4V3DB

The cidra domain from hb3var03 pfemp1 bound to endothelial protein c receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
169
structure length
169
Chain Sequence
QRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Conservation Despite Huge Sequence Diversity Allows Epcr Binding by the Pfemp1 Family Implicated in Severe Childhood Malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Signaling protein
molecule keywords HB3VAR03 CIDRA DOMAIN
total genus 51
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4v3dB00
3MRPA 5C0JA 1N3NA 1ZT1A 1S7UA 4U1IA 3QDMA 1R3HA 1HHGA 3TO4A 1KJMA 3RWGA 1ZSDA 1I1FA 2VLRA 5MERA 3BVNA 3MA7A 2P5EA 3MRGA 3VWKA 1JPFA 3DMMA 1N5AA 4PJEA 1DUZA 3O4LA 3MGOA 5D2LA 4GUPA 2X4RA 3VFTA 5FA4A 4FFEX 4NNYA 3P77A 5E8PA 3QUYA 4GKNA 2ZSVA 1JUFA 4PGBA 4APQA 4CW1A 3JVGA 4L8DA 4PJ5A 2HN7A 3HG1A 3ARFA 3KLAA 1LEGA 3UPRA 1Z5LA 1EEZA 1G6RH 2VLKA 1S9XA 2X70A 4HUXA 1T7WA 5IVXA 1LK2A 1RJYA 4U1HA 4GKSA 5E8OA 5F1IA 3PABA 3TFKA 3QZWA 3GSUA 3D18A 3VFUA 3CVHA 4ZUUA 4U1LA 3E6HA 5L2KA 3MRCA 3SDXA 4NNXA 3RTQA 1W0WA 3S6CA 4JQXA 1FO0H 3MRBA 1HHJA 3FQNA 4PGCA 4E0RA 5EU6A 4MS8A 5HGAA 5F7DA 3RWEA 3VFMA 1INQA 3QFJA 1A9BA 2BVOA 3BEVA 4Y4FA 1NEZA 1A1MA 1LP9A 3MRLA 4ZFZA 5IROA 1CE6A 2DYPA 4WU7A 3MRJA 4G8IA 5C0GA 3TIEA 3CDGA 3C8KA 4ZAKA 4JQVA 5BJTA 4PJDA 1S7VA 3TBYA 3RWJA 1MHCA 4Y16A 2CKBH 2BSSA 3KPSA 4PJCA 3GMNA 1NAMH 3LKQA 3LKPA 4NO2A 1T20A 1RK1A 1ZT7A 3BH8A 4WDIA 1SYVA 4MJ6A 3QEQA 1KBGH 1IM9A 4K7FA 3MR9A 4PGDA 5ISZA 2HJLA 3V5KA 4U1KA 1B0GA 3I6LD 3ILQC 1JGEA 1GZQA 1S7WA 4UQ3A 4QRUA 4L3CA 1Q94A 3GJFA 4L8BA 1FZOA 1OSZA 5HYJA 1BZ9A 1JE6A 4QRTA 5DDHA 2OI9A 4WWKC 1ED3A 3VFSA 1K8DA 3VFWA 1T1WA 4NQVA 4PRAA 4MNGA 1AKJA 4HS3A 4QRPA 4L8CA 4G42A 1QRNA 5B38A 5D5MA 3LKSA 2ZSWA 1FZMA 1ZAGA 3E6FA 5EUOA 3C9NA 4E5XA 1S7QA 3HPJA 3ARBA 3X11A 1HSAA 4N0CA 4O2CA 1IM3A 5EFIA 5J6GA 3RL1A 5J1AA 5MEPA 4JFDA 2OL3H 3GMQA 3TZVC 2JCCA 4CVZA 3TN0A 1VACA 3KPOA 1UXWA 1I7RA 2X4OA 2HJKA 3FQUA 1XR9A 4ZUWA 3CPLA 3FONA 4NQEA 1HOCA 5HGHA 3VFVA 1FG2A 4Y4HA 4EN3C 3FTGA 1GZPA 5F1NA 3JTSA 4F7TA 5IEKA 2HLAA 1P7QA 3VWJA 2AKRA 1QSEA 1ZHNA 3B6SA 3LKRA 1S7RA 3V5DA 1MWAH 1QLFA 2J8UA 4PR5A 5IEHA 3W39A 5C0FA 3PWUA 3ERYA 1S8DA 4MJ5A 5D7IA 3RUGA 4Y2DA 3P73A 2BNRA 4LCCC 3ARGA 4L9LC 3G08A 1A6ZA 2GT9A 1ZHLA 1M6OA 2A83A 4PRDA 3ECBA 3HUJA 3IXAA 3P9LA 3KXFA 5IB4A 2CLVA 1YN7A 4X6FA 5IB3A 3GMMA 2XFXA 1A9EA 3P4MA 4PP8C 1E28A 3GSWA 3SDAA 5HHQA 2MHAA 2YPLA 1T22A 4MVBA 2GITA 1KJ3H 1QO3A 4PDCE 1DDHA 1WBXA 1T1XA 4NHUE 4NQXA 5C0DA 1T1ZA 1AGCA 3BZEA 4F7PA 4L4VA 3X12A 3SDDA 5FDWA 5DEFA 2E7LE 2YEZA 3O8XA 4G8GA 1LD9A 3L3GA 5E8NA 4XXCA 1T0MA 1VADA 4U1JA 4MQ7A 1I7UA 3KPQA 3REWA 4IRJA 5GSVA 5HGDA 1CD1A 5C0AA 1I7TA 3TBWA 1T80A 1TVBA 3GSNH 4NQDA 4QOKA 1HYRC 1HSBA 2RFXA 3MRMA 4NT6A 1JPGA 2X4TA 3O3EA 4D0DA 3VRJA 4PGEA 4IIQC 4U6YA 4JFQA 1FFPA 3H9SA 4L29A 1VGKA 3VXSA 1DE4A 1HHIA 4ZUSA 4NO0A 1DUYA 3MRIA 3QUZA 3MRQA 2BVPA 3MROA 3PWPA 4IHOA 2BNQA 4F7MA 3KPPA 4PRIA 5SWSA 3P9MA 3VXOA 3P4OA 1HHHA 3CCHA 1ONQA 3BGMA 3MV8A 5AD0A 5HHPA 4V3EB 4L3EA 3ROLA 4HUVA 5E00A 2VLJA 3O3DA 4PJGA 4WUUA 3GMPA 1S9YA 1MI5A 3GSOA 1ZS8A 3AREA 3QUKA 3H7BA 2FZ3A 2YPKA 3D25A 3LN4A 1KJ2H 3UBXA 1T7VA 4EUPA 2F54A 3ES6A 4HV8A 5SWQA 3VFNA 4PJ8A 2X4SA 3I6GA 5DEGA 2CLZA 2UWEA 1T0NA 4D0CA 5J6HA 4MXQA 3L3HA 2PO6A 2GJ6A 1QR1A 4U1SA 4X6CA 5HGBA 3KPNA 2AV1A 4JRXA 3VCLA 2AK4A 1TVHA 2NX5A 1KPVA 3NFNA 4LCYA 1EEYA 5INDA 3WS6A 3U0PA 2CIKA 3BZFA 3I6KA 3LKNA 4QRSA 3DBXA 3OV6A 2P5WA 2X4PA 4HUUA 3FFCA 4WW2C 5C07A 1KPUA 4U1NA 3H9HA 3M17A 2FO4A 4G9FA 3FQXA 3TA3A 3VFPA 1ZHBA 5GSRA 3MRFA 5EO0A 4K71B 1AGEA 3QULA 5E9DA 5SWZA 1BIIA 4PJ9A 3KYOA 3TIDA 3VJ6A 4Z78A 4LHUA 3TBTA 1B0RA 1FFOA 1I1YA 1QQDA 2PYEA 3BP4A 5D9SA 1SYSA 4FTVA 4PG2A 4U1MA 1OGTA 1S7XA 5EU3A 3TJHA 5IB1A 1EFXA 2AXGA 3GSQA 1LQVA 4I48A 3FQTA 3KYNA 2VAAA 1OGAA 4CVXA 3BP7A 2F53A 3MRRA 3GMLA 4IRSA 3JTTA 4NQCA 3DX7A 3L9RA 4PRPA 5D7JC 5EO1A 4Z77A 1A1NA 5C0BA 5FKPA 2FYYA 3B3IA 1CG9A 3PWLA 1PQZA 3DX6A 3X14A 4N0FA 4G9DA 4S0UC 1JGDA 3FOMA 5MEQA 3MRNA 3E2HA 1T7ZA 2ZOKA 5MEOA 1MHEA 3BXNA 4ZUTA 5B39A 3GSXA 1JF1A 2XPGA 5F9JA 4WU5A 3HCVA 3M1BA 1YN6A 4LCWA 5BS0A 3MREA 3VXPA 1LDPH 4JFOA 4UQ2A 4D0BA 3QDGA 4MNQA 5HHOA 1FZJA 4HWZA 4V3DB 3BUYA 1AGDA 2WY3A 1K5NA 4ZUVA 1W0VA 3SJVA 5JHDA 3PQYA 5HHNA 3SDCA 1P1ZA 4L8SC 3V5HA 3O9WA 3AM8A 4MJIA 4PJ7A 1AO7A 1XR8A 3FQRA 1I1AA 3MRKA 3QQ4A 3CH1A 1UQSA 3OXSA 2F74A 3BHBA 1WBZA 2H26A 3HAEA 3MGTA 1T1YA 1HHKA 1UXSA 1ZVSA 1JFMA 2D31A 3QQ3A 4JFEA 2CIIA 4NO5A 3PWVA 5INCA 3RGVC 3MV7A 5ACZA 1OF2A 2VLLA 1KTLA 3O3BA 2X4QA 3UTSA 1M05A 1G7PA 3BWAA 4ELMA 3W0WA 4PV9A 3SPVA 3HLAA 2AXFA 2BSTA 4PJFA 3TF7A 3KPLA 4NSKA 2VE6A 1E27A 3OXRA 3D39A 4PJIA 3RWHA 3VFRA 2X4NA 2BCKA 1BD2A 5EOTA 1A1OA 1KCGC 1I4FA 5IB2A 4L4TA 4QRQA 4G43A 3VXNA 3DTXA 5C0EA 3PWJA 3LKOA 3KPMA 3RWDA 4N8VA 4X6EA 1W72A 1LEKA 2GTZA 1RK0A 3UTTA 1XZ0A 3WS3A 3WLBA 3L3KA 5C9JA 3FOLA 1NANH 1T21A 3MRDA 4G59A 4PG9A 1RJZA 3CZFA 3TO2A 5HHMA 1JHTA 3RZCA 3P4NA 4EI5A 3FRUA 1QSFA 3D2UA 3GMOA 4ONOA 1G7QA 2V2WA 1N2RA 2V2XA 3HE6A 3RL2A 3X13A 4PJXA 1X7QA 4N5EA 4JFPA 3RWFA 1B3JA 4U6XA 1L8JA 3T8XA 4PJBA 2AV7A 3VXMA 1N59A 2NW3A 3T1FA 3BW9A 1S7SA 1YPZA 1KPRA 3LN5A 3VFOA 3FT3A 4PJAA 2Q7YA 3TVMA 5L2JA 3OX8A 3MYJA 5H94A 3RWIA 5ENWA 1TMCA 3JTCA 3SKMA 3DX8A 3SCMA 1ZT4A 4O2EA 4MX7A 5EU5A 3D3VA 4HKJA 4PJHA 1U58A 3VXRA 5FA3A 2ESVA 1AGFA 3DXAA 3GSRA 4PRNA 3BH9A 4Z76A 2GUOA 5BXFA 1AGBA 5MENA 3VH8A 3ARDA 2CLRA 3LV3A 1BQHA 5IM7A 3BEWA 3O3AA 3SKOA 3QDJA 2VABA 1P4LA 3WUWA 1FZKA 5C08A 3WL9A 2ZOLA 1QVOA 4NO3A 3ILPA 4LNRA 3TBVA 3TPUE 3L3IA 3QFDA 4O2FA 4Y4KA 5IB5A 1YDPA 1C16A 3AU1A 3VRIA 3HE7A 4PREA 2GTWA 5D7LA 4JRYA 3QUXA 4WJ5A 4N0UA 3BO8A 3RWCA 3MRHA 3GMRA 4X6DA 5C09A 3L3DA 5E6IC 3FT2A 3GIVA 1KJVA 3CC5A 5EU4A 2FIKA 1FFNA 3ROOA 3KPRA 1QEWA 1WBYA 2GAZA 3IT8D 3E3QA 3FT4A 1EXUA 1S7TA 2FWOA 4PRBA 3VXUA 5C0CA 4I4WA 2BSRA 3FQWA 3QI9A 4JFFA 4WO4A 5BRZA 1S9WA 2X4UA 2BVQA 2H6PA 4HX1A 1ZHKA 3UTQA 4F7EA 4QRRA 1T7YA 1T7XA 2C7UA 3TBSA 3KWWA 3L3JA 3GSVA 3PWNA 4F7CA 3MV9A 4PV8A 4PRHA 5C0IA 5D2NA 4HUWA 1XH3A
chains in the Genus database with same CATH superfamily
3MRPA 3I0TA 5C0JA 1N3NA 1ZT1A 1S7UA 4U1IA 3QDMA 1R3HA 1HHGA 3TO4A 1KJMA 3RWGA 1ZSDA 1I1FA 2VLRA 5MERA 3BVNA 3MA7A 2P5EA 3MRGA 3VWKA 1JPFA 3DMMA 1N5AA 4PJEA 1DUZA 3O4LA 3MGOA 5D2LA 4GUPA 2X4RA 3VFTA 5FA4A 4FFEX 4NNYA 3P77A 5E8PA 3QUYA 4GKNA 2ZSVA 1JUFA 4PGBA 4APQA 4CW1A 3JVGA 4L8DA 4PJ5A 2HN7A 3HG1A 3ARFA 3KLAA 1LEGA 3UPRA 1Z5LA 1EEZA 1G6RH 2VLKA 1S9XA 2X70A 4HUXA 1T7WA 5IVXA 1LK2A 1RJYA 4U1HA 4GKSA 5E8OA 5F1IA 3PABA 3TFKA 3QZWA 3GSUA 3D18A 3VFUA 3CVHA 4ZUUA 4U1LA 3E6HA 5L2KA 3MRCA 3SDXA 4NNXA 3RTQA 1W0WA 3S6CA 4JQXA 1FO0H 3MRBA 1HHJA 3FQNA 4PGCA 4E0RA 5EU6A 4MS8A 5HGAA 5F7DA 3RWEA 3VFMA 1INQA 3QFJA 1A9BA 2BVOA 3BEVA 4Y4FA 1NEZA 1A1MA 1LP9A 3MRLA 4ZFZA 5IROA 1CE6A 2DYPA 4WU7A 3MRJA 4G8IA 5C0GA 3TIEA 3CDGA 3C8KA 4ZAKA 4JQVA 5BJTA 4PJDA 1S7VA 3TBYA 3RWJA 1MHCA 4Y16A 2CKBH 2BSSA 3KPSA 4PJCA 3GMNA 1NAMH 3LKQA 3LKPA 4NO2A 1T20A 1RK1A 1ZT7A 3BH8A 4WDIA 1SYVA 4MJ6A 3QEQA 1KBGH 1IM9A 4K7FA 3MR9A 4PGDA 5ISZA 2HJLA 3V5KA 4U1KA 1B0GA 3I6LD 3ILQC 1JGEA 1GZQA 1S7WA 4UQ3A 4QRUA 4L3CA 1Q94A 3GJFA 4L8BA 1FZOA 1OSZA 5HYJA 1BZ9A 1JE6A 4QRTA 5DDHA 2OI9A 4WWKC 1ED3A 3VFSA 1K8DA 3VFWA 4JO8A 1T1WA 4NQVA 4PRAA 4MNGA 1AKJA 4HS3A 4QRPA 4L8CA 4G42A 1QRNA 5B38A 5D5MA 3LKSA 2ZSWA 1FZMA 1ZAGA 3E6FA 5EUOA 3C9NA 4E5XA 1S7QA 3HPJA 3ARBA 3X11A 1HSAA 4N0CA 4O2CA 1IM3A 5EFIA 5J6GA 3RL1A 5J1AA 5MEPA 4JFDA 2OL3H 3GMQA 3TZVC 2JCCA 4CVZA 3TN0A 1VACA 3KPOA 1UXWA 1I7RA 2X4OA 2HJKA 3FQUA 1XR9A 4ZUWA 3CPLA 3FONA 4NQEA 1HOCA 5HGHA 3VFVA 1FG2A 4Y4HA 4EN3C 3FTGA 1GZPA 5F1NA 3JTSA 4F7TA 5IEKA 2HLAA 1P7QA 3VWJA 2AKRA 1QSEA 1ZHNA 3B6SA 3LKRA 1S7RA 3V5DA 1MWAH 1QLFA 2J8UA 4PR5A 5IEHA 3W39A 5C0FA 3PWUA 3ERYA 1S8DA 4MJ5A 5D7IA 3RUGA 4Y2DA 3P73A 4BKWA 2BNRA 4LCCC 3ARGA 4L9LC 3G08A 2NYKA 1A6ZA 2GT9A 4G59C 1ZHLA 1M6OA 2A83A 4PRDA 3ECBA 3HUJA 3IXAA 3P9LA 3KXFA 5IB4A 2CLVA 1YN7A 4X6FA 5IB3A 3GMMA 2XFXA 1A9EA 3P4MA 4PP8C 1E28A 3GSWA 3SDAA 5HHQA 2MHAA 2YPLA 1T22A 4MVBA 2GITA 1KJ3H 1QO3A 4PDCE 1DDHA 1WBXA 1T1XA 4NHUE 4NQXA 5C0DA 1T1ZA 1AGCA 3BZEA 4F7PA 4L4VA 3X12A 3SDDA 5FDWA 5DEFA 2E7LE 2YEZA 3O8XA 4G8GA 1LD9A 3L3GA 5E8NA 4XXCA 1T0MA 1VADA 4U1JA 4MQ7A 1I7UA 3KPQA 3REWA 4IRJA 5GSVA 5HGDA 1CD1A 5C0AA 1I7TA 3TBWA 1T80A 1TVBA 3GSNH 4NQDA 4QOKA 1HYRC 1HSBA 2RFXA 3MRMA 4NT6A 1JPGA 2X4TA 3O3EA 4D0DA 3VRJA 4PGEA 4IIQC 4U6YA 4JFQA 1FFPA 3H9SA 4L29A 1VGKA 3VXSA 1DE4A 1HHIA 4ZUSA 4NO0A 1DUYA 3MRIA 3QUZA 3MRQA 2BVPA 3MROA 3PWPA 4IHOA 2BNQA 4F7MA 3KPPA 4PRIA 5SWSA 3P9MA 3VXOA 3P4OA 1HHHA 3CCHA 1ONQA 3BGMA 3MV8A 5AD0A 5HHPA 4V3EB 4L3EA 3ROLA 4HUVA 5E00A 2VLJA 3O3DA 4PJGA 4WUUA 3GMPA 1S9YA 1MI5A 3GSOA 1ZS8A 3AREA 3QUKA 3H7BA 2FZ3A 2YPKA 3D25A 3LN4A 1KJ2H 3UBXA 1T7VA 4EUPA 2F54A 3ES6A 4HV8A 5SWQA 3VFNA 4PJ8A 2X4SA 3I6GA 5DEGA 2CLZA 2UWEA 1T0NA 4D0CA 5J6HA 4MXQA 3L3HA 2PO6A 2GJ6A 1QR1A 4U1SA 4X6CA 5HGBA 3KPNA 2AV1A 4JRXA 3VCLA 2AK4A 1TVHA 2NX5A 1KPVA 3NFNA 4LCYA 1EEYA 5INDA 3WS6A 3U0PA 2CIKA 3BZFA 3I6KA 3LKNA 4QRSA 3DBXA 3OV6A 2P5WA 2X4PA 4HUUA 3FFCA 4WW2C 5C07A 1KPUA 4U1NA 3H9HA 3M17A 2FO4A 4G9FA 3FQXA 3TA3A 3VFPA 1ZHBA 5GSRA 3MRFA 5EO0A 4K71B 1AGEA 3QULA 5E9DA 5SWZA 1BIIA 4PJ9A 3KYOA 3TIDA 3VJ6A 4Z78A 4LHUA 3TBTA 1B0RA 1FFOA 1I1YA 1QQDA 2PYEA 3BP4A 5D9SA 1SYSA 4FTVA 4PG2A 4U1MA 1OGTA 1S7XA 5EU3A 3TJHA 5IB1A 1EFXA 2AXGA 3GSQA 1LQVA 4I48A 3FQTA 3KYNA 2VAAA 1OGAA 4CVXA 3BP7A 2F53A 3MRRA 3GMLA 4IRSA 3JTTA 4NQCA 3DX7A 3L9RA 4PRPA 5D7JC 5EO1A 4Z77A 1A1NA 5C0BA 5FKPA 2FYYA 3B3IA 1CG9A 3PWLA 1PQZA 3DX6A 3X14A 4N0FA 4G9DA 4S0UC 1JGDA 3FOMA 5MEQA 3MRNA 3E2HA 1T7ZA 2ZOKA 5MEOA 1MHEA 3BXNA 4ZUTA 5B39A 3GSXA 1JF1A 2XPGA 5F9JA 4WU5A 3HCVA 3M1BA 1YN6A 4LCWA 5BS0A 3MREA 3VXPA 1LDPH 4JFOA 4UQ2A 4D0BA 3QDGA 4MNQA 5HHOA 1FZJA 4HWZA 4V3DB 3BUYA 1AGDA 2WY3A 1K5NA 4ZUVA 1W0VA 3SJVA 2O5NA 5JHDA 3PQYA 5HHNA 3SDCA 1P1ZA 4L8SC 3V5HA 3O9WA 3AM8A 4MJIA 4PJ7A 1AO7A 1XR8A 3FQRA 1I1AA 3MRKA 3QQ4A 3CH1A 1UQSA 3OXSA 2F74A 3BHBA 1WBZA 2H26A 3HAEA 3MGTA 1T1YA 1HHKA 1UXSA 1ZVSA 1JFMA 2D31A 3QQ3A 4JFEA 2CIIA 4NO5A 3PWVA 5INCA 3RGVC 3MV7A 5ACZA 1OF2A 2VLLA 1KTLA 3O3BA 2X4QA 3UTSA 1M05A 1G7PA 3BWAA 4ELMA 3W0WA 4PV9A 3SPVA 3HLAA 2AXFA 2BSTA 4PJFA 2IA1A 3TF7A 3KPLA 4NSKA 2VE6A 1E27A 3OXRA 3D39A 4PJIA 3RWHA 3VFRA 2X4NA 2BCKA 1BD2A 5EOTA 1A1OA 1KCGC 1I4FA 5IB2A 4L4TA 4QRQA 4G43A 3VXNA 3DTXA 5C0EA 3PWJA 3LKOA 3KPMA 3RWDA 4N8VA 4X6EA 1W72A 1LEKA 2GTZA 1RK0A 3UTTA 1XZ0A 3WS3A 3WLBA 3L3KA 5C9JA 3FOLA 1NANH 1T21A 3MRDA 4G59A 4PG9A 1RJZA 3CZFA 3TO2A 5HHMA 1JHTA 3RZCA 3P4NA 4EI5A 3FRUA 1QSFA 3D2UA 3GMOA 4ONOA 1G7QA 2V2WA 1N2RA 2V2XA 3HE6A 3RL2A 3X13A 4PJXA 1X7QA 4N5EA 4JFPA 3RWFA 1B3JA 4U6XA 1L8JA 3T8XA 4PJBA 2AV7A 3VXMA 1N59A 2NW3A 3T1FA 3BW9A 1S7SA 1YPZA 1KPRA 3LN5A 3VFOA 3FT3A 4PJAA 2Q7YA 3TVMA 5L2JA 3OX8A 3MYJA 5H94A 3RWIA 5ENWA 1TMCA 3JTCA 3SKMA 3DX8A 3SCMA 1ZT4A 4O2EA 4MX7A 5EU5A 3D3VA 4HKJA 4PJHA 1U58A 3VXRA 5FA3A 2ESVA 1AGFA 3DXAA 3GSRA 4PRNA 3BH9A 4Z76A 2GUOA 5BXFA 1AGBA 5MENA 3VH8A 3ARDA 2CLRA 3LV3A 1BQHA 5IM7A 3BEWA 3O3AA 3SKOA 3QDJA 2VABA 1P4LA 3WUWA 1FZKA 5C08A 3WL9A 2ZOLA 1QVOA 4NO3A 3ILPA 4LNRA 3TBVA 3TPUE 3L3IA 3QFDA 4O2FA 4Y4KA 5IB5A 1YDPA 1C16A 3AU1A 3VRIA 3HE7A 4PREA 2GTWA 5D7LA 4JRYA 3QUXA 4WJ5A 4N0UA 3BO8A 3RWCA 3MRHA 3GMRA 4X6DA 5C09A 3L3DA 5E6IC 3FT2A 3GIVA 1KJVA 3CC5A 5EU4A 2FIKA 1FFNA 3ROOA 3KPRA 1QEWA 1WBYA 2GAZA 3IT8D 3E3QA 3FT4A 1EXUA 1S7TA 2FWOA 4PRBA 3VXUA 5C0CA 4I4WA 2BSRA 3FQWA 3QI9A 4JFFA 4WO4A 5BRZA 1S9WA 2X4UA 2BVQA 2H6PA 4HX1A 1ZHKA 3UTQA 4F7EA 4QRRA 1T7YA 1T7XA 2C7UA 3TBSA 3KWWA 3L3JA 3GSVA 3PWNA 4F7CA 3MV9A 4PV8A 4PRHA 5C0IA 5D2NA 4HUWA 1XH3A
chains in the Genus database with same CATH topology
3MRPA 5C0JA 1N3NA 1ZT1A 1S7UA 4U1IA 3QDMA 1R3HA 1HHGA 3TO4A 1KJMA 3RWGA 1ZSDA 1I1FA 2VLRA 5MERA 3BVNA 3MA7A 2P5EA 3MRGA 3VWKA 1JPFA 3DMMA 1N5AA 4PJEA 1DUZA 3O4LA 3MGOA 5D2LA 4GUPA 2X4RA 3VFTA 5FA4A 4FFEX 4NNYA 3P77A 5E8PA 3QUYA 4GKNA 2ZSVA 1JUFA 4PGBA 4APQA 4CW1A 3JVGA 4L8DA 4PJ5A 2HN7A 3HG1A 3ARFA 3KLAA 1LEGA 3UPRA 1Z5LA 1EEZA 1G6RH 2VLKA 1S9XA 2X70A 4HUXA 1T7WA 5IVXA 1LK2A 1RJYA 4U1HA 4GKSA 5E8OA 5F1IA 3PABA 3TFKA 3QZWA 3GSUA 3D18A 3VFUA 3CVHA 4ZUUA 4U1LA 3E6HA 5L2KA 3MRCA 3SDXA 4NNXA 3RTQA 1W0WA 3S6CA 4JQXA 1FO0H 3MRBA 1HHJA 3FQNA 4PGCA 4E0RA 5EU6A 4MS8A 5HGAA 5F7DA 3RWEA 3VFMA 1INQA 3QFJA 1A9BA 2BVOA 3BEVA 4Y4FA 1NEZA 1A1MA 1LP9A 3MRLA 4ZFZA 5IROA 1CE6A 2DYPA 4WU7A 3MRJA 4G8IA 5C0GA 3TIEA 3CDGA 3C8KA 4ZAKA 4JQVA 5BJTA 4PJDA 1S7VA 3TBYA 3RWJA 1MHCA 4Y16A 2CKBH 2BSSA 3KPSA 4PJCA 3GMNA 1NAMH 3LKQA 3LKPA 4NO2A 1T20A 1RK1A 1ZT7A 3BH8A 4WDIA 1SYVA 4MJ6A 3QEQA 1KBGH 1IM9A 4K7FA 3MR9A 4PGDA 5ISZA 2HJLA 3V5KA 4U1KA 1B0GA 3I6LD 3ILQC 1JGEA 1GZQA 1S7WA 4UQ3A 4QRUA 4L3CA 1Q94A 3GJFA 4L8BA 1FZOA 1OSZA 5HYJA 1BZ9A 1JE6A 4QRTA 5DDHA 2OI9A 4WWKC 1ED3A 3VFSA 1K8DA 3VFWA 1T1WA 4NQVA 4PRAA 4MNGA 1AKJA 4HS3A 4QRPA 4L8CA 4G42A 1QRNA 5B38A 5D5MA 3LKSA 2ZSWA 1FZMA 1ZAGA 3E6FA 5EUOA 3C9NA 4E5XA 1S7QA 3HPJA 3ARBA 3X11A 1HSAA 4N0CA 4O2CA 1IM3A 5EFIA 5J6GA 3RL1A 5J1AA 5MEPA 4JFDA 2OL3H 3GMQA 3TZVC 2JCCA 4CVZA 3TN0A 1VACA 3KPOA 1UXWA 1I7RA 2X4OA 2HJKA 3FQUA 1XR9A 4ZUWA 3CPLA 3FONA 4NQEA 1HOCA 5HGHA 3VFVA 1FG2A 4Y4HA 4EN3C 3FTGA 1GZPA 5F1NA 3JTSA 4F7TA 5IEKA 2HLAA 1P7QA 3VWJA 2AKRA 1QSEA 1ZHNA 3B6SA 3LKRA 1S7RA 3V5DA 1MWAH 1QLFA 2J8UA 4PR5A 5IEHA 3W39A 5C0FA 3PWUA 3ERYA 1S8DA 4MJ5A 5D7IA 3RUGA 4Y2DA 3P73A 2BNRA 4LCCC 3ARGA 4L9LC 3G08A 1A6ZA 2GT9A 1ZHLA 1M6OA 2A83A 4PRDA 3ECBA 3HUJA 3IXAA 3P9LA 3KXFA 5IB4A 2CLVA 1YN7A 4X6FA 5IB3A 3GMMA 2XFXA 1A9EA 3P4MA 4PP8C 1E28A 3GSWA 3SDAA 5HHQA 2MHAA 2YPLA 1T22A 4MVBA 2GITA 1KJ3H 1QO3A 4PDCE 1DDHA 1WBXA 1T1XA 4NHUE 4NQXA 5C0DA 1T1ZA 1AGCA 3BZEA 4F7PA 4L4VA 3X12A 3SDDA 5FDWA 5DEFA 2E7LE 2YEZA 3O8XA 4G8GA 1LD9A 3L3GA 5E8NA 4XXCA 1T0MA 1VADA 4U1JA 4MQ7A 1I7UA 3KPQA 3REWA 4IRJA 5GSVA 5HGDA 1CD1A 5C0AA 1I7TA 3TBWA 1T80A 1TVBA 3GSNH 4NQDA 4QOKA 1HYRC 1HSBA 2RFXA 3MRMA 4NT6A 1JPGA 2X4TA 3O3EA 4D0DA 3VRJA 4PGEA 4IIQC 4U6YA 4JFQA 1FFPA 3H9SA 4L29A 1VGKA 3VXSA 1DE4A 1HHIA 4ZUSA 4NO0A 1DUYA 3MRIA 3QUZA 3MRQA 2BVPA 3MROA 3PWPA 4IHOA 2BNQA 4F7MA 3KPPA 4PRIA 5SWSA 3P9MA 3VXOA 3P4OA 1HHHA 3CCHA 1ONQA 3BGMA 3MV8A 5AD0A 5HHPA 4V3EB 4L3EA 3ROLA 4HUVA 5E00A 2VLJA 3O3DA 4PJGA 4WUUA 3GMPA 1S9YA 1MI5A 3GSOA 1ZS8A 3AREA 3QUKA 3H7BA 2FZ3A 2YPKA 3D25A 3LN4A 1KJ2H 3UBXA 1T7VA 4EUPA 2F54A 3ES6A 4HV8A 5SWQA 3VFNA 4PJ8A 2X4SA 3I6GA 5DEGA 2CLZA 2UWEA 1T0NA 4D0CA 5J6HA 4MXQA 3L3HA 2PO6A 2GJ6A 1QR1A 4U1SA 4X6CA 5HGBA 3KPNA 2AV1A 4JRXA 3VCLA 2AK4A 1TVHA 2NX5A 1KPVA 3NFNA 4LCYA 1EEYA 5INDA 3WS6A 3U0PA 2CIKA 3BZFA 3I6KA 3LKNA 4QRSA 3DBXA 3OV6A 2P5WA 2X4PA 4HUUA 3FFCA 4WW2C 5C07A 1KPUA 4U1NA 3H9HA 3M17A 2FO4A 4G9FA 3FQXA 3TA3A 3VFPA 1ZHBA 5GSRA 3MRFA 5EO0A 4K71B 1AGEA 3QULA 5E9DA 5SWZA 1BIIA 4PJ9A 3KYOA 3TIDA 3VJ6A 4Z78A 4LHUA 3TBTA 1B0RA 1FFOA 1I1YA 1QQDA 2PYEA 3BP4A 5D9SA 1SYSA 4FTVA 4PG2A 4U1MA 1OGTA 1S7XA 5EU3A 3TJHA 5IB1A 1EFXA 2AXGA 3GSQA 1LQVA 4I48A 3FQTA 3KYNA 2VAAA 1OGAA 4CVXA 3BP7A 2F53A 3MRRA 3GMLA 4IRSA 3JTTA 4NQCA 3DX7A 3L9RA 4PRPA 5D7JC 5EO1A 4Z77A 1A1NA 5C0BA 5FKPA 2FYYA 3B3IA 1CG9A 3PWLA 1PQZA 3DX6A 3X14A 4N0FA 4G9DA 4S0UC 1JGDA 3FOMA 5MEQA 3MRNA 3E2HA 1T7ZA 2ZOKA 5MEOA 1MHEA 3BXNA 4ZUTA 5B39A 3GSXA 1JF1A 2XPGA 5F9JA 4WU5A 3HCVA 3M1BA 1YN6A 4LCWA 5BS0A 3MREA 3VXPA 1LDPH 4JFOA 4UQ2A 4D0BA 3QDGA 4MNQA 5HHOA 1FZJA 4HWZA 4V3DB 3BUYA 1AGDA 2WY3A 1K5NA 4ZUVA 1W0VA 3SJVA 5JHDA 3PQYA 5HHNA 3SDCA 1P1ZA 4L8SC 3V5HA 3O9WA 3AM8A 4MJIA 4PJ7A 1AO7A 1XR8A 3FQRA 1I1AA 3MRKA 3QQ4A 3CH1A 1UQSA 3OXSA 2F74A 3BHBA 1WBZA 2H26A 3HAEA 3MGTA 1T1YA 1HHKA 1UXSA 1ZVSA 1JFMA 2D31A 3QQ3A 4JFEA 2CIIA 4NO5A 3PWVA 5INCA 3RGVC 3MV7A 5ACZA 1OF2A 2VLLA 1KTLA 3O3BA 2X4QA 3UTSA 1M05A 1G7PA 3BWAA 4ELMA 3W0WA 4PV9A 3SPVA 3HLAA 2AXFA 2BSTA 4PJFA 3TF7A 3KPLA 4NSKA 2VE6A 1E27A 3OXRA 3D39A 4PJIA 3RWHA 3VFRA 2X4NA 2BCKA 1BD2A 5EOTA 1A1OA 1KCGC 1I4FA 5IB2A 4L4TA 4QRQA 4G43A 3VXNA 3DTXA 5C0EA 3PWJA 3LKOA 3KPMA 3RWDA 4N8VA 4X6EA 1W72A 1LEKA 2GTZA 1RK0A 3UTTA 1XZ0A 3WS3A 3WLBA 3L3KA 5C9JA 3FOLA 1NANH 1T21A 3MRDA 4G59A 4PG9A 1RJZA 3CZFA 3TO2A 5HHMA 1JHTA 3RZCA 3P4NA 4EI5A 3FRUA 1QSFA 3D2UA 3GMOA 4ONOA 1G7QA 2V2WA 1N2RA 2V2XA 3HE6A 3RL2A 3X13A 4PJXA 1X7QA 4N5EA 4JFPA 3RWFA 1B3JA 4U6XA 1L8JA 3T8XA 4PJBA 2AV7A 3VXMA 1N59A 2NW3A 3T1FA 3BW9A 1S7SA 1YPZA 1KPRA 3LN5A 3VFOA 3FT3A 4PJAA 2Q7YA 3TVMA 5L2JA 3OX8A 3MYJA 5H94A 3RWIA 5ENWA 1TMCA 3JTCA 3SKMA 3DX8A 3SCMA 1ZT4A 4O2EA 4MX7A 5EU5A 3D3VA 4HKJA 4PJHA 1U58A 3VXRA 5FA3A 2ESVA 1AGFA 3DXAA 3GSRA 4PRNA 3BH9A 4Z76A 2GUOA 5BXFA 1AGBA 5MENA 3VH8A 3ARDA 2CLRA 3LV3A 1BQHA 5IM7A 3BEWA 3O3AA 3SKOA 3QDJA 2VABA 1P4LA 3WUWA 1FZKA 5C08A 3WL9A 2ZOLA 1QVOA 4NO3A 3ILPA 4LNRA 3TBVA 3TPUE 3L3IA 3QFDA 4O2FA 4Y4KA 5IB5A 1YDPA 1C16A 3AU1A 3VRIA 3HE7A 4PREA 2GTWA 5D7LA 4JRYA 3QUXA 4WJ5A 4N0UA 3BO8A 3RWCA 3MRHA 3GMRA 4X6DA 5C09A 3L3DA 5E6IC 3FT2A 3GIVA 1KJVA 3CC5A 5EU4A 2FIKA 1FFNA 3ROOA 3KPRA 1QEWA 1WBYA 2GAZA 3IT8D 3E3QA 3FT4A 1EXUA 1S7TA 2FWOA 4PRBA 3VXUA 5C0CA 4I4WA 2BSRA 3FQWA 3QI9A 4JFFA 4WO4A 5BRZA 1S9WA 2X4UA 2BVQA 2H6PA 4HX1A 1ZHKA 3UTQA 4F7EA 4QRRA 1T7YA 1T7XA 2C7UA 3TBSA 3KWWA 3L3JA 3GSVA 3PWNA 4F7CA 3MV9A 4PV8A 4PRHA 5C0IA 5D2NA 4HUWA 1XH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MRP A;  5C0J A;  1N3N A;  1ZT1 A;  1S7U A;  4U1I A;  3QDM A;  1R3H A;  1HHG A;  3TO4 A;  1KJM A;  3RWG A;  1ZSD A;  1I1F A;  2VLR A;  5MER A;  3BVN A;  3MA7 A;  2P5E A;  3MRG A;  3VWK A;  1JPF A;  3DMM A;  1N5A A;  4PJE A;  1DUZ A;  3O4L A;  3MGO A;  5D2L A;  4GUP A;  2X4R A;  3VFT A;  5FA4 A;  4FFE X;  4NNY A;  3P77 A;  5E8P A;  3QUY A;  4GKN A;  2ZSV A;  1JUF A;  4PGB A;  4APQ A;  4CW1 A;  3JVG A;  4L8D A;  4PJ5 A;  2HN7 A;  3HG1 A;  3ARF A;  3KLA A;  1LEG A;  3UPR A;  1Z5L A;  1EEZ A;  1G6R H;  2VLK A;  1S9X A;  2X70 A;  4HUX A;  1T7W A;  5IVX A;  1LK2 A;  1RJY A;  4U1H A;  4GKS A;  5E8O A;  5F1I A;  3PAB A;  3TFK A;  3QZW A;  3GSU A;  3D18 A;  3VFU A;  3CVH A;  4ZUU A;  4U1L A;  3E6H A;  5L2K A;  3MRC A;  3SDX A;  4NNX A;  3RTQ A;  1W0W A;  3S6C A;  4JQX A;  1FO0 H;  3MRB A;  1HHJ A;  3FQN A;  4PGC A;  4E0R A;  5EU6 A;  4MS8 A;  5HGA A;  5F7D A;  3RWE A;  3VFM A;  1INQ A;  3QFJ A;  1A9B A;  2BVO A;  3BEV A;  4Y4F A;  1NEZ A;  1A1M A;  1LP9 A;  3MRL A;  4ZFZ A;  5IRO A;  1CE6 A;  2DYP A;  4WU7 A;  3MRJ A;  4G8I A;  5C0G A;  3TIE A;  3CDG A;  3C8K A;  4ZAK A;  4JQV A;  5BJT A;  4PJD A;  1S7V A;  3TBY A;  3RWJ A;  1MHC A;  4Y16 A;  2CKB H;  2BSS A;  3KPS A;  4PJC A;  3GMN A;  1NAM H;  3LKQ A;  3LKP A;  4NO2 A;  1T20 A;  1RK1 A;  1ZT7 A;  3BH8 A;  4WDI A;  1SYV A;  4MJ6 A;  3QEQ A;  1KBG H;  1IM9 A;  4K7F A;  3MR9 A;  4PGD A;  5ISZ A;  2HJL A;  3V5K A;  4U1K A;  1B0G A;  3I6L D;  3ILQ C;  1JGE A;  1GZQ A;  1S7W A;  4UQ3 A;  4QRU A;  4L3C A;  1Q94 A;  3GJF A;  4L8B A;  1FZO A;  1OSZ A;  5HYJ A;  1BZ9 A;  1JE6 A;  4QRT A;  5DDH A;  2OI9 A;  4WWK C;  1ED3 A;  3VFS A;  1K8D A;  3VFW A;  1T1W A;  4NQV A;  4PRA A;  4MNG A;  1AKJ A;  4HS3 A;  4QRP A;  4L8C A;  4G42 A;  1QRN A;  5B38 A;  5D5M A;  3LKS A;  2ZSW A;  1FZM A;  1ZAG A;  3E6F A;  5EUO A;  3C9N A;  4E5X A;  1S7Q A;  3HPJ A;  3ARB A;  3X11 A;  1HSA A;  4N0C A;  4O2C A;  1IM3 A;  5EFI A;  5J6G A;  3RL1 A;  5J1A A;  5MEP A;  4JFD A;  2OL3 H;  3GMQ A;  3TZV C;  2JCC A;  4CVZ A;  3TN0 A;  1VAC A;  3KPO A;  1UXW A;  1I7R A;  2X4O A;  2HJK A;  3FQU A;  1XR9 A;  4ZUW A;  3CPL A;  3FON A;  4NQE A;  1HOC A;  5HGH A;  3VFV A;  1FG2 A;  4Y4H A;  4EN3 C;  3FTG A;  1GZP A;  5F1N A;  3JTS A;  4F7T A;  5IEK A;  2HLA A;  1P7Q A;  3VWJ A;  2AKR A;  1QSE A;  1ZHN A;  3B6S A;  3LKR A;  1S7R A;  3V5D A;  1MWA H;  1QLF A;  2J8U A;  4PR5 A;  5IEH A;  3W39 A;  5C0F A;  3PWU A;  3ERY A;  1S8D A;  4MJ5 A;  5D7I A;  3RUG A;  4Y2D A;  3P73 A;  2BNR A;  4LCC C;  3ARG A;  4L9L C;  3G08 A;  1A6Z A;  2GT9 A;  1ZHL A;  1M6O A;  2A83 A;  4PRD A;  3ECB A;  3HUJ A;  3IXA A;  3P9L A;  3KXF A;  5IB4 A;  2CLV A;  1YN7 A;  4X6F A;  5IB3 A;  3GMM A;  2XFX A;  1A9E A;  3P4M A;  4PP8 C;  1E28 A;  3GSW A;  3SDA A;  5HHQ A;  2MHA A;  2YPL A;  1T22 A;  4MVB A;  2GIT A;  1KJ3 H;  1QO3 A;  4PDC E;  1DDH A;  1WBX A;  1T1X A;  4NHU E;  4NQX A;  5C0D A;  1T1Z A;  1AGC A;  3BZE A;  4F7P A;  4L4V A;  3X12 A;  3SDD A;  5FDW A;  5DEF A;  2E7L E;  2YEZ A;  3O8X A;  4G8G A;  1LD9 A;  3L3G A;  5E8N A;  4XXC A;  1T0M A;  1VAD A;  4U1J A;  4MQ7 A;  1I7U A;  3KPQ A;  3REW A;  4IRJ A;  5GSV A;  5HGD A;  1CD1 A;  5C0A A;  1I7T A;  3TBW A;  1T80 A;  1TVB A;  3GSN H;  4NQD A;  4QOK A;  1HYR C;  1HSB A;  2RFX A;  3MRM A;  4NT6 A;  1JPG A;  2X4T A;  3O3E A;  4D0D A;  3VRJ A;  4PGE A;  4IIQ C;  4U6Y A;  4JFQ A;  1FFP A;  3H9S A;  4L29 A;  1VGK A;  3VXS A;  1DE4 A;  1HHI A;  4ZUS A;  4NO0 A;  1DUY A;  3MRI A;  3QUZ A;  3MRQ A;  2BVP A;  3MRO A;  3PWP A;  4IHO A;  2BNQ A;  4F7M A;  3KPP A;  4PRI A;  5SWS A;  3P9M A;  3VXO A;  3P4O A;  1HHH A;  3CCH A;  1ONQ A;  3BGM A;  3MV8 A;  5AD0 A;  5HHP A;  4V3E B;  4L3E A;  3ROL A;  4HUV A;  5E00 A;  2VLJ A;  3O3D A;  4PJG A;  4WUU A;  3GMP A;  1S9Y A;  1MI5 A;  3GSO A;  1ZS8 A;  3ARE A;  3QUK A;  3H7B A;  2FZ3 A;  2YPK A;  3D25 A;  3LN4 A;  1KJ2 H;  3UBX A;  1T7V A;  4EUP A;  2F54 A;  3ES6 A;  4HV8 A;  5SWQ A;  3VFN A;  4PJ8 A;  2X4S A;  3I6G A;  5DEG A;  2CLZ A;  2UWE A;  1T0N A;  4D0C A;  5J6H A;  4MXQ A;  3L3H A;  2PO6 A;  2GJ6 A;  1QR1 A;  4U1S A;  4X6C A;  5HGB A;  3KPN A;  2AV1 A;  4JRX A;  3VCL A;  2AK4 A;  1TVH A;  2NX5 A;  1KPV A;  3NFN A;  4LCY A;  1EEY A;  5IND A;  3WS6 A;  3U0P A;  2CIK A;  3BZF A;  3I6K A;  3LKN A;  4QRS A;  3DBX A;  3OV6 A;  2P5W A;  2X4P A;  4HUU A;  3FFC A;  4WW2 C;  5C07 A;  1KPU A;  4U1N A;  3H9H A;  3M17 A;  2FO4 A;  4G9F A;  3FQX A;  3TA3 A;  3VFP A;  1ZHB A;  5GSR A;  3MRF A;  5EO0 A;  4K71 B;  1AGE A;  3QUL A;  5E9D A;  5SWZ A;  1BII A;  4PJ9 A;  3KYO A;  3TID A;  3VJ6 A;  4Z78 A;  4LHU A;  3TBT A;  1B0R A;  1FFO A;  1I1Y A;  1QQD A;  2PYE A;  3BP4 A;  5D9S A;  1SYS A;  4FTV A;  4PG2 A;  4U1M A;  1OGT A;  1S7X A;  5EU3 A;  3TJH A;  5IB1 A;  1EFX A;  2AXG A;  3GSQ A;  1LQV A;  4I48 A;  3FQT A;  3KYN A;  2VAA A;  1OGA A;  4CVX A;  3BP7 A;  2F53 A;  3MRR A;  3GML A;  4IRS A;  3JTT A;  4NQC A;  3DX7 A;  3L9R A;  4PRP A;  5D7J C;  5EO1 A;  4Z77 A;  1A1N A;  5C0B A;  5FKP A;  2FYY A;  3B3I A;  1CG9 A;  3PWL A;  1PQZ A;  3DX6 A;  3X14 A;  4N0F A;  4G9D A;  4S0U C;  1JGD A;  3FOM A;  5MEQ A;  3MRN A;  3E2H A;  1T7Z A;  2ZOK A;  5MEO A;  1MHE A;  3BXN A;  4ZUT A;  5B39 A;  3GSX A;  1JF1 A;  2XPG A;  5F9J A;  4WU5 A;  3HCV A;  3M1B A;  1YN6 A;  4LCW A;  5BS0 A;  3MRE A;  3VXP A;  1LDP H;  4JFO A;  4UQ2 A;  4D0B A;  3QDG A;  4MNQ A;  5HHO A;  1FZJ A;  4HWZ A;  4V3D B;  3BUY A;  1AGD A;  2WY3 A;  1K5N A;  4ZUV A;  1W0V A;  3SJV A;  5JHD A;  3PQY A;  5HHN A;  3SDC A;  1P1Z A;  4L8S C;  3V5H A;  3O9W A;  3AM8 A;  4MJI A;  4PJ7 A;  1AO7 A;  1XR8 A;  3FQR A;  1I1A A;  3MRK A;  3QQ4 A;  3CH1 A;  1UQS A;  3OXS A;  2F74 A;  3BHB A;  1WBZ A;  2H26 A;  3HAE A;  3MGT A;  1T1Y A;  1HHK A;  1UXS A;  1ZVS A;  1JFM A;  2D31 A;  3QQ3 A;  4JFE A;  2CII A;  4NO5 A;  3PWV A;  5INC A;  3RGV C;  3MV7 A;  5ACZ A;  1OF2 A;  2VLL A;  1KTL A;  3O3B A;  2X4Q A;  3UTS A;  1M05 A;  1G7P A;  3BWA A;  4ELM A;  3W0W A;  4PV9 A;  3SPV A;  3HLA A;  2AXF A;  2BST A;  4PJF A;  3TF7 A;  3KPL A;  4NSK A;  2VE6 A;  1E27 A;  3OXR A;  3D39 A;  4PJI A;  3RWH A;  3VFR A;  2X4N A;  2BCK A;  1BD2 A;  5EOT A;  1A1O A;  1KCG C;  1I4F A;  5IB2 A;  4L4T A;  4QRQ A;  4G43 A;  3VXN A;  3DTX A;  5C0E A;  3PWJ A;  3LKO A;  3KPM A;  3RWD A;  4N8V A;  4X6E A;  1W72 A;  1LEK A;  2GTZ A;  1RK0 A;  3UTT A;  1XZ0 A;  3WS3 A;  3WLB A;  3L3K A;  5C9J A;  3FOL A;  1NAN H;  1T21 A;  3MRD A;  4G59 A;  4PG9 A;  1RJZ A;  3CZF A;  3TO2 A;  5HHM A;  1JHT A;  3RZC A;  3P4N A;  4EI5 A;  3FRU A;  1QSF A;  3D2U A;  3GMO A;  4ONO A;  1G7Q A;  2V2W A;  1N2R A;  2V2X A;  3HE6 A;  3RL2 A;  3X13 A;  4PJX A;  1X7Q A;  4N5E A;  4JFP A;  3RWF A;  1B3J A;  4U6X A;  1L8J A;  3T8X A;  4PJB A;  2AV7 A;  3VXM A;  1N59 A;  2NW3 A;  3T1F A;  3BW9 A;  1S7S A;  1YPZ A;  1KPR A;  3LN5 A;  3VFO A;  3FT3 A;  4PJA A;  2Q7Y A;  3TVM A;  5L2J A;  3OX8 A;  3MYJ A;  5H94 A;  3RWI A;  5ENW A;  1TMC A;  3JTC A;  3SKM A;  3DX8 A;  3SCM A;  1ZT4 A;  4O2E A;  4MX7 A;  5EU5 A;  3D3V A;  4HKJ A;  4PJH A;  1U58 A;  3VXR A;  5FA3 A;  2ESV A;  1AGF A;  3DXA A;  3GSR A;  4PRN A;  3BH9 A;  4Z76 A;  2GUO A;  5BXF A;  1AGB A;  5MEN A;  3VH8 A;  3ARD A;  2CLR A;  3LV3 A;  1BQH A;  5IM7 A;  3BEW A;  3O3A A;  3SKO A;  3QDJ A;  2VAB A;  1P4L A;  3WUW A;  1FZK A;  5C08 A;  3WL9 A;  2ZOL A;  1QVO A;  4NO3 A;  3ILP A;  4LNR A;  3TBV A;  3TPU E;  3L3I A;  3QFD A;  4O2F A;  4Y4K A;  5IB5 A;  1YDP A;  1C16 A;  3AU1 A;  3VRI A;  3HE7 A;  4PRE A;  2GTW A;  5D7L A;  4JRY A;  3QUX A;  4WJ5 A;  4N0U A;  3BO8 A;  3RWC A;  3MRH A;  3GMR A;  4X6D A;  5C09 A;  3L3D A;  5E6I C;  3FT2 A;  3GIV A;  1KJV A;  3CC5 A;  5EU4 A;  2FIK A;  1FFN A;  3ROO A;  3KPR A;  1QEW A;  1WBY A;  2GAZ A;  3IT8 D;  3E3Q A;  3FT4 A;  1EXU A;  1S7T A;  2FWO A;  4PRB A;  3VXU A;  5C0C A;  4I4W A;  2BSR A;  3FQW A;  3QI9 A;  4JFF A;  4WO4 A;  5BRZ A;  1S9W A;  2X4U A;  2BVQ A;  2H6P A;  4HX1 A;  1ZHK A;  3UTQ A;  4F7E A;  4QRR A;  1T7Y A;  1T7X A;  2C7U A;  3TBS A;  3KWW A;  3L3J A;  3GSV A;  3PWN A;  4F7C A;  3MV9 A;  4PV8 A;  4PRH A;  5C0I A;  5D2N A;  4HUW A;  1XH3 A; 
#chains in the Genus database with same CATH topology
 3MRP A;  3I0T A;  5C0J A;  1N3N A;  1ZT1 A;  1S7U A;  4U1I A;  3QDM A;  1R3H A;  1HHG A;  3TO4 A;  1KJM A;  3RWG A;  1ZSD A;  1I1F A;  2VLR A;  5MER A;  3BVN A;  3MA7 A;  2P5E A;  3MRG A;  3VWK A;  1JPF A;  3DMM A;  1N5A A;  4PJE A;  1DUZ A;  3O4L A;  3MGO A;  5D2L A;  4GUP A;  2X4R A;  3VFT A;  5FA4 A;  4FFE X;  4NNY A;  3P77 A;  5E8P A;  3QUY A;  4GKN A;  2ZSV A;  1JUF A;  4PGB A;  4APQ A;  4CW1 A;  3JVG A;  4L8D A;  4PJ5 A;  2HN7 A;  3HG1 A;  3ARF A;  3KLA A;  1LEG A;  3UPR A;  1Z5L A;  1EEZ A;  1G6R H;  2VLK A;  1S9X A;  2X70 A;  4HUX A;  1T7W A;  5IVX A;  1LK2 A;  1RJY A;  4U1H A;  4GKS A;  5E8O A;  5F1I A;  3PAB A;  3TFK A;  3QZW A;  3GSU A;  3D18 A;  3VFU A;  3CVH A;  4ZUU A;  4U1L A;  3E6H A;  5L2K A;  3MRC A;  3SDX A;  4NNX A;  3RTQ A;  1W0W A;  3S6C A;  4JQX A;  1FO0 H;  3MRB A;  1HHJ A;  3FQN A;  4PGC A;  4E0R A;  5EU6 A;  4MS8 A;  5HGA A;  5F7D A;  3RWE A;  3VFM A;  1INQ A;  3QFJ A;  1A9B A;  2BVO A;  3BEV A;  4Y4F A;  1NEZ A;  1A1M A;  1LP9 A;  3MRL A;  4ZFZ A;  5IRO A;  1CE6 A;  2DYP A;  4WU7 A;  3MRJ A;  4G8I A;  5C0G A;  3TIE A;  3CDG A;  3C8K A;  4ZAK A;  4JQV A;  5BJT A;  4PJD A;  1S7V A;  3TBY A;  3RWJ A;  1MHC A;  4Y16 A;  2CKB H;  2BSS A;  3KPS A;  4PJC A;  3GMN A;  1NAM H;  3LKQ A;  3LKP A;  4NO2 A;  1T20 A;  1RK1 A;  1ZT7 A;  3BH8 A;  4WDI A;  1SYV A;  4MJ6 A;  3QEQ A;  1KBG H;  1IM9 A;  4K7F A;  3MR9 A;  4PGD A;  5ISZ A;  2HJL A;  3V5K A;  4U1K A;  1B0G A;  3I6L D;  3ILQ C;  1JGE A;  1GZQ A;  1S7W A;  4UQ3 A;  4QRU A;  4L3C A;  1Q94 A;  3GJF A;  4L8B A;  1FZO A;  1OSZ A;  5HYJ A;  1BZ9 A;  1JE6 A;  4QRT A;  5DDH A;  2OI9 A;  4WWK C;  1ED3 A;  3VFS A;  1K8D A;  3VFW A;  4JO8 A;  1T1W A;  4NQV A;  4PRA A;  4MNG A;  1AKJ A;  4HS3 A;  4QRP A;  4L8C A;  4G42 A;  1QRN A;  5B38 A;  5D5M A;  3LKS A;  2ZSW A;  1FZM A;  1ZAG A;  3E6F A;  5EUO A;  3C9N A;  4E5X A;  1S7Q A;  3HPJ A;  3ARB A;  3X11 A;  1HSA A;  4N0C A;  4O2C A;  1IM3 A;  5EFI A;  5J6G A;  3RL1 A;  5J1A A;  5MEP A;  4JFD A;  2OL3 H;  3GMQ A;  3TZV C;  2JCC A;  4CVZ A;  3TN0 A;  1VAC A;  3KPO A;  1UXW A;  1I7R A;  2X4O A;  2HJK A;  3FQU A;  1XR9 A;  4ZUW A;  3CPL A;  3FON A;  4NQE A;  1HOC A;  5HGH A;  3VFV A;  1FG2 A;  4Y4H A;  4EN3 C;  3FTG A;  1GZP A;  5F1N A;  3JTS A;  4F7T A;  5IEK A;  2HLA A;  1P7Q A;  3VWJ A;  2AKR A;  1QSE A;  1ZHN A;  3B6S A;  3LKR A;  1S7R A;  3V5D A;  1MWA H;  1QLF A;  2J8U A;  4PR5 A;  5IEH A;  3W39 A;  5C0F A;  3PWU A;  3ERY A;  1S8D A;  4MJ5 A;  5D7I A;  3RUG A;  4Y2D A;  3P73 A;  4BKW A;  2BNR A;  4LCC C;  3ARG A;  4L9L C;  3G08 A;  2NYK A;  1A6Z A;  2GT9 A;  4G59 C;  1ZHL A;  1M6O A;  2A83 A;  4PRD A;  3ECB A;  3HUJ A;  3IXA A;  3P9L A;  3KXF A;  5IB4 A;  2CLV A;  1YN7 A;  4X6F A;  5IB3 A;  3GMM A;  2XFX A;  1A9E A;  3P4M A;  4PP8 C;  1E28 A;  3GSW A;  3SDA A;  5HHQ A;  2MHA A;  2YPL A;  1T22 A;  4MVB A;  2GIT A;  1KJ3 H;  1QO3 A;  4PDC E;  1DDH A;  1WBX A;  1T1X A;  4NHU E;  4NQX A;  5C0D A;  1T1Z A;  1AGC A;  3BZE A;  4F7P A;  4L4V A;  3X12 A;  3SDD A;  5FDW A;  5DEF A;  2E7L E;  2YEZ A;  3O8X A;  4G8G A;  1LD9 A;  3L3G A;  5E8N A;  4XXC A;  1T0M A;  1VAD A;  4U1J A;  4MQ7 A;  1I7U A;  3KPQ A;  3REW A;  4IRJ A;  5GSV A;  5HGD A;  1CD1 A;  5C0A A;  1I7T A;  3TBW A;  1T80 A;  1TVB A;  3GSN H;  4NQD A;  4QOK A;  1HYR C;  1HSB A;  2RFX A;  3MRM A;  4NT6 A;  1JPG A;  2X4T A;  3O3E A;  4D0D A;  3VRJ A;  4PGE A;  4IIQ C;  4U6Y A;  4JFQ A;  1FFP A;  3H9S A;  4L29 A;  1VGK A;  3VXS A;  1DE4 A;  1HHI A;  4ZUS A;  4NO0 A;  1DUY A;  3MRI A;  3QUZ A;  3MRQ A;  2BVP A;  3MRO A;  3PWP A;  4IHO A;  2BNQ A;  4F7M A;  3KPP A;  4PRI A;  5SWS A;  3P9M A;  3VXO A;  3P4O A;  1HHH A;  3CCH A;  1ONQ A;  3BGM A;  3MV8 A;  5AD0 A;  5HHP A;  4V3E B;  4L3E A;  3ROL A;  4HUV A;  5E00 A;  2VLJ A;  3O3D A;  4PJG A;  4WUU A;  3GMP A;  1S9Y A;  1MI5 A;  3GSO A;  1ZS8 A;  3ARE A;  3QUK A;  3H7B A;  2FZ3 A;  2YPK A;  3D25 A;  3LN4 A;  1KJ2 H;  3UBX A;  1T7V A;  4EUP A;  2F54 A;  3ES6 A;  4HV8 A;  5SWQ A;  3VFN A;  4PJ8 A;  2X4S A;  3I6G A;  5DEG A;  2CLZ A;  2UWE A;  1T0N A;  4D0C A;  5J6H A;  4MXQ A;  3L3H A;  2PO6 A;  2GJ6 A;  1QR1 A;  4U1S A;  4X6C A;  5HGB A;  3KPN A;  2AV1 A;  4JRX A;  3VCL A;  2AK4 A;  1TVH A;  2NX5 A;  1KPV A;  3NFN A;  4LCY A;  1EEY A;  5IND A;  3WS6 A;  3U0P A;  2CIK A;  3BZF A;  3I6K A;  3LKN A;  4QRS A;  3DBX A;  3OV6 A;  2P5W A;  2X4P A;  4HUU A;  3FFC A;  4WW2 C;  5C07 A;  1KPU A;  4U1N A;  3H9H A;  3M17 A;  2FO4 A;  4G9F A;  3FQX A;  3TA3 A;  3VFP A;  1ZHB A;  5GSR A;  3MRF A;  5EO0 A;  4K71 B;  1AGE A;  3QUL A;  5E9D A;  5SWZ A;  1BII A;  4PJ9 A;  3KYO A;  3TID A;  3VJ6 A;  4Z78 A;  4LHU A;  3TBT A;  1B0R A;  1FFO A;  1I1Y A;  1QQD A;  2PYE A;  3BP4 A;  5D9S A;  1SYS A;  4FTV A;  4PG2 A;  4U1M A;  1OGT A;  1S7X A;  5EU3 A;  3TJH A;  5IB1 A;  1EFX A;  2AXG A;  3GSQ A;  1LQV A;  4I48 A;  3FQT A;  3KYN A;  2VAA A;  1OGA A;  4CVX A;  3BP7 A;  2F53 A;  3MRR A;  3GML A;  4IRS A;  3JTT A;  4NQC A;  3DX7 A;  3L9R A;  4PRP A;  5D7J C;  5EO1 A;  4Z77 A;  1A1N A;  5C0B A;  5FKP A;  2FYY A;  3B3I A;  1CG9 A;  3PWL A;  1PQZ A;  3DX6 A;  3X14 A;  4N0F A;  4G9D A;  4S0U C;  1JGD A;  3FOM A;  5MEQ A;  3MRN A;  3E2H A;  1T7Z A;  2ZOK A;  5MEO A;  1MHE A;  3BXN A;  4ZUT A;  5B39 A;  3GSX A;  1JF1 A;  2XPG A;  5F9J A;  4WU5 A;  3HCV A;  3M1B A;  1YN6 A;  4LCW A;  5BS0 A;  3MRE A;  3VXP A;  1LDP H;  4JFO A;  4UQ2 A;  4D0B A;  3QDG A;  4MNQ A;  5HHO A;  1FZJ A;  4HWZ A;  4V3D B;  3BUY A;  1AGD A;  2WY3 A;  1K5N A;  4ZUV A;  1W0V A;  3SJV A;  2O5N A;  5JHD A;  3PQY A;  5HHN A;  3SDC A;  1P1Z A;  4L8S C;  3V5H A;  3O9W A;  3AM8 A;  4MJI A;  4PJ7 A;  1AO7 A;  1XR8 A;  3FQR A;  1I1A A;  3MRK A;  3QQ4 A;  3CH1 A;  1UQS A;  3OXS A;  2F74 A;  3BHB A;  1WBZ A;  2H26 A;  3HAE A;  3MGT A;  1T1Y A;  1HHK A;  1UXS A;  1ZVS A;  1JFM A;  2D31 A;  3QQ3 A;  4JFE A;  2CII A;  4NO5 A;  3PWV A;  5INC A;  3RGV C;  3MV7 A;  5ACZ A;  1OF2 A;  2VLL A;  1KTL A;  3O3B A;  2X4Q A;  3UTS A;  1M05 A;  1G7P A;  3BWA A;  4ELM A;  3W0W A;  4PV9 A;  3SPV A;  3HLA A;  2AXF A;  2BST A;  4PJF A;  2IA1 A;  3TF7 A;  3KPL A;  4NSK A;  2VE6 A;  1E27 A;  3OXR A;  3D39 A;  4PJI A;  3RWH A;  3VFR A;  2X4N A;  2BCK A;  1BD2 A;  5EOT A;  1A1O A;  1KCG C;  1I4F A;  5IB2 A;  4L4T A;  4QRQ A;  4G43 A;  3VXN A;  3DTX A;  5C0E A;  3PWJ A;  3LKO A;  3KPM A;  3RWD A;  4N8V A;  4X6E A;  1W72 A;  1LEK A;  2GTZ A;  1RK0 A;  3UTT A;  1XZ0 A;  3WS3 A;  3WLB A;  3L3K A;  5C9J A;  3FOL A;  1NAN H;  1T21 A;  3MRD A;  4G59 A;  4PG9 A;  1RJZ A;  3CZF A;  3TO2 A;  5HHM A;  1JHT A;  3RZC A;  3P4N A;  4EI5 A;  3FRU A;  1QSF A;  3D2U A;  3GMO A;  4ONO A;  1G7Q A;  2V2W A;  1N2R A;  2V2X A;  3HE6 A;  3RL2 A;  3X13 A;  4PJX A;  1X7Q A;  4N5E A;  4JFP A;  3RWF A;  1B3J A;  4U6X A;  1L8J A;  3T8X A;  4PJB A;  2AV7 A;  3VXM A;  1N59 A;  2NW3 A;  3T1F A;  3BW9 A;  1S7S A;  1YPZ A;  1KPR A;  3LN5 A;  3VFO A;  3FT3 A;  4PJA A;  2Q7Y A;  3TVM A;  5L2J A;  3OX8 A;  3MYJ A;  5H94 A;  3RWI A;  5ENW A;  1TMC A;  3JTC A;  3SKM A;  3DX8 A;  3SCM A;  1ZT4 A;  4O2E A;  4MX7 A;  5EU5 A;  3D3V A;  4HKJ A;  4PJH A;  1U58 A;  3VXR A;  5FA3 A;  2ESV A;  1AGF A;  3DXA A;  3GSR A;  4PRN A;  3BH9 A;  4Z76 A;  2GUO A;  5BXF A;  1AGB A;  5MEN A;  3VH8 A;  3ARD A;  2CLR A;  3LV3 A;  1BQH A;  5IM7 A;  3BEW A;  3O3A A;  3SKO A;  3QDJ A;  2VAB A;  1P4L A;  3WUW A;  1FZK A;  5C08 A;  3WL9 A;  2ZOL A;  1QVO A;  4NO3 A;  3ILP A;  4LNR A;  3TBV A;  3TPU E;  3L3I A;  3QFD A;  4O2F A;  4Y4K A;  5IB5 A;  1YDP A;  1C16 A;  3AU1 A;  3VRI A;  3HE7 A;  4PRE A;  2GTW A;  5D7L A;  4JRY A;  3QUX A;  4WJ5 A;  4N0U A;  3BO8 A;  3RWC A;  3MRH A;  3GMR A;  4X6D A;  5C09 A;  3L3D A;  5E6I C;  3FT2 A;  3GIV A;  1KJV A;  3CC5 A;  5EU4 A;  2FIK A;  1FFN A;  3ROO A;  3KPR A;  1QEW A;  1WBY A;  2GAZ A;  3IT8 D;  3E3Q A;  3FT4 A;  1EXU A;  1S7T A;  2FWO A;  4PRB A;  3VXU A;  5C0C A;  4I4W A;  2BSR A;  3FQW A;  3QI9 A;  4JFF A;  4WO4 A;  5BRZ A;  1S9W A;  2X4U A;  2BVQ A;  2H6P A;  4HX1 A;  1ZHK A;  3UTQ A;  4F7E A;  4QRR A;  1T7Y A;  1T7X A;  2C7U A;  3TBS A;  3KWW A;  3L3J A;  3GSV A;  3PWN A;  4F7C A;  3MV9 A;  4PV8 A;  4PRH A;  5C0I A;  5D2N A;  4HUW A;  1XH3 A; 
#chains in the Genus database with same CATH homology
 3MRP A;  5C0J A;  1N3N A;  1ZT1 A;  1S7U A;  4U1I A;  3QDM A;  1R3H A;  1HHG A;  3TO4 A;  1KJM A;  3RWG A;  1ZSD A;  1I1F A;  2VLR A;  5MER A;  3BVN A;  3MA7 A;  2P5E A;  3MRG A;  3VWK A;  1JPF A;  3DMM A;  1N5A A;  4PJE A;  1DUZ A;  3O4L A;  3MGO A;  5D2L A;  4GUP A;  2X4R A;  3VFT A;  5FA4 A;  4FFE X;  4NNY A;  3P77 A;  5E8P A;  3QUY A;  4GKN A;  2ZSV A;  1JUF A;  4PGB A;  4APQ A;  4CW1 A;  3JVG A;  4L8D A;  4PJ5 A;  2HN7 A;  3HG1 A;  3ARF A;  3KLA A;  1LEG A;  3UPR A;  1Z5L A;  1EEZ A;  1G6R H;  2VLK A;  1S9X A;  2X70 A;  4HUX A;  1T7W A;  5IVX A;  1LK2 A;  1RJY A;  4U1H A;  4GKS A;  5E8O A;  5F1I A;  3PAB A;  3TFK A;  3QZW A;  3GSU A;  3D18 A;  3VFU A;  3CVH A;  4ZUU A;  4U1L A;  3E6H A;  5L2K A;  3MRC A;  3SDX A;  4NNX A;  3RTQ A;  1W0W A;  3S6C A;  4JQX A;  1FO0 H;  3MRB A;  1HHJ A;  3FQN A;  4PGC A;  4E0R A;  5EU6 A;  4MS8 A;  5HGA A;  5F7D A;  3RWE A;  3VFM A;  1INQ A;  3QFJ A;  1A9B A;  2BVO A;  3BEV A;  4Y4F A;  1NEZ A;  1A1M A;  1LP9 A;  3MRL A;  4ZFZ A;  5IRO A;  1CE6 A;  2DYP A;  4WU7 A;  3MRJ A;  4G8I A;  5C0G A;  3TIE A;  3CDG A;  3C8K A;  4ZAK A;  4JQV A;  5BJT A;  4PJD A;  1S7V A;  3TBY A;  3RWJ A;  1MHC A;  4Y16 A;  2CKB H;  2BSS A;  3KPS A;  4PJC A;  3GMN A;  1NAM H;  3LKQ A;  3LKP A;  4NO2 A;  1T20 A;  1RK1 A;  1ZT7 A;  3BH8 A;  4WDI A;  1SYV A;  4MJ6 A;  3QEQ A;  1KBG H;  1IM9 A;  4K7F A;  3MR9 A;  4PGD A;  5ISZ A;  2HJL A;  3V5K A;  4U1K A;  1B0G A;  3I6L D;  3ILQ C;  1JGE A;  1GZQ A;  1S7W A;  4UQ3 A;  4QRU A;  4L3C A;  1Q94 A;  3GJF A;  4L8B A;  1FZO A;  1OSZ A;  5HYJ A;  1BZ9 A;  1JE6 A;  4QRT A;  5DDH A;  2OI9 A;  4WWK C;  1ED3 A;  3VFS A;  1K8D A;  3VFW A;  1T1W A;  4NQV A;  4PRA A;  4MNG A;  1AKJ A;  4HS3 A;  4QRP A;  4L8C A;  4G42 A;  1QRN A;  5B38 A;  5D5M A;  3LKS A;  2ZSW A;  1FZM A;  1ZAG A;  3E6F A;  5EUO A;  3C9N A;  4E5X A;  1S7Q A;  3HPJ A;  3ARB A;  3X11 A;  1HSA A;  4N0C A;  4O2C A;  1IM3 A;  5EFI A;  5J6G A;  3RL1 A;  5J1A A;  5MEP A;  4JFD A;  2OL3 H;  3GMQ A;  3TZV C;  2JCC A;  4CVZ A;  3TN0 A;  1VAC A;  3KPO A;  1UXW A;  1I7R A;  2X4O A;  2HJK A;  3FQU A;  1XR9 A;  4ZUW A;  3CPL A;  3FON A;  4NQE A;  1HOC A;  5HGH A;  3VFV A;  1FG2 A;  4Y4H A;  4EN3 C;  3FTG A;  1GZP A;  5F1N A;  3JTS A;  4F7T A;  5IEK A;  2HLA A;  1P7Q A;  3VWJ A;  2AKR A;  1QSE A;  1ZHN A;  3B6S A;  3LKR A;  1S7R A;  3V5D A;  1MWA H;  1QLF A;  2J8U A;  4PR5 A;  5IEH A;  3W39 A;  5C0F A;  3PWU A;  3ERY A;  1S8D A;  4MJ5 A;  5D7I A;  3RUG A;  4Y2D A;  3P73 A;  2BNR A;  4LCC C;  3ARG A;  4L9L C;  3G08 A;  1A6Z A;  2GT9 A;  1ZHL A;  1M6O A;  2A83 A;  4PRD A;  3ECB A;  3HUJ A;  3IXA A;  3P9L A;  3KXF A;  5IB4 A;  2CLV A;  1YN7 A;  4X6F A;  5IB3 A;  3GMM A;  2XFX A;  1A9E A;  3P4M A;  4PP8 C;  1E28 A;  3GSW A;  3SDA A;  5HHQ A;  2MHA A;  2YPL A;  1T22 A;  4MVB A;  2GIT A;  1KJ3 H;  1QO3 A;  4PDC E;  1DDH A;  1WBX A;  1T1X A;  4NHU E;  4NQX A;  5C0D A;  1T1Z A;  1AGC A;  3BZE A;  4F7P A;  4L4V A;  3X12 A;  3SDD A;  5FDW A;  5DEF A;  2E7L E;  2YEZ A;  3O8X A;  4G8G A;  1LD9 A;  3L3G A;  5E8N A;  4XXC A;  1T0M A;  1VAD A;  4U1J A;  4MQ7 A;  1I7U A;  3KPQ A;  3REW A;  4IRJ A;  5GSV A;  5HGD A;  1CD1 A;  5C0A A;  1I7T A;  3TBW A;  1T80 A;  1TVB A;  3GSN H;  4NQD A;  4QOK A;  1HYR C;  1HSB A;  2RFX A;  3MRM A;  4NT6 A;  1JPG A;  2X4T A;  3O3E A;  4D0D A;  3VRJ A;  4PGE A;  4IIQ C;  4U6Y A;  4JFQ A;  1FFP A;  3H9S A;  4L29 A;  1VGK A;  3VXS A;  1DE4 A;  1HHI A;  4ZUS A;  4NO0 A;  1DUY A;  3MRI A;  3QUZ A;  3MRQ A;  2BVP A;  3MRO A;  3PWP A;  4IHO A;  2BNQ A;  4F7M A;  3KPP A;  4PRI A;  5SWS A;  3P9M A;  3VXO A;  3P4O A;  1HHH A;  3CCH A;  1ONQ A;  3BGM A;  3MV8 A;  5AD0 A;  5HHP A;  4V3E B;  4L3E A;  3ROL A;  4HUV A;  5E00 A;  2VLJ A;  3O3D A;  4PJG A;  4WUU A;  3GMP A;  1S9Y A;  1MI5 A;  3GSO A;  1ZS8 A;  3ARE A;  3QUK A;  3H7B A;  2FZ3 A;  2YPK A;  3D25 A;  3LN4 A;  1KJ2 H;  3UBX A;  1T7V A;  4EUP A;  2F54 A;  3ES6 A;  4HV8 A;  5SWQ A;  3VFN A;  4PJ8 A;  2X4S A;  3I6G A;  5DEG A;  2CLZ A;  2UWE A;  1T0N A;  4D0C A;  5J6H A;  4MXQ A;  3L3H A;  2PO6 A;  2GJ6 A;  1QR1 A;  4U1S A;  4X6C A;  5HGB A;  3KPN A;  2AV1 A;  4JRX A;  3VCL A;  2AK4 A;  1TVH A;  2NX5 A;  1KPV A;  3NFN A;  4LCY A;  1EEY A;  5IND A;  3WS6 A;  3U0P A;  2CIK A;  3BZF A;  3I6K A;  3LKN A;  4QRS A;  3DBX A;  3OV6 A;  2P5W A;  2X4P A;  4HUU A;  3FFC A;  4WW2 C;  5C07 A;  1KPU A;  4U1N A;  3H9H A;  3M17 A;  2FO4 A;  4G9F A;  3FQX A;  3TA3 A;  3VFP A;  1ZHB A;  5GSR A;  3MRF A;  5EO0 A;  4K71 B;  1AGE A;  3QUL A;  5E9D A;  5SWZ A;  1BII A;  4PJ9 A;  3KYO A;  3TID A;  3VJ6 A;  4Z78 A;  4LHU A;  3TBT A;  1B0R A;  1FFO A;  1I1Y A;  1QQD A;  2PYE A;  3BP4 A;  5D9S A;  1SYS A;  4FTV A;  4PG2 A;  4U1M A;  1OGT A;  1S7X A;  5EU3 A;  3TJH A;  5IB1 A;  1EFX A;  2AXG A;  3GSQ A;  1LQV A;  4I48 A;  3FQT A;  3KYN A;  2VAA A;  1OGA A;  4CVX A;  3BP7 A;  2F53 A;  3MRR A;  3GML A;  4IRS A;  3JTT A;  4NQC A;  3DX7 A;  3L9R A;  4PRP A;  5D7J C;  5EO1 A;  4Z77 A;  1A1N A;  5C0B A;  5FKP A;  2FYY A;  3B3I A;  1CG9 A;  3PWL A;  1PQZ A;  3DX6 A;  3X14 A;  4N0F A;  4G9D A;  4S0U C;  1JGD A;  3FOM A;  5MEQ A;  3MRN A;  3E2H A;  1T7Z A;  2ZOK A;  5MEO A;  1MHE A;  3BXN A;  4ZUT A;  5B39 A;  3GSX A;  1JF1 A;  2XPG A;  5F9J A;  4WU5 A;  3HCV A;  3M1B A;  1YN6 A;  4LCW A;  5BS0 A;  3MRE A;  3VXP A;  1LDP H;  4JFO A;  4UQ2 A;  4D0B A;  3QDG A;  4MNQ A;  5HHO A;  1FZJ A;  4HWZ A;  4V3D B;  3BUY A;  1AGD A;  2WY3 A;  1K5N A;  4ZUV A;  1W0V A;  3SJV A;  5JHD A;  3PQY A;  5HHN A;  3SDC A;  1P1Z A;  4L8S C;  3V5H A;  3O9W A;  3AM8 A;  4MJI A;  4PJ7 A;  1AO7 A;  1XR8 A;  3FQR A;  1I1A A;  3MRK A;  3QQ4 A;  3CH1 A;  1UQS A;  3OXS A;  2F74 A;  3BHB A;  1WBZ A;  2H26 A;  3HAE A;  3MGT A;  1T1Y A;  1HHK A;  1UXS A;  1ZVS A;  1JFM A;  2D31 A;  3QQ3 A;  4JFE A;  2CII A;  4NO5 A;  3PWV A;  5INC A;  3RGV C;  3MV7 A;  5ACZ A;  1OF2 A;  2VLL A;  1KTL A;  3O3B A;  2X4Q A;  3UTS A;  1M05 A;  1G7P A;  3BWA A;  4ELM A;  3W0W A;  4PV9 A;  3SPV A;  3HLA A;  2AXF A;  2BST A;  4PJF A;  3TF7 A;  3KPL A;  4NSK A;  2VE6 A;  1E27 A;  3OXR A;  3D39 A;  4PJI A;  3RWH A;  3VFR A;  2X4N A;  2BCK A;  1BD2 A;  5EOT A;  1A1O A;  1KCG C;  1I4F A;  5IB2 A;  4L4T A;  4QRQ A;  4G43 A;  3VXN A;  3DTX A;  5C0E A;  3PWJ A;  3LKO A;  3KPM A;  3RWD A;  4N8V A;  4X6E A;  1W72 A;  1LEK A;  2GTZ A;  1RK0 A;  3UTT A;  1XZ0 A;  3WS3 A;  3WLB A;  3L3K A;  5C9J A;  3FOL A;  1NAN H;  1T21 A;  3MRD A;  4G59 A;  4PG9 A;  1RJZ A;  3CZF A;  3TO2 A;  5HHM A;  1JHT A;  3RZC A;  3P4N A;  4EI5 A;  3FRU A;  1QSF A;  3D2U A;  3GMO A;  4ONO A;  1G7Q A;  2V2W A;  1N2R A;  2V2X A;  3HE6 A;  3RL2 A;  3X13 A;  4PJX A;  1X7Q A;  4N5E A;  4JFP A;  3RWF A;  1B3J A;  4U6X A;  1L8J A;  3T8X A;  4PJB A;  2AV7 A;  3VXM A;  1N59 A;  2NW3 A;  3T1F A;  3BW9 A;  1S7S A;  1YPZ A;  1KPR A;  3LN5 A;  3VFO A;  3FT3 A;  4PJA A;  2Q7Y A;  3TVM A;  5L2J A;  3OX8 A;  3MYJ A;  5H94 A;  3RWI A;  5ENW A;  1TMC A;  3JTC A;  3SKM A;  3DX8 A;  3SCM A;  1ZT4 A;  4O2E A;  4MX7 A;  5EU5 A;  3D3V A;  4HKJ A;  4PJH A;  1U58 A;  3VXR A;  5FA3 A;  2ESV A;  1AGF A;  3DXA A;  3GSR A;  4PRN A;  3BH9 A;  4Z76 A;  2GUO A;  5BXF A;  1AGB A;  5MEN A;  3VH8 A;  3ARD A;  2CLR A;  3LV3 A;  1BQH A;  5IM7 A;  3BEW A;  3O3A A;  3SKO A;  3QDJ A;  2VAB A;  1P4L A;  3WUW A;  1FZK A;  5C08 A;  3WL9 A;  2ZOL A;  1QVO A;  4NO3 A;  3ILP A;  4LNR A;  3TBV A;  3TPU E;  3L3I A;  3QFD A;  4O2F A;  4Y4K A;  5IB5 A;  1YDP A;  1C16 A;  3AU1 A;  3VRI A;  3HE7 A;  4PRE A;  2GTW A;  5D7L A;  4JRY A;  3QUX A;  4WJ5 A;  4N0U A;  3BO8 A;  3RWC A;  3MRH A;  3GMR A;  4X6D A;  5C09 A;  3L3D A;  5E6I C;  3FT2 A;  3GIV A;  1KJV A;  3CC5 A;  5EU4 A;  2FIK A;  1FFN A;  3ROO A;  3KPR A;  1QEW A;  1WBY A;  2GAZ A;  3IT8 D;  3E3Q A;  3FT4 A;  1EXU A;  1S7T A;  2FWO A;  4PRB A;  3VXU A;  5C0C A;  4I4W A;  2BSR A;  3FQW A;  3QI9 A;  4JFF A;  4WO4 A;  5BRZ A;  1S9W A;  2X4U A;  2BVQ A;  2H6P A;  4HX1 A;  1ZHK A;  3UTQ A;  4F7E A;  4QRR A;  1T7Y A;  1T7X A;  2C7U A;  3TBS A;  3KWW A;  3L3J A;  3GSV A;  3PWN A;  4F7C A;  3MV9 A;  4PV8 A;  4PRH A;  5C0I A;  5D2N A;  4HUW A;  1XH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...