4V3DB

The cidra domain from hb3var03 pfemp1 bound to endothelial protein c receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
169
structure length
169
Chain Sequence
QRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HB3VAR03 CIDRA DOMAIN
publication title Structural Conservation Despite Huge Sequence Diversity Allows Epcr Binding by the Pfemp1 Family Implicated in Severe Childhood Malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Signaling protein
total genus 51
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4v3dB00
3U0PA 3VXRA 5MERA 3ARGA 3P4NA 4MQ7A 4N0FA 3VFWA 3VXOA 1BD2A 1SYVA 5B39A 3OV6A 4QRQA 3X14A 4LCWA 3VXMA 1FFNA 3CCHA 4PJIA 1FFPA 5HHNA 4G8IA 2VE6A 3M1BA 3MRQA 4WU5A 2CLVA 3HAEA 5D7IA 5DDHA 5GSRA 1S7XA 1I7RA 3MRDA 1T7YA 1FZKA 2YPLA 3QQ3A 1XZ0A 4XXCA 4U6YA 1QO3A 2BSTA 2FYYA 3TBVA 2VLLA 1ZHBA 3T1FA 4E0RA 1KBGH 5EO1A 2VLRA 4K71B 4MXQA 3PWPA 4HUVA 1ZT7A 1I1AA 1XR8A 3S6CA 1JGEA 2X70A 3O3BA 4PG2A 5D9SA 1XH3A 3NFNA 3WS3A 3P9MA 1OSZA 4JFPA 1S7QA 4JFQA 4F7TA 5ISZA 1G7PA 2AV7A 3MA7A 3H7BA 2CIKA 4HS3A 4ZUTA 1K8DA 4NHUE 4WJ5A 5MEQA 3H9HA 3E6HA 2XFXA 1YPZA 2UWEA 5EU6A 5FA4A 1EEYA 3TVMA 3HE6A 2FIKA 4X6DA 5MENA 5EFIA 1KCGC 1OGTA 2CLRA 1MHCA 3PWVA 4PJEA 4Y16A 4PRBA 4NT6A 1S7VA 3DX8A 3GMQA 2P5WA 3KWWA 3SDCA 3MV8A 4QOKA 5C07A 3UTSA 1INQA 1AGBA 3FT4A 4CVZA 1EFXA 4L8CA 1GZPA 1CD1A 4Y2DA 5HHPA 3FFCA 4PJDA 3GSVA 3E6FA 5B38A 3WS6A 5BS0A 3VRIA 1S7RA 3O8XA 1KPRA 2ZSVA 2ZSWA 3B6SA 3MRCA 1KTLA 1T0MA 2HJKA 4NO5A 3SKOA 3O3EA 1IM9A 1W0WA 1EXUA 3BH8A 3BHBA 1HSAA 2VLKA 4MNQA 1ZS8A 2D31A 3RWFA 3E2HA 3OXRA 3TBWA 5C9JA 3GMOA 4F7CA 4WW2C 3BZFA 4N8VA 3MRBA 4I4WA 4EUPA 1I4FA 3SDAA 4U1LA 1ZT4A 3MGTA 4WDIA 5D7LA 3VCLA 3VRJA 1LEGA 1BZ9A 4IRSA 4NO2A 4Y4HA 4LCCC 3PWUA 4L9LC 3DMMA 5D2LA 3LKRA 2YEZA 4L8DA 3UPRA 1B0RA 4MJIA 1T7XA 3HG1A 2Q7YA 3TIDA 4X6EA 3KPLA 3BW9A 4QRTA 3ROOA 1JPGA 1JPFA 3P4OA 3VFUA 5C0EA 1LDPH 5EOTA 1A6ZA 2C7UA 3CC5A 1N5AA 5INDA 2X4UA 5E00A 1JFMA 3ECBA 5HGHA 3PQYA 1T7VA 2ESVA 4FFEX 5DEGA 3GSXA 3VXSA 3KPNA 2X4PA 3BWAA 4MNGA 3CPLA 5IVXA 3ILPA 1CE6A 1W72A 1W0VA 4E5XA 1AGFA 1B3JA 1E28A 3L3IA 1JHTA 3VXPA 4PRAA 3TFKA 1S9XA 2X4RA 4PJ5A 3WL9A 3V5KA 3MRIA 2GJ6A 5BXFA 4ZAKA 3QUKA 2PO6A 4JRYA 3TO4A 1T0NA 3LKPA 1FFOA 3SCMA 3MYJA 1VACA 1T20A 5IB3A 3KPMA 4D0CA 5C09A 3O4LA 3SDDA 5C0BA 1A9EA 2YPKA 2HN7A 4NO0A 5D7JC 4QRSA 4HUWA 4JQXA 2GTZA 2XPGA 3SJVA 3QULA 4PREA 1HSBA 4L4VA 5IM7A 3KPQA 1S7TA 3RWGA 3P77A 5EO0A 3QZWA 3GMNA 3BEVA 5GSVA 3D18A 3FT3A 1KJ2H 3D3VA 4O2CA 1KJ3H 3TF7A 1Q94A 3RTQA 4PJXA 4PGDA 3AM8A 3KPOA 4PJHA 3REWA 2ZOKA 1ONQA 1Z5LA 1JUFA 4G42A 2BNRA 5E8PA 3TBSA 3VWKA 5MEOA 4CW1A 4U1HA 3JTTA 1ZVSA 2VAAA 1OF2A 3KLAA 3G08A 3LN4A 3PWJA 4LCYA 1S9YA 4GKNA 1BIIA 1A1OA 1WBYA 2VLJA 4L3CA 5IB1A 2RFXA 4MX7A 1I7TA 1S8DA 2MHAA 4U1IA 4PR5A 2CKBH 3GSOA 3MV7A 3VJ6A 3HE7A 5E8NA 4GKSA 3GSNH 3RGVC 3VFMA 1TVHA 3QDJA 4V3EB 2X4OA 4PJ9A 3BUYA 2CIIA 5C0AA 1LP9A 3LKNA 3RWJA 1I1FA 1QSEA 3DXAA 5C0JA 4WUUA 3MRMA 4O2FA 3TIEA 4WWKC 1UXWA 5J6GA 4MJ5A 1LEKA 3ARFA 3QI9A 1CG9A 3H9SA 3FTGA 3VXNA 3WUWA 1M05A 2VABA 3UTQA 4MS8A 2AKRA 2A83A 3TN0A 5C0IA 3KXFA 2V2XA 2V2WA 1JE6A 3QEQA 3DX6A 1NAMH 2BVQA 2X4QA 1EEZA 3FQTA 4WU7A 2BSSA 1T1YA 1YN7A 2PYEA 3IT8D 3KYOA 3MRPA 4PV9A 3W39A 3BZEA 3RL2A 3C8KA 4F7EA 4NO3A 4PJAA 4PRDA 4IRJA 4NQDA 1T22A 5JHDA 3BP4A 4JQVA 3BEWA 4JFDA 1L8JA 3BH9A 1IM3A 1LK2A 1YN6A 3QQ4A 3VWJA 4IHOA 5IB2A 1UQSA 1TMCA 3I6KA 1I1YA 1T80A 1ZT1A 3MREA 5EU4A 3C9NA 1AGCA 5F1NA 1ZHLA 3KPRA 1A1MA 3RWHA 1X7QA 4ZFZA 4U1JA 3VFTA 3LV3A 2WY3A 4MJ6A 3SDXA 4HKJA 4ONOA 1G7QA 1KJMA 3RWDA 1T1XA 3I6LD 1K5NA 3FT2A 3MRKA 3P73A 3GSUA 3VFRA 3FQUA 3V5HA 2X4NA 3W0WA 4PRIA 1E27A 4Y4FA 2JCCA 1ED3A 4LHUA 4NQCA 4HWZA 5ENWA 4JFOA 3GMMA 2FWOA 2GAZA 3X11A 1ZSDA 3GSWA 1NEZA 3ROLA 3VH8A 3ILQC 1MWAH 1HHIA 4O2EA 4PGCA 4X6FA 4PV8A 3TA3A 3T8XA 1GZQA 3KPPA 1N2RA 3X12A 2DYPA 3QFJA 1AO7A 5F7DA 3O3DA 3FOMA 3GSRA 1N3NA 5E9DA 3BXNA 3CDGA 4PJFA 3RUGA 3MRJA 2OI9A 4NQEA 3WLBA 1XR9A 3JVGA 2OL3H 3ARBA 4NNYA 2NX5A 2BCKA 5J1AA 4D0DA 2X4SA 3KPSA 3OX8A 3BVNA 1FZMA 4PP8C 3BGMA 1QR1A 4NQXA 5FA3A 5IB4A 3JTSA 3D39A 4MVBA 5AD0A 5IEHA 1R3HA 3FQXA 4CVXA 3CH1A 3TJHA 3MV9A 2HJLA 1RK0A 1T7ZA 1QSFA 4JFEA 3OXSA 4ZUWA 4PGEA 4QRUA 3CZFA 3TBTA 1WBXA 2X4TA 1UXSA 1S7WA 1KPVA 1T1ZA 4HUXA 1PQZA 5DEFA 1A9BA 5J6HA 3BO8A 4G43A 2F54A 1KJVA 1OGAA 5C0DA 2J8UA 3MRHA 4U1MA 1N59A 2AV1A 1T21A 3O9WA 1LD9A 1QRNA 3PABA 1RJYA 1NANH 3DX7A 4PGBA 3FRUA 4WO4A 3RWIA 3FQNA 5HGDA 4PRHA 3VFVA 2E7LE 3E3QA 3MRNA 1HYRC 1QVOA 3GMLA 3UBXA 4S0UC 3HPJA 3FQWA 3M17A 5SWZA 3RWCA 1FG2A 1FO0H 1ZAGA 4N5EA 2ZOLA 4L8BA 1JGDA 1P4LA 3MROA 1C16A 4PRPA 4PDCE 4G9DA 4PJ8A 2GTWA 5BJTA 1S7SA 3IXAA 1S7UA 3LN5A 3L9RA 4L8SC 4U1NA 3I6GA 4L4TA 1DUYA 1DE4A 3MR9A 3QUYA 1YDPA 4PJCA 3MRLA 3HUJA 4I48A 3BP7A 2H6PA 1AGEA 4Z77A 5C0GA 1HOCA 3L3GA 1JF1A 5EUOA 3GIVA 3VFSA 5C0FA 5IEKA 1RJZA 2FZ3A 1MI5A 4Z76A 4PG9A 1HHJA 1G6RH 4F7MA 5IB5A 5BRZA 3GMPA 1DDHA 4JFFA 3GMRA 3X13A 3TO2A 5C0CA 4U1KA 4JRXA 1KPUA 5F1IA 5HHMA 4ZUUA 3RWEA 3KYNA 3PWLA 3ERYA 2AXGA 1A1NA 3SKMA 3LKOA 3D25A 4HV8A 2F53A 4ZUVA 3P9LA 3UTTA 4ZUSA 1M6OA 3VFNA 3QFDA 3MRRA 4Y4KA 4FTVA 4NSKA 4HUUA 4PRNA 5FKPA 2GITA 3TPUE 3DBXA 5MEPA 3ARDA 3AREA 4UQ2A 2AXFA 3L3JA 3VFPA 5EU5A 2F74A 3QUXA 5F9JA 4U6XA 1VADA 3QDMA 3P4MA 1TVBA 2NW3A 2FO4A 5IROA 1QLFA 1T7WA 4PJ7A 4UQ3A 4EN3C 2AK4A 5L2KA 4K7FA 5FDWA 2P5EA 4V3DB 1BQHA 1HHKA 4QRRA 1FZJA 2GT9A 2BVPA 2BSRA 3QDGA 3TBYA 1AGDA 3LKSA 3FONA 3RZCA 1HHHA 4HX1A 4NQVA 3L3KA 3L3DA 4GUPA 4EI5A 1ZHNA 3JTCA 3B3IA 3LKQA 3MRFA 4NNXA 3VFOA 4ELMA 2GUOA 3HCVA 4Z78A 1DUZA 3GJFA 4LNRA 1B0GA 4PJGA 1S9WA 4U1SA 1MHEA 1QEWA 4PJBA 1WBZA 2CLZA 1P1ZA 3TZVC 3MRGA 3FQRA 5HYJA 4L29A 4F7PA 1AKJA 4QRPA 5D2NA 3DTXA 4G8GA 1HHGA 5D5MA 3ES6A 3L3HA 1RK1A 3QUZA 4APQA 4N0CA 4L3EA 5INCA 1T1WA 4G59A 5C08A 2BNQA 5H94A 5L2JA 5SWSA 1FZOA 1VGKA 4N0UA 1QQDA 4X6CA 5HGBA 5ACZA 3O3AA 2H26A 5E8OA 5SWQA 3MGOA 3AU1A 4IIQC 5EU3A 5E6IC 3PWNA 3GSQA 3HLAA 3CVHA 3VXUA 4D0BA 1LQVA 1U58A 4G9FA 1ZHKA 3RL1A 1P7QA 3FOLA 1SYSA 5HHOA 5HHQA 2HLAA 1I7UA 2BVOA 3SPVA 3V5DA 3D2UA 5HGAA
chains in the Genus database with same CATH superfamily
3U0PA 3VXRA 5MERA 3ARGA 3P4NA 4MQ7A 4N0FA 3VFWA 3VXOA 1BD2A 1SYVA 5B39A 3OV6A 4QRQA 3X14A 4LCWA 3VXMA 1FFNA 3CCHA 4PJIA 1FFPA 5HHNA 4G8IA 2VE6A 3M1BA 3MRQA 4WU5A 2CLVA 3HAEA 5D7IA 5DDHA 5GSRA 1S7XA 1I7RA 2IA1A 3MRDA 1T7YA 1FZKA 2YPLA 3QQ3A 1XZ0A 4XXCA 4U6YA 1QO3A 2BSTA 2FYYA 3TBVA 2VLLA 1ZHBA 3T1FA 4E0RA 1KBGH 5EO1A 2VLRA 4K71B 4MXQA 3PWPA 4HUVA 1ZT7A 1I1AA 1XR8A 3S6CA 1JGEA 2X70A 3O3BA 4PG2A 5D9SA 1XH3A 3NFNA 3WS3A 3P9MA 1OSZA 4JFPA 1S7QA 4JFQA 4F7TA 5ISZA 1G7PA 2AV7A 3MA7A 3H7BA 2CIKA 4HS3A 4ZUTA 1K8DA 4NHUE 4WJ5A 5MEQA 3H9HA 3E6HA 2XFXA 1YPZA 2UWEA 5EU6A 5FA4A 1EEYA 3TVMA 3HE6A 2FIKA 4X6DA 5MENA 5EFIA 1KCGC 1OGTA 2CLRA 1MHCA 3PWVA 4PJEA 4Y16A 4PRBA 4NT6A 1S7VA 3DX8A 3GMQA 2P5WA 3KWWA 3SDCA 3MV8A 4QOKA 5C07A 3UTSA 1INQA 1AGBA 3FT4A 4CVZA 1EFXA 4L8CA 1GZPA 1CD1A 4Y2DA 5HHPA 3FFCA 4PJDA 3GSVA 3E6FA 5B38A 3WS6A 5BS0A 3VRIA 1S7RA 3O8XA 1KPRA 2ZSVA 2ZSWA 3B6SA 3MRCA 1KTLA 1T0MA 2HJKA 4NO5A 3SKOA 3O3EA 1IM9A 1W0WA 1EXUA 3BH8A 3BHBA 1HSAA 2VLKA 4MNQA 1ZS8A 2D31A 3RWFA 3E2HA 3OXRA 3TBWA 5C9JA 3GMOA 4F7CA 4WW2C 3BZFA 4N8VA 3MRBA 4I4WA 4EUPA 1I4FA 3SDAA 4U1LA 1ZT4A 3MGTA 4WDIA 5D7LA 3VCLA 3VRJA 1LEGA 1BZ9A 4IRSA 4NO2A 4Y4HA 4LCCC 3PWUA 4L9LC 3DMMA 5D2LA 3LKRA 2YEZA 4L8DA 3UPRA 1B0RA 4MJIA 1T7XA 3HG1A 2Q7YA 3TIDA 4X6EA 3KPLA 3BW9A 4QRTA 3ROOA 1JPGA 1JPFA 3P4OA 3VFUA 5C0EA 1LDPH 5EOTA 1A6ZA 2C7UA 3CC5A 1N5AA 5INDA 2X4UA 5E00A 1JFMA 3ECBA 5HGHA 3PQYA 1T7VA 2ESVA 4FFEX 5DEGA 3GSXA 3VXSA 3KPNA 2X4PA 3BWAA 4MNGA 3CPLA 5IVXA 3ILPA 1CE6A 1W72A 1W0VA 4E5XA 1AGFA 1B3JA 1E28A 3L3IA 1JHTA 3VXPA 4PRAA 3TFKA 1S9XA 2X4RA 4PJ5A 3WL9A 3V5KA 3MRIA 2GJ6A 5BXFA 4ZAKA 3QUKA 2PO6A 4JRYA 3TO4A 1T0NA 3LKPA 1FFOA 3SCMA 3MYJA 1VACA 1T20A 5IB3A 3KPMA 4D0CA 5C09A 3O4LA 3SDDA 5C0BA 1A9EA 2YPKA 2HN7A 4NO0A 5D7JC 4QRSA 4HUWA 4JQXA 2GTZA 2XPGA 3SJVA 3QULA 4PREA 1HSBA 4L4VA 5IM7A 3KPQA 1S7TA 2O5NA 3P77A 4G59C 5EO0A 3RWGA 3QZWA 3GMNA 3BEVA 5GSVA 3D18A 3FT3A 1KJ2H 3D3VA 4O2CA 1KJ3H 3TF7A 1Q94A 3RTQA 4PJXA 4PGDA 3AM8A 3KPOA 4PJHA 3REWA 2ZOKA 1ONQA 1Z5LA 1JUFA 4G42A 2BNRA 5E8PA 3TBSA 3VWKA 5MEOA 4CW1A 4U1HA 3JTTA 1ZVSA 2VAAA 1OF2A 3KLAA 3G08A 3LN4A 3PWJA 4LCYA 1S9YA 4GKNA 1BIIA 1A1OA 1WBYA 2VLJA 4L3CA 5IB1A 2RFXA 4MX7A 1I7TA 1S8DA 2MHAA 4U1IA 4PR5A 2CKBH 3GSOA 3MV7A 3VJ6A 3HE7A 5E8NA 4GKSA 3GSNH 3RGVC 3VFMA 1TVHA 3QDJA 4V3EB 2X4OA 4PJ9A 3BUYA 2CIIA 5C0AA 1LP9A 3LKNA 3RWJA 1I1FA 1QSEA 3DXAA 5C0JA 4WUUA 3MRMA 4O2FA 3TIEA 4WWKC 1UXWA 5J6GA 4MJ5A 1LEKA 3ARFA 3QI9A 1CG9A 3H9SA 3FTGA 3VXNA 3WUWA 1M05A 2VABA 3UTQA 4MS8A 2AKRA 2A83A 3TN0A 5C0IA 3KXFA 2V2XA 2V2WA 1JE6A 3QEQA 3DX6A 1NAMH 2BVQA 2X4QA 1EEZA 3FQTA 4WU7A 2BSSA 1T1YA 1YN7A 2PYEA 3IT8D 3KYOA 3MRPA 4PV9A 3W39A 3BZEA 3RL2A 3C8KA 4F7EA 4NO3A 4PJAA 4PRDA 4IRJA 4NQDA 1T22A 5JHDA 3BP4A 4JQVA 3BEWA 4JFDA 1L8JA 3BH9A 1IM3A 1LK2A 1YN6A 3QQ4A 3VWJA 4IHOA 5IB2A 1UQSA 1TMCA 3I0TA 3I6KA 1I1YA 1T80A 1ZT1A 3MREA 5EU4A 3C9NA 1AGCA 5F1NA 1ZHLA 3KPRA 1A1MA 3RWHA 1X7QA 4ZFZA 4U1JA 3VFTA 3LV3A 2WY3A 4MJ6A 3SDXA 4HKJA 4ONOA 1G7QA 1KJMA 3RWDA 1T1XA 3I6LD 1K5NA 3FT2A 3MRKA 3P73A 3GSUA 3VFRA 3FQUA 3V5HA 2X4NA 3W0WA 4PRIA 1E27A 4Y4FA 2JCCA 1ED3A 4LHUA 4NQCA 4HWZA 5ENWA 4JFOA 3GMMA 2FWOA 2GAZA 3X11A 4JO8A 1ZSDA 3GSWA 1NEZA 3ROLA 3VH8A 3ILQC 1MWAH 1HHIA 4O2EA 4PGCA 4X6FA 4PV8A 3TA3A 3T8XA 1GZQA 3KPPA 1N2RA 3X12A 2DYPA 3QFJA 1AO7A 5F7DA 3O3DA 3FOMA 3GSRA 1N3NA 5E9DA 3BXNA 3CDGA 4PJFA 3RUGA 3MRJA 2OI9A 4NQEA 3WLBA 1XR9A 3JVGA 2OL3H 3ARBA 4NNYA 2NX5A 2BCKA 5J1AA 4D0DA 2X4SA 3KPSA 3OX8A 3BVNA 1FZMA 4PP8C 3BGMA 1QR1A 4NQXA 5FA3A 5IB4A 3JTSA 3D39A 4MVBA 5AD0A 5IEHA 1R3HA 3FQXA 4CVXA 3CH1A 3TJHA 3MV9A 2NYKA 2HJLA 1RK0A 1T7ZA 1QSFA 4JFEA 3OXSA 4ZUWA 4PGEA 4QRUA 3CZFA 3TBTA 1WBXA 2X4TA 1UXSA 1S7WA 1KPVA 1T1ZA 4HUXA 1PQZA 5DEFA 1A9BA 5J6HA 3BO8A 4G43A 2F54A 1KJVA 1OGAA 5C0DA 2J8UA 3MRHA 4U1MA 1N59A 2AV1A 1T21A 3O9WA 1LD9A 1QRNA 3PABA 1RJYA 1NANH 3DX7A 4PGBA 3FRUA 4WO4A 3RWIA 3FQNA 5HGDA 4PRHA 3VFVA 2E7LE 3E3QA 3MRNA 1HYRC 1QVOA 3GMLA 3UBXA 4S0UC 3HPJA 3FQWA 3M17A 5SWZA 3RWCA 1FG2A 1FO0H 1ZAGA 4N5EA 2ZOLA 4L8BA 1JGDA 1P4LA 3MROA 1C16A 4PRPA 4PDCE 4G9DA 4PJ8A 2GTWA 5BJTA 1S7SA 3IXAA 1S7UA 3LN5A 3L9RA 4L8SC 4U1NA 3I6GA 4L4TA 1DUYA 1DE4A 3MR9A 3QUYA 1YDPA 4PJCA 3MRLA 3HUJA 4I48A 3BP7A 2H6PA 1AGEA 4Z77A 5C0GA 1HOCA 3L3GA 1JF1A 5EUOA 3GIVA 3VFSA 5C0FA 5IEKA 1RJZA 2FZ3A 1MI5A 4Z76A 4PG9A 1HHJA 1G6RH 4F7MA 5IB5A 5BRZA 3GMPA 1DDHA 4JFFA 3GMRA 3X13A 3TO2A 5C0CA 4U1KA 4JRXA 1KPUA 5F1IA 5HHMA 4ZUUA 3RWEA 3KYNA 3PWLA 3ERYA 2AXGA 1A1NA 3SKMA 3LKOA 3D25A 4HV8A 2F53A 4ZUVA 3P9LA 3UTTA 4ZUSA 1M6OA 3VFNA 3QFDA 3MRRA 4Y4KA 4FTVA 4NSKA 4HUUA 4PRNA 5FKPA 2GITA 3TPUE 3DBXA 5MEPA 3ARDA 3AREA 4UQ2A 2AXFA 3L3JA 3VFPA 5EU5A 2F74A 3QUXA 5F9JA 4U6XA 1VADA 3QDMA 3P4MA 1TVBA 2NW3A 2FO4A 5IROA 1QLFA 1T7WA 4PJ7A 4UQ3A 4EN3C 2AK4A 5L2KA 4K7FA 5FDWA 2P5EA 4V3DB 1BQHA 1HHKA 4QRRA 1FZJA 2GT9A 2BVPA 2BSRA 3QDGA 3TBYA 1AGDA 3LKSA 3FONA 3RZCA 1HHHA 4HX1A 4NQVA 3L3KA 3L3DA 4GUPA 4EI5A 1ZHNA 3JTCA 3B3IA 3LKQA 3MRFA 4NNXA 3VFOA 4ELMA 2GUOA 3HCVA 4Z78A 1DUZA 3GJFA 4LNRA 1B0GA 4PJGA 1S9WA 4U1SA 1MHEA 1QEWA 4PJBA 1WBZA 2CLZA 1P1ZA 3TZVC 3MRGA 3FQRA 5HYJA 4L29A 4F7PA 1AKJA 4QRPA 5D2NA 3DTXA 4G8GA 1HHGA 5D5MA 3ES6A 3L3HA 1RK1A 3QUZA 4APQA 4N0CA 4L3EA 5INCA 1T1WA 4G59A 5C08A 2BNQA 5H94A 5L2JA 5SWSA 1FZOA 1VGKA 4N0UA 1QQDA 4X6CA 5HGBA 5ACZA 3O3AA 2H26A 5E8OA 5SWQA 3MGOA 3AU1A 4IIQC 5EU3A 5E6IC 3PWNA 3GSQA 4BKWA 3HLAA 3CVHA 3VXUA 4D0BA 1LQVA 1U58A 4G9FA 1ZHKA 3RL1A 1P7QA 3FOLA 1SYSA 5HHOA 5HHQA 2HLAA 1I7UA 2BVOA 3SPVA 3V5DA 3D2UA 5HGAA
chains in the Genus database with same CATH topology
3U0PA 3VXRA 5MERA 3ARGA 3P4NA 4MQ7A 4N0FA 3VFWA 3VXOA 1BD2A 1SYVA 5B39A 3OV6A 4QRQA 3X14A 4LCWA 3VXMA 1FFNA 3CCHA 4PJIA 1FFPA 5HHNA 4G8IA 2VE6A 3M1BA 3MRQA 4WU5A 2CLVA 3HAEA 5D7IA 5DDHA 5GSRA 1S7XA 1I7RA 3MRDA 1T7YA 1FZKA 2YPLA 3QQ3A 1XZ0A 4XXCA 4U6YA 1QO3A 2BSTA 2FYYA 3TBVA 2VLLA 1ZHBA 3T1FA 4E0RA 1KBGH 5EO1A 2VLRA 4K71B 4MXQA 3PWPA 4HUVA 1ZT7A 1I1AA 1XR8A 3S6CA 1JGEA 2X70A 3O3BA 4PG2A 5D9SA 1XH3A 3NFNA 3WS3A 3P9MA 1OSZA 4JFPA 1S7QA 4JFQA 4F7TA 5ISZA 1G7PA 2AV7A 3MA7A 3H7BA 2CIKA 4HS3A 4ZUTA 1K8DA 4NHUE 4WJ5A 5MEQA 3H9HA 3E6HA 2XFXA 1YPZA 2UWEA 5EU6A 5FA4A 1EEYA 3TVMA 3HE6A 2FIKA 4X6DA 5MENA 5EFIA 1KCGC 1OGTA 2CLRA 1MHCA 3PWVA 4PJEA 4Y16A 4PRBA 4NT6A 1S7VA 3DX8A 3GMQA 2P5WA 3KWWA 3SDCA 3MV8A 4QOKA 5C07A 3UTSA 1INQA 1AGBA 3FT4A 4CVZA 1EFXA 4L8CA 1GZPA 1CD1A 4Y2DA 5HHPA 3FFCA 4PJDA 3GSVA 3E6FA 5B38A 3WS6A 5BS0A 3VRIA 1S7RA 3O8XA 1KPRA 2ZSVA 2ZSWA 3B6SA 3MRCA 1KTLA 1T0MA 2HJKA 4NO5A 3SKOA 3O3EA 1IM9A 1W0WA 1EXUA 3BH8A 3BHBA 1HSAA 2VLKA 4MNQA 1ZS8A 2D31A 3RWFA 3E2HA 3OXRA 3TBWA 5C9JA 3GMOA 4F7CA 4WW2C 3BZFA 4N8VA 3MRBA 4I4WA 4EUPA 1I4FA 3SDAA 4U1LA 1ZT4A 3MGTA 4WDIA 5D7LA 3VCLA 3VRJA 1LEGA 1BZ9A 4IRSA 4NO2A 4Y4HA 4LCCC 3PWUA 4L9LC 3DMMA 5D2LA 3LKRA 2YEZA 4L8DA 3UPRA 1B0RA 4MJIA 1T7XA 3HG1A 2Q7YA 3TIDA 4X6EA 3KPLA 3BW9A 4QRTA 3ROOA 1JPGA 1JPFA 3P4OA 3VFUA 5C0EA 1LDPH 5EOTA 1A6ZA 2C7UA 3CC5A 1N5AA 5INDA 2X4UA 5E00A 1JFMA 3ECBA 5HGHA 3PQYA 1T7VA 2ESVA 4FFEX 5DEGA 3GSXA 3VXSA 3KPNA 2X4PA 3BWAA 4MNGA 3CPLA 5IVXA 3ILPA 1CE6A 1W72A 1W0VA 4E5XA 1AGFA 1B3JA 1E28A 3L3IA 1JHTA 3VXPA 4PRAA 3TFKA 1S9XA 2X4RA 4PJ5A 3WL9A 3V5KA 3MRIA 2GJ6A 5BXFA 4ZAKA 3QUKA 2PO6A 4JRYA 3TO4A 1T0NA 3LKPA 1FFOA 3SCMA 3MYJA 1VACA 1T20A 5IB3A 3KPMA 4D0CA 5C09A 3O4LA 3SDDA 5C0BA 1A9EA 2YPKA 2HN7A 4NO0A 5D7JC 4QRSA 4HUWA 4JQXA 2GTZA 2XPGA 3SJVA 3QULA 4PREA 1HSBA 4L4VA 5IM7A 3KPQA 1S7TA 3RWGA 3P77A 5EO0A 3QZWA 3GMNA 3BEVA 5GSVA 3D18A 3FT3A 1KJ2H 3D3VA 4O2CA 1KJ3H 3TF7A 1Q94A 3RTQA 4PJXA 4PGDA 3AM8A 3KPOA 4PJHA 3REWA 2ZOKA 1ONQA 1Z5LA 1JUFA 4G42A 2BNRA 5E8PA 3TBSA 3VWKA 5MEOA 4CW1A 4U1HA 3JTTA 1ZVSA 2VAAA 1OF2A 3KLAA 3G08A 3LN4A 3PWJA 4LCYA 1S9YA 4GKNA 1BIIA 1A1OA 1WBYA 2VLJA 4L3CA 5IB1A 2RFXA 4MX7A 1I7TA 1S8DA 2MHAA 4U1IA 4PR5A 2CKBH 3GSOA 3MV7A 3VJ6A 3HE7A 5E8NA 4GKSA 3GSNH 3RGVC 3VFMA 1TVHA 3QDJA 4V3EB 2X4OA 4PJ9A 3BUYA 2CIIA 5C0AA 1LP9A 3LKNA 3RWJA 1I1FA 1QSEA 3DXAA 5C0JA 4WUUA 3MRMA 4O2FA 3TIEA 4WWKC 1UXWA 5J6GA 4MJ5A 1LEKA 3ARFA 3QI9A 1CG9A 3H9SA 3FTGA 3VXNA 3WUWA 1M05A 2VABA 3UTQA 4MS8A 2AKRA 2A83A 3TN0A 5C0IA 3KXFA 2V2XA 2V2WA 1JE6A 3QEQA 3DX6A 1NAMH 2BVQA 2X4QA 1EEZA 3FQTA 4WU7A 2BSSA 1T1YA 1YN7A 2PYEA 3IT8D 3KYOA 3MRPA 4PV9A 3W39A 3BZEA 3RL2A 3C8KA 4F7EA 4NO3A 4PJAA 4PRDA 4IRJA 4NQDA 1T22A 5JHDA 3BP4A 4JQVA 3BEWA 4JFDA 1L8JA 3BH9A 1IM3A 1LK2A 1YN6A 3QQ4A 3VWJA 4IHOA 5IB2A 1UQSA 1TMCA 3I6KA 1I1YA 1T80A 1ZT1A 3MREA 5EU4A 3C9NA 1AGCA 5F1NA 1ZHLA 3KPRA 1A1MA 3RWHA 1X7QA 4ZFZA 4U1JA 3VFTA 3LV3A 2WY3A 4MJ6A 3SDXA 4HKJA 4ONOA 1G7QA 1KJMA 3RWDA 1T1XA 3I6LD 1K5NA 3FT2A 3MRKA 3P73A 3GSUA 3VFRA 3FQUA 3V5HA 2X4NA 3W0WA 4PRIA 1E27A 4Y4FA 2JCCA 1ED3A 4LHUA 4NQCA 4HWZA 5ENWA 4JFOA 3GMMA 2FWOA 2GAZA 3X11A 1ZSDA 3GSWA 1NEZA 3ROLA 3VH8A 3ILQC 1MWAH 1HHIA 4O2EA 4PGCA 4X6FA 4PV8A 3TA3A 3T8XA 1GZQA 3KPPA 1N2RA 3X12A 2DYPA 3QFJA 1AO7A 5F7DA 3O3DA 3FOMA 3GSRA 1N3NA 5E9DA 3BXNA 3CDGA 4PJFA 3RUGA 3MRJA 2OI9A 4NQEA 3WLBA 1XR9A 3JVGA 2OL3H 3ARBA 4NNYA 2NX5A 2BCKA 5J1AA 4D0DA 2X4SA 3KPSA 3OX8A 3BVNA 1FZMA 4PP8C 3BGMA 1QR1A 4NQXA 5FA3A 5IB4A 3JTSA 3D39A 4MVBA 5AD0A 5IEHA 1R3HA 3FQXA 4CVXA 3CH1A 3TJHA 3MV9A 2HJLA 1RK0A 1T7ZA 1QSFA 4JFEA 3OXSA 4ZUWA 4PGEA 4QRUA 3CZFA 3TBTA 1WBXA 2X4TA 1UXSA 1S7WA 1KPVA 1T1ZA 4HUXA 1PQZA 5DEFA 1A9BA 5J6HA 3BO8A 4G43A 2F54A 1KJVA 1OGAA 5C0DA 2J8UA 3MRHA 4U1MA 1N59A 2AV1A 1T21A 3O9WA 1LD9A 1QRNA 3PABA 1RJYA 1NANH 3DX7A 4PGBA 3FRUA 4WO4A 3RWIA 3FQNA 5HGDA 4PRHA 3VFVA 2E7LE 3E3QA 3MRNA 1HYRC 1QVOA 3GMLA 3UBXA 4S0UC 3HPJA 3FQWA 3M17A 5SWZA 3RWCA 1FG2A 1FO0H 1ZAGA 4N5EA 2ZOLA 4L8BA 1JGDA 1P4LA 3MROA 1C16A 4PRPA 4PDCE 4G9DA 4PJ8A 2GTWA 5BJTA 1S7SA 3IXAA 1S7UA 3LN5A 3L9RA 4L8SC 4U1NA 3I6GA 4L4TA 1DUYA 1DE4A 3MR9A 3QUYA 1YDPA 4PJCA 3MRLA 3HUJA 4I48A 3BP7A 2H6PA 1AGEA 4Z77A 5C0GA 1HOCA 3L3GA 1JF1A 5EUOA 3GIVA 3VFSA 5C0FA 5IEKA 1RJZA 2FZ3A 1MI5A 4Z76A 4PG9A 1HHJA 1G6RH 4F7MA 5IB5A 5BRZA 3GMPA 1DDHA 4JFFA 3GMRA 3X13A 3TO2A 5C0CA 4U1KA 4JRXA 1KPUA 5F1IA 5HHMA 4ZUUA 3RWEA 3KYNA 3PWLA 3ERYA 2AXGA 1A1NA 3SKMA 3LKOA 3D25A 4HV8A 2F53A 4ZUVA 3P9LA 3UTTA 4ZUSA 1M6OA 3VFNA 3QFDA 3MRRA 4Y4KA 4FTVA 4NSKA 4HUUA 4PRNA 5FKPA 2GITA 3TPUE 3DBXA 5MEPA 3ARDA 3AREA 4UQ2A 2AXFA 3L3JA 3VFPA 5EU5A 2F74A 3QUXA 5F9JA 4U6XA 1VADA 3QDMA 3P4MA 1TVBA 2NW3A 2FO4A 5IROA 1QLFA 1T7WA 4PJ7A 4UQ3A 4EN3C 2AK4A 5L2KA 4K7FA 5FDWA 2P5EA 4V3DB 1BQHA 1HHKA 4QRRA 1FZJA 2GT9A 2BVPA 2BSRA 3QDGA 3TBYA 1AGDA 3LKSA 3FONA 3RZCA 1HHHA 4HX1A 4NQVA 3L3KA 3L3DA 4GUPA 4EI5A 1ZHNA 3JTCA 3B3IA 3LKQA 3MRFA 4NNXA 3VFOA 4ELMA 2GUOA 3HCVA 4Z78A 1DUZA 3GJFA 4LNRA 1B0GA 4PJGA 1S9WA 4U1SA 1MHEA 1QEWA 4PJBA 1WBZA 2CLZA 1P1ZA 3TZVC 3MRGA 3FQRA 5HYJA 4L29A 4F7PA 1AKJA 4QRPA 5D2NA 3DTXA 4G8GA 1HHGA 5D5MA 3ES6A 3L3HA 1RK1A 3QUZA 4APQA 4N0CA 4L3EA 5INCA 1T1WA 4G59A 5C08A 2BNQA 5H94A 5L2JA 5SWSA 1FZOA 1VGKA 4N0UA 1QQDA 4X6CA 5HGBA 5ACZA 3O3AA 2H26A 5E8OA 5SWQA 3MGOA 3AU1A 4IIQC 5EU3A 5E6IC 3PWNA 3GSQA 3HLAA 3CVHA 3VXUA 4D0BA 1LQVA 1U58A 4G9FA 1ZHKA 3RL1A 1P7QA 3FOLA 1SYSA 5HHOA 5HHQA 2HLAA 1I7UA 2BVOA 3SPVA 3V5DA 3D2UA 5HGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U0P A;  3VXR A;  5MER A;  3ARG A;  3P4N A;  4MQ7 A;  4N0F A;  3VFW A;  3VXO A;  1BD2 A;  1SYV A;  5B39 A;  3OV6 A;  4QRQ A;  3X14 A;  4LCW A;  3VXM A;  1FFN A;  3CCH A;  4PJI A;  1FFP A;  5HHN A;  4G8I A;  2VE6 A;  3M1B A;  3MRQ A;  4WU5 A;  2CLV A;  3HAE A;  5D7I A;  5DDH A;  5GSR A;  1S7X A;  1I7R A;  3MRD A;  1T7Y A;  1FZK A;  2YPL A;  3QQ3 A;  1XZ0 A;  4XXC A;  4U6Y A;  1QO3 A;  2BST A;  2FYY A;  3TBV A;  2VLL A;  1ZHB A;  3T1F A;  4E0R A;  1KBG H;  5EO1 A;  2VLR A;  4K71 B;  4MXQ A;  3PWP A;  4HUV A;  1ZT7 A;  1I1A A;  1XR8 A;  3S6C A;  1JGE A;  2X70 A;  3O3B A;  4PG2 A;  5D9S A;  1XH3 A;  3NFN A;  3WS3 A;  3P9M A;  1OSZ A;  4JFP A;  1S7Q A;  4JFQ A;  4F7T A;  5ISZ A;  1G7P A;  2AV7 A;  3MA7 A;  3H7B A;  2CIK A;  4HS3 A;  4ZUT A;  1K8D A;  4NHU E;  4WJ5 A;  5MEQ A;  3H9H A;  3E6H A;  2XFX A;  1YPZ A;  2UWE A;  5EU6 A;  5FA4 A;  1EEY A;  3TVM A;  3HE6 A;  2FIK A;  4X6D A;  5MEN A;  5EFI A;  1KCG C;  1OGT A;  2CLR A;  1MHC A;  3PWV A;  4PJE A;  4Y16 A;  4PRB A;  4NT6 A;  1S7V A;  3DX8 A;  3GMQ A;  2P5W A;  3KWW A;  3SDC A;  3MV8 A;  4QOK A;  5C07 A;  3UTS A;  1INQ A;  1AGB A;  3FT4 A;  4CVZ A;  1EFX A;  4L8C A;  1GZP A;  1CD1 A;  4Y2D A;  5HHP A;  3FFC A;  4PJD A;  3GSV A;  3E6F A;  5B38 A;  3WS6 A;  5BS0 A;  3VRI A;  1S7R A;  3O8X A;  1KPR A;  2ZSV A;  2ZSW A;  3B6S A;  3MRC A;  1KTL A;  1T0M A;  2HJK A;  4NO5 A;  3SKO A;  3O3E A;  1IM9 A;  1W0W A;  1EXU A;  3BH8 A;  3BHB A;  1HSA A;  2VLK A;  4MNQ A;  1ZS8 A;  2D31 A;  3RWF A;  3E2H A;  3OXR A;  3TBW A;  5C9J A;  3GMO A;  4F7C A;  4WW2 C;  3BZF A;  4N8V A;  3MRB A;  4I4W A;  4EUP A;  1I4F A;  3SDA A;  4U1L A;  1ZT4 A;  3MGT A;  4WDI A;  5D7L A;  3VCL A;  3VRJ A;  1LEG A;  1BZ9 A;  4IRS A;  4NO2 A;  4Y4H A;  4LCC C;  3PWU A;  4L9L C;  3DMM A;  5D2L A;  3LKR A;  2YEZ A;  4L8D A;  3UPR A;  1B0R A;  4MJI A;  1T7X A;  3HG1 A;  2Q7Y A;  3TID A;  4X6E A;  3KPL A;  3BW9 A;  4QRT A;  3ROO A;  1JPG A;  1JPF A;  3P4O A;  3VFU A;  5C0E A;  1LDP H;  5EOT A;  1A6Z A;  2C7U A;  3CC5 A;  1N5A A;  5IND A;  2X4U A;  5E00 A;  1JFM A;  3ECB A;  5HGH A;  3PQY A;  1T7V A;  2ESV A;  4FFE X;  5DEG A;  3GSX A;  3VXS A;  3KPN A;  2X4P A;  3BWA A;  4MNG A;  3CPL A;  5IVX A;  3ILP A;  1CE6 A;  1W72 A;  1W0V A;  4E5X A;  1AGF A;  1B3J A;  1E28 A;  3L3I A;  1JHT A;  3VXP A;  4PRA A;  3TFK A;  1S9X A;  2X4R A;  4PJ5 A;  3WL9 A;  3V5K A;  3MRI A;  2GJ6 A;  5BXF A;  4ZAK A;  3QUK A;  2PO6 A;  4JRY A;  3TO4 A;  1T0N A;  3LKP A;  1FFO A;  3SCM A;  3MYJ A;  1VAC A;  1T20 A;  5IB3 A;  3KPM A;  4D0C A;  5C09 A;  3O4L A;  3SDD A;  5C0B A;  1A9E A;  2YPK A;  2HN7 A;  4NO0 A;  5D7J C;  4QRS A;  4HUW A;  4JQX A;  2GTZ A;  2XPG A;  3SJV A;  3QUL A;  4PRE A;  1HSB A;  4L4V A;  5IM7 A;  3KPQ A;  1S7T A;  3RWG A;  3P77 A;  5EO0 A;  3QZW A;  3GMN A;  3BEV A;  5GSV A;  3D18 A;  3FT3 A;  1KJ2 H;  3D3V A;  4O2C A;  1KJ3 H;  3TF7 A;  1Q94 A;  3RTQ A;  4PJX A;  4PGD A;  3AM8 A;  3KPO A;  4PJH A;  3REW A;  2ZOK A;  1ONQ A;  1Z5L A;  1JUF A;  4G42 A;  2BNR A;  5E8P A;  3TBS A;  3VWK A;  5MEO A;  4CW1 A;  4U1H A;  3JTT A;  1ZVS A;  2VAA A;  1OF2 A;  3KLA A;  3G08 A;  3LN4 A;  3PWJ A;  4LCY A;  1S9Y A;  4GKN A;  1BII A;  1A1O A;  1WBY A;  2VLJ A;  4L3C A;  5IB1 A;  2RFX A;  4MX7 A;  1I7T A;  1S8D A;  2MHA A;  4U1I A;  4PR5 A;  2CKB H;  3GSO A;  3MV7 A;  3VJ6 A;  3HE7 A;  5E8N A;  4GKS A;  3GSN H;  3RGV C;  3VFM A;  1TVH A;  3QDJ A;  4V3E B;  2X4O A;  4PJ9 A;  3BUY A;  2CII A;  5C0A A;  1LP9 A;  3LKN A;  3RWJ A;  1I1F A;  1QSE A;  3DXA A;  5C0J A;  4WUU A;  3MRM A;  4O2F A;  3TIE A;  4WWK C;  1UXW A;  5J6G A;  4MJ5 A;  1LEK A;  3ARF A;  3QI9 A;  1CG9 A;  3H9S A;  3FTG A;  3VXN A;  3WUW A;  1M05 A;  2VAB A;  3UTQ A;  4MS8 A;  2AKR A;  2A83 A;  3TN0 A;  5C0I A;  3KXF A;  2V2X A;  2V2W A;  1JE6 A;  3QEQ A;  3DX6 A;  1NAM H;  2BVQ A;  2X4Q A;  1EEZ A;  3FQT A;  4WU7 A;  2BSS A;  1T1Y A;  1YN7 A;  2PYE A;  3IT8 D;  3KYO A;  3MRP A;  4PV9 A;  3W39 A;  3BZE A;  3RL2 A;  3C8K A;  4F7E A;  4NO3 A;  4PJA A;  4PRD A;  4IRJ A;  4NQD A;  1T22 A;  5JHD A;  3BP4 A;  4JQV A;  3BEW A;  4JFD A;  1L8J A;  3BH9 A;  1IM3 A;  1LK2 A;  1YN6 A;  3QQ4 A;  3VWJ A;  4IHO A;  5IB2 A;  1UQS A;  1TMC A;  3I6K A;  1I1Y A;  1T80 A;  1ZT1 A;  3MRE A;  5EU4 A;  3C9N A;  1AGC A;  5F1N A;  1ZHL A;  3KPR A;  1A1M A;  3RWH A;  1X7Q A;  4ZFZ A;  4U1J A;  3VFT A;  3LV3 A;  2WY3 A;  4MJ6 A;  3SDX A;  4HKJ A;  4ONO A;  1G7Q A;  1KJM A;  3RWD A;  1T1X A;  3I6L D;  1K5N A;  3FT2 A;  3MRK A;  3P73 A;  3GSU A;  3VFR A;  3FQU A;  3V5H A;  2X4N A;  3W0W A;  4PRI A;  1E27 A;  4Y4F A;  2JCC A;  1ED3 A;  4LHU A;  4NQC A;  4HWZ A;  5ENW A;  4JFO A;  3GMM A;  2FWO A;  2GAZ A;  3X11 A;  1ZSD A;  3GSW A;  1NEZ A;  3ROL A;  3VH8 A;  3ILQ C;  1MWA H;  1HHI A;  4O2E A;  4PGC A;  4X6F A;  4PV8 A;  3TA3 A;  3T8X A;  1GZQ A;  3KPP A;  1N2R A;  3X12 A;  2DYP A;  3QFJ A;  1AO7 A;  5F7D A;  3O3D A;  3FOM A;  3GSR A;  1N3N A;  5E9D A;  3BXN A;  3CDG A;  4PJF A;  3RUG A;  3MRJ A;  2OI9 A;  4NQE A;  3WLB A;  1XR9 A;  3JVG A;  2OL3 H;  3ARB A;  4NNY A;  2NX5 A;  2BCK A;  5J1A A;  4D0D A;  2X4S A;  3KPS A;  3OX8 A;  3BVN A;  1FZM A;  4PP8 C;  3BGM A;  1QR1 A;  4NQX A;  5FA3 A;  5IB4 A;  3JTS A;  3D39 A;  4MVB A;  5AD0 A;  5IEH A;  1R3H A;  3FQX A;  4CVX A;  3CH1 A;  3TJH A;  3MV9 A;  2HJL A;  1RK0 A;  1T7Z A;  1QSF A;  4JFE A;  3OXS A;  4ZUW A;  4PGE A;  4QRU A;  3CZF A;  3TBT A;  1WBX A;  2X4T A;  1UXS A;  1S7W A;  1KPV A;  1T1Z A;  4HUX A;  1PQZ A;  5DEF A;  1A9B A;  5J6H A;  3BO8 A;  4G43 A;  2F54 A;  1KJV A;  1OGA A;  5C0D A;  2J8U A;  3MRH A;  4U1M A;  1N59 A;  2AV1 A;  1T21 A;  3O9W A;  1LD9 A;  1QRN A;  3PAB A;  1RJY A;  1NAN H;  3DX7 A;  4PGB A;  3FRU A;  4WO4 A;  3RWI A;  3FQN A;  5HGD A;  4PRH A;  3VFV A;  2E7L E;  3E3Q A;  3MRN A;  1HYR C;  1QVO A;  3GML A;  3UBX A;  4S0U C;  3HPJ A;  3FQW A;  3M17 A;  5SWZ A;  3RWC A;  1FG2 A;  1FO0 H;  1ZAG A;  4N5E A;  2ZOL A;  4L8B A;  1JGD A;  1P4L A;  3MRO A;  1C16 A;  4PRP A;  4PDC E;  4G9D A;  4PJ8 A;  2GTW A;  5BJT A;  1S7S A;  3IXA A;  1S7U A;  3LN5 A;  3L9R A;  4L8S C;  4U1N A;  3I6G A;  4L4T A;  1DUY A;  1DE4 A;  3MR9 A;  3QUY A;  1YDP A;  4PJC A;  3MRL A;  3HUJ A;  4I48 A;  3BP7 A;  2H6P A;  1AGE A;  4Z77 A;  5C0G A;  1HOC A;  3L3G A;  1JF1 A;  5EUO A;  3GIV A;  3VFS A;  5C0F A;  5IEK A;  1RJZ A;  2FZ3 A;  1MI5 A;  4Z76 A;  4PG9 A;  1HHJ A;  1G6R H;  4F7M A;  5IB5 A;  5BRZ A;  3GMP A;  1DDH A;  4JFF A;  3GMR A;  3X13 A;  3TO2 A;  5C0C A;  4U1K A;  4JRX A;  1KPU A;  5F1I A;  5HHM A;  4ZUU A;  3RWE A;  3KYN A;  3PWL A;  3ERY A;  2AXG A;  1A1N A;  3SKM A;  3LKO A;  3D25 A;  4HV8 A;  2F53 A;  4ZUV A;  3P9L A;  3UTT A;  4ZUS A;  1M6O A;  3VFN A;  3QFD A;  3MRR A;  4Y4K A;  4FTV A;  4NSK A;  4HUU A;  4PRN A;  5FKP A;  2GIT A;  3TPU E;  3DBX A;  5MEP A;  3ARD A;  3ARE A;  4UQ2 A;  2AXF A;  3L3J A;  3VFP A;  5EU5 A;  2F74 A;  3QUX A;  5F9J A;  4U6X A;  1VAD A;  3QDM A;  3P4M A;  1TVB A;  2NW3 A;  2FO4 A;  5IRO A;  1QLF A;  1T7W A;  4PJ7 A;  4UQ3 A;  4EN3 C;  2AK4 A;  5L2K A;  4K7F A;  5FDW A;  2P5E A;  4V3D B;  1BQH A;  1HHK A;  4QRR A;  1FZJ A;  2GT9 A;  2BVP A;  2BSR A;  3QDG A;  3TBY A;  1AGD A;  3LKS A;  3FON A;  3RZC A;  1HHH A;  4HX1 A;  4NQV A;  3L3K A;  3L3D A;  4GUP A;  4EI5 A;  1ZHN A;  3JTC A;  3B3I A;  3LKQ A;  3MRF A;  4NNX A;  3VFO A;  4ELM A;  2GUO A;  3HCV A;  4Z78 A;  1DUZ A;  3GJF A;  4LNR A;  1B0G A;  4PJG A;  1S9W A;  4U1S A;  1MHE A;  1QEW A;  4PJB A;  1WBZ A;  2CLZ A;  1P1Z A;  3TZV C;  3MRG A;  3FQR A;  5HYJ A;  4L29 A;  4F7P A;  1AKJ A;  4QRP A;  5D2N A;  3DTX A;  4G8G A;  1HHG A;  5D5M A;  3ES6 A;  3L3H A;  1RK1 A;  3QUZ A;  4APQ A;  4N0C A;  4L3E A;  5INC A;  1T1W A;  4G59 A;  5C08 A;  2BNQ A;  5H94 A;  5L2J A;  5SWS A;  1FZO A;  1VGK A;  4N0U A;  1QQD A;  4X6C A;  5HGB A;  5ACZ A;  3O3A A;  2H26 A;  5E8O A;  5SWQ A;  3MGO A;  3AU1 A;  4IIQ C;  5EU3 A;  5E6I C;  3PWN A;  3GSQ A;  3HLA A;  3CVH A;  3VXU A;  4D0B A;  1LQV A;  1U58 A;  4G9F A;  1ZHK A;  3RL1 A;  1P7Q A;  3FOL A;  1SYS A;  5HHO A;  5HHQ A;  2HLA A;  1I7U A;  2BVO A;  3SPV A;  3V5D A;  3D2U A;  5HGA A; 
#chains in the Genus database with same CATH topology
 3U0P A;  3VXR A;  5MER A;  3ARG A;  3P4N A;  4MQ7 A;  4N0F A;  3VFW A;  3VXO A;  1BD2 A;  1SYV A;  5B39 A;  3OV6 A;  4QRQ A;  3X14 A;  4LCW A;  3VXM A;  1FFN A;  3CCH A;  4PJI A;  1FFP A;  5HHN A;  4G8I A;  2VE6 A;  3M1B A;  3MRQ A;  4WU5 A;  2CLV A;  3HAE A;  5D7I A;  5DDH A;  5GSR A;  1S7X A;  1I7R A;  2IA1 A;  3MRD A;  1T7Y A;  1FZK A;  2YPL A;  3QQ3 A;  1XZ0 A;  4XXC A;  4U6Y A;  1QO3 A;  2BST A;  2FYY A;  3TBV A;  2VLL A;  1ZHB A;  3T1F A;  4E0R A;  1KBG H;  5EO1 A;  2VLR A;  4K71 B;  4MXQ A;  3PWP A;  4HUV A;  1ZT7 A;  1I1A A;  1XR8 A;  3S6C A;  1JGE A;  2X70 A;  3O3B A;  4PG2 A;  5D9S A;  1XH3 A;  3NFN A;  3WS3 A;  3P9M A;  1OSZ A;  4JFP A;  1S7Q A;  4JFQ A;  4F7T A;  5ISZ A;  1G7P A;  2AV7 A;  3MA7 A;  3H7B A;  2CIK A;  4HS3 A;  4ZUT A;  1K8D A;  4NHU E;  4WJ5 A;  5MEQ A;  3H9H A;  3E6H A;  2XFX A;  1YPZ A;  2UWE A;  5EU6 A;  5FA4 A;  1EEY A;  3TVM A;  3HE6 A;  2FIK A;  4X6D A;  5MEN A;  5EFI A;  1KCG C;  1OGT A;  2CLR A;  1MHC A;  3PWV A;  4PJE A;  4Y16 A;  4PRB A;  4NT6 A;  1S7V A;  3DX8 A;  3GMQ A;  2P5W A;  3KWW A;  3SDC A;  3MV8 A;  4QOK A;  5C07 A;  3UTS A;  1INQ A;  1AGB A;  3FT4 A;  4CVZ A;  1EFX A;  4L8C A;  1GZP A;  1CD1 A;  4Y2D A;  5HHP A;  3FFC A;  4PJD A;  3GSV A;  3E6F A;  5B38 A;  3WS6 A;  5BS0 A;  3VRI A;  1S7R A;  3O8X A;  1KPR A;  2ZSV A;  2ZSW A;  3B6S A;  3MRC A;  1KTL A;  1T0M A;  2HJK A;  4NO5 A;  3SKO A;  3O3E A;  1IM9 A;  1W0W A;  1EXU A;  3BH8 A;  3BHB A;  1HSA A;  2VLK A;  4MNQ A;  1ZS8 A;  2D31 A;  3RWF A;  3E2H A;  3OXR A;  3TBW A;  5C9J A;  3GMO A;  4F7C A;  4WW2 C;  3BZF A;  4N8V A;  3MRB A;  4I4W A;  4EUP A;  1I4F A;  3SDA A;  4U1L A;  1ZT4 A;  3MGT A;  4WDI A;  5D7L A;  3VCL A;  3VRJ A;  1LEG A;  1BZ9 A;  4IRS A;  4NO2 A;  4Y4H A;  4LCC C;  3PWU A;  4L9L C;  3DMM A;  5D2L A;  3LKR A;  2YEZ A;  4L8D A;  3UPR A;  1B0R A;  4MJI A;  1T7X A;  3HG1 A;  2Q7Y A;  3TID A;  4X6E A;  3KPL A;  3BW9 A;  4QRT A;  3ROO A;  1JPG A;  1JPF A;  3P4O A;  3VFU A;  5C0E A;  1LDP H;  5EOT A;  1A6Z A;  2C7U A;  3CC5 A;  1N5A A;  5IND A;  2X4U A;  5E00 A;  1JFM A;  3ECB A;  5HGH A;  3PQY A;  1T7V A;  2ESV A;  4FFE X;  5DEG A;  3GSX A;  3VXS A;  3KPN A;  2X4P A;  3BWA A;  4MNG A;  3CPL A;  5IVX A;  3ILP A;  1CE6 A;  1W72 A;  1W0V A;  4E5X A;  1AGF A;  1B3J A;  1E28 A;  3L3I A;  1JHT A;  3VXP A;  4PRA A;  3TFK A;  1S9X A;  2X4R A;  4PJ5 A;  3WL9 A;  3V5K A;  3MRI A;  2GJ6 A;  5BXF A;  4ZAK A;  3QUK A;  2PO6 A;  4JRY A;  3TO4 A;  1T0N A;  3LKP A;  1FFO A;  3SCM A;  3MYJ A;  1VAC A;  1T20 A;  5IB3 A;  3KPM A;  4D0C A;  5C09 A;  3O4L A;  3SDD A;  5C0B A;  1A9E A;  2YPK A;  2HN7 A;  4NO0 A;  5D7J C;  4QRS A;  4HUW A;  4JQX A;  2GTZ A;  2XPG A;  3SJV A;  3QUL A;  4PRE A;  1HSB A;  4L4V A;  5IM7 A;  3KPQ A;  1S7T A;  2O5N A;  3P77 A;  4G59 C;  5EO0 A;  3RWG A;  3QZW A;  3GMN A;  3BEV A;  5GSV A;  3D18 A;  3FT3 A;  1KJ2 H;  3D3V A;  4O2C A;  1KJ3 H;  3TF7 A;  1Q94 A;  3RTQ A;  4PJX A;  4PGD A;  3AM8 A;  3KPO A;  4PJH A;  3REW A;  2ZOK A;  1ONQ A;  1Z5L A;  1JUF A;  4G42 A;  2BNR A;  5E8P A;  3TBS A;  3VWK A;  5MEO A;  4CW1 A;  4U1H A;  3JTT A;  1ZVS A;  2VAA A;  1OF2 A;  3KLA A;  3G08 A;  3LN4 A;  3PWJ A;  4LCY A;  1S9Y A;  4GKN A;  1BII A;  1A1O A;  1WBY A;  2VLJ A;  4L3C A;  5IB1 A;  2RFX A;  4MX7 A;  1I7T A;  1S8D A;  2MHA A;  4U1I A;  4PR5 A;  2CKB H;  3GSO A;  3MV7 A;  3VJ6 A;  3HE7 A;  5E8N A;  4GKS A;  3GSN H;  3RGV C;  3VFM A;  1TVH A;  3QDJ A;  4V3E B;  2X4O A;  4PJ9 A;  3BUY A;  2CII A;  5C0A A;  1LP9 A;  3LKN A;  3RWJ A;  1I1F A;  1QSE A;  3DXA A;  5C0J A;  4WUU A;  3MRM A;  4O2F A;  3TIE A;  4WWK C;  1UXW A;  5J6G A;  4MJ5 A;  1LEK A;  3ARF A;  3QI9 A;  1CG9 A;  3H9S A;  3FTG A;  3VXN A;  3WUW A;  1M05 A;  2VAB A;  3UTQ A;  4MS8 A;  2AKR A;  2A83 A;  3TN0 A;  5C0I A;  3KXF A;  2V2X A;  2V2W A;  1JE6 A;  3QEQ A;  3DX6 A;  1NAM H;  2BVQ A;  2X4Q A;  1EEZ A;  3FQT A;  4WU7 A;  2BSS A;  1T1Y A;  1YN7 A;  2PYE A;  3IT8 D;  3KYO A;  3MRP A;  4PV9 A;  3W39 A;  3BZE A;  3RL2 A;  3C8K A;  4F7E A;  4NO3 A;  4PJA A;  4PRD A;  4IRJ A;  4NQD A;  1T22 A;  5JHD A;  3BP4 A;  4JQV A;  3BEW A;  4JFD A;  1L8J A;  3BH9 A;  1IM3 A;  1LK2 A;  1YN6 A;  3QQ4 A;  3VWJ A;  4IHO A;  5IB2 A;  1UQS A;  1TMC A;  3I0T A;  3I6K A;  1I1Y A;  1T80 A;  1ZT1 A;  3MRE A;  5EU4 A;  3C9N A;  1AGC A;  5F1N A;  1ZHL A;  3KPR A;  1A1M A;  3RWH A;  1X7Q A;  4ZFZ A;  4U1J A;  3VFT A;  3LV3 A;  2WY3 A;  4MJ6 A;  3SDX A;  4HKJ A;  4ONO A;  1G7Q A;  1KJM A;  3RWD A;  1T1X A;  3I6L D;  1K5N A;  3FT2 A;  3MRK A;  3P73 A;  3GSU A;  3VFR A;  3FQU A;  3V5H A;  2X4N A;  3W0W A;  4PRI A;  1E27 A;  4Y4F A;  2JCC A;  1ED3 A;  4LHU A;  4NQC A;  4HWZ A;  5ENW A;  4JFO A;  3GMM A;  2FWO A;  2GAZ A;  3X11 A;  4JO8 A;  1ZSD A;  3GSW A;  1NEZ A;  3ROL A;  3VH8 A;  3ILQ C;  1MWA H;  1HHI A;  4O2E A;  4PGC A;  4X6F A;  4PV8 A;  3TA3 A;  3T8X A;  1GZQ A;  3KPP A;  1N2R A;  3X12 A;  2DYP A;  3QFJ A;  1AO7 A;  5F7D A;  3O3D A;  3FOM A;  3GSR A;  1N3N A;  5E9D A;  3BXN A;  3CDG A;  4PJF A;  3RUG A;  3MRJ A;  2OI9 A;  4NQE A;  3WLB A;  1XR9 A;  3JVG A;  2OL3 H;  3ARB A;  4NNY A;  2NX5 A;  2BCK A;  5J1A A;  4D0D A;  2X4S A;  3KPS A;  3OX8 A;  3BVN A;  1FZM A;  4PP8 C;  3BGM A;  1QR1 A;  4NQX A;  5FA3 A;  5IB4 A;  3JTS A;  3D39 A;  4MVB A;  5AD0 A;  5IEH A;  1R3H A;  3FQX A;  4CVX A;  3CH1 A;  3TJH A;  3MV9 A;  2NYK A;  2HJL A;  1RK0 A;  1T7Z A;  1QSF A;  4JFE A;  3OXS A;  4ZUW A;  4PGE A;  4QRU A;  3CZF A;  3TBT A;  1WBX A;  2X4T A;  1UXS A;  1S7W A;  1KPV A;  1T1Z A;  4HUX A;  1PQZ A;  5DEF A;  1A9B A;  5J6H A;  3BO8 A;  4G43 A;  2F54 A;  1KJV A;  1OGA A;  5C0D A;  2J8U A;  3MRH A;  4U1M A;  1N59 A;  2AV1 A;  1T21 A;  3O9W A;  1LD9 A;  1QRN A;  3PAB A;  1RJY A;  1NAN H;  3DX7 A;  4PGB A;  3FRU A;  4WO4 A;  3RWI A;  3FQN A;  5HGD A;  4PRH A;  3VFV A;  2E7L E;  3E3Q A;  3MRN A;  1HYR C;  1QVO A;  3GML A;  3UBX A;  4S0U C;  3HPJ A;  3FQW A;  3M17 A;  5SWZ A;  3RWC A;  1FG2 A;  1FO0 H;  1ZAG A;  4N5E A;  2ZOL A;  4L8B A;  1JGD A;  1P4L A;  3MRO A;  1C16 A;  4PRP A;  4PDC E;  4G9D A;  4PJ8 A;  2GTW A;  5BJT A;  1S7S A;  3IXA A;  1S7U A;  3LN5 A;  3L9R A;  4L8S C;  4U1N A;  3I6G A;  4L4T A;  1DUY A;  1DE4 A;  3MR9 A;  3QUY A;  1YDP A;  4PJC A;  3MRL A;  3HUJ A;  4I48 A;  3BP7 A;  2H6P A;  1AGE A;  4Z77 A;  5C0G A;  1HOC A;  3L3G A;  1JF1 A;  5EUO A;  3GIV A;  3VFS A;  5C0F A;  5IEK A;  1RJZ A;  2FZ3 A;  1MI5 A;  4Z76 A;  4PG9 A;  1HHJ A;  1G6R H;  4F7M A;  5IB5 A;  5BRZ A;  3GMP A;  1DDH A;  4JFF A;  3GMR A;  3X13 A;  3TO2 A;  5C0C A;  4U1K A;  4JRX A;  1KPU A;  5F1I A;  5HHM A;  4ZUU A;  3RWE A;  3KYN A;  3PWL A;  3ERY A;  2AXG A;  1A1N A;  3SKM A;  3LKO A;  3D25 A;  4HV8 A;  2F53 A;  4ZUV A;  3P9L A;  3UTT A;  4ZUS A;  1M6O A;  3VFN A;  3QFD A;  3MRR A;  4Y4K A;  4FTV A;  4NSK A;  4HUU A;  4PRN A;  5FKP A;  2GIT A;  3TPU E;  3DBX A;  5MEP A;  3ARD A;  3ARE A;  4UQ2 A;  2AXF A;  3L3J A;  3VFP A;  5EU5 A;  2F74 A;  3QUX A;  5F9J A;  4U6X A;  1VAD A;  3QDM A;  3P4M A;  1TVB A;  2NW3 A;  2FO4 A;  5IRO A;  1QLF A;  1T7W A;  4PJ7 A;  4UQ3 A;  4EN3 C;  2AK4 A;  5L2K A;  4K7F A;  5FDW A;  2P5E A;  4V3D B;  1BQH A;  1HHK A;  4QRR A;  1FZJ A;  2GT9 A;  2BVP A;  2BSR A;  3QDG A;  3TBY A;  1AGD A;  3LKS A;  3FON A;  3RZC A;  1HHH A;  4HX1 A;  4NQV A;  3L3K A;  3L3D A;  4GUP A;  4EI5 A;  1ZHN A;  3JTC A;  3B3I A;  3LKQ A;  3MRF A;  4NNX A;  3VFO A;  4ELM A;  2GUO A;  3HCV A;  4Z78 A;  1DUZ A;  3GJF A;  4LNR A;  1B0G A;  4PJG A;  1S9W A;  4U1S A;  1MHE A;  1QEW A;  4PJB A;  1WBZ A;  2CLZ A;  1P1Z A;  3TZV C;  3MRG A;  3FQR A;  5HYJ A;  4L29 A;  4F7P A;  1AKJ A;  4QRP A;  5D2N A;  3DTX A;  4G8G A;  1HHG A;  5D5M A;  3ES6 A;  3L3H A;  1RK1 A;  3QUZ A;  4APQ A;  4N0C A;  4L3E A;  5INC A;  1T1W A;  4G59 A;  5C08 A;  2BNQ A;  5H94 A;  5L2J A;  5SWS A;  1FZO A;  1VGK A;  4N0U A;  1QQD A;  4X6C A;  5HGB A;  5ACZ A;  3O3A A;  2H26 A;  5E8O A;  5SWQ A;  3MGO A;  3AU1 A;  4IIQ C;  5EU3 A;  5E6I C;  3PWN A;  3GSQ A;  4BKW A;  3HLA A;  3CVH A;  3VXU A;  4D0B A;  1LQV A;  1U58 A;  4G9F A;  1ZHK A;  3RL1 A;  1P7Q A;  3FOL A;  1SYS A;  5HHO A;  5HHQ A;  2HLA A;  1I7U A;  2BVO A;  3SPV A;  3V5D A;  3D2U A;  5HGA A; 
#chains in the Genus database with same CATH homology
 3U0P A;  3VXR A;  5MER A;  3ARG A;  3P4N A;  4MQ7 A;  4N0F A;  3VFW A;  3VXO A;  1BD2 A;  1SYV A;  5B39 A;  3OV6 A;  4QRQ A;  3X14 A;  4LCW A;  3VXM A;  1FFN A;  3CCH A;  4PJI A;  1FFP A;  5HHN A;  4G8I A;  2VE6 A;  3M1B A;  3MRQ A;  4WU5 A;  2CLV A;  3HAE A;  5D7I A;  5DDH A;  5GSR A;  1S7X A;  1I7R A;  3MRD A;  1T7Y A;  1FZK A;  2YPL A;  3QQ3 A;  1XZ0 A;  4XXC A;  4U6Y A;  1QO3 A;  2BST A;  2FYY A;  3TBV A;  2VLL A;  1ZHB A;  3T1F A;  4E0R A;  1KBG H;  5EO1 A;  2VLR A;  4K71 B;  4MXQ A;  3PWP A;  4HUV A;  1ZT7 A;  1I1A A;  1XR8 A;  3S6C A;  1JGE A;  2X70 A;  3O3B A;  4PG2 A;  5D9S A;  1XH3 A;  3NFN A;  3WS3 A;  3P9M A;  1OSZ A;  4JFP A;  1S7Q A;  4JFQ A;  4F7T A;  5ISZ A;  1G7P A;  2AV7 A;  3MA7 A;  3H7B A;  2CIK A;  4HS3 A;  4ZUT A;  1K8D A;  4NHU E;  4WJ5 A;  5MEQ A;  3H9H A;  3E6H A;  2XFX A;  1YPZ A;  2UWE A;  5EU6 A;  5FA4 A;  1EEY A;  3TVM A;  3HE6 A;  2FIK A;  4X6D A;  5MEN A;  5EFI A;  1KCG C;  1OGT A;  2CLR A;  1MHC A;  3PWV A;  4PJE A;  4Y16 A;  4PRB A;  4NT6 A;  1S7V A;  3DX8 A;  3GMQ A;  2P5W A;  3KWW A;  3SDC A;  3MV8 A;  4QOK A;  5C07 A;  3UTS A;  1INQ A;  1AGB A;  3FT4 A;  4CVZ A;  1EFX A;  4L8C A;  1GZP A;  1CD1 A;  4Y2D A;  5HHP A;  3FFC A;  4PJD A;  3GSV A;  3E6F A;  5B38 A;  3WS6 A;  5BS0 A;  3VRI A;  1S7R A;  3O8X A;  1KPR A;  2ZSV A;  2ZSW A;  3B6S A;  3MRC A;  1KTL A;  1T0M A;  2HJK A;  4NO5 A;  3SKO A;  3O3E A;  1IM9 A;  1W0W A;  1EXU A;  3BH8 A;  3BHB A;  1HSA A;  2VLK A;  4MNQ A;  1ZS8 A;  2D31 A;  3RWF A;  3E2H A;  3OXR A;  3TBW A;  5C9J A;  3GMO A;  4F7C A;  4WW2 C;  3BZF A;  4N8V A;  3MRB A;  4I4W A;  4EUP A;  1I4F A;  3SDA A;  4U1L A;  1ZT4 A;  3MGT A;  4WDI A;  5D7L A;  3VCL A;  3VRJ A;  1LEG A;  1BZ9 A;  4IRS A;  4NO2 A;  4Y4H A;  4LCC C;  3PWU A;  4L9L C;  3DMM A;  5D2L A;  3LKR A;  2YEZ A;  4L8D A;  3UPR A;  1B0R A;  4MJI A;  1T7X A;  3HG1 A;  2Q7Y A;  3TID A;  4X6E A;  3KPL A;  3BW9 A;  4QRT A;  3ROO A;  1JPG A;  1JPF A;  3P4O A;  3VFU A;  5C0E A;  1LDP H;  5EOT A;  1A6Z A;  2C7U A;  3CC5 A;  1N5A A;  5IND A;  2X4U A;  5E00 A;  1JFM A;  3ECB A;  5HGH A;  3PQY A;  1T7V A;  2ESV A;  4FFE X;  5DEG A;  3GSX A;  3VXS A;  3KPN A;  2X4P A;  3BWA A;  4MNG A;  3CPL A;  5IVX A;  3ILP A;  1CE6 A;  1W72 A;  1W0V A;  4E5X A;  1AGF A;  1B3J A;  1E28 A;  3L3I A;  1JHT A;  3VXP A;  4PRA A;  3TFK A;  1S9X A;  2X4R A;  4PJ5 A;  3WL9 A;  3V5K A;  3MRI A;  2GJ6 A;  5BXF A;  4ZAK A;  3QUK A;  2PO6 A;  4JRY A;  3TO4 A;  1T0N A;  3LKP A;  1FFO A;  3SCM A;  3MYJ A;  1VAC A;  1T20 A;  5IB3 A;  3KPM A;  4D0C A;  5C09 A;  3O4L A;  3SDD A;  5C0B A;  1A9E A;  2YPK A;  2HN7 A;  4NO0 A;  5D7J C;  4QRS A;  4HUW A;  4JQX A;  2GTZ A;  2XPG A;  3SJV A;  3QUL A;  4PRE A;  1HSB A;  4L4V A;  5IM7 A;  3KPQ A;  1S7T A;  3RWG A;  3P77 A;  5EO0 A;  3QZW A;  3GMN A;  3BEV A;  5GSV A;  3D18 A;  3FT3 A;  1KJ2 H;  3D3V A;  4O2C A;  1KJ3 H;  3TF7 A;  1Q94 A;  3RTQ A;  4PJX A;  4PGD A;  3AM8 A;  3KPO A;  4PJH A;  3REW A;  2ZOK A;  1ONQ A;  1Z5L A;  1JUF A;  4G42 A;  2BNR A;  5E8P A;  3TBS A;  3VWK A;  5MEO A;  4CW1 A;  4U1H A;  3JTT A;  1ZVS A;  2VAA A;  1OF2 A;  3KLA A;  3G08 A;  3LN4 A;  3PWJ A;  4LCY A;  1S9Y A;  4GKN A;  1BII A;  1A1O A;  1WBY A;  2VLJ A;  4L3C A;  5IB1 A;  2RFX A;  4MX7 A;  1I7T A;  1S8D A;  2MHA A;  4U1I A;  4PR5 A;  2CKB H;  3GSO A;  3MV7 A;  3VJ6 A;  3HE7 A;  5E8N A;  4GKS A;  3GSN H;  3RGV C;  3VFM A;  1TVH A;  3QDJ A;  4V3E B;  2X4O A;  4PJ9 A;  3BUY A;  2CII A;  5C0A A;  1LP9 A;  3LKN A;  3RWJ A;  1I1F A;  1QSE A;  3DXA A;  5C0J A;  4WUU A;  3MRM A;  4O2F A;  3TIE A;  4WWK C;  1UXW A;  5J6G A;  4MJ5 A;  1LEK A;  3ARF A;  3QI9 A;  1CG9 A;  3H9S A;  3FTG A;  3VXN A;  3WUW A;  1M05 A;  2VAB A;  3UTQ A;  4MS8 A;  2AKR A;  2A83 A;  3TN0 A;  5C0I A;  3KXF A;  2V2X A;  2V2W A;  1JE6 A;  3QEQ A;  3DX6 A;  1NAM H;  2BVQ A;  2X4Q A;  1EEZ A;  3FQT A;  4WU7 A;  2BSS A;  1T1Y A;  1YN7 A;  2PYE A;  3IT8 D;  3KYO A;  3MRP A;  4PV9 A;  3W39 A;  3BZE A;  3RL2 A;  3C8K A;  4F7E A;  4NO3 A;  4PJA A;  4PRD A;  4IRJ A;  4NQD A;  1T22 A;  5JHD A;  3BP4 A;  4JQV A;  3BEW A;  4JFD A;  1L8J A;  3BH9 A;  1IM3 A;  1LK2 A;  1YN6 A;  3QQ4 A;  3VWJ A;  4IHO A;  5IB2 A;  1UQS A;  1TMC A;  3I6K A;  1I1Y A;  1T80 A;  1ZT1 A;  3MRE A;  5EU4 A;  3C9N A;  1AGC A;  5F1N A;  1ZHL A;  3KPR A;  1A1M A;  3RWH A;  1X7Q A;  4ZFZ A;  4U1J A;  3VFT A;  3LV3 A;  2WY3 A;  4MJ6 A;  3SDX A;  4HKJ A;  4ONO A;  1G7Q A;  1KJM A;  3RWD A;  1T1X A;  3I6L D;  1K5N A;  3FT2 A;  3MRK A;  3P73 A;  3GSU A;  3VFR A;  3FQU A;  3V5H A;  2X4N A;  3W0W A;  4PRI A;  1E27 A;  4Y4F A;  2JCC A;  1ED3 A;  4LHU A;  4NQC A;  4HWZ A;  5ENW A;  4JFO A;  3GMM A;  2FWO A;  2GAZ A;  3X11 A;  1ZSD A;  3GSW A;  1NEZ A;  3ROL A;  3VH8 A;  3ILQ C;  1MWA H;  1HHI A;  4O2E A;  4PGC A;  4X6F A;  4PV8 A;  3TA3 A;  3T8X A;  1GZQ A;  3KPP A;  1N2R A;  3X12 A;  2DYP A;  3QFJ A;  1AO7 A;  5F7D A;  3O3D A;  3FOM A;  3GSR A;  1N3N A;  5E9D A;  3BXN A;  3CDG A;  4PJF A;  3RUG A;  3MRJ A;  2OI9 A;  4NQE A;  3WLB A;  1XR9 A;  3JVG A;  2OL3 H;  3ARB A;  4NNY A;  2NX5 A;  2BCK A;  5J1A A;  4D0D A;  2X4S A;  3KPS A;  3OX8 A;  3BVN A;  1FZM A;  4PP8 C;  3BGM A;  1QR1 A;  4NQX A;  5FA3 A;  5IB4 A;  3JTS A;  3D39 A;  4MVB A;  5AD0 A;  5IEH A;  1R3H A;  3FQX A;  4CVX A;  3CH1 A;  3TJH A;  3MV9 A;  2HJL A;  1RK0 A;  1T7Z A;  1QSF A;  4JFE A;  3OXS A;  4ZUW A;  4PGE A;  4QRU A;  3CZF A;  3TBT A;  1WBX A;  2X4T A;  1UXS A;  1S7W A;  1KPV A;  1T1Z A;  4HUX A;  1PQZ A;  5DEF A;  1A9B A;  5J6H A;  3BO8 A;  4G43 A;  2F54 A;  1KJV A;  1OGA A;  5C0D A;  2J8U A;  3MRH A;  4U1M A;  1N59 A;  2AV1 A;  1T21 A;  3O9W A;  1LD9 A;  1QRN A;  3PAB A;  1RJY A;  1NAN H;  3DX7 A;  4PGB A;  3FRU A;  4WO4 A;  3RWI A;  3FQN A;  5HGD A;  4PRH A;  3VFV A;  2E7L E;  3E3Q A;  3MRN A;  1HYR C;  1QVO A;  3GML A;  3UBX A;  4S0U C;  3HPJ A;  3FQW A;  3M17 A;  5SWZ A;  3RWC A;  1FG2 A;  1FO0 H;  1ZAG A;  4N5E A;  2ZOL A;  4L8B A;  1JGD A;  1P4L A;  3MRO A;  1C16 A;  4PRP A;  4PDC E;  4G9D A;  4PJ8 A;  2GTW A;  5BJT A;  1S7S A;  3IXA A;  1S7U A;  3LN5 A;  3L9R A;  4L8S C;  4U1N A;  3I6G A;  4L4T A;  1DUY A;  1DE4 A;  3MR9 A;  3QUY A;  1YDP A;  4PJC A;  3MRL A;  3HUJ A;  4I48 A;  3BP7 A;  2H6P A;  1AGE A;  4Z77 A;  5C0G A;  1HOC A;  3L3G A;  1JF1 A;  5EUO A;  3GIV A;  3VFS A;  5C0F A;  5IEK A;  1RJZ A;  2FZ3 A;  1MI5 A;  4Z76 A;  4PG9 A;  1HHJ A;  1G6R H;  4F7M A;  5IB5 A;  5BRZ A;  3GMP A;  1DDH A;  4JFF A;  3GMR A;  3X13 A;  3TO2 A;  5C0C A;  4U1K A;  4JRX A;  1KPU A;  5F1I A;  5HHM A;  4ZUU A;  3RWE A;  3KYN A;  3PWL A;  3ERY A;  2AXG A;  1A1N A;  3SKM A;  3LKO A;  3D25 A;  4HV8 A;  2F53 A;  4ZUV A;  3P9L A;  3UTT A;  4ZUS A;  1M6O A;  3VFN A;  3QFD A;  3MRR A;  4Y4K A;  4FTV A;  4NSK A;  4HUU A;  4PRN A;  5FKP A;  2GIT A;  3TPU E;  3DBX A;  5MEP A;  3ARD A;  3ARE A;  4UQ2 A;  2AXF A;  3L3J A;  3VFP A;  5EU5 A;  2F74 A;  3QUX A;  5F9J A;  4U6X A;  1VAD A;  3QDM A;  3P4M A;  1TVB A;  2NW3 A;  2FO4 A;  5IRO A;  1QLF A;  1T7W A;  4PJ7 A;  4UQ3 A;  4EN3 C;  2AK4 A;  5L2K A;  4K7F A;  5FDW A;  2P5E A;  4V3D B;  1BQH A;  1HHK A;  4QRR A;  1FZJ A;  2GT9 A;  2BVP A;  2BSR A;  3QDG A;  3TBY A;  1AGD A;  3LKS A;  3FON A;  3RZC A;  1HHH A;  4HX1 A;  4NQV A;  3L3K A;  3L3D A;  4GUP A;  4EI5 A;  1ZHN A;  3JTC A;  3B3I A;  3LKQ A;  3MRF A;  4NNX A;  3VFO A;  4ELM A;  2GUO A;  3HCV A;  4Z78 A;  1DUZ A;  3GJF A;  4LNR A;  1B0G A;  4PJG A;  1S9W A;  4U1S A;  1MHE A;  1QEW A;  4PJB A;  1WBZ A;  2CLZ A;  1P1Z A;  3TZV C;  3MRG A;  3FQR A;  5HYJ A;  4L29 A;  4F7P A;  1AKJ A;  4QRP A;  5D2N A;  3DTX A;  4G8G A;  1HHG A;  5D5M A;  3ES6 A;  3L3H A;  1RK1 A;  3QUZ A;  4APQ A;  4N0C A;  4L3E A;  5INC A;  1T1W A;  4G59 A;  5C08 A;  2BNQ A;  5H94 A;  5L2J A;  5SWS A;  1FZO A;  1VGK A;  4N0U A;  1QQD A;  4X6C A;  5HGB A;  5ACZ A;  3O3A A;  2H26 A;  5E8O A;  5SWQ A;  3MGO A;  3AU1 A;  4IIQ C;  5EU3 A;  5E6I C;  3PWN A;  3GSQ A;  3HLA A;  3CVH A;  3VXU A;  4D0B A;  1LQV A;  1U58 A;  4G9F A;  1ZHK A;  3RL1 A;  1P7Q A;  3FOL A;  1SYS A;  5HHO A;  5HHQ A;  2HLA A;  1I7U A;  2BVO A;  3SPV A;  3V5D A;  3D2U A;  5HGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...