTA 1DDHB 2BSSB 3P9LB 2JIXA 1A7OH 1JTTA 1EXUA 2MQ3A 2AV1B 4M6OL 1NEZA 1CFBA 2I9LA 5IB2B 5C6PB 3LN5B 5HVWA 4WO4B 4AENB 4RISH 3MLXH 3MRHA 4OBSA 1KEGL 3UJIH 1HQ4B 4FQQB 1IEBA 3HA0A 3PDGA 1ZSDB 4GS7B 1FNSL 4X6CF 2PW1A 3SGEI 1HDMA 2GY5A 5C07B 4LSTH 5D9SB 1DQQA 4HUVA 5F1IA 4OZGF 4JFDA 4AK1A 5EB9A 3O3EB 4LGRB 5IB1A 4YNYA 1T20A 5EBWB 1LNUB 3U2SB 1FG2A 3MXVL 3OJDB 3UYOD 4NT6B 1BAFH 5IUSA 4RRPG 2GK2A 3WFZA 3EYFB 4BH8A 5IQ7L 1ZHNB 4ONHB 1ZHBA 1W8OA 1JPGB 1JK8A 4XX1G 3WSQH 1NGWB 1CYGA 3NFPB 4ZOAA 3GIVB 1OGTA 4ENED 3H2WA 3IJYB 5FB8A 3RWCA 4WFFE 5H2BA 4CW1A 1CTNA 1I9JH 2P5WE 1LE9B 5GPRA 1FIEA 4PJ8C 3MRMB 4PV9B 4KXZH 4FTVA 3Q6FA 3BN3B 4LSRH 4UB0H 1YN7B 4HC1L 3LY6A 3IDUA 3PQYA 4LU5H 4O2FA 5SWZA 3OF6A 4ZO7A 4CU7A 4GRMA 3C09B 1WZ1H 2MHAA 5KTEL 4MQTB 2KKQA 2GT9B 2IAMC 2J5LB 3UZQA 3SDXE 1A22B 1JHTB 5DHXB 2BSSA 3QUYD 4MAUH 4WEUD 4KUCF 2QQKL 2X1OA 4NPYA 3SKJL 4N5EC 4FMKA 4WO4A 3GUTA 4HLZH 4AENA 4C54A 5TDOA 1FGNL 4FXKA 3WE6B 4FQQA 4NIKB 1VEPA 3HFML 2V6HA 4YWGH 3TVMC 4W4OC 5KG9B 4NGHH 5GSVB 2H2PC 3ARFB 3MREB 5SV4A 2BX5A 1YMME 3OB0K 4UT9L 2VXQL 2EICA 4S1QL 5CEYB 4AMKH 2X4RB 5ACZB 1J8HE 3O3EA 5FUCC 4Z7VF 2CLRA 4WIQA 3M17B 1FNHA 1OAQL 1LNUA 1T3FB 3U2SA 5CLTA 5CCKH 5HHVH 2VMFA 2E6JA 1IGFL 2IFFL 3RL2B 3KWWA 3UJJL 5L88L 3U7WH 1JF5A 2V9QA 1ZHNA 3REVA 3RGVA 3L1OH 3TF7A 4HIEB 2XA8H 4L3AA 3D2UA 3WL9B 3L5XH 3NTCH 2ZUUA 3NOIA 1I9RL 4WDIB 1PYWA 2C4FU 4LARH 2HWZL 5LWYL 2I5YL 2DQUL 1NUDA 2X4TA 1X4ZA 2JCCB 2J8UB 1VFAA 4GQ9L 1LD9B 1IQWH 4QHMA 3S36H 1LDPL 3F7QA 2R0KH 2DTMH 3N85L 3RJQB 2GT9A 5AZ2L 4HGMA 3VXPB 2BVPA 5MENB 4LFHG 3V95A 1ZGLP 3ELAT 1V7NL 1B0GB 2IFGA 3QB7C 2ENSA 1KLGA 4R4BB 2ZZUT 1OGAE 1JGUL 3NIGF 3ARQA 3ARFA 3GJEA 5T33H 5CUSH 4NNYA 1B2WL 3ARUA 1QBMH 1FBIL 4U1HB 4FQHB 1MNUL 3VMPA 3G5YA 5DMKA 4XP4H 1DTUA 4LP4A 4XMLH 5EWIH 3L3HA 4DN4L 1TLKA 1GGBH 3B2UC 3DX7B 4G8GD 1J86A 3HZYA 1RFDL 3AY4A 5CINL 4G3YH 1T4KA 4Z77B 6FABH 2A6IB 3I3EA 3E8UH 3ULVD 4I8DA 1KYOJ 3EDKA 5IR1A 3CZFA 2GTWB 2VZUA 4MA8L 5DJ0A 1X5IA 1BIIA 3SN6N 5DVKA 3HI6L 1LD9A 1MLCB 2IBZX 2V2TA 1JZ4A 4JJ5A 3WIHH 4I18B 3RUGA 5C8JA 4QHLB 4PRPA 4XMKL 5I30H 2FJHB 3CVHB 2EO1A 1FL6A 2VXSL 1YMHA 1IC7L 2P7TB 2UYLA 1RAMA 4X9IA 4M61B 2UUDK 5I8KL 3WFCL 3L9RB 4JFXA 2HRPH 2BSRB 3OQ3B 3AS1A 3O81A 4E41B 2B0SL 3EOBA 3AFLA 2PF6A 2DBJA 1DE4B 4HJ0C 1QPPA 3MUGB 4I9WE 4F2MB 4ZAKA 4PGZA 5MI0B 4JANA 5EIIA 1F3DH 3S88L 1ZV5A 3VGAB 5E8DL 3ILQC 3R0MA 4EDWL 4LEXH 4QKXB 3V6OE 5GGTH 5HY9B 1GOHA 3AC0A 3FT4A 3D69B 2EDOA 2EDTA 2X4QB 3P4LA 3TN0A 1QTYT 3TYGL 1A8JH 4K2UL 4AIXA 3RX5A 4ZUVB 2V7HA 3T4AA 4JRWA 3TO4B 1J18A 4I0PD 1MCDA 3G5ZB 4P2RE 3BKCH 2APWA 5E5UB 5ENWB 4MDIB 1EJ6A 1VDGA 2JJSA 4U6YA 5FYKU 3MCG1 4G7VL 1QBLL 1MLCA 5HD8D 5HYIA 2RCSH 1NGZA 3D3VD 3ESUF 1F3RB 3B3IB 3EFDL 4JZOA 1KCUH 2HTLC 3X3GH 1I85C 1TVHB 2Z93B 3RDTB 4MGXA 25C8H 1NCWH 4M61A 1BOGB 3SHSA 1E28B 5D7LA 4OGAD 1RZIA 5ICZB 3KLAA 4EI5D 1X5KA 1YEEH 2C26A 2OJEB 2BSRA 5JLZB 2P48B 3S3SA 4J6RL 4Q58C 3V4UH 3MCKB 5HDLA 4E41A 1OAZH 1JNLH 3SGEH 1QA9B 3UTSE 4RCAA 3R1GH 4M7KL 2ZSVA 3STZB 1OB1B 3PWJB 2NYYD 4EOWL 1U8HB 3B9DA 4YDKL 4BSWB 4H1LG 3QXDB 4F2MA 5E8PA 3MJ6A 3RVXC 1T5WB 3BD4A 3QDJB 2GUOB 3SCMD 2Y07H 2J88L 3W5NA 3WN5B 4N0YL 5GGSA 2VYRE 2XIDA 2VDOL 5GS0C 4K3GA 1EGJA 4KDTC 2YUWA 5BW7C 4Y4KC 2G60H 3WNPA 3OKDA 2HLFD 1HN1A 3M1BB 4YBLC 2H8PB 2A1WH 1LP9F 3OWEA 1EVUA 2Q7YB 1MCLA 3WUZA 4Y1AB 3CH1B 4ORZC 5ENWA 4MDIA 4NZUH 1G6RB 1INEH 4OCRL 4C56E 5J1AB 1R5WA 2LU4A 1NKRA 4LBEB 2NY4B 1QP1A 3TNNB 4WU5A 1CLZH 1NC4B 4HHAA 1HEZA 1LO3H 4LF3B 1SJHB 2Z93A 4MVBD 3TZVA 5LBSL 4FABL 4JJHA 4NQCD 1DBBL 5HPMA 5C0RL 2BERA 2CK0H 1DQML 1E28A 2P5WA 3T09A 3LEXA 3HE6A 4YHPA 4DEPC 2OJEA 3G6AB 1IAOA 3MCKA 3OXSA 3MOBL 4YGVB 3RY6C 1NDMA 2P8MB 5F7EH 2WBJB 2BRRL 2IPKA 4NRZA 1JFMA 1UCBL 3L5HA 4EN3C 4M93B 3PWJA 1U8HA 3NH7H 4S2SB 2ZUTA 2ICCA 4BSWA 2RHEA 3QXDA 7CGTA 3WJLA 5DD6A 4IIQA 3DMMC 1JYNA 3QEQD 3WD5H 3QI9C 3HR5B 3FB8A 4MJ2A 2I26N 3RA7L 4P57B 3TH3T 4MJ6A 3IDGB 5D93B 3BW9A 4GMSL 1UACL 3X13B 1CG9B 4OIBA 4EUPG 2IC2A 1YMMA 2M8XA 3QO0A 2Q7YA 4P46C 4XVUC 3VFWB 1S3KH 3JWOH 1IKFH 1J8HA 5HYJD 1MI5D 3FO0H 2ARWA 1MCWW 4Z7QE 5CAYB 4F58L 1IC5H 4IS6A 4B41A 4X5XB 3S5LA 4RGND 4QRQB 2JE8A 3UYRL 1SJHA 4D0DB 2W91A 2HN7B 4JG0H 4LKCA 1HKLL 4L5FH 2P5EE 4LL9A 3BISA 3WDIA 2XKSA 4QWWD 3MRGA 2Q3AA 3CFCL 4OZFA 4Y16D 1EA9C 3ORJA 3EYVB 2P8MA 1V8HA 5D1ZD 4JPIA 3SKMB 1GJIA 5I0DA 1KN4H 3RZCA 4GXVL 2Z91B 1UWGH 4D0BB 1MRFL 5F3BB 3BSZL 3S6CA 1R3JB 2IH1A 1U2HA 2R56L 1Y0LB 4PYHA 5HTSA 2NY2C 3K4DA 3HI1A 5JPMB 2HFFA 3LRGA 4XPTL 2GJ6D 3NFSH 3CDYA 3K8KA 2FJGB 3W9DA 3BZEB 4NUJB 4KMQA 2VZOA 4NSKB 4UBDD 1AFVL 4X6DB 1MWAA 1HCVA 2X09A 3MLVH 2QSVA 5IHUL 3L3OB 2V17L 1LQSR 3B43A 2VAAB 1Q9WB 1GGIL 4XCEB 5DFVD 1SVCP 4PP8C 3DX8A 1EBAA 3BO8B 4HS8H 4PGBB 4M6AA 3AUVA 4QHUA 1P4BL 4QRQA 1RUPH 1KPUA 3O3AB 2HN7A 4Y5VC 1ZTXL 4P3DA 1N5AB 3O8XC 3QSKB 2YXMA 1IGCL 2I60H 3V8OA 4GBXB 2PO6B 5C0AB 1DVFA 5ILTL 2GCYB 2NPLX 4G6KL 4ZD3H 2WMPA 1FCCA 3ULUE 4P2QD 1QSVA 1CS6A 1DLFH 3EYVA 3MV8E 3O2VL 2QKIA 5E2UL 3L95A 1RZ7L 3OR6A 2HLAA 1TMCB 5C0GB 4XH2B 3ZKMC 3AS0A 1S9WA 2BNQB 3FOMB 2AS5M 3QPXL 1JGEB 1JPFA 4Z7UB 4NJ9H 3DLQR 2L0DA 1JHKL 3QCVH 4QRTB 4X80L 3S34L 1YC8A 3IJHB 1JYVA 4F7EA 1UH3A 5L9DH 3EOAB 4ALAL 4ODSH 2IQ9L 3SKOA 3OX8B 4C57C 2VDNL 3HR6A 3BKJL 5CJXA 3AREA 5F88B 2UWEF 3WLWD 2F9BT 4C58B 4X6DA 3E2HC 4FQXB 5CGYD 4U1NB 3VFTB 4CNIA 5IESL 3QG7H 3AS2A 1YECL 3HN3A 3L3OA 3SQBA 5AZEH 3TO2B 1OPGH 3IT8D 2FSEA 1QFWI 3NN8A 1J87A 1P4IL 3V2AR 3L7FA 4OF5A 3MO1B 2FD6L 1QSZA 5DZNA 3RRQA 3V6OA 2X70B 2AABH 5MERA 5AYUH 1NFIB 4FN0A 5DEGB 1Q9LB 3SKUD 4OFYA 4YHLL 1OP5H 5KSAB 4WW2B 3TBSB 1NBVL 2PW2A 2XNAB 5FF6B 3V6FA 2H1PH 1N3NA 3MODH 4R2GB 5I66B 4ONGL 5T3XL 3ZE0E 4WHYH 4GG8A 4NWTH 5CEXB 1N2RA 1J0KA 5K59F 3HG1D 3C8KB 4EZMA 5TE4L 3OKNB 1MCOL 1OAKL 5CZVL 1P9MA 1JGEA 3RAJL 1BX2B 3LRSB 1MJUL 2CRZA 4X4YB 1A6TB 2B1AL 1MCHA 3H3KA 1JGDB 4D2NA 5LQBL 1CXLA 3IJHA 4HUNB 5BJTA 4YHYC 2DIBA 4UIMB 4AEHL 4P5TA 5I1HH 2HRLA 4MB3A 2D7PA 3G6JF 3QUZB 4XMPL 2YPVL 3VFTA 1JF1B 3UTSA 4KK9C 4V3DB 5EH1A 3CU7A 5F9OL 5F7DB 1R5IA 3TIEB 2OTWA 1I4FA 4JFHD 4L3ED 2DDQH 4UDTB 1J05B 1K5NA 4A2MA 4LIQL 1YNKL 4TVPH 3HUJB 2MPAL 4LCUA 3RBSA 3OKKA 4F33A 3C6LD 4LQ1A 1F90H 3SE3A 2HVKB 3SQOL 1I9EA 1KTDB 1JGLH 5D5MB 1Q9LA 2WUBL 3EYUL 2JELH 4GW4A 2DIAA 4O2CA 4JKLA 1QSFD 3C8KA 1QRNE 4HAFA 4C56A 4X99B 3OKNA 4LASH 1U93A 1T0NB 1CTOA 2Q76B 1CU4L 4P23D 5JXEA 4KKBC 1CR9L 4V2BA 3BP5A 6CGTA 4I1NB 4JR9H 1A6TA 5D8JL 4HGWB 5EO0B 4P4KC 3U4AA 4J3VA 1GRWA 1WICA 1DUYB 4NBYB 2R0ZH 3CJJA 4LSVH 1EGJH 5DVLA 4Q6YA 4PJXB 5DVOA 1F58L 3DRQA 3QUZA 5K9JL 4LNRB 3WJJA 5TDNB 1C5BH 1MIMH 3PL6B 4JN2A 5FO8A 5DR5L 3EDDA 5GSRB 4MA7H 5DUML 5HVHB 3TIEA 5GJSL 2YS4A 3DIFA 3LKRB 3O6LL 5C0FB 5J8OA 3D0LB 5B4MC 2HG5B 3LH2H 5TF1H 2O61A 5IROC 1R3LB 1YYLH 2M2DA 3TP4A 1CFSB 1IT9L 1DUZA 2FH8A 3PNWB 1F3DJ 2GSGB 3O6FC 4NQSA 4F7MA 4QRRD 1CD9B 3O9WA 5ITBH 4EDXA 1ZEAL 5I8CB 4WI5A 3UROR 5IBTL 2NX5B 1FRGL 2HJLA 1A6VL 2EXYC 4LFHD 3NCJH 2J4WL 1WIUA 4W70A 1LGVA 1EHLH 2Z0BA 1IJ9A 1FHGA 4EQ3A 3QNZB 5EBMB 1CD1B 4G8FB 4PLNC 2ADJB 2CJUL 3EFFA 3WFDH 5GS2D 4L9LB 3QXAA 4NQED 3C8DA 4G8GE 1FN4A 2P5EA 4RMWA 4WU7B 5GRYA 2MMXA 3P9MB 5JZ7C 4GRWB 4UZGA 1MHHB 3C5ZC 4PJBB 2QQNH 4K55A 1U3HC 3UTQB 2A83B 3ULVE 1QG3A 1D7FA 3T08A 4YXKL 4O4YL 3MV7D 4LMQE 3LKQB 4RA0C 3MLTB 3SO5A 3WO4B 5C0IA 1OVZA 2YD4A 3QZWA 1KCRL 1JZ8A 4NKIH 5DJ6A 1XR8A 4NN7B 3LKRA 4QOKB 1P4LB 4Y5XA 3EOTL 1G6RH 3KJ6H 4F15C 1DBJH 3ARBD 5IG7B 3SDCC 3BWAA 2QSTA 2W1NA 5F7UA 5FECB 4UAOB 4XC3H 4RBPH 4OD3H 4S1SL 4BZ1L 3RPIB 1FNGB 3CK0L 4PJFE 3E6FB 4Y4FD 4PJ7B 1AKJD 5D1XC 5F9JB 2Y1VA 3K2MC 3FFCD 5HXMA 4OZFH 1D6EA 2XZCH 3TWCH 4BK4A 2WINA 4U1MB 3CXDL 1OSZA 4RQQB 4HFUH 1CD1A 3IDYC 4QY8A 5DLMH 2H32B 1CDGA 5FYJD 1HSAB 2ADJA 1NAMB 2AKRB 2EC9T 3TCLA 4FNLH 4CMMA 4WV1C 3CVIL 2BOCB 5C9JA 1D5IL 7FABH 2ATPA 4I48B 4OCLC 4WU7A 3ARWA 5IV2B 1ONQB 2APVA 3CSPA 5E6ID 1MHHA 5C0CB 4PJBA 1FYHB 5GZOC 1LK2A 2DQDL 5HI4C 3MLTA 4TUJA 3LMJH 4IHOB 5TJWK 4B0MM 4KU1A 3T2QA 3OGCA 4K7PX 5EN2B 5FM8A 5DZLA 1VGKA 5DHVB 1SEBB 4XPGH 5JDSB 3D3VE 4C4KT 4IOFD 3WNLA 4KVCL 5F7LB 3RWEA 4HK0B 1IEAA 2QQLL 3WYRA 3T0ED 1VADB 4LVHC 4F80A 4NQUA 3P0YH 2YPLB 3T0WA 2VO5A 3V6ZB 1P7QD 4YPJA 4JQIL 4L8DA 1IE5A 2C3VB 3HC4H 3RPIA 2R0LL 3KPMB 4XBPA 5IMLA 2ZOKB 1KB5B 4PG9A 4F9PA 4LSPH 4MCYB 4PB0H 2IJ0C 2DMBA 1NUFA 2ERJB 1VA9A 1GOGA 1WBXB 1BEYL 3HLAB 3UCRA 4EXPX 5LJYH 4D0CA 3W2DH 1MJ8L 4M5YL 3QUYB 5C7XH 4WHCA 1GPOL 3QQNA 2BOCA 4IDJH 3JWOC 1F11A 1OF2B 2CR6A 2SEBB 4PJGB 2P42B 3BQUB 4WCYL 5J6HA 1XZ0B 4N0FB 1KBGH 2X1QA 3BAEL 4TVSa 3FOLB 3PHQB 4ODWB 3NGBC 1JNHB 4ZUSB 2HJFA 2F54B 3G5VA 3KXFD 2OJZL 4CJ0A 5DJYA 1KCVL 4UI2A 3B2VL 4GH7B 2OMBA 2WSKA 3BFOA 4XI5C 4OGXH 3D5OF 5JHDD 1QFUL 1XCTB 4GMTH 1X5GA 1R3KB 4NZRL 4X0KB 1AR2A 2XPGB 5I6XB 3QRFM 2BHYA 3GEWB 1A1OA 1RZKC 1S9YA 2O26U 3VXMD 2FX9H 3SDYL 5GS0L 3QJFA 1INDH 1ZA3B 5DHYA 2XY2A 2H41A 1G0YR 4HIXL 4JPWH 4WY7H 2H3NB 3K0WA 1CE1L 4NQCE 5BXFA 1RD6A 3FZUC 4HX1A 5D6DA 4P9ML 4NBXB 3V6ZA 3C87A 4FQCL 4JO2H 4RWHA 2DYPB 2Z31D 4PGEB 3WLBA 3PWPD 3KPMA 5DRZB 4BFEA 1G7HB 5BV7B 5FM4A 4BZ2L 1ZE3C 3GK8L 4LPWA 3JVGA 1JTPA 5E1AB 4QRPE 2X9WA 3CX5J 5ITFB 1G7QA 3RGVC 3O6KL 1X4YA 1A6UL 3T2NH 4HLZG 3TF7C 5HVGB 1WQVT 2BOBB 1CXIA 4MD5B 3S97C 5L8LB 3QHZL 4RGMB 5A43C 4YEFA 1WWAX 4IEFB 5EOQH 4ERSL 4PJGA 4IRSD 4Y5YB 1XZ0A 4X7SH 4N0FA 4K3DL 4LAJH 3SE9H 1RHHA 3PHQA 3I50H 4ZUSA 4DKDC 5EPMB 2QHRL 1A6WH 4NDMB 3RY4A 3EYSH 5B3JF 5T3XD 1SEQH 5JOEA 4HUXA 3IFNL 3I3DA 3SY0A 2AXFB 5HYJE 1MI5E 1XCTA 2F58H 1WT5A 4EI6A 1QRNA 3ZL4L 3I02B 4ISVB 3BEVA 4RGNE 3MPCA 4LRNH 1IM9B 2FO4B 3BUYB 4XNXL 3BGAA 4WI4A 4YQXL 4M7ZB 3U0WH 3UX9B 5E5RB 4G80A 4Z95L 1FPTL 3IS0X 4JFEB 4FQLH 3RVWC 1ACZA 2XG5A 1MCFA 3AU1B 1WLHA 4FP8L 4PJ9B 4PGEA 5DF0A 3WNNA 3U79A 2VDRL 2I07A 2FEDC 2JB6A 2WUCL 4MD0B 4GKSA 1PG7X 2E8ZA 2NTFB 3MRKB 3MYJA 4M48H 3OHXA 4E42A 4RMUA 2R4SH 4LLMA 5HHXH 4DCQB 5CMAB 2NW2B 1NCAL 3FB7B 3AY4C 3D9AH 1A5FL 1LO4H 4R7NA 3QUMB 5IT2H 1T0MB 4M7JL 2W07A 1DEEB 1LO0L 4PJEB 4XPFH 2Z35B 2FWOA 4QRSA 2Y36H 1S7VB 2GJ6E 3DUSA 2BVEA 3X14A 3LSOA 2BDNH 1J1OH 3OG6B 3EYOA 2M26A 4N8VG 1JGVH 1T03L 4KAQL 3BPCB 1QPXA 1CDBA 2WBWB 1U8KB 4ZOCA 1YN6B 1FJ1A 3O3DB 5FK9A 5DT1L 3JSSA 1OW0A 2UZIL 4WJ5A 3I02A 4ISVA 1NCDH 3N1QC 3PABA 5ISZE 3FQXA 1FC2D 1TZHB 4R96B 5FGCE 3F58L 1VCAA 1BMGA 4P3WA 5I1DB 4YHOL 4TSBL 1N59B 4G8GA 4R8WL 5ICXB 4PD4K 1L7TH 1X5ZA 3KYAA 3P4NB 5I1GH 1A7OL 4KUZH 3CFIC 3AU1A 4PBVC 5GGVH 4P2QE 3UO1L 4MLIA 3OAUL 1KLUB 2F15A 4RISL 4XB7A 5EZLA 1S7WB 3UJIL 3BH9B 4D9QD 3PWLB 2OI9B 4ZAKC 3F12A 1VESA 4LSTL 5FYKD 3MRKA 3AMLA 5JW4Q 3BI9X 1DJSA 5CWSA 15C8H 3MRFB 3JV5A 4JZNA 1D5BB 3FRPA 1CIDA 4NP4H 3FB7A 3HZMA 3HC0A 2E7CA 4EQ2A 2ZWLT 2BNUB 3LKNB 2ZSWA 3TN0C 4Z7NF 1BAFL 1BD2E 3QNXA 5HI5C 5IGXH 4V1DD 3QUXB 4KRPD 3LEYH 4EI5B 2NY0D 3NPSB 1XR9A 3WSQL 4Q6IC 2VIRB 4XBEH 2JJSC 1U8KA 1YN6A 5TE6H 1I9JL 4I2XE 4LCWB 4JFOA 1MCNA 1BBJB 1DCLA 9CGTA 4LSRL 2A6DB 2IADB 5IVZB 5DUBB 1EHXA 4LU5L 1XEDA 2BFVL 1EH9A 5IB3B 1U8MA 5I1DA 4PJDB 1WZ1L 1IFHH 4RX4A 3DURB 3MJ8B 4KKLD 4H20H 5J56B 1RUKH 3LEVL 3REWB 3TA3C 4MAUL 1AR1C 3C5JB 4YR6B 1YPZB 1Q8MA 3BRFA 4MAYD 3VXUD 1MAJA 3GMPA 2FZ3B 1XT5A 3KPTA 4I0PA 4NKOA 5I1IH 4BELD 4KKCC 1JN6B 3LQMA 3L3JB 4OQ1A 4YWGL 1QLEH 3BJLA 4NGHL 3QO1B 2VLRD 2FLRT 3HE7B 4AMKL 3D3VA 1MFCH 3WHE1 4OTXH 4XVSH 5CIPB 4XPAH 2PYED 3CMGA 5CCKL 4X4ZA 5HHVL 3WXVH 2BNUA 3LKNA 5CSBA 1OP3K 1UB5B 4LPCA 1I8IB 3U7WL 4Z18A 5I73C 3GFUA 3VFPA 1WAAE 2APBA 5F6HI 4EI5A 4ZFOB 4PUBH 1DBKH 3L1OL 5BZWB 1JNNH 2AV7A 4N0UE 5L0QB 2DBLH 4LQFH 3L5XL 1YEIH 3FQUA 1MAKA 4GG6E 4BYHA 4ZSOB 3ULUH 3JV4B 4U6HB 5IMOA 3LN4B 2VXTH 3TYFA 4LARL 5D96C 1T7ZA 5KVGH 3TZVC 3MJ7B 2B4CH 4QNPE 5IVZA 1N6UA 3SCMA 1IAIL 3BPLB 1MJJB 3NZHH 2A38A 3MJGX 3QEQB 1IQWL 3S36L 2HVJB 1G6VK 3SDAB 2R0KL 3HE6C 3GMLB 2DTML 2ZNWA 4PBXA 3IFPB 1A1MB 5DI8B 5DK0B 1J11A 3AMKA 4HJ0D 3DGCR 3ZE1E 2WWMD 4AM0B 4YR6A 1YPZA 4JVUA 3RGHA 5KSVB 1FLTX 3ZKSD 3L3JA 1UZ8A 2EDKA 4IIQC 1QSFE 2NNAA 1KNOA 4TNWK 4ZYKA 5T33L 5CUSL 3TNMA 1WC7B 3QQ9D 1AD0B 1H3PH 1S7UA 3O11B 1QBML 4UIKH 4HFWA 3B8SA 4KJWD 4MVBA 5TPWH 1JWMB 4ZMAT 4NQCA 5B39B 5BVPH 1HZHH 4BKLB 1UB5A 3LV3A 4FS0A 4IMKA 3S96A 3QIUB 5I2IB 1IAKB 1U8PB 2EE3A 4D3CH 1GGBL 5EA0L 5DZOA 4ZFOA 4V3EB 1AC6A 2G75B 4Y16B 2PKDA 3ARDD 3BP7A 3KPRB 5JORB 2D0HA 2IBBA 4G3YL 4ELME 3FJTA 1OAXH 1WWWX 1EV2E 1XGTA 3GNMH 4U6HA 3E8UL 4QRPA 3DBXB 4KV5E 3MJ7A 3W0WB 4EIGB 1GL4B 1R3HB 1RURH 4EJ1C 2A6KB 5D7KD 1MCKA 2AJYH 1E6OH 3QEQA 2QBWA 3WIHL 2IG2H 3RVUC 4NZJA 2GSIB 2HP4A 2IPUK 4EXKA 2EE6A 1BZ9B 4X6EA 1TCMA 5I30L 3QIWD 1T04B 4PV8A 3X11A 4P49A 1BFSA 4U1LA 3WHXB 3TBWB 4NN6B 3RZCC 4G6FD 2AP2A 4Y8DC 2Q1EA 2C3HA 5F71A 1UEYA 5HYJA 1MI5A 2HRPL 2B39A 4FQJH 3DGGB 3ZE2E 2I24N 2JJVA 2QSCL 4OZIB 3S3JA 5KVFH 1JWMA 3L5WA 5D7JA 3CSGA 3FRUA 1ITBB 1A1NA 1U8LA 1JZ3A 5GHWL 4CDHA 4HIIB 4OFPA 5DJXA 1M7XA 3VFSA 2Z4QA 2G5BA 4FZEL 3ARZA 3MV7E 4Y16A 4U1JB 5GGTL 5A40E 3LHPH 1N0LA 1G7MB 2YWZA 2EIEA 2DM4A 4WW1A 5D1ZA 4UUJB 4LCIL 4KC3B 3RWDA 3FCTB 3MCLL 2DKSA 1L0YA 5E99H 1R3HA 1B0RA 2A6KA 4GLRI 3FAWA 3EO0A 5IFJB 3V5DB 3H9SE 1DVFC 2EDHA 1MCPL 2RCSL 4H5SB 2GSIA 2DOCA 2GJ6A 2HYMA 1AGFB 1KCUL 3X3GL 4R97C 3VD7A 2FCBA 25C8L 4BK5A 1HWGB 3V5HB 3HB3C 2JCCF 4DAGL 2J8UF 3C5SB 2W9LA 4R0LA 3FFCE 3HAEB 3VFVB 1YEEL 2XOTA 3QI9D 1K4DB 4H25B 5J06A 3V4UL 2PCPB 1E4XL 1OAZL 3SDDB 5ALCH 3VXRE 5FYJE 4TUOA 5IMMB 1LE5A 4U1GB 5IW3A 1Q0YL 4YGAB 2FHBA 1ZS8A 4ZPVB 5CJ5A 5CJXC 2OCFD 3AREC 4P46D 4PRBA 2ARJQ 4ZFFA 1K3ZA 3N1MC 4OF6A 1ND0B 2Y07L 1SY6A 3S4SA 1Q38A 2PR4L 3STBA 4MDJA 1OT1A 3VRJB 5C2BH 2X1WL 4P2QA 4OB5L 3IKKA 3HNVH 2Y5TB 2AQ2A 5J89A 2G60L 1H3VA 1I1YA 2ATKA 3GSRB 3HG1B 3KPSD 4U7MA 1DLHA 1EZVX 1G9NH 1JPSH 2A1WL 1V7MH 1J1PH 1RIUH 3O4LE 4OZHE 3IKCB 1B9ZA 1CL7I 4HV8A 3T77A 5ALBH 1U91B 3CSYA 3J8F7 4YC2C 3U4BH 3V6OC 5GS1A 1DQJB 3AROA 3T0EE 3WFHB 1WJ3A 4M8VA 4NQVA 2QADD 4HKBB 1CLZL 4YFLI 1CDHA 3ZSTA 1W72L 1LO3L 1A7RH 1UXWA 5F9WC 1KLFA 2N56A 5JIKA 3VFMB 1JZ6A 4LEOB 2BVYA 1A7QH 2CK0L 3CFBA 3BRGC 3C5SA 1ZMYA 4R26H 2YD1A 2DLGA 4I2XA 1P9MC 4M4RA 5DDHA 3ULVH 3LD8C 4PGCA 2NY2D 4M1CD 3AXLB 1X6LA 4L3EB 3EJZC 5F7EL 3KPOB 3BKYH 4O51A 1IGTB 5FGRA 2NXZC 3D25A 4P5TC 2IANB 3NH7L 2FEEI 5E5MA 1Q9KA 2A9MH 1ND0A 5M94B 4WHYG 3QXVA 5DS8A 2ESVD 4CN1A 3KXFE 3LRHA 1ITCA 1Y18B 2CXGA 1I8LC 3VG9B 1KPRA 1Z0MA 3HPJB 4P3CL 5DD0L 4CN6A 3Q5YA 1N8ZA 1MHEB 2DAVA 2OP4L 1ETZA 5JHDE 2VN4A 5I9QB 1ZT7A 4YIQB 5F93C 5IQ9B 4HIJB 1WFUA 3HG1A 3KJ4B 5TGBB 2X4UB 4WWKB 4U1KA 1F97A 1S3KL 5AD0B 3JWOL 3VXME 2VUYA 3IKCA 1IKFL 1NSNH 2YD2A 3FO0L 2VQ1A 3SE3C 1JPTH 1UXSB 3C60B 1IC5L 1UKTA 5I74B 2DLFH 4XGZA 2NCMA 4Q9RH 1T2QH 2AXHA 4AY0A 1A4KA 1WAAA 3GMMA 1WUNT 3FL7A 3RY5A 1AQDB 3B9KB 4L5FL 3PWPE 4N0UA 43CAA 2FRGP 2EXWC 4PJAE 1KCGC 5C0JA 1RZKL 2VL5B 3ZYOA 4GG6A 4G5ZH 4JDZA 5KVDH 5IHBA 5JXEC 4K3EH 2ED7A 3VD3A 1UYWL 3WDHA 5T3ZD 1FNFA 4JRYD 1UWXK 3KPOA 5F1KC 4YPGA 4GKNA 4HBCH 4KZEH 4N0RA 4LHJB 2J8HA 2WWKT 1VFBA 3P11H 4JEGB 4P9HH 2NTSP 3QH3B 3C6LA 5T1LD 1KTLA 3MMEB 2CLZB 4QRRB 3DI3B 5J57B 3WJJC 4L29A 4JM2B 3RVVD 3HPJA 3EO1A 2C1OA 3NFSL 1MHEA 1FH5H 4FHBD 2B2XH 5IQ9A 2EDXA 3EIFA 1QSFA 5I1JH 1Q94A 1A9BB 4P23A 3QIBC 1U36A 3NCYS 1ZLSH 1DBAH 4NQEB 2PTTB 4MHHG 2K7PA 5CJOH 3O9WC 3KLSA 3PGCA 4LDLB 4HS8L 2YC1B 3MRDB 2DLTA 4MJIB 4Z7VB 2DQTL 4OLWH 1RUPL 1NQBA 1SJVA 4F9LA 3D6GA 4NFBA 3EZJB 1AH1A 1TETH 2I60L 5L2JB 3TPUB 4GAYA 2MJWA 1K2DA 4N1CA 4PB9H 4MA1C 3UC0H 5DQJA 2VUOA 3KAAA 4TTDC 1DLFL 4HZLB 1AO7D 1EHAA 4KK5D 4KK9D 3RZWA 4NJ9L 2A73B 4WFED 4QRRA 2E7BA 3QCVL 3UBXA 5C09B 5JA9A 5IBUG 4Y4FB 1DBMH 1IL1A 1AKJB 5L9DL 4G8IA 5DK2A 4CVUA 2DKMA 3AS3A 3IF1A 5FOBA 1M7DB 2Y72A 4MQXD 4Y5XC 3X12A 2X10A 3B8YA 3QG7L 4M1DH 2W38A 3IJSA 1CT8B 3UP1A 5EZIL 4NQEA 5AZEL 5CP3A 1OPGL 4JQXA 4GLRH 1C08B 3T0VA 2YC1A 4Q2ZA 1HIMH 3LIZL 5BS0B 1E27B 4HZAA 5E6IB 3DVGB 4HMEA 1K85A 1W8NA 3FQRB 4PLOB 5CJQH 1IAMA 3MV7A 3OKEB 2AABL 3DNKA 4D9QE 5AYUL 3K46A 3R06B 1A9EA 2LTQC 1BFOA 5I71C 1H0DB 5FYKE 3S5LG 4NO3A 4ZODA 1HHIB 3FQWB 5DJ8A 4P4KD 4CN4A 3MODL 1U8IB 4E0RB 2X40A 3MXVH 3HRZB 2WP3O 3TIDB 3ARGB 3H9SA 1A6ZA 2VDMH 3ARBA 5DMGC 3RWHB 4LSDA 1A6PA 2WP3T 3QG6B 4QYOA 3ULUC 1IZKA 5D2NE 1OARH 4V1DE 2A73A 5MEOA 4OZFG 3MRNB 4OZ4A 5E94B 2B4CC 1EEZA 1CFQB 5LXGH 4ODXA 4Y4FA 1KXTB 3OKMB 4G8EB 1AKJA 3PDDA 3FFCA 2ZUWA 5I1HL 5GGSY 2F53B 5E6YA 2FHFA 3OAYK 3RWGB 3TBYA 1YZZA 3CZJA 1T83A 4L8CB 3TH4T 3GKZA 5KTEH 2NY6C 3VWKC 2OTUB 1IRAY 4U6XB 1CL7H 1JCKA 1C08A 1FYTB 4Z7WE 2DDQL 5F3HB 2OK0H 4FFEX 3SKJH 4PTUA 1AGBA 2EXYD 4TVPL 2XYCA 4CMHB 4H1LB 4ZXBD 3DVGA 3PGDB 1I7RB 4X6DF 4Z0XA 1RVFH 3W9EB 1WSST 1I7ZB 3VXUE 4IRJB 3MV9D 3MLRL 1F90L 1U6AL 2DQHH 1SBSL 1KELH 2YSSA 1II4E 5DQ9A 1JGLL 2JELL 5EU6D 1JRHL 3GSQB 3T2OA 3O4LA 3U6RB 4NJAH 3ZTJG 4OZHA 1U8IA 5IJVA 5JZ7D 3FQNA 1I1AD 1VEOA 2PYEE 1D5ZB 1AHWA 1U3HD 3BGFB 3MLSH 4PY7B 3T0EA 3AAZA 1U58B 4LASL 3B6SA 4YE4H 5DSCA 1JL8A 1T1YB 1ZHLA 3QUKB 1IGJA 1P7QA 1KACB 1URLA 4JR9L 4OI9A 5E6ZA 5L2KB 1Z9LA 3U9PH 1I9RH 2VQTA 3U7YH 4M4PA 4G8EA 1SY6H 2A0LC 5LWYH 2R0ZL 4JKMA 4YDLC 3WKNA 2KQMA 4LSVL 1EGJL 3ES6A 4TRPH 4NN5B 4GQ9H 4Z7UF 1A0QH 1FG9C 1C5BL 1MIML 3TBVB 4R7DB 3BDYH 4MA7L 1GIGH 5J6GA 1D9KC 5F3HA 4H0GA 5FGSA 3ZHDA 4JFYB 4KK6D 4YZFF 3LH2L 5TF1L 2VN7A 3VH8G 3KXFA 4E5XB 2LV4A 4M03A 3MA7B 2XWTA 1YYLL 3JVGC 5ESQB 1I7ZA 1NH6A 2GFBA 5INCA 3FONA 1SVZA 5JHDA 5HHMD 1PSKL 3L3DB 1TNMA 3PV6B 3C6SB 5ITBL 1B2WH 2RBLA 1RJZB 3D1MC 4ZQKA 3HAEH 3VXMA 1FLRH 3QDMB 2H9GA 3MRLB 4UQ2B 1XAUA 2HFEB 1MFBH 1EHLL 4EUPB 1CFTB 2VRAA 1GHFH 4BJLA 4F7CA 4XCYB 4WW2F 1RFDH 4ZPTA 4ZTPH 1ZLUK 4JDVB 1U41A 4QRUA 5CS7A 1IGYB 2Z31A 2UY7A 5KS9B 2IWGA 3PWPA 4EKXA 2ICEA 4PJAA 4ELKB 5DO2D 4YHIB 1M71A 4Q0XH 4U0RC 4DN3H 4MD4B 3BZ4A 5AG8A 2BMKA 2XWJA 1X44A 4NC1E 1HI6B 5IEKB 5D7KE 2FBJH 3AB0B 5IW6B 4R7DA 4PJ8B 1EX0A 5DJAA 3PWUB 4GW5B 1KFAL 1CXHA 1GYAA 1KT2A 2CIIB 1FVDB 4IRSA 3GO1H 1NDGA 4YX2L 1H15A 3KJ6L 1Z0NA 3NIFF 3MA7A 1VFUA 4PJHB 1CDCA 2IAMB 2JK5B 5F72S 4XC3L 3BPOC 4PYGA 2B0SH 4QXWA 1BZQK 3C6SA 4JGJA 4BQCA 4PRAA 1OAUL 5HYEA 1RJZA 3PIQA 1NBYB 4UOW1 5E9DB 1DSFH 1D5XA 2XKNB 4PRDB 2WLYA 3HUJF 3D87B 2XZCL 3TWCL 4S0TD 2J6EA 2XN9B 3I75A 2VLKE 4HFUL 3OKOA 3DX6A 4Z5RA 5DLML 3QWOB 3RKDC 5D5MF 1G9NC 3GMQB 4FNLL 2CLVA 4NCC2 1EO7A 4EVNB 1T89A 4RAUB 5C3TA 1TCRA 5CKGA 4XPHH 1IM3A 5I17A 1OW0C 3ZHLA 1NGQL 3TYGH 4WUUB 3BN9D 4OI7A 2PTUA 3P77B 3IFOB 4UTBL 4TTGA 1FZMB 2GK0B 4KDWA 2ICWA 4MD4A 4KTEL 1I8MB 3A67H 3F7YB 1WEJH 5B38A 1I3UA 5IW6A 3O0RH 1NCTA 2EDLA 1MWAL 3EFDH 3PWUA 2CDFB 2W60B 2K9UA 4GKOA 3ULVC 1EFXD 3IYLW 1ES0B 3PDOA 5F7HA 5FEBA 3WKML 1U8NA 4PJXF 3VMNA 3D0VB 5KZCD 5C08E 3TPKA 5F1SA 4J6RH 5HJ3B 4X4XB 4JO3H 5F6HJ 4W4NA 4Y2DD 5IW1A 4PB0L 5SWQB 1VFMA 4U3XA 1AXIB 1GVIA 3PGFH 1U92A 4YUEH 1OSPL 2X05A 2FL5B 3RWJA 5JOFA 5C7XL 2A9NH 3FT2B 4XT1C 3TJHD 3U1SH 4EVNA 4NQTA 3JTSA 4IDJL 4HKZB 4QTHA 1R5VA 1KBGL 1M6OB 5DWUL 3P0GB 4OUUB 2RFXA