4V3DB

The cidra domain from hb3var03 pfemp1 bound to endothelial protein c receptor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
169
structure length
169
Chain Sequence
QRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HB3VAR03 CIDRA DOMAIN
publication title Structural Conservation Despite Huge Sequence Diversity Allows Epcr Binding by the Pfemp1 Family Implicated in Severe Childhood Malaria.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Signaling protein
total genus 51
structure length 169
sequence length 169
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4v3dB00
5ISZA 1BD2A 4U1LA 4E0RA 1EEYA 4L4VA 3I6KA 3O3AA 2CKBH 1A6ZA 4EUPA 3QQ4A 3KYOA 4IIQC 1IM3A 5E00A 5IB4A 2OI9A 3D3VA 4JQVA 1KPRA 3SJVA 4O2CA 3L3GA 3JTTA 3X14A 4GKSA 1HHJA 5C0CA 2P5WA 4PJ7A 4ZUWA 3VFNA 2V2XA 5FDWA 4PJFA 5L2KA 2GT9A 3GSWA 1QSFA 5IB3A 3ILPA 4PDCE 5C0DA 3KPRA 3ERYA 1A1OA 2PO6A 4PGEA 3BEVA 4U1SA 4NO0A 1YN6A 1K5NA 3D2UA 1QLFA 5C0IA 1I1FA 3BWAA 1CE6A 3BEWA 4NO5A 1T0NA 3HE6A 3QULA 1M6OA 4PJIA 1XR9A 1S7SA 3VFSA 3TJHA 4D0DA 3ARGA 3LN4A 4PRAA 3VRJA 3QUYA 4U6XA 3FT4A 1L8JA 3AREA 1HHHA 1ZHBA 5EO0A 3MGTA 3P4NA 3B3IA 1G6RH 2PYEA 3SPVA 1YDPA 2AKRA 4PV8A 3MRCA 1FFPA 1QRNA 4U1JA 2UWEA 3CVHA 5GSVA 2NW3A 1I1AA 4PJHA 5E8OA 3RWGA 3UTQA 2F74A 3GMNA 4NT6A 3VFWA 5C9JA 1AGEA 5MEQA 3W0WA 3GMMA 3TPUE 1FZJA 3MRPA 4PJXA 2FYYA 1S8DA 4NSKA 4MNQA 3ROLA 3LV3A 3RWDA 4JRYA 5B38A 3MA7A 3SDAA 3ARDA 5D7JC 1HYRC 1I1YA 2X4OA 3GSXA 3ILQC 4V3DB 3MR9A 5EOTA 5AD0A 5F1NA 3PQYA 1ZHKA 3IXAA 1W0VA 3TIDA 1CG9A 5MENA 5B39A 2HN7A 1HHGA 3HLAA 4X6CA 4QRRA 1XZ0A 4N0CA 2V2WA 3VFVA 3RTQA 1XH3A 1ZT4A 1NEZA 3FQWA 2FO4A 3TIEA 1OF2A 3MV9A 1JE6A 3PWUA 2OL3H 1QO3A 1S7QA 3WS6A 5D2LA 1T1WA 2VLKA 3FFCA 3OXSA 1G7PA 2X4RA 3GSRA 1ZT1A 3SDXA 3GSNH 1A1MA 3FONA 3VFPA 3TN0A 2C7UA 3VFRA 2WY3A 3MRHA 2VLRA 3HCVA 3AM8A 4L8BA 3VH8A 3E3QA 1TVHA 5C0BA 3OX8A 1VADA 2AV7A 4L3CA 3MRDA 2AXGA 4U1IA 4CVXA 4EI5A 5C0FA 4MJ5A 1T0MA 4WWKC 4Y4FA 3P4OA 5FA3A 3UPRA 3WUWA 3GSVA 1VACA 3U0PA 3IT8D 3JTCA 3VFOA 5JHDA 1JUFA 5F9JA 3TZVC 3VWKA 3QEQA 1T1XA 1LP9A 3KPSA 2CIKA 2ZSVA 4HUWA 4ZFZA 5MEOA 1P4LA 3GMRA 1KJMA 4PJGA 1S7RA 3O3BA 3BW9A 3QQ3A 4ELMA 3FQRA 3TFKA 2CIIA 5SWQA 3OXRA 5BRZA 5L2JA 2AV1A 1B0GA 1KJ2H 3BVNA 3JTSA 3X13A 5IB1A 3DX6A 4X6DA 3MRBA 4U1MA 1ZVSA 3UBXA 4L29A 4X6EA 3LKOA 1W72A 1HOCA 1T1YA 3GIVA 3GSQA 3HPJA 4LCYA 3JVGA 5F7DA 3L3JA 3MRNA 4PJAA 5SWSA 4F7EA 5MEPA 1YN7A 5C09A 5J6HA 3H9SA 4WW2C 4PJ8A 4PG9A 4LHUA 3MRGA 4K7FA 2ZOLA 5D2NA 3VRIA 5IB5A 4IRJA 1M05A 4PRBA 4K71B 1NAMH 2DYPA 4WU7A 3RWFA 5IM7A 1TMCA 3I6GA 1OGTA 3MRRA 1MWAH 3O3DA 3CDGA 3P73A 1HHIA 3LKQA 5DEGA 5EFIA 3VJ6A 3S6CA 3BZFA 3H9HA 2JCCA 1ED3A 1Z5LA 3D25A 1FZOA 4MQ7A 4L8SC 1KJVA 3CCHA 3QDJA 4QOKA 4G42A 3KYNA 1KBGH 3MROA 1XR8A 4F7CA 4GUPA 5C07A 3KWWA 5IEKA 1JF1A 2P5EA 4MXQA 3G08A 3MRJA 1LQVA 2BNRA 3C8KA 3GSOA 4JFEA 1GZPA 5D7IA 5BS0A 4PJBA 2J8UA 4HV8A 5D9SA 3TBVA 4APQA 5DEFA 3TO4A 3CPLA 4LCCC 3MRFA 1AGFA 4U1KA 5HHMA 3D39A 3TBTA 4IRSA 1MHCA 4MJ6A 1RJYA 2CLVA 2X4NA 3B6SA 3MREA 4MJIA 4NNXA 4PV9A 3REWA 3VXRA 3TBWA 3LN5A 1KCGC 2GITA 1RK0A 3LKPA 3TBYA 1W0WA 4CVZA 1G7QA 3BP4A 4IHOA 3FT2A 1OGAA 5D7LA 5DDHA 1I4FA 2X4SA 1CD1A 1HSAA 1T1ZA 3GMPA 1HHKA 3MV8A 4PP8C 4U1NA 4JRXA 3RWHA 4JQXA 1KPVA 1RK1A 4Z76A 4U6YA 3VXPA 3DXAA 1VGKA 3WLBA 1WBZA 2BVOA 4NQEA 1AGBA 4PRHA 4F7PA 1EXUA 1AKJA 3TO2A 1S9XA 3BH8A 2D31A 3KPNA 3O8XA 4XXCA 3W39A 5D5MA 1OSZA 1BZ9A 4PGDA 4L3EA 2CLZA 4PGBA 3P9LA 3MV7A 2HLAA 1ZHNA 2GTZA 3H7BA 3TVMA 2VLLA 4JFPA 5FA4A 1A9EA 1B0RA 1ZT7A 2AXFA 2H6PA 2ESVA 1FZKA 3VFTA 2ZOKA 4PG2A 1T7VA 4PJCA 1YPZA 3SKMA 1HSBA 1EEZA 1U58A 3WL9A 1AGCA 5HGAA 1LDPH 3DMMA 1DE4A 3L3IA 3X12A 5ACZA 4JFQA 5EU6A 2X4PA 4HS3A 5HGDA 1JGDA 5EO1A 3DTXA 1SYVA 5H94A 3VFUA 3PWLA 1LEKA 3ROOA 1E28A 5E9DA 1MI5A 4G8GA 1JHTA 2F53A 4PRPA 4O2EA 3FTGA 4HKJA 3TF7A 2YPKA 3KPQA 2X4TA 3LKSA 4WJ5A 3QUKA 2GJ6A 4X6FA 3T1FA 4HWZA 5J1AA 1T22A 3PWNA 1N59A 3MRKA 4O2FA 5INDA 2BVQA 4JFOA 3GMOA 3MRIA 1P7QA 1KPUA 4LCWA 4S0UC 1FFOA 4PJ9A 1UXWA 1T7YA 5FKPA 3SDDA 1I7RA 3RWEA 2HJLA 1JPFA 3L3HA 4HUVA 3KPMA 3BHBA 4V3EB 4F7MA 4D0CA 2YPLA 4HX1A 3RUGA 4NQDA 5EUOA 5SWZA 3HE7A 5GSRA 3FRUA 3FQTA 5F1IA 3KXFA 3PWPA 4MX7A 1BIIA 3BO8A 4LNRA 3VXSA 2BVPA 2GAZA 4MNGA 3VXOA 4G59A 4WU5A 5HGBA 3I6LD 3FQNA 2FWOA 4PR5A 1LEGA 3E6HA 1QQDA 5E8PA 4HUXA 2NX5A 1FG2A 3ECBA 1DUZA 3GSUA 3VCLA 4Z77A 4PRIA 2XPGA 1S9WA 1IM9A 3SCMA 3UTSA 3PWVA 4G43A 4MS8A 2AK4A 3AU1A 3L9RA 3QUXA 3ARFA 3KPLA 3M17A 1DDHA 3DX8A 4PJDA 3PWJA 4QRPA 3BZEA 4G8IA 3RGVC 4NO2A 2Q7YA 3FQUA 4FTVA 1B3JA 1QEWA 4ZUUA 3FOMA 3FT3A 4NHUE 1ZHLA 3QFJA 1JFMA 2A83A 4PRNA 3V5HA 2X4UA 3SKOA 1WBXA 1TVBA 4QRTA 5IB2A 3DBXA 1N2RA 4PGCA 3T8XA 2BSRA 2VE6A 4HUUA 2X4QA 3MRQA 4F7TA 2FZ3A 4U1HA 5EU5A 1SYSA 2YEZA 2FIKA 3M1BA 3RZCA 5E6IC 3E2HA 1FZMA 3BUYA 3PABA 4JFFA 1QVOA 5C0GA 5ENWA 1NANH 1T80A 1ZS8A 4I48A 4QRSA 3RL2A 3QZWA 4CW1A 4Y2DA 1AO7A 1K8DA 3QUZA 4L8DA 5HHNA 1S7WA 4PJEA 1N3NA 2GTWA 4G9DA 3QI9A 2BSTA 3VXUA 5INCA 3CC5A 2H26A 1A1NA 1FO0H 1KTLA 2HJKA 3OV6A 5C08A 4L8CA 1S7UA 1ZSDA 1T7ZA 2X70A 4L4TA 1T21A 3TA3A 1UXSA 3LKRA 4N5EA 4ZUVA 4GKNA 3P9MA 2BNQA 1R3HA 3QDGA 3P4MA 1JGEA 3E6FA 3SDCA 1RJZA 1Q94A 4NQXA 1P1ZA 5E8NA 4PRDA 5MERA 4Y4KA 2E7LE 1S7TA 1DUYA 3NFNA 1UQSA 3CZFA 4D0BA 4Y16A 3MRMA 3BH9A 1AGDA 4MVBA 4NO3A 4Z78A 3GMLA 4PJ5A 3L3DA 5IROA 3FQXA 2F54A 3V5DA 4WO4A 2RFXA 2XFXA 3GJFA 4JFDA 1PQZA 1JPGA 1S7XA 1ZAGA 3HAEA 3VXNA 3DX7A 1MHEA 4ZAKA 5HHQA 5EU3A 3QDMA 1QR1A 3P77A 3X11A 2ZSWA 3RWJA 3LKNA 5C0EA 1S9YA 5IVXA 3ES6A 5EU4A 3TBSA 3HUJA 4NQCA 4ZUSA 3MYJA 1INQA 2BCKA 3VFMA 5HYJA 3MRLA 5C0JA 1N5AA 5HGHA 3MGOA 3V5KA 4QRQA 4N0FA 5HHOA 3L3KA 3O3EA 3UTTA 3D18A 4G9FA 4N8VA 1C16A 4ONOA 4L9LC 4QRUA 3HG1A 2MHAA 1FFNA 1X7QA 3KPOA 3RL1A 4FFEX 3O4LA 3BXNA 3QFDA 4I4WA 4UQ3A 5HHPA 1ONQA 3VWJA 1I7TA 1GZQA 2BSSA 5J6GA 4WUUA 5BXFA 3ARBA 4ZUTA 5C0AA 1T7XA 2CLRA 2VABA 2VAAA 3FOLA 4UQ2A 3KLAA 4PREA 3BP7A 3O9WA 2GUOA 3VXMA 4E5XA 4NNYA 3GMQA 5IEHA 3RWIA 4N0UA 1KJ3H 3CH1A 1QSEA 1A9BA 3WS3A 2VLJA 1T20A 1I7UA 3BGMA 3RWCA 1E27A 3KPPA 4NQVA 1S7VA 1BQHA 1LK2A 3C9NA 1EFXA 1T7WA 4WDIA 1LD9A 4Y4HA 5BJTA 4EN3C 1WBYA
chains in the Genus database with same CATH superfamily
5ISZA 1BD2A 4U1LA 4E0RA 1EEYA 4L4VA 3I6KA 3O3AA 2CKBH 1A6ZA 4EUPA 3QQ4A 3KYOA 4IIQC 1IM3A 5E00A 5IB4A 2OI9A 3D3VA 4JQVA 1KPRA 3SJVA 4O2CA 3L3GA 3JTTA 3X14A 4GKSA 1HHJA 5C0CA 2P5WA 3I0TA 4PJ7A 4ZUWA 3VFNA 2V2XA 5FDWA 4PJFA 5L2KA 2GT9A 3GSWA 1QR1A 1QSFA 5IB3A 3ILPA 4PDCE 5C0DA 3KPRA 3ERYA 1A1OA 2PO6A 4PGEA 3BEVA 4U1SA 4NO0A 1YN6A 1K5NA 3D2UA 1QLFA 5C0IA 1I1FA 4JO8A 3BWAA 1CE6A 3BEWA 4NO5A 1T0NA 3HE6A 3QULA 1M6OA 4PJIA 1XR9A 1S7SA 3VFSA 3TJHA 4D0DA 3ARGA 3LN4A 4PRAA 3VRJA 3QUYA 4U6XA 3FT4A 1L8JA 3AREA 1HHHA 1ZHBA 5EO0A 3MGTA 3P4NA 3B3IA 1G6RH 2PYEA 3SPVA 1YDPA 2AKRA 4PV8A 3MRCA 1FFPA 1QRNA 4U1JA 2UWEA 3CVHA 5GSVA 2NW3A 1I1AA 4PJHA 5E8OA 3RWGA 3UTQA 2F74A 3GMNA 4NT6A 3VFWA 5C9JA 1AGEA 5MEQA 3W0WA 3GMMA 3TPUE 2O5NA 1FZJA 3MRPA 4PJXA 2FYYA 1S8DA 4NSKA 4MNQA 3ROLA 3LV3A 3RWDA 4JRYA 5B38A 3MA7A 3SDAA 3ARDA 5D7JC 1HYRC 1I1YA 2X4OA 3GSXA 3ILQC 4V3DB 3MR9A 5EOTA 5AD0A 5F1NA 3PQYA 1ZHKA 3IXAA 1W0VA 3TIDA 1CG9A 5MENA 5B39A 2HN7A 1HHGA 3HLAA 4X6CA 4QRRA 1XZ0A 4N0CA 2V2WA 3VFVA 3RTQA 1XH3A 1ZT4A 1NEZA 3FQWA 2FO4A 3TIEA 1OF2A 3MV9A 1JE6A 3PWUA 2OL3H 1QO3A 1S7QA 3WS6A 5D2LA 1T1WA 2VLKA 3FFCA 3OXSA 1G7PA 2X4RA 3GSRA 1ZT1A 3SDXA 3GSNH 1A1MA 3FONA 3VFPA 3TN0A 2C7UA 3VFRA 2WY3A 3MRHA 2VLRA 3HCVA 3AM8A 4L8BA 3VH8A 3E3QA 1TVHA 5C0BA 3OX8A 1VADA 2AV7A 4L3CA 3MRDA 2AXGA 4U1IA 4CVXA 4EI5A 5C0FA 4MJ5A 1T0MA 4WWKC 4Y4FA 3P4OA 5FA3A 3UPRA 3WUWA 3GSVA 1VACA 3U0PA 3IT8D 3JTCA 3VFOA 5JHDA 1JUFA 5F9JA 3TZVC 3VWKA 3QEQA 1T1XA 1LP9A 3KPSA 2CIKA 2ZSVA 4HUWA 4ZFZA 5MEOA 1P4LA 3GMRA 1KJMA 4PJGA 1S7RA 3O3BA 3BW9A 3QQ3A 4ELMA 3FQRA 3TFKA 2CIIA 5SWQA 3OXRA 5BRZA 5L2JA 2AV1A 1B0GA 1KJ2H 3BVNA 3JTSA 3X13A 5IB1A 3DX6A 4X6DA 3MRBA 4U1MA 1ZVSA 3UBXA 4L29A 4X6EA 3LKOA 1W72A 1HOCA 1T1YA 3GIVA 3GSQA 3HPJA 4LCYA 3JVGA 5F7DA 3L3JA 3MRNA 4PJAA 5SWSA 4F7EA 5MEPA 1YN7A 5C09A 5J6HA 3H9SA 4WW2C 4PJ8A 4PG9A 4LHUA 3MRGA 4K7FA 2ZOLA 5D2NA 3VRIA 5IB5A 4IRJA 1M05A 4PRBA 4K71B 1NAMH 2DYPA 4WU7A 3RWFA 5IM7A 1TMCA 3I6GA 1OGTA 3MRRA 1MWAH 3O3DA 3CDGA 3P73A 1HHIA 3LKQA 5DEGA 5EFIA 3VJ6A 3S6CA 3BZFA 3H9HA 2JCCA 1ED3A 1Z5LA 3D25A 1FZOA 4MQ7A 4L8SC 1KJVA 3CCHA 3QDJA 4QOKA 4G42A 3KYNA 1KBGH 3MROA 1XR8A 4F7CA 4GUPA 5C07A 3KWWA 5IEKA 1JF1A 2P5EA 4MXQA 3G08A 3MRJA 1LQVA 2BNRA 3C8KA 3GSOA 4JFEA 1GZPA 5D7IA 5BS0A 4PJBA 2J8UA 4HV8A 5D9SA 3TBVA 4APQA 5DEFA 3TO4A 3CPLA 4LCCC 3MRFA 1AGFA 4U1KA 5HHMA 3D39A 3TBTA 4IRSA 1MHCA 4MJ6A 1RJYA 2CLVA 2X4NA 3B6SA 3MREA 4MJIA 4NNXA 4PV9A 3REWA 3VXRA 3TBWA 3LN5A 1KCGC 2GITA 1RK0A 3LKPA 3TBYA 1W0WA 4CVZA 1G7QA 3BP4A 4IHOA 3FT2A 1OGAA 5D7LA 5DDHA 1I4FA 2X4SA 1CD1A 1HSAA 1T1ZA 3GMPA 1HHKA 3MV8A 4PP8C 4U1NA 4JRXA 3RWHA 4JQXA 1KPVA 1RK1A 4Z76A 4U6YA 3VXPA 3DXAA 1VGKA 3WLBA 1WBZA 2BVOA 4NQEA 1AGBA 4PRHA 4F7PA 1EXUA 1AKJA 3TO2A 1S9XA 3BH8A 2D31A 3KPNA 3O8XA 4XXCA 3W39A 5D5MA 1OSZA 1BZ9A 4PGDA 4L3EA 2CLZA 4PGBA 3P9LA 3MV7A 2HLAA 1ZHNA 2GTZA 3H7BA 3TVMA 2VLLA 4JFPA 5FA4A 1A9EA 1B0RA 1ZT7A 2AXFA 2H6PA 2ESVA 1FZKA 3VFTA 2ZOKA 4PG2A 1T7VA 4PJCA 1YPZA 3SKMA 1HSBA 1EEZA 1U58A 3WL9A 1AGCA 5HGAA 1LDPH 3DMMA 1DE4A 3L3IA 3X12A 5ACZA 4JFQA 5EU6A 2X4PA 4HS3A 5HGDA 1JGDA 5EO1A 3DTXA 1SYVA 5H94A 3VFUA 3PWLA 1LEKA 3ROOA 1E28A 5E9DA 1MI5A 4G8GA 1JHTA 2F53A 4PRPA 4O2EA 3FTGA 4HKJA 3TF7A 2YPKA 3KPQA 2X4TA 3LKSA 4WJ5A 3QUKA 2GJ6A 4X6FA 3T1FA 4HWZA 5J1AA 1T22A 3PWNA 1N59A 3MRKA 4O2FA 5INDA 2BVQA 4JFOA 3GMOA 3MRIA 1P7QA 1KPUA 4LCWA 4S0UC 1FFOA 4PJ9A 1UXWA 1T7YA 5FKPA 3SDDA 1I7RA 3RWEA 2HJLA 1JPFA 3L3HA 4HUVA 3KPMA 3BHBA 4V3EB 4F7MA 4D0CA 2YPLA 4HX1A 3RUGA 4NQDA 5EUOA 5SWZA 3HE7A 5GSRA 3FRUA 3FQTA 5F1IA 3KXFA 3PWPA 4MX7A 1BIIA 3BO8A 4LNRA 3VXSA 2BVPA 2GAZA 4MNGA 3VXOA 4G59A 4WU5A 5HGBA 3I6LD 3FQNA 2FWOA 4PR5A 1LEGA 3E6HA 1QQDA 5E8PA 4HUXA 2NX5A 1FG2A 3ECBA 1DUZA 3GSUA 3VCLA 4Z77A 4PRIA 2XPGA 1S9WA 1IM9A 3SCMA 3UTSA 3PWVA 4G43A 4MS8A 2AK4A 3AU1A 3L9RA 3QUXA 3ARFA 3KPLA 3M17A 1DDHA 3DX8A 4PJDA 3PWJA 4QRPA 3BZEA 4G59C 4G8IA 3RGVC 4NO2A 2Q7YA 3FQUA 4FTVA 1B3JA 1QEWA 4ZUUA 3FOMA 3FT3A 4NHUE 1ZHLA 3QFJA 1JFMA 2A83A 4PRNA 3V5HA 2X4UA 3SKOA 1WBXA 1TVBA 4QRTA 5IB2A 3DBXA 1N2RA 4PGCA 3T8XA 2BSRA 2VE6A 4HUUA 2X4QA 3MRQA 4F7TA 2FZ3A 4U1HA 5EU5A 1SYSA 2YEZA 2FIKA 3M1BA 3RZCA 5E6IC 3E2HA 1FZMA 3BUYA 3PABA 4JFFA 1QVOA 5C0GA 5ENWA 1NANH 1T80A 1ZS8A 4I48A 4QRSA 3RL2A 3QZWA 4CW1A 4Y2DA 1AO7A 1K8DA 3QUZA 4L8DA 5HHNA 1S7WA 4PJEA 1N3NA 2GTWA 4G9DA 3QI9A 2BSTA 3VXUA 5INCA 3CC5A 2H26A 1A1NA 1FO0H 1KTLA 2HJKA 3OV6A 5C08A 4L8CA 1S7UA 1ZSDA 1T7ZA 2X70A 4L4TA 1T21A 3TA3A 1UXSA 3LKRA 4N5EA 4ZUVA 4GKNA 3P9MA 2BNQA 1R3HA 3QDGA 3P4MA 1JGEA 3E6FA 3SDCA 1RJZA 1Q94A 4NQXA 1P1ZA 5E8NA 4PRDA 5MERA 4Y4KA 2E7LE 1S7TA 1DUYA 3NFNA 1UQSA 3CZFA 4D0BA 4Y16A 3MRMA 3BH9A 1AGDA 4MVBA 4NO3A 4Z78A 3GMLA 4PJ5A 3L3DA 5IROA 3FQXA 2F54A 3V5DA 4WO4A 2RFXA 2XFXA 3GJFA 4JFDA 1PQZA 1JPGA 1S7XA 1ZAGA 3HAEA 3VXNA 3DX7A 1MHEA 4ZAKA 5HHQA 5EU3A 2NYKA 3QDMA 3P77A 3X11A 2ZSWA 3RWJA 3LKNA 5C0EA 1S9YA 5IVXA 3ES6A 5EU4A 3TBSA 3HUJA 4NQCA 4BKWA 4ZUSA 3MYJA 1INQA 2BCKA 3VFMA 5HYJA 3MRLA 5C0JA 1N5AA 5HGHA 3MGOA 3V5KA 4QRQA 4N0FA 5HHOA 3L3KA 3O3EA 3UTTA 3D18A 4G9FA 4N8VA 1C16A 4ONOA 4L9LC 4QRUA 3HG1A 2MHAA 1FFNA 1X7QA 3KPOA 3RL1A 4FFEX 3O4LA 3BXNA 3QFDA 4I4WA 4UQ3A 5HHPA 1ONQA 3VWJA 1I7TA 1GZQA 2BSSA 5J6GA 4WUUA 5BXFA 3ARBA 4ZUTA 5C0AA 1T7XA 2CLRA 2VABA 2VAAA 3FOLA 4UQ2A 3KLAA 4PREA 3BP7A 3O9WA 2GUOA 3VXMA 4E5XA 4NNYA 3GMQA 5IEHA 3RWIA 4N0UA 1KJ3H 3CH1A 1QSEA 1A9BA 3WS3A 2VLJA 1T20A 1I7UA 3BGMA 3RWCA 1E27A 2IA1A 3KPPA 4NQVA 1S7VA 1BQHA 1LK2A 3C9NA 1EFXA 1T7WA 4WDIA 1LD9A 4Y4HA 5BJTA 4EN3C 1WBYA
chains in the Genus database with same CATH topology
5ISZA 1BD2A 4U1LA 4E0RA 1EEYA 4L4VA 3I6KA 3O3AA 2CKBH 1A6ZA 4EUPA 3QQ4A 3KYOA 4IIQC 1IM3A 5E00A 5IB4A 2OI9A 3D3VA 4JQVA 1KPRA 3SJVA 4O2CA 3L3GA 3JTTA 3X14A 4GKSA 1HHJA 5C0CA 2P5WA 4PJ7A 4ZUWA 3VFNA 2V2XA 5FDWA 4PJFA 5L2KA 2GT9A 3GSWA 1QSFA 5IB3A 3ILPA 4PDCE 5C0DA 3KPRA 3ERYA 1A1OA 2PO6A 4PGEA 3BEVA 4U1SA 4NO0A 1YN6A 1K5NA 3D2UA 1QLFA 5C0IA 1I1FA 3BWAA 1CE6A 3BEWA 4NO5A 1T0NA 3HE6A 3QULA 1M6OA 4PJIA 1XR9A 1S7SA 3VFSA 3TJHA 4D0DA 3ARGA 3LN4A 4PRAA 3VRJA 3QUYA 4U6XA 3FT4A 1L8JA 3AREA 1HHHA 1ZHBA 5EO0A 3MGTA 3P4NA 3B3IA 1G6RH 2PYEA 3SPVA 1YDPA 2AKRA 4PV8A 3MRCA 1FFPA 1QRNA 4U1JA 2UWEA 3CVHA 5GSVA 2NW3A 1I1AA 4PJHA 5E8OA 3RWGA 3UTQA 2F74A 3GMNA 4NT6A 3VFWA 5C9JA 1AGEA 5MEQA 3W0WA 3GMMA 3TPUE 1FZJA 3MRPA 4PJXA 2FYYA 1S8DA 4NSKA 4MNQA 3ROLA 3LV3A 3RWDA 4JRYA 5B38A 3MA7A 3SDAA 3ARDA 5D7JC 1HYRC 1I1YA 2X4OA 3GSXA 3ILQC 4V3DB 3MR9A 5EOTA 5AD0A 5F1NA 3PQYA 1ZHKA 3IXAA 1W0VA 3TIDA 1CG9A 5MENA 5B39A 2HN7A 1HHGA 3HLAA 4X6CA 4QRRA 1XZ0A 4N0CA 2V2WA 3VFVA 3RTQA 1XH3A 1ZT4A 1NEZA 3FQWA 2FO4A 3TIEA 1OF2A 3MV9A 1JE6A 3PWUA 2OL3H 1QO3A 1S7QA 3WS6A 5D2LA 1T1WA 2VLKA 3FFCA 3OXSA 1G7PA 2X4RA 3GSRA 1ZT1A 3SDXA 3GSNH 1A1MA 3FONA 3VFPA 3TN0A 2C7UA 3VFRA 2WY3A 3MRHA 2VLRA 3HCVA 3AM8A 4L8BA 3VH8A 3E3QA 1TVHA 5C0BA 3OX8A 1VADA 2AV7A 4L3CA 3MRDA 2AXGA 4U1IA 4CVXA 4EI5A 5C0FA 4MJ5A 1T0MA 4WWKC 4Y4FA 3P4OA 5FA3A 3UPRA 3WUWA 3GSVA 1VACA 3U0PA 3IT8D 3JTCA 3VFOA 5JHDA 1JUFA 5F9JA 3TZVC 3VWKA 3QEQA 1T1XA 1LP9A 3KPSA 2CIKA 2ZSVA 4HUWA 4ZFZA 5MEOA 1P4LA 3GMRA 1KJMA 4PJGA 1S7RA 3O3BA 3BW9A 3QQ3A 4ELMA 3FQRA 3TFKA 2CIIA 5SWQA 3OXRA 5BRZA 5L2JA 2AV1A 1B0GA 1KJ2H 3BVNA 3JTSA 3X13A 5IB1A 3DX6A 4X6DA 3MRBA 4U1MA 1ZVSA 3UBXA 4L29A 4X6EA 3LKOA 1W72A 1HOCA 1T1YA 3GIVA 3GSQA 3HPJA 4LCYA 3JVGA 5F7DA 3L3JA 3MRNA 4PJAA 5SWSA 4F7EA 5MEPA 1YN7A 5C09A 5J6HA 3H9SA 4WW2C 4PJ8A 4PG9A 4LHUA 3MRGA 4K7FA 2ZOLA 5D2NA 3VRIA 5IB5A 4IRJA 1M05A 4PRBA 4K71B 1NAMH 2DYPA 4WU7A 3RWFA 5IM7A 1TMCA 3I6GA 1OGTA 3MRRA 1MWAH 3O3DA 3CDGA 3P73A 1HHIA 3LKQA 5DEGA 5EFIA 3VJ6A 3S6CA 3BZFA 3H9HA 2JCCA 1ED3A 1Z5LA 3D25A 1FZOA 4MQ7A 4L8SC 1KJVA 3CCHA 3QDJA 4QOKA 4G42A 3KYNA 1KBGH 3MROA 1XR8A 4F7CA 4GUPA 5C07A 3KWWA 5IEKA 1JF1A 2P5EA 4MXQA 3G08A 3MRJA 1LQVA 2BNRA 3C8KA 3GSOA 4JFEA 1GZPA 5D7IA 5BS0A 4PJBA 2J8UA 4HV8A 5D9SA 3TBVA 4APQA 5DEFA 3TO4A 3CPLA 4LCCC 3MRFA 1AGFA 4U1KA 5HHMA 3D39A 3TBTA 4IRSA 1MHCA 4MJ6A 1RJYA 2CLVA 2X4NA 3B6SA 3MREA 4MJIA 4NNXA 4PV9A 3REWA 3VXRA 3TBWA 3LN5A 1KCGC 2GITA 1RK0A 3LKPA 3TBYA 1W0WA 4CVZA 1G7QA 3BP4A 4IHOA 3FT2A 1OGAA 5D7LA 5DDHA 1I4FA 2X4SA 1CD1A 1HSAA 1T1ZA 3GMPA 1HHKA 3MV8A 4PP8C 4U1NA 4JRXA 3RWHA 4JQXA 1KPVA 1RK1A 4Z76A 4U6YA 3VXPA 3DXAA 1VGKA 3WLBA 1WBZA 2BVOA 4NQEA 1AGBA 4PRHA 4F7PA 1EXUA 1AKJA 3TO2A 1S9XA 3BH8A 2D31A 3KPNA 3O8XA 4XXCA 3W39A 5D5MA 1OSZA 1BZ9A 4PGDA 4L3EA 2CLZA 4PGBA 3P9LA 3MV7A 2HLAA 1ZHNA 2GTZA 3H7BA 3TVMA 2VLLA 4JFPA 5FA4A 1A9EA 1B0RA 1ZT7A 2AXFA 2H6PA 2ESVA 1FZKA 3VFTA 2ZOKA 4PG2A 1T7VA 4PJCA 1YPZA 3SKMA 1HSBA 1EEZA 1U58A 3WL9A 1AGCA 5HGAA 1LDPH 3DMMA 1DE4A 3L3IA 3X12A 5ACZA 4JFQA 5EU6A 2X4PA 4HS3A 5HGDA 1JGDA 5EO1A 3DTXA 1SYVA 5H94A 3VFUA 3PWLA 1LEKA 3ROOA 1E28A 5E9DA 1MI5A 4G8GA 1JHTA 2F53A 4PRPA 4O2EA 3FTGA 4HKJA 3TF7A 2YPKA 3KPQA 2X4TA 3LKSA 4WJ5A 3QUKA 2GJ6A 4X6FA 3T1FA 4HWZA 5J1AA 1T22A 3PWNA 1N59A 3MRKA 4O2FA 5INDA 2BVQA 4JFOA 3GMOA 3MRIA 1P7QA 1KPUA 4LCWA 4S0UC 1FFOA 4PJ9A 1UXWA 1T7YA 5FKPA 3SDDA 1I7RA 3RWEA 2HJLA 1JPFA 3L3HA 4HUVA 3KPMA 3BHBA 4V3EB 4F7MA 4D0CA 2YPLA 4HX1A 3RUGA 4NQDA 5EUOA 5SWZA 3HE7A 5GSRA 3FRUA 3FQTA 5F1IA 3KXFA 3PWPA 4MX7A 1BIIA 3BO8A 4LNRA 3VXSA 2BVPA 2GAZA 4MNGA 3VXOA 4G59A 4WU5A 5HGBA 3I6LD 3FQNA 2FWOA 4PR5A 1LEGA 3E6HA 1QQDA 5E8PA 4HUXA 2NX5A 1FG2A 3ECBA 1DUZA 3GSUA 3VCLA 4Z77A 4PRIA 2XPGA 1S9WA 1IM9A 3SCMA 3UTSA 3PWVA 4G43A 4MS8A 2AK4A 3AU1A 3L9RA 3QUXA 3ARFA 3KPLA 3M17A 1DDHA 3DX8A 4PJDA 3PWJA 4QRPA 3BZEA 4G8IA 3RGVC 4NO2A 2Q7YA 3FQUA 4FTVA 1B3JA 1QEWA 4ZUUA 3FOMA 3FT3A 4NHUE 1ZHLA 3QFJA 1JFMA 2A83A 4PRNA 3V5HA 2X4UA 3SKOA 1WBXA 1TVBA 4QRTA 5IB2A 3DBXA 1N2RA 4PGCA 3T8XA 2BSRA 2VE6A 4HUUA 2X4QA 3MRQA 4F7TA 2FZ3A 4U1HA 5EU5A 1SYSA 2YEZA 2FIKA 3M1BA 3RZCA 5E6IC 3E2HA 1FZMA 3BUYA 3PABA 4JFFA 1QVOA 5C0GA 5ENWA 1NANH 1T80A 1ZS8A 4I48A 4QRSA 3RL2A 3QZWA 4CW1A 4Y2DA 1AO7A 1K8DA 3QUZA 4L8DA 5HHNA 1S7WA 4PJEA 1N3NA 2GTWA 4G9DA 3QI9A 2BSTA 3VXUA 5INCA 3CC5A 2H26A 1A1NA 1FO0H 1KTLA 2HJKA 3OV6A 5C08A 4L8CA 1S7UA 1ZSDA 1T7ZA 2X70A 4L4TA 1T21A 3TA3A 1UXSA 3LKRA 4N5EA 4ZUVA 4GKNA 3P9MA 2BNQA 1R3HA 3QDGA 3P4MA 1JGEA 3E6FA 3SDCA 1RJZA 1Q94A 4NQXA 1P1ZA 5E8NA 4PRDA 5MERA 4Y4KA 2E7LE 1S7TA 1DUYA 3NFNA 1UQSA 3CZFA 4D0BA 4Y16A 3MRMA 3BH9A 1AGDA 4MVBA 4NO3A 4Z78A 3GMLA 4PJ5A 3L3DA 5IROA 3FQXA 2F54A 3V5DA 4WO4A 2RFXA 2XFXA 3GJFA 4JFDA 1PQZA 1JPGA 1S7XA 1ZAGA 3HAEA 3VXNA 3DX7A 1MHEA 4ZAKA 5HHQA 5EU3A 3QDMA 1QR1A 3P77A 3X11A 2ZSWA 3RWJA 3LKNA 5C0EA 1S9YA 5IVXA 3ES6A 5EU4A 3TBSA 3HUJA 4NQCA 4ZUSA 3MYJA 1INQA 2BCKA 3VFMA 5HYJA 3MRLA 5C0JA 1N5AA 5HGHA 3MGOA 3V5KA 4QRQA 4N0FA 5HHOA 3L3KA 3O3EA 3UTTA 3D18A 4G9FA 4N8VA 1C16A 4ONOA 4L9LC 4QRUA 3HG1A 2MHAA 1FFNA 1X7QA 3KPOA 3RL1A 4FFEX 3O4LA 3BXNA 3QFDA 4I4WA 4UQ3A 5HHPA 1ONQA 3VWJA 1I7TA 1GZQA 2BSSA 5J6GA 4WUUA 5BXFA 3ARBA 4ZUTA 5C0AA 1T7XA 2CLRA 2VABA 2VAAA 3FOLA 4UQ2A 3KLAA 4PREA 3BP7A 3O9WA 2GUOA 3VXMA 4E5XA 4NNYA 3GMQA 5IEHA 3RWIA 4N0UA 1KJ3H 3CH1A 1QSEA 1A9BA 3WS3A 2VLJA 1T20A 1I7UA 3BGMA 3RWCA 1E27A 3KPPA 4NQVA 1S7VA 1BQHA 1LK2A 3C9NA 1EFXA 1T7WA 4WDIA 1LD9A 4Y4HA 5BJTA 4EN3C 1WBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ISZ A;  1BD2 A;  4U1L A;  4E0R A;  1EEY A;  4L4V A;  3I6K A;  3O3A A;  2CKB H;  1A6Z A;  4EUP A;  3QQ4 A;  3KYO A;  4IIQ C;  1IM3 A;  5E00 A;  5IB4 A;  2OI9 A;  3D3V A;  4JQV A;  1KPR A;  3SJV A;  4O2C A;  3L3G A;  3JTT A;  3X14 A;  4GKS A;  1HHJ A;  5C0C A;  2P5W A;  4PJ7 A;  4ZUW A;  3VFN A;  2V2X A;  5FDW A;  4PJF A;  5L2K A;  2GT9 A;  3GSW A;  1QSF A;  5IB3 A;  3ILP A;  4PDC E;  5C0D A;  3KPR A;  3ERY A;  1A1O A;  2PO6 A;  4PGE A;  3BEV A;  4U1S A;  4NO0 A;  1YN6 A;  1K5N A;  3D2U A;  1QLF A;  5C0I A;  1I1F A;  3BWA A;  1CE6 A;  3BEW A;  4NO5 A;  1T0N A;  3HE6 A;  3QUL A;  1M6O A;  4PJI A;  1XR9 A;  1S7S A;  3VFS A;  3TJH A;  4D0D A;  3ARG A;  3LN4 A;  4PRA A;  3VRJ A;  3QUY A;  4U6X A;  3FT4 A;  1L8J A;  3ARE A;  1HHH A;  1ZHB A;  5EO0 A;  3MGT A;  3P4N A;  3B3I A;  1G6R H;  2PYE A;  3SPV A;  1YDP A;  2AKR A;  4PV8 A;  3MRC A;  1FFP A;  1QRN A;  4U1J A;  2UWE A;  3CVH A;  5GSV A;  2NW3 A;  1I1A A;  4PJH A;  5E8O A;  3RWG A;  3UTQ A;  2F74 A;  3GMN A;  4NT6 A;  3VFW A;  5C9J A;  1AGE A;  5MEQ A;  3W0W A;  3GMM A;  3TPU E;  1FZJ A;  3MRP A;  4PJX A;  2FYY A;  1S8D A;  4NSK A;  4MNQ A;  3ROL A;  3LV3 A;  3RWD A;  4JRY A;  5B38 A;  3MA7 A;  3SDA A;  3ARD A;  5D7J C;  1HYR C;  1I1Y A;  2X4O A;  3GSX A;  3ILQ C;  4V3D B;  3MR9 A;  5EOT A;  5AD0 A;  5F1N A;  3PQY A;  1ZHK A;  3IXA A;  1W0V A;  3TID A;  1CG9 A;  5MEN A;  5B39 A;  2HN7 A;  1HHG A;  3HLA A;  4X6C A;  4QRR A;  1XZ0 A;  4N0C A;  2V2W A;  3VFV A;  3RTQ A;  1XH3 A;  1ZT4 A;  1NEZ A;  3FQW A;  2FO4 A;  3TIE A;  1OF2 A;  3MV9 A;  1JE6 A;  3PWU A;  2OL3 H;  1QO3 A;  1S7Q A;  3WS6 A;  5D2L A;  1T1W A;  2VLK A;  3FFC A;  3OXS A;  1G7P A;  2X4R A;  3GSR A;  1ZT1 A;  3SDX A;  3GSN H;  1A1M A;  3FON A;  3VFP A;  3TN0 A;  2C7U A;  3VFR A;  2WY3 A;  3MRH A;  2VLR A;  3HCV A;  3AM8 A;  4L8B A;  3VH8 A;  3E3Q A;  1TVH A;  5C0B A;  3OX8 A;  1VAD A;  2AV7 A;  4L3C A;  3MRD A;  2AXG A;  4U1I A;  4CVX A;  4EI5 A;  5C0F A;  4MJ5 A;  1T0M A;  4WWK C;  4Y4F A;  3P4O A;  5FA3 A;  3UPR A;  3WUW A;  3GSV A;  1VAC A;  3U0P A;  3IT8 D;  3JTC A;  3VFO A;  5JHD A;  1JUF A;  5F9J A;  3TZV C;  3VWK A;  3QEQ A;  1T1X A;  1LP9 A;  3KPS A;  2CIK A;  2ZSV A;  4HUW A;  4ZFZ A;  5MEO A;  1P4L A;  3GMR A;  1KJM A;  4PJG A;  1S7R A;  3O3B A;  3BW9 A;  3QQ3 A;  4ELM A;  3FQR A;  3TFK A;  2CII A;  5SWQ A;  3OXR A;  5BRZ A;  5L2J A;  2AV1 A;  1B0G A;  1KJ2 H;  3BVN A;  3JTS A;  3X13 A;  5IB1 A;  3DX6 A;  4X6D A;  3MRB A;  4U1M A;  1ZVS A;  3UBX A;  4L29 A;  4X6E A;  3LKO A;  1W72 A;  1HOC A;  1T1Y A;  3GIV A;  3GSQ A;  3HPJ A;  4LCY A;  3JVG A;  5F7D A;  3L3J A;  3MRN A;  4PJA A;  5SWS A;  4F7E A;  5MEP A;  1YN7 A;  5C09 A;  5J6H A;  3H9S A;  4WW2 C;  4PJ8 A;  4PG9 A;  4LHU A;  3MRG A;  4K7F A;  2ZOL A;  5D2N A;  3VRI A;  5IB5 A;  4IRJ A;  1M05 A;  4PRB A;  4K71 B;  1NAM H;  2DYP A;  4WU7 A;  3RWF A;  5IM7 A;  1TMC A;  3I6G A;  1OGT A;  3MRR A;  1MWA H;  3O3D A;  3CDG A;  3P73 A;  1HHI A;  3LKQ A;  5DEG A;  5EFI A;  3VJ6 A;  3S6C A;  3BZF A;  3H9H A;  2JCC A;  1ED3 A;  1Z5L A;  3D25 A;  1FZO A;  4MQ7 A;  4L8S C;  1KJV A;  3CCH A;  3QDJ A;  4QOK A;  4G42 A;  3KYN A;  1KBG H;  3MRO A;  1XR8 A;  4F7C A;  4GUP A;  5C07 A;  3KWW A;  5IEK A;  1JF1 A;  2P5E A;  4MXQ A;  3G08 A;  3MRJ A;  1LQV A;  2BNR A;  3C8K A;  3GSO A;  4JFE A;  1GZP A;  5D7I A;  5BS0 A;  4PJB A;  2J8U A;  4HV8 A;  5D9S A;  3TBV A;  4APQ A;  5DEF A;  3TO4 A;  3CPL A;  4LCC C;  3MRF A;  1AGF A;  4U1K A;  5HHM A;  3D39 A;  3TBT A;  4IRS A;  1MHC A;  4MJ6 A;  1RJY A;  2CLV A;  2X4N A;  3B6S A;  3MRE A;  4MJI A;  4NNX A;  4PV9 A;  3REW A;  3VXR A;  3TBW A;  3LN5 A;  1KCG C;  2GIT A;  1RK0 A;  3LKP A;  3TBY A;  1W0W A;  4CVZ A;  1G7Q A;  3BP4 A;  4IHO A;  3FT2 A;  1OGA A;  5D7L A;  5DDH A;  1I4F A;  2X4S A;  1CD1 A;  1HSA A;  1T1Z A;  3GMP A;  1HHK A;  3MV8 A;  4PP8 C;  4U1N A;  4JRX A;  3RWH A;  4JQX A;  1KPV A;  1RK1 A;  4Z76 A;  4U6Y A;  3VXP A;  3DXA A;  1VGK A;  3WLB A;  1WBZ A;  2BVO A;  4NQE A;  1AGB A;  4PRH A;  4F7P A;  1EXU A;  1AKJ A;  3TO2 A;  1S9X A;  3BH8 A;  2D31 A;  3KPN A;  3O8X A;  4XXC A;  3W39 A;  5D5M A;  1OSZ A;  1BZ9 A;  4PGD A;  4L3E A;  2CLZ A;  4PGB A;  3P9L A;  3MV7 A;  2HLA A;  1ZHN A;  2GTZ A;  3H7B A;  3TVM A;  2VLL A;  4JFP A;  5FA4 A;  1A9E A;  1B0R A;  1ZT7 A;  2AXF A;  2H6P A;  2ESV A;  1FZK A;  3VFT A;  2ZOK A;  4PG2 A;  1T7V A;  4PJC A;  1YPZ A;  3SKM A;  1HSB A;  1EEZ A;  1U58 A;  3WL9 A;  1AGC A;  5HGA A;  1LDP H;  3DMM A;  1DE4 A;  3L3I A;  3X12 A;  5ACZ A;  4JFQ A;  5EU6 A;  2X4P A;  4HS3 A;  5HGD A;  1JGD A;  5EO1 A;  3DTX A;  1SYV A;  5H94 A;  3VFU A;  3PWL A;  1LEK A;  3ROO A;  1E28 A;  5E9D A;  1MI5 A;  4G8G A;  1JHT A;  2F53 A;  4PRP A;  4O2E A;  3FTG A;  4HKJ A;  3TF7 A;  2YPK A;  3KPQ A;  2X4T A;  3LKS A;  4WJ5 A;  3QUK A;  2GJ6 A;  4X6F A;  3T1F A;  4HWZ A;  5J1A A;  1T22 A;  3PWN A;  1N59 A;  3MRK A;  4O2F A;  5IND A;  2BVQ A;  4JFO A;  3GMO A;  3MRI A;  1P7Q A;  1KPU A;  4LCW A;  4S0U C;  1FFO A;  4PJ9 A;  1UXW A;  1T7Y A;  5FKP A;  3SDD A;  1I7R A;  3RWE A;  2HJL A;  1JPF A;  3L3H A;  4HUV A;  3KPM A;  3BHB A;  4V3E B;  4F7M A;  4D0C A;  2YPL A;  4HX1 A;  3RUG A;  4NQD A;  5EUO A;  5SWZ A;  3HE7 A;  5GSR A;  3FRU A;  3FQT A;  5F1I A;  3KXF A;  3PWP A;  4MX7 A;  1BII A;  3BO8 A;  4LNR A;  3VXS A;  2BVP A;  2GAZ A;  4MNG A;  3VXO A;  4G59 A;  4WU5 A;  5HGB A;  3I6L D;  3FQN A;  2FWO A;  4PR5 A;  1LEG A;  3E6H A;  1QQD A;  5E8P A;  4HUX A;  2NX5 A;  1FG2 A;  3ECB A;  1DUZ A;  3GSU A;  3VCL A;  4Z77 A;  4PRI A;  2XPG A;  1S9W A;  1IM9 A;  3SCM A;  3UTS A;  3PWV A;  4G43 A;  4MS8 A;  2AK4 A;  3AU1 A;  3L9R A;  3QUX A;  3ARF A;  3KPL A;  3M17 A;  1DDH A;  3DX8 A;  4PJD A;  3PWJ A;  4QRP A;  3BZE A;  4G8I A;  3RGV C;  4NO2 A;  2Q7Y A;  3FQU A;  4FTV A;  1B3J A;  1QEW A;  4ZUU A;  3FOM A;  3FT3 A;  4NHU E;  1ZHL A;  3QFJ A;  1JFM A;  2A83 A;  4PRN A;  3V5H A;  2X4U A;  3SKO A;  1WBX A;  1TVB A;  4QRT A;  5IB2 A;  3DBX A;  1N2R A;  4PGC A;  3T8X A;  2BSR A;  2VE6 A;  4HUU A;  2X4Q A;  3MRQ A;  4F7T A;  2FZ3 A;  4U1H A;  5EU5 A;  1SYS A;  2YEZ A;  2FIK A;  3M1B A;  3RZC A;  5E6I C;  3E2H A;  1FZM A;  3BUY A;  3PAB A;  4JFF A;  1QVO A;  5C0G A;  5ENW A;  1NAN H;  1T80 A;  1ZS8 A;  4I48 A;  4QRS A;  3RL2 A;  3QZW A;  4CW1 A;  4Y2D A;  1AO7 A;  1K8D A;  3QUZ A;  4L8D A;  5HHN A;  1S7W A;  4PJE A;  1N3N A;  2GTW A;  4G9D A;  3QI9 A;  2BST A;  3VXU A;  5INC A;  3CC5 A;  2H26 A;  1A1N A;  1FO0 H;  1KTL A;  2HJK A;  3OV6 A;  5C08 A;  4L8C A;  1S7U A;  1ZSD A;  1T7Z A;  2X70 A;  4L4T A;  1T21 A;  3TA3 A;  1UXS A;  3LKR A;  4N5E A;  4ZUV A;  4GKN A;  3P9M A;  2BNQ A;  1R3H A;  3QDG A;  3P4M A;  1JGE A;  3E6F A;  3SDC A;  1RJZ A;  1Q94 A;  4NQX A;  1P1Z A;  5E8N A;  4PRD A;  5MER A;  4Y4K A;  2E7L E;  1S7T A;  1DUY A;  3NFN A;  1UQS A;  3CZF A;  4D0B A;  4Y16 A;  3MRM A;  3BH9 A;  1AGD A;  4MVB A;  4NO3 A;  4Z78 A;  3GML A;  4PJ5 A;  3L3D A;  5IRO A;  3FQX A;  2F54 A;  3V5D A;  4WO4 A;  2RFX A;  2XFX A;  3GJF A;  4JFD A;  1PQZ A;  1JPG A;  1S7X A;  1ZAG A;  3HAE A;  3VXN A;  3DX7 A;  1MHE A;  4ZAK A;  5HHQ A;  5EU3 A;  3QDM A;  1QR1 A;  3P77 A;  3X11 A;  2ZSW A;  3RWJ A;  3LKN A;  5C0E A;  1S9Y A;  5IVX A;  3ES6 A;  5EU4 A;  3TBS A;  3HUJ A;  4NQC A;  4ZUS A;  3MYJ A;  1INQ A;  2BCK A;  3VFM A;  5HYJ A;  3MRL A;  5C0J A;  1N5A A;  5HGH A;  3MGO A;  3V5K A;  4QRQ A;  4N0F A;  5HHO A;  3L3K A;  3O3E A;  3UTT A;  3D18 A;  4G9F A;  4N8V A;  1C16 A;  4ONO A;  4L9L C;  4QRU A;  3HG1 A;  2MHA A;  1FFN A;  1X7Q A;  3KPO A;  3RL1 A;  4FFE X;  3O4L A;  3BXN A;  3QFD A;  4I4W A;  4UQ3 A;  5HHP A;  1ONQ A;  3VWJ A;  1I7T A;  1GZQ A;  2BSS A;  5J6G A;  4WUU A;  5BXF A;  3ARB A;  4ZUT A;  5C0A A;  1T7X A;  2CLR A;  2VAB A;  2VAA A;  3FOL A;  4UQ2 A;  3KLA A;  4PRE A;  3BP7 A;  3O9W A;  2GUO A;  3VXM A;  4E5X A;  4NNY A;  3GMQ A;  5IEH A;  3RWI A;  4N0U A;  1KJ3 H;  3CH1 A;  1QSE A;  1A9B A;  3WS3 A;  2VLJ A;  1T20 A;  1I7U A;  3BGM A;  3RWC A;  1E27 A;  3KPP A;  4NQV A;  1S7V A;  1BQH A;  1LK2 A;  3C9N A;  1EFX A;  1T7W A;  4WDI A;  1LD9 A;  4Y4H A;  5BJT A;  4EN3 C;  1WBY A; 
#chains in the Genus database with same CATH topology
 5ISZ A;  1BD2 A;  4U1L A;  4E0R A;  1EEY A;  4L4V A;  3I6K A;  3O3A A;  2CKB H;  1A6Z A;  4EUP A;  3QQ4 A;  3KYO A;  4IIQ C;  1IM3 A;  5E00 A;  5IB4 A;  2OI9 A;  3D3V A;  4JQV A;  1KPR A;  3SJV A;  4O2C A;  3L3G A;  3JTT A;  3X14 A;  4GKS A;  1HHJ A;  5C0C A;  2P5W A;  3I0T A;  4PJ7 A;  4ZUW A;  3VFN A;  2V2X A;  5FDW A;  4PJF A;  5L2K A;  2GT9 A;  3GSW A;  1QR1 A;  1QSF A;  5IB3 A;  3ILP A;  4PDC E;  5C0D A;  3KPR A;  3ERY A;  1A1O A;  2PO6 A;  4PGE A;  3BEV A;  4U1S A;  4NO0 A;  1YN6 A;  1K5N A;  3D2U A;  1QLF A;  5C0I A;  1I1F A;  4JO8 A;  3BWA A;  1CE6 A;  3BEW A;  4NO5 A;  1T0N A;  3HE6 A;  3QUL A;  1M6O A;  4PJI A;  1XR9 A;  1S7S A;  3VFS A;  3TJH A;  4D0D A;  3ARG A;  3LN4 A;  4PRA A;  3VRJ A;  3QUY A;  4U6X A;  3FT4 A;  1L8J A;  3ARE A;  1HHH A;  1ZHB A;  5EO0 A;  3MGT A;  3P4N A;  3B3I A;  1G6R H;  2PYE A;  3SPV A;  1YDP A;  2AKR A;  4PV8 A;  3MRC A;  1FFP A;  1QRN A;  4U1J A;  2UWE A;  3CVH A;  5GSV A;  2NW3 A;  1I1A A;  4PJH A;  5E8O A;  3RWG A;  3UTQ A;  2F74 A;  3GMN A;  4NT6 A;  3VFW A;  5C9J A;  1AGE A;  5MEQ A;  3W0W A;  3GMM A;  3TPU E;  2O5N A;  1FZJ A;  3MRP A;  4PJX A;  2FYY A;  1S8D A;  4NSK A;  4MNQ A;  3ROL A;  3LV3 A;  3RWD A;  4JRY A;  5B38 A;  3MA7 A;  3SDA A;  3ARD A;  5D7J C;  1HYR C;  1I1Y A;  2X4O A;  3GSX A;  3ILQ C;  4V3D B;  3MR9 A;  5EOT A;  5AD0 A;  5F1N A;  3PQY A;  1ZHK A;  3IXA A;  1W0V A;  3TID A;  1CG9 A;  5MEN A;  5B39 A;  2HN7 A;  1HHG A;  3HLA A;  4X6C A;  4QRR A;  1XZ0 A;  4N0C A;  2V2W A;  3VFV A;  3RTQ A;  1XH3 A;  1ZT4 A;  1NEZ A;  3FQW A;  2FO4 A;  3TIE A;  1OF2 A;  3MV9 A;  1JE6 A;  3PWU A;  2OL3 H;  1QO3 A;  1S7Q A;  3WS6 A;  5D2L A;  1T1W A;  2VLK A;  3FFC A;  3OXS A;  1G7P A;  2X4R A;  3GSR A;  1ZT1 A;  3SDX A;  3GSN H;  1A1M A;  3FON A;  3VFP A;  3TN0 A;  2C7U A;  3VFR A;  2WY3 A;  3MRH A;  2VLR A;  3HCV A;  3AM8 A;  4L8B A;  3VH8 A;  3E3Q A;  1TVH A;  5C0B A;  3OX8 A;  1VAD A;  2AV7 A;  4L3C A;  3MRD A;  2AXG A;  4U1I A;  4CVX A;  4EI5 A;  5C0F A;  4MJ5 A;  1T0M A;  4WWK C;  4Y4F A;  3P4O A;  5FA3 A;  3UPR A;  3WUW A;  3GSV A;  1VAC A;  3U0P A;  3IT8 D;  3JTC A;  3VFO A;  5JHD A;  1JUF A;  5F9J A;  3TZV C;  3VWK A;  3QEQ A;  1T1X A;  1LP9 A;  3KPS A;  2CIK A;  2ZSV A;  4HUW A;  4ZFZ A;  5MEO A;  1P4L A;  3GMR A;  1KJM A;  4PJG A;  1S7R A;  3O3B A;  3BW9 A;  3QQ3 A;  4ELM A;  3FQR A;  3TFK A;  2CII A;  5SWQ A;  3OXR A;  5BRZ A;  5L2J A;  2AV1 A;  1B0G A;  1KJ2 H;  3BVN A;  3JTS A;  3X13 A;  5IB1 A;  3DX6 A;  4X6D A;  3MRB A;  4U1M A;  1ZVS A;  3UBX A;  4L29 A;  4X6E A;  3LKO A;  1W72 A;  1HOC A;  1T1Y A;  3GIV A;  3GSQ A;  3HPJ A;  4LCY A;  3JVG A;  5F7D A;  3L3J A;  3MRN A;  4PJA A;  5SWS A;  4F7E A;  5MEP A;  1YN7 A;  5C09 A;  5J6H A;  3H9S A;  4WW2 C;  4PJ8 A;  4PG9 A;  4LHU A;  3MRG A;  4K7F A;  2ZOL A;  5D2N A;  3VRI A;  5IB5 A;  4IRJ A;  1M05 A;  4PRB A;  4K71 B;  1NAM H;  2DYP A;  4WU7 A;  3RWF A;  5IM7 A;  1TMC A;  3I6G A;  1OGT A;  3MRR A;  1MWA H;  3O3D A;  3CDG A;  3P73 A;  1HHI A;  3LKQ A;  5DEG A;  5EFI A;  3VJ6 A;  3S6C A;  3BZF A;  3H9H A;  2JCC A;  1ED3 A;  1Z5L A;  3D25 A;  1FZO A;  4MQ7 A;  4L8S C;  1KJV A;  3CCH A;  3QDJ A;  4QOK A;  4G42 A;  3KYN A;  1KBG H;  3MRO A;  1XR8 A;  4F7C A;  4GUP A;  5C07 A;  3KWW A;  5IEK A;  1JF1 A;  2P5E A;  4MXQ A;  3G08 A;  3MRJ A;  1LQV A;  2BNR A;  3C8K A;  3GSO A;  4JFE A;  1GZP A;  5D7I A;  5BS0 A;  4PJB A;  2J8U A;  4HV8 A;  5D9S A;  3TBV A;  4APQ A;  5DEF A;  3TO4 A;  3CPL A;  4LCC C;  3MRF A;  1AGF A;  4U1K A;  5HHM A;  3D39 A;  3TBT A;  4IRS A;  1MHC A;  4MJ6 A;  1RJY A;  2CLV A;  2X4N A;  3B6S A;  3MRE A;  4MJI A;  4NNX A;  4PV9 A;  3REW A;  3VXR A;  3TBW A;  3LN5 A;  1KCG C;  2GIT A;  1RK0 A;  3LKP A;  3TBY A;  1W0W A;  4CVZ A;  1G7Q A;  3BP4 A;  4IHO A;  3FT2 A;  1OGA A;  5D7L A;  5DDH A;  1I4F A;  2X4S A;  1CD1 A;  1HSA A;  1T1Z A;  3GMP A;  1HHK A;  3MV8 A;  4PP8 C;  4U1N A;  4JRX A;  3RWH A;  4JQX A;  1KPV A;  1RK1 A;  4Z76 A;  4U6Y A;  3VXP A;  3DXA A;  1VGK A;  3WLB A;  1WBZ A;  2BVO A;  4NQE A;  1AGB A;  4PRH A;  4F7P A;  1EXU A;  1AKJ A;  3TO2 A;  1S9X A;  3BH8 A;  2D31 A;  3KPN A;  3O8X A;  4XXC A;  3W39 A;  5D5M A;  1OSZ A;  1BZ9 A;  4PGD A;  4L3E A;  2CLZ A;  4PGB A;  3P9L A;  3MV7 A;  2HLA A;  1ZHN A;  2GTZ A;  3H7B A;  3TVM A;  2VLL A;  4JFP A;  5FA4 A;  1A9E A;  1B0R A;  1ZT7 A;  2AXF A;  2H6P A;  2ESV A;  1FZK A;  3VFT A;  2ZOK A;  4PG2 A;  1T7V A;  4PJC A;  1YPZ A;  3SKM A;  1HSB A;  1EEZ A;  1U58 A;  3WL9 A;  1AGC A;  5HGA A;  1LDP H;  3DMM A;  1DE4 A;  3L3I A;  3X12 A;  5ACZ A;  4JFQ A;  5EU6 A;  2X4P A;  4HS3 A;  5HGD A;  1JGD A;  5EO1 A;  3DTX A;  1SYV A;  5H94 A;  3VFU A;  3PWL A;  1LEK A;  3ROO A;  1E28 A;  5E9D A;  1MI5 A;  4G8G A;  1JHT A;  2F53 A;  4PRP A;  4O2E A;  3FTG A;  4HKJ A;  3TF7 A;  2YPK A;  3KPQ A;  2X4T A;  3LKS A;  4WJ5 A;  3QUK A;  2GJ6 A;  4X6F A;  3T1F A;  4HWZ A;  5J1A A;  1T22 A;  3PWN A;  1N59 A;  3MRK A;  4O2F A;  5IND A;  2BVQ A;  4JFO A;  3GMO A;  3MRI A;  1P7Q A;  1KPU A;  4LCW A;  4S0U C;  1FFO A;  4PJ9 A;  1UXW A;  1T7Y A;  5FKP A;  3SDD A;  1I7R A;  3RWE A;  2HJL A;  1JPF A;  3L3H A;  4HUV A;  3KPM A;  3BHB A;  4V3E B;  4F7M A;  4D0C A;  2YPL A;  4HX1 A;  3RUG A;  4NQD A;  5EUO A;  5SWZ A;  3HE7 A;  5GSR A;  3FRU A;  3FQT A;  5F1I A;  3KXF A;  3PWP A;  4MX7 A;  1BII A;  3BO8 A;  4LNR A;  3VXS A;  2BVP A;  2GAZ A;  4MNG A;  3VXO A;  4G59 A;  4WU5 A;  5HGB A;  3I6L D;  3FQN A;  2FWO A;  4PR5 A;  1LEG A;  3E6H A;  1QQD A;  5E8P A;  4HUX A;  2NX5 A;  1FG2 A;  3ECB A;  1DUZ A;  3GSU A;  3VCL A;  4Z77 A;  4PRI A;  2XPG A;  1S9W A;  1IM9 A;  3SCM A;  3UTS A;  3PWV A;  4G43 A;  4MS8 A;  2AK4 A;  3AU1 A;  3L9R A;  3QUX A;  3ARF A;  3KPL A;  3M17 A;  1DDH A;  3DX8 A;  4PJD A;  3PWJ A;  4QRP A;  3BZE A;  4G59 C;  4G8I A;  3RGV C;  4NO2 A;  2Q7Y A;  3FQU A;  4FTV A;  1B3J A;  1QEW A;  4ZUU A;  3FOM A;  3FT3 A;  4NHU E;  1ZHL A;  3QFJ A;  1JFM A;  2A83 A;  4PRN A;  3V5H A;  2X4U A;  3SKO A;  1WBX A;  1TVB A;  4QRT A;  5IB2 A;  3DBX A;  1N2R A;  4PGC A;  3T8X A;  2BSR A;  2VE6 A;  4HUU A;  2X4Q A;  3MRQ A;  4F7T A;  2FZ3 A;  4U1H A;  5EU5 A;  1SYS A;  2YEZ A;  2FIK A;  3M1B A;  3RZC A;  5E6I C;  3E2H A;  1FZM A;  3BUY A;  3PAB A;  4JFF A;  1QVO A;  5C0G A;  5ENW A;  1NAN H;  1T80 A;  1ZS8 A;  4I48 A;  4QRS A;  3RL2 A;  3QZW A;  4CW1 A;  4Y2D A;  1AO7 A;  1K8D A;  3QUZ A;  4L8D A;  5HHN A;  1S7W A;  4PJE A;  1N3N A;  2GTW A;  4G9D A;  3QI9 A;  2BST A;  3VXU A;  5INC A;  3CC5 A;  2H26 A;  1A1N A;  1FO0 H;  1KTL A;  2HJK A;  3OV6 A;  5C08 A;  4L8C A;  1S7U A;  1ZSD A;  1T7Z A;  2X70 A;  4L4T A;  1T21 A;  3TA3 A;  1UXS A;  3LKR A;  4N5E A;  4ZUV A;  4GKN A;  3P9M A;  2BNQ A;  1R3H A;  3QDG A;  3P4M A;  1JGE A;  3E6F A;  3SDC A;  1RJZ A;  1Q94 A;  4NQX A;  1P1Z A;  5E8N A;  4PRD A;  5MER A;  4Y4K A;  2E7L E;  1S7T A;  1DUY A;  3NFN A;  1UQS A;  3CZF A;  4D0B A;  4Y16 A;  3MRM A;  3BH9 A;  1AGD A;  4MVB A;  4NO3 A;  4Z78 A;  3GML A;  4PJ5 A;  3L3D A;  5IRO A;  3FQX A;  2F54 A;  3V5D A;  4WO4 A;  2RFX A;  2XFX A;  3GJF A;  4JFD A;  1PQZ A;  1JPG A;  1S7X A;  1ZAG A;  3HAE A;  3VXN A;  3DX7 A;  1MHE A;  4ZAK A;  5HHQ A;  5EU3 A;  2NYK A;  3QDM A;  3P77 A;  3X11 A;  2ZSW A;  3RWJ A;  3LKN A;  5C0E A;  1S9Y A;  5IVX A;  3ES6 A;  5EU4 A;  3TBS A;  3HUJ A;  4NQC A;  4BKW A;  4ZUS A;  3MYJ A;  1INQ A;  2BCK A;  3VFM A;  5HYJ A;  3MRL A;  5C0J A;  1N5A A;  5HGH A;  3MGO A;  3V5K A;  4QRQ A;  4N0F A;  5HHO A;  3L3K A;  3O3E A;  3UTT A;  3D18 A;  4G9F A;  4N8V A;  1C16 A;  4ONO A;  4L9L C;  4QRU A;  3HG1 A;  2MHA A;  1FFN A;  1X7Q A;  3KPO A;  3RL1 A;  4FFE X;  3O4L A;  3BXN A;  3QFD A;  4I4W A;  4UQ3 A;  5HHP A;  1ONQ A;  3VWJ A;  1I7T A;  1GZQ A;  2BSS A;  5J6G A;  4WUU A;  5BXF A;  3ARB A;  4ZUT A;  5C0A A;  1T7X A;  2CLR A;  2VAB A;  2VAA A;  3FOL A;  4UQ2 A;  3KLA A;  4PRE A;  3BP7 A;  3O9W A;  2GUO A;  3VXM A;  4E5X A;  4NNY A;  3GMQ A;  5IEH A;  3RWI A;  4N0U A;  1KJ3 H;  3CH1 A;  1QSE A;  1A9B A;  3WS3 A;  2VLJ A;  1T20 A;  1I7U A;  3BGM A;  3RWC A;  1E27 A;  2IA1 A;  3KPP A;  4NQV A;  1S7V A;  1BQH A;  1LK2 A;  3C9N A;  1EFX A;  1T7W A;  4WDI A;  1LD9 A;  4Y4H A;  5BJT A;  4EN3 C;  1WBY A; 
#chains in the Genus database with same CATH homology
 5ISZ A;  1BD2 A;  4U1L A;  4E0R A;  1EEY A;  4L4V A;  3I6K A;  3O3A A;  2CKB H;  1A6Z A;  4EUP A;  3QQ4 A;  3KYO A;  4IIQ C;  1IM3 A;  5E00 A;  5IB4 A;  2OI9 A;  3D3V A;  4JQV A;  1KPR A;  3SJV A;  4O2C A;  3L3G A;  3JTT A;  3X14 A;  4GKS A;  1HHJ A;  5C0C A;  2P5W A;  4PJ7 A;  4ZUW A;  3VFN A;  2V2X A;  5FDW A;  4PJF A;  5L2K A;  2GT9 A;  3GSW A;  1QSF A;  5IB3 A;  3ILP A;  4PDC E;  5C0D A;  3KPR A;  3ERY A;  1A1O A;  2PO6 A;  4PGE A;  3BEV A;  4U1S A;  4NO0 A;  1YN6 A;  1K5N A;  3D2U A;  1QLF A;  5C0I A;  1I1F A;  3BWA A;  1CE6 A;  3BEW A;  4NO5 A;  1T0N A;  3HE6 A;  3QUL A;  1M6O A;  4PJI A;  1XR9 A;  1S7S A;  3VFS A;  3TJH A;  4D0D A;  3ARG A;  3LN4 A;  4PRA A;  3VRJ A;  3QUY A;  4U6X A;  3FT4 A;  1L8J A;  3ARE A;  1HHH A;  1ZHB A;  5EO0 A;  3MGT A;  3P4N A;  3B3I A;  1G6R H;  2PYE A;  3SPV A;  1YDP A;  2AKR A;  4PV8 A;  3MRC A;  1FFP A;  1QRN A;  4U1J A;  2UWE A;  3CVH A;  5GSV A;  2NW3 A;  1I1A A;  4PJH A;  5E8O A;  3RWG A;  3UTQ A;  2F74 A;  3GMN A;  4NT6 A;  3VFW A;  5C9J A;  1AGE A;  5MEQ A;  3W0W A;  3GMM A;  3TPU E;  1FZJ A;  3MRP A;  4PJX A;  2FYY A;  1S8D A;  4NSK A;  4MNQ A;  3ROL A;  3LV3 A;  3RWD A;  4JRY A;  5B38 A;  3MA7 A;  3SDA A;  3ARD A;  5D7J C;  1HYR C;  1I1Y A;  2X4O A;  3GSX A;  3ILQ C;  4V3D B;  3MR9 A;  5EOT A;  5AD0 A;  5F1N A;  3PQY A;  1ZHK A;  3IXA A;  1W0V A;  3TID A;  1CG9 A;  5MEN A;  5B39 A;  2HN7 A;  1HHG A;  3HLA A;  4X6C A;  4QRR A;  1XZ0 A;  4N0C A;  2V2W A;  3VFV A;  3RTQ A;  1XH3 A;  1ZT4 A;  1NEZ A;  3FQW A;  2FO4 A;  3TIE A;  1OF2 A;  3MV9 A;  1JE6 A;  3PWU A;  2OL3 H;  1QO3 A;  1S7Q A;  3WS6 A;  5D2L A;  1T1W A;  2VLK A;  3FFC A;  3OXS A;  1G7P A;  2X4R A;  3GSR A;  1ZT1 A;  3SDX A;  3GSN H;  1A1M A;  3FON A;  3VFP A;  3TN0 A;  2C7U A;  3VFR A;  2WY3 A;  3MRH A;  2VLR A;  3HCV A;  3AM8 A;  4L8B A;  3VH8 A;  3E3Q A;  1TVH A;  5C0B A;  3OX8 A;  1VAD A;  2AV7 A;  4L3C A;  3MRD A;  2AXG A;  4U1I A;  4CVX A;  4EI5 A;  5C0F A;  4MJ5 A;  1T0M A;  4WWK C;  4Y4F A;  3P4O A;  5FA3 A;  3UPR A;  3WUW A;  3GSV A;  1VAC A;  3U0P A;  3IT8 D;  3JTC A;  3VFO A;  5JHD A;  1JUF A;  5F9J A;  3TZV C;  3VWK A;  3QEQ A;  1T1X A;  1LP9 A;  3KPS A;  2CIK A;  2ZSV A;  4HUW A;  4ZFZ A;  5MEO A;  1P4L A;  3GMR A;  1KJM A;  4PJG A;  1S7R A;  3O3B A;  3BW9 A;  3QQ3 A;  4ELM A;  3FQR A;  3TFK A;  2CII A;  5SWQ A;  3OXR A;  5BRZ A;  5L2J A;  2AV1 A;  1B0G A;  1KJ2 H;  3BVN A;  3JTS A;  3X13 A;  5IB1 A;  3DX6 A;  4X6D A;  3MRB A;  4U1M A;  1ZVS A;  3UBX A;  4L29 A;  4X6E A;  3LKO A;  1W72 A;  1HOC A;  1T1Y A;  3GIV A;  3GSQ A;  3HPJ A;  4LCY A;  3JVG A;  5F7D A;  3L3J A;  3MRN A;  4PJA A;  5SWS A;  4F7E A;  5MEP A;  1YN7 A;  5C09 A;  5J6H A;  3H9S A;  4WW2 C;  4PJ8 A;  4PG9 A;  4LHU A;  3MRG A;  4K7F A;  2ZOL A;  5D2N A;  3VRI A;  5IB5 A;  4IRJ A;  1M05 A;  4PRB A;  4K71 B;  1NAM H;  2DYP A;  4WU7 A;  3RWF A;  5IM7 A;  1TMC A;  3I6G A;  1OGT A;  3MRR A;  1MWA H;  3O3D A;  3CDG A;  3P73 A;  1HHI A;  3LKQ A;  5DEG A;  5EFI A;  3VJ6 A;  3S6C A;  3BZF A;  3H9H A;  2JCC A;  1ED3 A;  1Z5L A;  3D25 A;  1FZO A;  4MQ7 A;  4L8S C;  1KJV A;  3CCH A;  3QDJ A;  4QOK A;  4G42 A;  3KYN A;  1KBG H;  3MRO A;  1XR8 A;  4F7C A;  4GUP A;  5C07 A;  3KWW A;  5IEK A;  1JF1 A;  2P5E A;  4MXQ A;  3G08 A;  3MRJ A;  1LQV A;  2BNR A;  3C8K A;  3GSO A;  4JFE A;  1GZP A;  5D7I A;  5BS0 A;  4PJB A;  2J8U A;  4HV8 A;  5D9S A;  3TBV A;  4APQ A;  5DEF A;  3TO4 A;  3CPL A;  4LCC C;  3MRF A;  1AGF A;  4U1K A;  5HHM A;  3D39 A;  3TBT A;  4IRS A;  1MHC A;  4MJ6 A;  1RJY A;  2CLV A;  2X4N A;  3B6S A;  3MRE A;  4MJI A;  4NNX A;  4PV9 A;  3REW A;  3VXR A;  3TBW A;  3LN5 A;  1KCG C;  2GIT A;  1RK0 A;  3LKP A;  3TBY A;  1W0W A;  4CVZ A;  1G7Q A;  3BP4 A;  4IHO A;  3FT2 A;  1OGA A;  5D7L A;  5DDH A;  1I4F A;  2X4S A;  1CD1 A;  1HSA A;  1T1Z A;  3GMP A;  1HHK A;  3MV8 A;  4PP8 C;  4U1N A;  4JRX A;  3RWH A;  4JQX A;  1KPV A;  1RK1 A;  4Z76 A;  4U6Y A;  3VXP A;  3DXA A;  1VGK A;  3WLB A;  1WBZ A;  2BVO A;  4NQE A;  1AGB A;  4PRH A;  4F7P A;  1EXU A;  1AKJ A;  3TO2 A;  1S9X A;  3BH8 A;  2D31 A;  3KPN A;  3O8X A;  4XXC A;  3W39 A;  5D5M A;  1OSZ A;  1BZ9 A;  4PGD A;  4L3E A;  2CLZ A;  4PGB A;  3P9L A;  3MV7 A;  2HLA A;  1ZHN A;  2GTZ A;  3H7B A;  3TVM A;  2VLL A;  4JFP A;  5FA4 A;  1A9E A;  1B0R A;  1ZT7 A;  2AXF A;  2H6P A;  2ESV A;  1FZK A;  3VFT A;  2ZOK A;  4PG2 A;  1T7V A;  4PJC A;  1YPZ A;  3SKM A;  1HSB A;  1EEZ A;  1U58 A;  3WL9 A;  1AGC A;  5HGA A;  1LDP H;  3DMM A;  1DE4 A;  3L3I A;  3X12 A;  5ACZ A;  4JFQ A;  5EU6 A;  2X4P A;  4HS3 A;  5HGD A;  1JGD A;  5EO1 A;  3DTX A;  1SYV A;  5H94 A;  3VFU A;  3PWL A;  1LEK A;  3ROO A;  1E28 A;  5E9D A;  1MI5 A;  4G8G A;  1JHT A;  2F53 A;  4PRP A;  4O2E A;  3FTG A;  4HKJ A;  3TF7 A;  2YPK A;  3KPQ A;  2X4T A;  3LKS A;  4WJ5 A;  3QUK A;  2GJ6 A;  4X6F A;  3T1F A;  4HWZ A;  5J1A A;  1T22 A;  3PWN A;  1N59 A;  3MRK A;  4O2F A;  5IND A;  2BVQ A;  4JFO A;  3GMO A;  3MRI A;  1P7Q A;  1KPU A;  4LCW A;  4S0U C;  1FFO A;  4PJ9 A;  1UXW A;  1T7Y A;  5FKP A;  3SDD A;  1I7R A;  3RWE A;  2HJL A;  1JPF A;  3L3H A;  4HUV A;  3KPM A;  3BHB A;  4V3E B;  4F7M A;  4D0C A;  2YPL A;  4HX1 A;  3RUG A;  4NQD A;  5EUO A;  5SWZ A;  3HE7 A;  5GSR A;  3FRU A;  3FQT A;  5F1I A;  3KXF A;  3PWP A;  4MX7 A;  1BII A;  3BO8 A;  4LNR A;  3VXS A;  2BVP A;  2GAZ A;  4MNG A;  3VXO A;  4G59 A;  4WU5 A;  5HGB A;  3I6L D;  3FQN A;  2FWO A;  4PR5 A;  1LEG A;  3E6H A;  1QQD A;  5E8P A;  4HUX A;  2NX5 A;  1FG2 A;  3ECB A;  1DUZ A;  3GSU A;  3VCL A;  4Z77 A;  4PRI A;  2XPG A;  1S9W A;  1IM9 A;  3SCM A;  3UTS A;  3PWV A;  4G43 A;  4MS8 A;  2AK4 A;  3AU1 A;  3L9R A;  3QUX A;  3ARF A;  3KPL A;  3M17 A;  1DDH A;  3DX8 A;  4PJD A;  3PWJ A;  4QRP A;  3BZE A;  4G8I A;  3RGV C;  4NO2 A;  2Q7Y A;  3FQU A;  4FTV A;  1B3J A;  1QEW A;  4ZUU A;  3FOM A;  3FT3 A;  4NHU E;  1ZHL A;  3QFJ A;  1JFM A;  2A83 A;  4PRN A;  3V5H A;  2X4U A;  3SKO A;  1WBX A;  1TVB A;  4QRT A;  5IB2 A;  3DBX A;  1N2R A;  4PGC A;  3T8X A;  2BSR A;  2VE6 A;  4HUU A;  2X4Q A;  3MRQ A;  4F7T A;  2FZ3 A;  4U1H A;  5EU5 A;  1SYS A;  2YEZ A;  2FIK A;  3M1B A;  3RZC A;  5E6I C;  3E2H A;  1FZM A;  3BUY A;  3PAB A;  4JFF A;  1QVO A;  5C0G A;  5ENW A;  1NAN H;  1T80 A;  1ZS8 A;  4I48 A;  4QRS A;  3RL2 A;  3QZW A;  4CW1 A;  4Y2D A;  1AO7 A;  1K8D A;  3QUZ A;  4L8D A;  5HHN A;  1S7W A;  4PJE A;  1N3N A;  2GTW A;  4G9D A;  3QI9 A;  2BST A;  3VXU A;  5INC A;  3CC5 A;  2H26 A;  1A1N A;  1FO0 H;  1KTL A;  2HJK A;  3OV6 A;  5C08 A;  4L8C A;  1S7U A;  1ZSD A;  1T7Z A;  2X70 A;  4L4T A;  1T21 A;  3TA3 A;  1UXS A;  3LKR A;  4N5E A;  4ZUV A;  4GKN A;  3P9M A;  2BNQ A;  1R3H A;  3QDG A;  3P4M A;  1JGE A;  3E6F A;  3SDC A;  1RJZ A;  1Q94 A;  4NQX A;  1P1Z A;  5E8N A;  4PRD A;  5MER A;  4Y4K A;  2E7L E;  1S7T A;  1DUY A;  3NFN A;  1UQS A;  3CZF A;  4D0B A;  4Y16 A;  3MRM A;  3BH9 A;  1AGD A;  4MVB A;  4NO3 A;  4Z78 A;  3GML A;  4PJ5 A;  3L3D A;  5IRO A;  3FQX A;  2F54 A;  3V5D A;  4WO4 A;  2RFX A;  2XFX A;  3GJF A;  4JFD A;  1PQZ A;  1JPG A;  1S7X A;  1ZAG A;  3HAE A;  3VXN A;  3DX7 A;  1MHE A;  4ZAK A;  5HHQ A;  5EU3 A;  3QDM A;  1QR1 A;  3P77 A;  3X11 A;  2ZSW A;  3RWJ A;  3LKN A;  5C0E A;  1S9Y A;  5IVX A;  3ES6 A;  5EU4 A;  3TBS A;  3HUJ A;  4NQC A;  4ZUS A;  3MYJ A;  1INQ A;  2BCK A;  3VFM A;  5HYJ A;  3MRL A;  5C0J A;  1N5A A;  5HGH A;  3MGO A;  3V5K A;  4QRQ A;  4N0F A;  5HHO A;  3L3K A;  3O3E A;  3UTT A;  3D18 A;  4G9F A;  4N8V A;  1C16 A;  4ONO A;  4L9L C;  4QRU A;  3HG1 A;  2MHA A;  1FFN A;  1X7Q A;  3KPO A;  3RL1 A;  4FFE X;  3O4L A;  3BXN A;  3QFD A;  4I4W A;  4UQ3 A;  5HHP A;  1ONQ A;  3VWJ A;  1I7T A;  1GZQ A;  2BSS A;  5J6G A;  4WUU A;  5BXF A;  3ARB A;  4ZUT A;  5C0A A;  1T7X A;  2CLR A;  2VAB A;  2VAA A;  3FOL A;  4UQ2 A;  3KLA A;  4PRE A;  3BP7 A;  3O9W A;  2GUO A;  3VXM A;  4E5X A;  4NNY A;  3GMQ A;  5IEH A;  3RWI A;  4N0U A;  1KJ3 H;  3CH1 A;  1QSE A;  1A9B A;  3WS3 A;  2VLJ A;  1T20 A;  1I7U A;  3BGM A;  3RWC A;  1E27 A;  3KPP A;  4NQV A;  1S7V A;  1BQH A;  1LK2 A;  3C9N A;  1EFX A;  1T7W A;  4WDI A;  1LD9 A;  4Y4H A;  5BJT A;  4EN3 C;  1WBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...