3LKNA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1918 strain
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lknA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lknA01
4U1HA 1CGSH 1WJ3A 5EULV 2Y72A 3U46B 3DX9B 1F6AB 5CHNA 3TJHD 4GKSA 5SWSB 4M7JH 1D5MB 1UZ6F 4FNLL 3C8KB 2EDDA 3G6DL 2X7LB 1KUMA 4LASL 4HGMA 3MV9E 3K46A 1UXSB 2DBLL 2IAMC 4P4KB 1GGCL 1INQB 5DJAB 1CBVH 3EKCA 2PYFA 1I1AD 1U3YA 1MJUH 4LLUA 3LAFA 4PRIA 1QZ1A 5FF6B 1QFUL 4PJIB 1VFUA 1ZS8A 3MV9B 4X8XA 1EZVX 2IAMB 3AXLA 4AG4L 3MLYL 4M1DH 4GW4A 2HVKB 2IANE 4X7TB 4H20L 2CLZA 2KDGA 4NO2B 3B2UD 4W70A 5DSCA 2ZUXA 5CZXD 1NAMH 4JO3L 4X98A 4K7FB 3C09B 3CVHL 3ARBA 3QJHB 4LAQH 3SDDB 3RIAF 4M8QA 1MIEH 1IKNA 43C9B 4MDIB 5ALCL 3AS1A 1NCDH 5B8CB 3QDGE 3VXSA 4S1QL 3S96A 5KZCB 1LO0L 3C9NA 5EU5A 1B2WL 3ZMRA 2G5RA 2BVEA 1MUJA 3C09C 1E4KA 3QNZA 4HQQL 2E5EA 3RKDC 1IQDA 2DD8H 5I1LA 1EEYB 1N6VA 1BAFH 3BVNA 2GUOA 1D5XB 4KY1H 4LCWD 5KSBB 5ACLA 4YBQC 2GAZB 5FYLH 3ISWA 3UTPD 2M26A 1XH3B 3J7HA 4QHMA 5F1OB 5EU3A 2PF6A 2FLBT 3MR9B 3MGTB 1INDH 3MJ9L 4N0UE 2Y07H 1CK0L 4K3EL 3QFDB 4KUZH 1F45A 1EHXA 1WICA 3CXDH 4BFEA 4WDIB 4XPTL 1XF3A 1TITA 1MI5D 1CICA 2VUOA 2E9WA 4PJ5E 2IJ0C 1JNLL 4RGMB 5I16A 2H41A 4F9LC 5HPOA 3U7WL 3AAZB 4QF1B 3QEUB 2NX5D 3P4MA 3C5SB 4M6OL 4WTWA 3VFOA 4L3EB 1HYRC 5HHNA 2GITB 1DBAL 4HIJB 1FSKC 4P2YA 1T83A 1JPST 4JAMB 1HHIB 1UJ3A 4MQTB 2CR6A 2XWJB 5IQ7H 5JDSA 4WFHD 1UM4H 3TN0A 3MACH 1U92A 1FSKB 1S7TA 4BA8A 5BCAA 2A74A 4OQTH 4CVXB 1BOGA 3Q6FA 4TSAH 3Q1SH 3W11D 2VZOA 3FFCA 5TDNB 4QRQA 3WDIA 1WBZA 4F7CA 4JN1L 4OIIH 1TVDA 1FYTB 3T3ME 3A6BH 5IBLD 4JM4H 1JRHL 4GKZA 1E4XI 5SWQB 3OKOA 3K4DA 3QHZL 5K59E 1XT5A 4NRZB 5ADPH 2AXHA 5JUEL 2B2XL 4L4VA 3QDMB 2P43B 4GUPA 1ZT1A 2VYRE 4RWHA 2IH3B 4ELMA 4C83A 4MX7B 5DTFA 4J3UA 5LBSH 2ICWJ 1G7PA 3ULUL 3DIFB 4LGPB 1Q9OA 2GCYA 1LD9B 4UILH 3RDTA 1IGFH 1VEMA 2IFFL 1CLOL 2ZUVA 3ARUA 3ULUE 1FNEA 4JY4B 4WCYL 4G6AD 5JW3H 1NJ9B 1NGWB 1F5WA 1WFNA 2VDKH 4HHAA 3S5LG 4JM2A 2HJFA 5CD5C 3BKJH 2Q8BL 4YFDB 5E0QA 5FM8A 1KCGC 4DGIH 2VH5L 5DO2C 1EO8L 3T3PE 1J88A 3OPZL 3ESUF 1FGNL 3DBXA 4OCRL 5EZJA 4KROC 3X11B 4L8DB 3GM0A 3STLA 3L5WA 3VH8B 4MVBC 5C2UB 5AG8A 4WWKA 4FFYH 4XWOC 3SDCA 3X13A 3KPTA 1K5NB 1OAKL 1PLGH 2ADFH 2IBZY 4POUB 2ENSA 3OKLA 2VDLH 3D2UD 3ROLA 2A73A 4Z77B 4YHNB 5IFAH 1ZGLA 3MRCB 4F2MB 1OLZA 2J6EL 4PR5A 4QXGH 1AIFB 2APVA 3SO3B 1JHLH 3FQTB 5D7LE 5FFLA 3SGEI 3CSYA 4IJ3B 2PKDA 4X4XA 5AYQA 2CKBA 4MD0B 4IRJD 3KPPA 3BWAB 2JCCF 4D9LL 3OAZK 3ULSB 4WFHE 3U4EA 1QQDB 2LU4A 4JFOB 2EYSA 2I60L 1FL6B 4HKJB 2EE6A 3CPLA 4JKPH 2F54E 5CSZA 3BH9B 3MNWA 3CLFL 4F80A 4PRBB 3DMMC 1CFTA 3U0WH 3BKJL 3VXPB 3RWJA 1HH6A 4JLRB 2FECL 5CJQL 4YH6A 1CL7I 3S7GA 4OGAD 3L95A 3WNPA 4YJZL 4PRAA 4XNUH 2VC2L 3UEZA 3MRLB 3LS4H 4JFHD 4X5WA 2QHLA 2HMIC 5D1XD 1U95A 3RI5F 4S11A 3TJHC 1AO7D 4QRRA 3LRSB 4NOFA 1KLFA 5DDHB 3CCHA 4QRPA 2H2PC 3BZFA 1YJDL 2WWMC 1QFWM 2L7JA 4C4KT 1AFVL 1QQDA 3DXAE 3LKNA 5GZND 2DS4A 3IFNH 1YMHA 1YPZB 4JREB 3DUUB 1IM3A 4UTBH 1KBGL 4AJ0A 2J8OA 2CQVA 4WFFD 3IFLH 3TBTA 1INDL 4LEOA 4DUWA 1D9KC 4OLUL 4NDMB 1XF2A 3OHXA 1N5AB 1FAKT 1X4ZA 3WKNA 5DFWH 4ZPTA 4R7DA 1ORSA 5E1AB 4OZHE 3RZCA 4PRNB 1OAXL 5E6IC 1NC2D 3WJJA 4EXPX 3MRFA 4Y1AB 4ODVL 1UM4L 4HWBL 1R3IL 2A9MH 3EJZC 5EA0H 5I15H 3IJYB 3CFKA 1A0QH 4ODUA 3SE8H 4S1QH 1NCDL 4NHCH 1GZPB 1MIEL 2VZSA 5KVEH 2E27H 2WBWB 1JWSA 5AD0A 5CMAA 5ALBL 2C7UB 1U8OB 3WIFB 1CGTA 1I8IA 1WEJL 2HJFB 4PJAA 1FFNB 4I2XA 1C5CH 1WIOA 3O2DA 1R0AH 2AEQH 2D7TL 2ZUQC 2VDPH 5JOFB 3P30H 3JWOL 3PHQA 3MLWL 3MFFB 4QO1A 3MJ9H 1RZFH 2KBGA 1IZJA 2H8PA 5SWZA 3ZKND 1JNJA 1N26A 2GTZA 3MNZA 3DIFA 3HAEH 3QDHA 1RUKL 3LPGA 4JRYA 2IH3A 4ELMB 3VFRB 1KCSH 1S7RA 4J8RA 4PJHA 3DURB 2YWYA 2EZ0C 2XPGB 5DC4B 3HKFA 3V2AR 3RFZC 1WWWX 1OW0C 5DRNB 1UB5B 2FO1A 3QIUC 3MOBH 4LCCA 1WAAA 2JE8A 3OKOB 4JFHE 3V6ZA 1S7SA 3B9KB 1N6QH 5F1IA 4ZD3L 5FM5O 1KPVA 1FYTA 5I1JL 4CN1A 5D7IB 3LQMA 1T2QH 3LEXB 1AHWB 2FJHB 1CF8L 1MHEB 2FZ3A 2VDRL 3OXRA 9CGTA 3HE7C 1LE9A 3DI2B 1L0YA 2FEDD 3P9MA 4YXLL 2BFVH 2QEJA 3D3VB 4P5TB 4K55A 1H15A 5DJCB 3B2VH 4LFHD 1A3LL 2DM4A 1F8TH 2FWOA 3S3PA 1JF1A 4F58L 4RFEA 2FR4B 4QRUA 1L0QA 4L8CB 3E6FB 1CE1L 1UKSA 2FX9L 3NFPA 3G6DH 3V0VB 3HAEA 3ECBB 4FFWC 2YHGA 1OTSC 2ZNWA 4AYFA 4M7JL 1ACYH 1JNHA 5DJXA 3UJJH 3LEYL 5IT2L 1JPSH 4OAWA 5DFVC 2OJEA 1CGSL 4EDWL 5MENB 3MZTA 5CGTA 1JPTH 3O2DH 5GS1A 1QSZA 5GXBB 1A9EA 4GAGL 1OARL 4L8BB 5EU3B 4QHMB 3ZDYF 1TPXC 2UZXB 3LN5A 3UPRB 3GBMH 5HSFA 1UH3A 5I1CL 3ES6A 2C3VA 5BS0B 2LVEA 1H8OA 2BXZA 1P7QD 3MFGB 1HXYB 4PY8J 3CVIL 5I30L 2BSRA 4XNQA 3FOLA 1RZGA 1RZKH 2V2TA 2FIKA 1FZMB 5IB4B 4XTRD 1OP3K 2DQJH 1KFAL 3D2UB 4E9LA 5HD8C 4YHML 2HH0L 3GMMB 3S96B 3I6KB 3VXSB 1P84J 4LVOC 5T1KD 3VFTB 3REVA 3IT8D 3PDOB 2A83B 4WFED 4HH9B 2VLRD 4X98B 3S5LA 2LFGA 2D9QB 3GSWB 4ALAH 2BY1A 2H32A 3E8UH 2CLZB 1Y18A 4X7TA 1L9NA 5D8JH 2J8UB 2HVKA 2HT4C 2OTUB 2OTUA 3BIAX 2Y23A 3SJVB 1CT8B 2EDYA 1KCVL 5F72S 1NL0H 3B8SA 3GSWA 3DVGB 4MWFA 5ID1B 5CZXC 5I6XB 2PYFB 5ECJE 1GGUA 3BDYL 4HZLA 3N85L 4N1HB 3VFTA 2R0KL 1UXSA 2XTJD 3RPKA 3HRPA 2ADGA 1C7SA 3QYCA 2X4UB 4FXKB 5HYJB 1NCNA 2XKNB 1SMAA 3UP1A 2W60B 1S5IH 4M1CD 4ZXBB 4GO6B 4CNIB 1GL4B 1ADQH 3ZHKA 3DX9A 4GXUN 4U1IA 2G60L 3D69A 3ES6B 5I71B 1KIPA 4HLZG 3ALWA 3VRIA 1UT9A 3HI5H 3FAXA 4K3DH 2NY6C 5HHMD 4ZO9A 4K7PH 2PTVA 2HAZA 5K9QG 5AAMA 1V7MH 3RKPA 5MENA 5DC9B 1GRWA 4JFFE 1AY1L 1D9KA 2NY6B 3IGAB 4HS3A 3VE0B 2YUXA 4JM2F 1YY9D 1JNHB 2NZ9D 1G84A 4M6NH 4NM8L 3HCVA 5ENWA 3BRGC 5TGBA 2R0WH 4S0UC 2ICCA 3TNMA 4KKLD 3A67H 4W4OC 2GT9A 5BRZD 3O2VH 5KVGL 3TIDB 2KKQA 4L8CA 4X6DF 2Y6SD 4XPAL 2VLJA 4XXDB 2DF3A 3O2WH 3TFKA 3I2CL 4PGZA 5DJCA 4K94C 3VI3F 1I8KB 2XQBL 3EDFA 4K2UL 4ZOBA 2R1YA 3TJEH 4L3ED 4P9ML 2DI7A 3ULUD 1OTTD 2P1YA 2CKNA 3BEWA 3T0XA 4ENED 4M5ZL 5IFJB 3BT2H 4BFIB 2FJHA 5F44A 2VL5A 5FO7B 3T8XB 4TOYL 3RTQB 5C9JB 2DIAA 1S7SB 1KIQB 4PJ7E 2IEPA 1KCRL 3U4BL 1A6UL 5LAXB 1UB5A 1ZLSH 4C4KO 5E8NB 5D1XA 5HYIA 1T7ZA 2C1OB 4MNGB 4NOBA 5I73B 2JCCB 4HWZA 4PJHB 3RTQC 1UM5H 2JJSA 2WW8A 4NT6B 1FPTH 2MQCA 1KJMB 5D4QA 5C09B 3MUY1 4HEPG 5HXMA 3UTZA 1KOAA 5ID1A 1EUUA 1CFNA 5DD1H 2YN3A 1U8PA 3WHXA 4ZQKA 1A1MA 4NP4H 3VXOB 3T77B 4EXKA 5DEZA 1K9TA 4F58H 1NFDA 3HZVB 3LD8C 4I2XB 4NQCB 3DYPA 1HSBA 4HH9A 2EKSB 2FIRT 2R4SL 4YXLH 2AKRB 5C2BL 1IC5L 3IU3A 5FYKD 5C0JA 1NC2B 1U8OA 3QDJA 1MHCA 3GMMA 5JXEC 1P2CB 1VPOL 1S3KH 1CL7L 4X8JB 5HHOD 5CS7A 4NQSA 4IMKC 1FZMA 5IVXF 4WW1B 2V2TB 4KXZH 3FTGA 5D5MF 4KZDH 4ZD3H 5EUKA 5BW7A 4KKBC 3PIQA 4OLZL 5BS0A 2C3VB 3UC0H 4OZIE 1BREA 1WQVT 1CE6A 2HKFL 4XP6L 3V4UH 3K7UA 1NGQH 3UTSB 4MZ3A 5F9WB 5IVZB 4PRNA 4MJ4A 1MFBH 1FNGB 4R7DB 3NCCB 2Q3ZA 4EI5D 1ITBB 1QUNA 1B3JA 5JIPA 3QUMB 1N5AA 1RUKH 1HCFX 3ARFD 2XYCA 2P49B 5ISZA 2HKFH 1LO3H 2RGSA 4WNQA 1MPAL 2VXVL 1LEIA 4NNYB 4AL8L 5JHLL 1ZHNB 4YBLB 2CDFA 1BZ9B 5FA3A 4LNVA 3ECBA 5A43C 3SCMD 5IB1A 5C1MB 3QCTL 3NFPB 3MXVL 2BVOB 1YEKH 3Q6GL 5B4MC 2F53A 2HFEB 3D48R 4PJFB 3OWEA 4OJFH 2P46B 2D7TH 1YEIH 3BZFB 4NN6B 3CCHB 4QRPB 2F58L 5SV3A 4F15B 4RWYL 2FWOB 3IS0X 3O0RH 1A6TB 4RGMC 5FGBC 4QRRB 3QA3B 3IU4L 4Z5RB 4LLMB 2P5WB 5L8KB 5BXFA 5AEAA 1UC6A 2V2WA 4ZOEA 2BNRE 2DTSA 4NN6C 1A5FL 4RISH 3E2HB 4NHCL 4NP4L 3DHMA 2AW2A 1JWMB 1QBAA 4OGXL 2GJZA 1N5YL 1G7MA 3LEXA 4GQPH 1YPZE 5FIEA 4Y19B 2O5ZH 1ETZB 1JYVA 1RURL 2UY6A 4MAUL 5ESVA 3BH9A 3MNWB 1HHJA 4OZGE 3ZKNC 1G1YA 2CXKA 5HHPA 2YS4A 4LCCB 4P2QD 4JZJA 2EYSB 4PLJD 4QXUL 4XVSH 4JFOA 1HYSD 5DJZB 1BFVH 1XF4B 1U6AL 4NGHH 2M1KA 4K71C 1MWAA 3FB8B 1WZKA 2BHYA 3OKEA 3QDAA 1A02N 5H37G 1NAMA 3MRNB 3IFLL 3NCJL 5LXGH 4MXVF 5EZLA 3S35L 3IFOA 3SKUD 1S9KC 5GGRY 3S97C 2GHWB 3U0TA 4K3JH 4HUXB 5T33H 4WY7L 4YHOH 4OI9A 4M9PA 1I7RB 4MNQD 4FS0A 1MF2H 2J88H 3ZE2F 1UADC 3MRCA 1JL8A 3RWFA 1WF5A 2A73B 1OAZL 4MJ5B 1D5IL 4JPIB 2FJGB 5EWIH 5JOFA 2KL6A 4NWUL 4JB9H 4X80L 3VGHA 4LPCA 2OI9A 3PWUB 4ZSOE 1UA6L 2BVPB 1GGTA 5DMKA 3L1OH 2F5BH 5IESH 3O2WL 5CMAB 5AD0B 2W65A 3DBXB 3ILQC 2E6QA 3BO8A 4MA7L 4WHTB 2NY2C 1ONQB 1BECA 4G7YL 1DQLH 2J5LC 3OXSB 4U3CA 4PJAE 2UYLB 2BVPA 2QHRH 3CFKB 4WV1C 1IILE 4I0PD 3GMOB 1J8KA 4LLVB 1TZHB 2NY2B 3MRFB 5EH1A 5FUZL 1NLDH 2CRIA 4O02L 2QLVB 2VLRA 5BQ7B 3VXQA 3E3QE 3GSQB 2XQYK 4P9HL 1YYML 1XIWD 4YGAB 3RX5A 3ROOB 4LEOB 1CD0A 4XMPH 3BKCL 1G7PB 1U3HD 3MRNA 2AEWA 1JHLL 5F21B 1C16A 2QQNL 2YA2A 1B90A 5IHUH 3NA4A 1B88A 1YMHB 4LCIH 1CGYA 4FFVD 1HKLH 3S37X 1UWGH 4GUPB 4KK5D 3VWKB 3ULVL 1CFVL 1NEZG 1H0DA 1YA5A 2XTLA 1IT9H 2PW1B 5L0QB 1HINL 1QO3A 2OBGA 4TSCL 2A6KA 1I85C 4FFEX 3K0WA 3BYTA 4WO4D 5EBLB 1GIGL 2EC9U 2Y4SA 5I18H 3S4SG 1HH6B 1MVUA 3EHBC 2VJXA 4MQSB 4KK8C 4Z5RA 2XTJC 3BKMH 3GRWA 5J1SC 1DBJL 4XH2B 3RY6A 3O6FA 4HIJA 1FL5B 4MMXC 1KSRA 3C8DA 1OW0A 1Q94B 1FZOB 2F8OA 5L9DH 4JFFD 3U4EB 4KRNA 1EDQA 5DXWA 5D7IF 2H6PA 4GMTH 3L3HA 5GHWL 5T3XD 5EU4B 1XF3B 5LBSL 4CMHB 1LEIB 4MA3A 3FCTA 1Z9OA 2EECA 3JV6A 2HLAA 3B4NA 2F74B 1HHHB 1J1OH 2QR0A 3SDCC 3GEWB 1CDYA 1UVQB 5KAQG 3OKMA 1FNGA 4DFIA 4DVBA 3GKZA 2VSCA 2YR3A 3VCLA 3TLRA 1FVCA 4BZ2H 3SDCB 4IRZH 3CZFA 2OXHA 2YD2A 2P24B 4Y4HD 3BVNB 3VXRE 4GRMB 3L5WB 3H8NA 2EC9T 3CD4A 3SQOH 5TFSL 2ZOLA 4I0KA 2DB8A 1AJ7L 1KEMH 4BUGA 5EU5B 3C9NB 3UYOD 4RAUA 1LE5B 2E7LC 4MDIA 2DLFH 4LNRA 5C0JB 1RUQL 4JN2A 1NLBH 3QH3A 1EFXA 5I8EA 4M7LH 3MLXH 1FAIL 3OF6A 1YEEL 3HZVA 1MNUL 4JY4A 4G5ZL 1KACB 2EIEA 5C0EB 4U0RC 3NPZB 3T77A 4M7KL 2XY1A 1EVTC 1IKNC 1OLLA 3AXLB 2AJUL 1FFQA 2R1XA 5BZWA 4KI5C 3RHWF 4CJ1A 5JW4N 1T22A 2EO1A 3MJ9A 1CXFA 5FF6A 2BNQA 2ZOKA 1WITA 4OLWH 1Z3GL 2D7QA 3X3FH 4ETYA 3DRQA 1LK3L 1KJMA 4OTXH 2R0LH 5D1QD 4C83B 3RX7A 5C08E 1XGUA 4BKLB 1KB5L 5IB5A 4Z76B 1MJ7L 2P8MA 3QCUL 4CU6A 1AR1C 1A6WH 2LTQB 4V3DB 5D7SL 5E8NA 2MPAH 3D85A 1D5MA 4PJHF 5LAXA 3DPBA 3ARXA 4RIRA 5E2UH 3GKWH 3DWTA 5JW4Q 1D6EA 5C9JA 4C59B 1MRCL 3TJHA 4U1HB 4F7CB 1J0HA 5F7WC 4LHQB 4DW2L 2LTQC 4G3YH 2VL5B 5E2WH 4PRPA 4PJCB 1I3GL 4BFIA 3BIBX 4HFWA 4J3OC 5I1IL 1RZFL 4HMCA 5DA4A 3OZ9H 5CD5D 2E9BA 2R8SL 5JDSB 4XBGA 2XWJA 5IBUB 2MKWA 4JAMA 1ZWIA 1X5AA 1SEBA 4HBCL 2W0PA 3ULVE 1XGTA 3SE3C 5LWYH 5T1LD 4K7PX 4WEUD 4X4ZA 5HI3D 3FRUB 4HBCH 4M1DL 1ZE3C 4FTVA 5SWSE 4FN0A 3MRHA 1KN2H 3L9RA 1YEEH 1QFUH 1MQKL 1Z0MA 3CUPA 3WFCL 3T4AB 1NBYB 2GY7B 4NSKB 4WI8A 3SE8L 1XCQB 3DX6B 5EPMA 3BYYA 4OV5A 43CAA 4UDUA 3MBXH 1T4KB 3LKRB 1CDCA 3NZHL 2VLME 3C2AL 4PY7B 4JHZA 4G6MH 4POZC 4TVPL 3SQOL 4HD9A 3IVKB 1BJ1H 4PP1C 5FHAL 3VI3E 3C08L 4G42A 5DWUL 4HUWB 1MCOL 3QEHB 1DBMH 4PJ7A 4B5EA 5I8KH 4KHTH 3N1GC 1U91A 3VRIB 1RIVL 1KIPB 5J9PB 4HC1H 2J8UE 2C1PA 3QB7C 1AKJD 4LVOB 2XN9E 5KSBA 3JVGC 3WFEL 4ZXBA 5IEKA 1JMZA 4JHBA 2I5YL 2WUCL 4Y4FB 1MUJB 2D03H 4M00A 3BAEL 5HYJA 4Z95L 2IADB 2R9HC 1AFVH 1R5WA 3FZUC 4Z0XA 3FO1A 4DGVL 3NZ8A 5B8CA 5D6DA 1F3DJ 4HZLB 2HWZL 1DQMH 3GK8L 2ICWA 2IPKA 4CVWA 2NCMA 3ARBB 5KVDL 4K7FA 3C5JA 3OX8A 2PO6B 3DVGA 1YUHB 3FO2B 3NTCL 3T4YB 3SJVA 4GRLC 1KG0A 4DKAA 2DYPA 2O5YL 3SDXF 1WLHA 5KN5A 2H32B 3FB7B 3VWKD 3IDMB 3O6LL 5KS9A 3BKML 3S5LB 1KEML 5D6CB 1RIHH 1OD9A 1MH5A 5E7BA 4W6XB 5C92A 5FECB 3QPQD 4YDJB 4WTZG 12E8H 4JFDB 2VXUL 3QXDB 4BSJA 4BZ2L 1NCCH 1G0DA 4IOFD 5KOVC 5GGTH 3C8KA 3MLRL 4Z6AT 2NQCA 2BSRB 5D6DC 5I75C 1ZA3A 4GRWB 4BELD 2MSPA 4QHNB 5CGYC 1U8IA 4NC1C 4N0UA 3BXNB 4D9RD 4I0PB 3U79A 5E6ID 5EBWB 2GFBA 4QXGL 5EZIL 4LCIL 3KHQA 3MJ7B 3LKOA 1S7XB 1Z2KA 4DK6A 1KTDB 2XQYG 4U7MA 1UH2A 3ULVC 4N90D 7CGTA 5A2JH 4FFYL 2DJSA 4P9HH 4JPKH 3TFKC 1DBJH 3OR6A 2I9TB 3V0VA 1N8ZB 4WUUA 2CLVB 1MIML 2DQIH 3ARGA 2EIZB 4ONFL 3E6FA 1JFQL 1ZAGA 2BHUA 4Y89A 1MOEA 5I18L 4Z78A 5FHBH 5L7XL 5MHSD 4P5TA 3T0EB 3W9EA 3SPVB 1KXVC 3S37H 4G7YH 1WZMA 3MCKB 2JK5B 3P9MB 3CSPA 1R3HA 1A1OA 3ZYIA 1LE9B 2NY7H 4A6YH 5F7LB 1F2QA 3GB7A 3NPSC 1IM9D 1BIIB 1OGAD 1OVZA 4KJYA 4Y5VC 1AHWA 4G8FA 4ZAKC 2GI7A 4P57A 1U3HC 1IKFH 2B0SL 3OB0K 1MHPL 4NO3A 3QSKB 4PP8C 4JFYA 5HI5D 4NWUH 3NCFB 1UFUA 1JN6A 2DL2A 4OLEA 3T0DA 1CXEA 5DRNA 4EI5B 5EIIB 5CP7B 3H6JA 3NCYP 2SEBB 3MQIA 5EO0B 1HCVA 4P3WA 3VFGH 3MRGB 5TDPA 3BN3B 5DJ6A 1BF8A 2EDOA 5DFVD 3O6FD 4P48A 5EZIH 1CXIA 1W0WA 2ADJB 3KPSE 3CIQA 3ARSA 3JV5A 4JFEA 2NY3B 5F3BA 3H42L 2ICEA 1L7IH 4ODHH 2H8PB 5CJOH 3UO1L 1S9YB 3NOIA 2I27N 5FYKE 4MCZB 2DWEA 4QRTA 4GAYB 4IOIA 1FBIL 2HLFD 2CO7B 1M6OA 1JYNA 4L5FL 3RNKA 3RIFK 3P0VL 2FB4H 5B39B 3VFUA 4PJAB 5EZOH 5BVJA 4I3RL 5J06A 2FJFB 4H5SB 4X5LA 3WIFA 4NFDA 3L1OL 1KLGB 3LN4B 1BHGA 1QHPA 2C7UA 4G8GA 2ZKHL 2B39A 2AP2A 3U4AA 2DMCA 2UWEF 4GS7C 4R0LB 4JB9L 1RJYB 5LGJA 3LHPL 4U33A 2YD6A 1VA9A 3QFJE 4KTEL 5L2KB 3BGMA 3BMVA 3HNSH 3HUJA 1YMME 1X3DA 2YD4A 2D0GA 3VMNA 3O0RL 3D6GA 2GY5A 1OTUD 4ZS6D 4DFHA 1XEDA 2VE6A 1M05B 3BPCA 3PWPE 4GSDH 3QQNA 4Y5VA 1PG7W 5SX4I 1MCQA 3NCJH 15C8H 4PYGA 1HDMB 3FO0H 4KJQD 4Z95H 1KPRA 2YSSA 1XF2B 3CX2A 4DAGH 4YXKH 2W9EL 1MLBB 2I5YH 2WUCH 3MRMA 3TBTB 3AUVA 1I8MB 2YUVA 3FQWB 5FM4A 4NNPH 1FO0H 2C3HA 1ZANH 2BY0A 4LSRH 3LIZH 2MMXA 5IVNA 3G6AB 1A7NH 2F54A 3O4LE 3DUSB 4D94A 5EOCH 3GHEH 1YY8A 5FYJH 1IGCH 5ESQA 5B8CC 1A2YB 3E2HC 3J8F7 3AROA 3F12A 5E70A 2O61A 3NZHH 5HJ3A 1A5FH 4KZDL 4ZTOH 4KHXL 4F33B 4YNYB 2X05A 2VLKD 3EUUA 3QWRD 1UCBH 5KJRL 4NN5C 5F88B 4ENEC 4F15C 4R4BB 1CDUA 5EC2A 2VN4A 3OAYK 3MRPA 3WFCH 3QUML 2GSIB 3SBWC 3L95B 5BO1L 1NCAL 2X9WA 1KN2L 1RSFA 3MLSL 4QRRE 4UU9B 3GMNA 1LHZA 4P59L 5DHXB 2X4QA 4NQEB 4PJ9D 3Q6GH 4HK3N 4OZGB 5C0DA 4OGZA 4D2NA 4KK8D 1MAMH 3O11A 1RV6X 4WFFE 4JFPA 3DXAA 3MV9D 3B6SB 3WS3B 1VKXB 1GYAA 4U7SA 5HYSG 3HFML 4ZUWB 2OCFD 4GG6B 4L9LB 4HAFA 1BD2E 5GJTL 2AK4D 2CKBB 1LWRA 4X4XB 4XHJD 4LLWA 2L0DA 2WBJA 2X4NA 4PTUA 2ZG1A 3IXAB 4IMLA 3T1FA 3UJIL 1KCUH 3WLBA 4ELKB 2GKIA 3EO0A 2JF1A 4YHNA 4Z77A 1ZGLB 4GRLA 4OI7A 1ZLSL 1L7TH 2CLRB 1JZ5A 1ZGLP 3INUL 5D2LE 1A7OL 1AD9A 1MJ7H 3D87B 5KSUA 4YHZL 3PDGA 4JDVB 1V7NH 1DVFC 2G2RB 3H3PL 4O2FA 4FP8H 4UV4H 1PFCA 3HRZA 3RU8L 3KPRB 3K8LA 5CJ5A 1EERB 4YWGH 2V6HA 4PLNC 2R4SH 2KPNA 4RAHA 3GHBH 4JM2C 1EH9A 4CADB 1KB5A 4OCXH 2WNGA 2B8OT 1HOCA 1DN2A 4JY6B 1A4KA 3I2CH 4WHDA 3TM6A 4JM2B 4RQQB 4HHAB 3UX9B 2XFXA 4AH2B 3B3IB 4P4KD 4Z7VA 3C6SA 3S36H 4PG9B 2XWTB 1AGFB 4HLJA 1IL1B 5F7EH 2BNQE 4Y5XB 1DTUA 2AJ3B 4EUPH 1N0XH 1LD9A 2GCYB 2ERJB 5F3HA 4X4YB 2Y36H 2P8PB 1TMCB 3OB8A 3KPNB 4N8PA 1IMHC 4I77H 5DTFB 2IG2L 4MX7A 4RZCA 1F4YH 3V0WH 3NGBC 3L3OA 5L0QC 3VFMB 3VD7A 1ZT1B 4FQLL 1BGXL 3QDMA 4XWOD 1B4RA 3V79C 1OWWA 2Y06L 5FB8B 4K7PL 5E08H 1Y0LB 3RVVC 3HI5L 1FVEA 1U8JB 4YO0A 4PJDA 1FYTE 4M5YH 3RVXD 2R4RL 1FFOA 3HPLB 2V7HA 4Q9CA 5A3ID 3A6CH 1RZJC 5C07D 1S5IL 1WC7B 4Y7MA 3L7EB 2ICES 2VZUA 2XQBH 1RIUH 4OT1L 4ETQA 1QG3A 2XN9D 3ME0A 4DN3H 3VG9C 3WJLA 3ZTJH 2IFGA 3WE6A 3PGFH 3W2DL 3PWPB 1EHLL 25C8L 3GSRA 4X5XB 5BV7H 1CGVA 4P2RA 4RNRA 3SO3C 4YFLI 4FQQB 3QQ4B 5A3IC 3P4MB 4NCDA 4QF1A 2XWBA 2CDGA 1OSZA 4J4PA 5L8LB 4P2RD 3STZA 1T03H 1YEJH 4NUJA 1MCJA 1FN4A 4ODSH 4MDJA 1NDGA 3B5HA 3GJEB 3MGAA 1X6LA 1Q9LA 4TSBH 1TJHH 1TJIL 1SJHA 1IZKA 5H8DA 4NHUE 4BFBD 4IIQC 4HWEH 5CBAA 2P4AB 2CK0H 1FV1B 2Q7YA 3MBEA 5KSBE 4V1DB 3ZKQD 2NY1B 1A7QL 5IK3B 3QP3A 3MZGB 5DMJB 5KBNC 1FIEA 1CXKA 1NGZB 3P4OB 2Z31A 3V0WL 1F4YL 1DL7L 3QAZC 5I1LB 3BDYH 5E94B 2IMMA 3WXVH 3FB5A 4JRXE 4PJXE 4WW2A 1NL0L 1VFAB 2DL9A 4JY5H 2VQ1A 4U4BA 4ZNEA 4QOKD 1IEAB 1NGXB 5HHOB 4F7TB 3S36L 2IANB 5EBMB 1KJ2A 5DSCB 3N06B 1A3RH 3EFFA 2FX9H 4PREB 1ES0B 3F5WB 2IAMA 3QO1A 1L9MA 4JHAH 5CGYD 4HIIA 5DD6A 3KLHD 4PJIA 5K9JL 2WP3T 4PRIB 3VG0H 3W9DA 2VXSH 5T3XH 1UA6H 3QULA 3RU8H 4DZBA 1J8HD 3IJSA 4FP8L 1CR9H 1WUNT 1XF5A 2LVCA 1JGVH 4TNWF 1ED3B 1ZMYA 5HGAA 3BP4A 2NY0B 5J1AA 4E5XB 4CMMB 4JHWL 3TBSA 2W59A 4GBXA 3PQYB 3MPCA 3V6OC 2N56A 1U0QA 4EIGB 4NCC1 3BOVA 1V3JA 3FONB 1IGYA 4QHUB 5I74C 4LFHG 1DUYB 3BZDA 4NJAH 3PWVB 4KRPC 3ORJA 3B2UC 5DK0B 4KRLB 4NGHL 4IBLT 2AXGB 1J1XH 3M8OH 4WWID 5FA4B 2ED7A 4WI7A 2BC4B 3RUGF 2YC1B 1K4CB 3UBXA 3OTTA 1RQ5A 3IJHA 3OBAA 4TUJB 5AWNL 3OJDB 2Q6WA 5D7JC 2OS7A 5I19H 5HI5C 3D39B 1Q9KB 1XIWB 1GPOL 2XG5A 4HGWA 4H88H 3KNBA 2BCKA 2C5DC 1OCWH 5GGUA 2PR4H 1MCKA 5T3ZE 3JTSA 4AEHH 2VWEC 5IW6B 1V3KA 3X14A 4NO5B 2LE9A 1OL0A 4NQCE 3BP6B 2WSKA 1N59A 5FAAA 1IAKB 3VFVA 2F19L 3W81A 3WFZA 2CIIB 5K93A 1A7NL 2EH8H 3NAAH 1S7UB 3TF7C 4N0FA 1F97A 2AV7A 1AXSA 5DHYA 5GGQL 3STBA 5EUOB 2QKIA 4JG0L 1FCGA 5T3ZL 4FQXC 2IBGA 2VUYA 4HXAH 1IM9B 1JI1A 1OGAB 3CFBB 7FABL 3UTSD 5KTEL 4P2OD 4U1SB 4N8CH 4PJGA 4XP6H 3V4UL 5B3JF 1IEBA 3O3AB 4R8WL 2R1WA 4UUJA 2ZWLT 4FQIH 1P9MA 4ZYKB 2AEQL 2MCG1 3CFJB 4OM0L 3MRIA 4BZ1L 2R2HB 4JFZL 1UXWB 3F58L 4PJEE 1K8DA 2KH2B 4LLYB 4ZFZB 3KPMB 3HNSL 1TVHA 5M7QA 3GSNB 3L5JA 3S34H 2PO6C 5MI0C 1WSST 2DM7A 5DUBA 5KVEL 4GFTB 3DGGB 5SX4H 1JGVL 1WTGT 3G9AB 3QDJE 2XICA 2RCSH 4YHLL 5IJVA 4O2CB 2VC2H 3M45A 4TUOA 1TPXB 4D0CA 3DO7A 1EAPB 1DEEA 4JQIL 2RFXB 3IDNB 4HKZA 5AWNH 5J6GB 4Y4HA 1G7QB 1MCWW 4ZG1A 2YRZA 1IQWH 2V9QA 2CRZA 1K8IA 5KANI 4JKPL 5KVFL 3SDYL 1NBZA 5TE7H 3ELAT 1JCKA 1G0XA 3BGAA 4H25B 3CFDA 4D9LH 1KGCD 5J1TC 1KV3A 4PLKD 3ZDZE 1KPUA 5DRWA 3IFNL 3ZE2E 4BQ8A 4BQ9A 1M4KA 1BMGA 4F7MA 2JLLA 3MLZH 1EMTL 2UUDK 5HI3C 4HIEA 3GRWL 2BNQD 5A16A 1YMMB 2J6EH 5I76A 3ESVF 4Q2ZA 4NRXB 1MHPH 5CUSH 5GZNC 1UWEH 1IKFL 4H0IA 5AZ2H 2G5BA 4P46B 3WL9B 1UZ8A 2G75B 3QQ3A 1A7RL 1BIHA 2NY7L 1SVCP 3DVNB 4Y5YB 3EYVA 4ZSOB 3IRZA 3NVQA 4Y8AA 5HYSB 1ZOXA 4U7KA 4U3XA 3FFDA 5EOTB 4QHKI 1YY9C 2ADIB 2CJUL 4PGJA 3W39A 2UWEB 2X4PA 3T0EC 3GJFK 2FEEL 1IVLA 1H3UA 1MIMH 2DQIL 1KIRA 5EO9B 4LIQL 3D18B 1EHLH 3U36A 4JPKL 1CLOH 1IAOB 4PJEF 2PTTA 3LEVL 3WXVL 4GG8B 2R9HD 1P7KA 2D9CA 4H1LH 4JRYE 4NYLB 3TBYB 3PABB 2NNAB 1IAII 4X7FC 5CWSB 4MNQE 5FK9A 2VR4A 4M61A 3G6JF 4WGWB 5I66B 3EOTH 1J8HB 4HMDA 2IALA 4JRWA 4K3DL 1KCKA 2X42A 3A6CL 2YN5A 4M8VA 1H5BB 1BFOA 4NKOA 4JJ5A 4M5YL 4QT5A 4WU5A 2B2XH 1K4DB 3IAPA 4N8VG 1WCBB 5ICXA 5KSAA 3FO9A 1PEZA 4LF3A 4MB5A 1CS6A 1Y6KR 4X6BA 3RWEA 4GS7B 3CFCH 3QI9D 4R0LC 4JM4L 5IIEA 4X9GA 2YMXH 3EZJB 3NN8B 4MXVE 1G7IA 3SE4A 3VFWB 2FL5A 1DVFD 2VH5H 1IGMH 4NQVB 4TVPD 4PS4H 1C1EL 4Y4HC 3EGSB 3VFSB 3L7FA 2ID5A 2X10A 1YN7A 3PWPD 3NIDF 3BW9B 3MGOA 5ERWB 4BSWB 3RA7L 5JW3L 3E6HA 2OL3B 2BVQB 1FVDB 2E9JA 4C56A 4DN3L 2DQDL 3EOAB 5I73C 3OR7A 1BVLA 4TRPL 3MGOB 5C0IA 4ALAL 4GKNB 4UILL 3QEQA 1GZQA 1CZ8L 2CIKB 3I9GL 4L29B 3MV8A 5DJ2B 4N1EA 5J13B 5LKNA 3CMGA 4PJ7F 4MCYA 1HQRB 1ZVYA 4P4KC 3ARBD 3KR3L 3D3VE 4XNMB 5ADOH 5T1LA 3LV3A 1YEFH 1MI5E 2LQRA 4G9FB 3ULVD 3BEVA 4A6YA 2D03L 1A9BB 3QPXL 2IAMD 3PP3K 2UVFA 4H26A 5E4IA 1G9MH 4ZUSB 3QZWB 5ADPL 1X5XA 5IR1B 4EJ1C 4YHZH 4RMUA 1BLNA 1EAJA 2Y07L 5GS3A 4NKOB 3LD8B 5GSRA 4OZ4B 3FZUD 4Y16B 2DLEA 4CJ0A 4KQ3H 1FQ9C 4KWUA 4KHTL 3SDDC 2APXA 4X6DE 1OTSD 4HPOL 4I77L 3C08H 4WI5A 5EFIA 3BN9C 2E7LA 1GOFA 3R1GH 3JTCA 1BOYA 2NLJB 5IW1A 1J8HE 1LK2B 3D0VB 1HHGB 1LQSR 4Z8FL 4HG4J 4FG6D 1ACYL 1P53A 1IAOA 4RFNC 2Q86B 5GJTH 2GJJA 2EEDA 4D9QE 4G7VH 4YGVB 5E2VH 2EDWA 5EO9A 5F7YC 3V0AC 4G8EB 1I8LA 3KAAA 2O5XL 3JTTB 4LAQL 3RKDD 1CFQA 3V5HB 1VHPA 3O4LB 2JKXA 4BQCA 2JJWA 3DO3A 1F8TL 4FQHB 1SBSL 1ZHLB 3K80A 4XNZB 4LOUC 3L3GA 1R5VA 4HT1L 1DQQB 4XNXL 1OAQH 3TT3H 5C0AB 5FYJU 4XGZB 5CEXB 5IB2A 5MEPB 2ESVE 3H7BB 3DMMA 3TCLB 1NMBH 4GW1B 5DEGA 4KUZL 1ZXQA 3VU2A 5H2BB 1PG7H 5I1IH 1CBVL 1PKOA 4NPYB 3VXNA 4APQD 4ZTOL 4G3YL 3LQZB 1TQCC 2E8YA 1JZ2A 3UPCA 3MOBL 3VW3L 1OB1A 1O7VA 4JDTL 3UJIH 1PSKH 4PJBF 4IRSB 4F7MB 2PYEA 4LOUD 4FZ8H 1JMXA 1T0MA 1KCSL 1IGIL 2MQ0A 3V52H 5L2KE 4G6FB 4ERSL 2VIRA 1ZHBB 2X1XR 5D7JD 1G0YR 1R6VA 3KLHC 1UWXH 5ALCH 3LRGA 5L8JB 3R0MA 3FQNB 3PP4H 5IWLC 5IROA 4LLQA 1V3MA 2E9IA 3F65A 3AS2A 2BRRH 1DANT 3KPRD 2FSEB 4JFXB 4P59H 4GBXC 2VDPL 4LK4A 2VABB 4Y4KB 3O8XD 5C0BE 2FO4A 1CICD 4DTGH 4HG4K 5BO1H 1OAQL 3TT3L 2HTLD 3IDNA 4QWWC 1J1PH 3QXUA 1AGCB 2NX5A 3FMGL 1FCCA 2ZUYA 4PJCF 4E41B 3FQRB 2DLFL 3BUTA 3GMLA 5DJYB 3UAJC 2VLJD 4X0KA 1I4FB 3BFOA 1XGRB 3HPJB 3EYSH 4HUNB 4MMZC 1O0VA 3VMPA 4I3SL 5D96B 4XBEH 4OCYH 1LP9A 3GHEL 3PNWA 3KPMA 5IF0A 3GBLA 1EHNA 4Y5XC 4BQBA 4UB0L 5D1ZA 3KXFA 4TTDC 5D72L 1S7WB 2FB4L 3Q48A 4HWBH 2Z35B 4N0YL 4L3CA 3MRQB 5D96C 1FLRL 3V8OA 3V7MA 3UZQA 1E6JH 4Y19E 2EDRA 3O6FC 1P4BL 1MFDL 2V5RA 3D9AL 1MJJA 4L8SC 4B7LA 3G6JB 4NQDB 1A4JA 3QIBA 4YEEA 1F4HA 1IC7L 4EQ3A 1KBGH 5DHYB 2W0KA 4Q7DA 2H2SD 2CMRL 2I9LB 5DLML 1KN4H 1GVIA 3VFPA 2YEZB 5BZDA 4N0FB 3H9ZA 3G08A 1NKRA 1YEFL 5E6IA 1IAKA 5CLTA 5CAYB 5DRZA 4LHUG 1C12A 2KQNA 3H0TA 4WU7B 2Q3AA 4MA8L 1TDQA 3VXUA 1ZLUK 3VG9B 3VXSE 2J8UF 4NJ9L 3QNYB 3K8KA 3PGCB 4OZFB 5JNYA 1HXMA 5I1EL 3KNBB 3QT2A 5D2NA 1P4IL 2A9NH 1N7MH 1ORQA 4IIQB 4ZO6A 5FO9A 5DD3H 2V5SA 1F90L 3GJFB 3WJLC 1Q9WB 3WXWL 5CKAA 4N0RA 1X4XA 3UZEA 4D0BB 1HINH 4WU7A 3H0TB 4PGCB 2UV3A 3H42H 4ODHL 4PJBA 3QAZB 5ITBL 1HILB 3CFCL 1G9EA 4RCAA 1F11A 2QSCH 5HPMB 4QXTB 4NRYA 4MXQC 5CJXA 5JLZA 4BH7A 1H8NA 4H8WC 5E9DB 1PGRB 5ISZE 2B20A 1TENA 1I9RH 3ILPB 4HIXH 1DUYA 1VFBB 2VXTH 4WI4A 5DEFB 1RZIB 3VFGL 4XMPL 5TE4H 4GXUM 1EFQA 4PIRF 1A14H 5GS0D 5HDOA 1I9RL 3EOTL 3OAUL 4XP5H 1JZ8A 3G6JA 1A22B 4OIAA 3QHFH 4MAYC 1X5ZA 1JGEB 4IDJL 4JPVH 1E27A 4U6VH 2F8VA 5FYLD 1MFCL 1OAKH 4PJEA 4R7NA 3ZDXE 4CMMA 5I9QC 3SGDI 2ZJSH 4MYWB 1NFKA 4U1LA 2ED8A 1JHTA 1AGBB 3QULB 4LIQH 5C0AD 4JFDE 1MJ8L 1EXUA 2APWA 4XCFL 3S3JA 1MEXH 2VQTA 3OPZH 3N0PB 1XGQA 4FQJL 4Z7WA 3U6RA 1MRFH 2X40A 1S5HB 5FUCE 4U0RB 5EOQL 5DJYA 4ZUVA 3F5WA 4KK9C 4XVJL 4NQDE 2IH1A 4G6KH 2DQGH 1RIHL 2AABH 2EDKA 4MVBD 1RAMA 1MLCA 1LNUB 1KJ2B 4RGND 2QV2A 1QRNB 4J12A 3N1QC 3D5OF 4XAWL 3LKPB 1D5IH 1NGXA 1E27B 5CIPH 1AXTL 5FM5M 5E24E 1HEZB 1GC1H 4KK6C 3ZT5A 2LAAA 1I1CA 4X7SH 2DWDB 1T1YA 4WY7H 3GK8H 5C9KA 5IM7A 1KTLA 2YPLE 3TA3C 4ZNCD 3BD3A 3GGWB 2IGFL 1LP9F 3LS5H 3VDCA 4YPJA 1ZHBA 3WUWG 3QEQD 4BH7B 5JLZB 3BAEH 2Z92B 4QXTA 2ZUQB 3X12B 2JTDA 1U6AH 1I1YA 5C0CD 2P5EE 5JO5A 4XVSL 4KRPB 1VEPA 3WFDL 5C6PB 3QHZH 1OB1B 2NY4C 4Y1AE 3WIHH 3RVVD 4O5LL 3ARDA 1WZ1H 4KZEH 1OF2B 4WENB 4MAUH 1Q9LB 1T6WA 4XBPA 3VXNB 4NPYA 1ZSDB 1FN4B 4IIQA 1IQWL 4I3SH 2X4OA 4KJPC 1J87A 1KC5H 3RGHA 1R24B 4RISL 1DBKH 3C2AH 4Z7UF 1MSPA 2VLKE 4HS6A 2XZCL 2AGJL 4P4RA 5J8OA 1JIBA 4PRHD 4PB0H 4HCRH 4N9OB 2H3NB 1ZHLA 1J1PL 1G7JA 1P5VA 4FQHA 3RY5A 3HN3A 2F58H 4J6RL 2NY4D 2EZ0D 1QR1A 5KVDH 3JTTA 1DQML 3E3QA 2H2PD 2P45B 3WD5H 4B41A 2BRRL 4XZUA 4YLQT 1URLA 5BZDB 1CD8A 2GTWA 2F9BT 3HE7B 4OLXH 1U8MA 4BM7A 3JWOC 3ZKSD 3HS0A 2ZSVB 1WC7A 1CK0H 1A4JB 1M7XA 4K3EH 1RU9L 4HCRA 5KTEH 4ERSH 3V9FA 4XI5D 4EBQL 1I3GH 1U8JA 1IAMA 1FVEB 3MXWH 4YO0B 4UNTA 4KI1A 2P44B 3MV7A 1Y0LA 2R29H 1NDMB 1NGQL 5MI0B 3ZL4H 5FYLL 1ZLVH 3IDUA 3VGAB 2Z35A 2E8ZA 4MA1C 3GKWL 2X89D 1KENL 1EEZB 4LMQI 5IR1A 2DD8L 2CXGA 2KZ1B 4OCSL 1TLKA 3DARA 4RGNE 5MEQA 4IRJC 1BP3B 1XGRA 2AJZB 2BNRB 1JZ7A 3QDGA 5JIIA 2XA3A 5D71L 3BPNB 1LK3H 1IL1A 2Z91A 1AGFA 4E41A 1QBLH 2AEIT 3HZKA 4MCYB 4KVNL 3FJTA 2XFXB 2XT1B 3V95A 1UB6A 1OCWL 1J86A 3EOAA 1XGPB 2R56H 2D31B 1FIGL 4AG4H 2VZ1A 4MS8D 3QEQE 4Q6IC 4YIQA 2Y1VA 4NCC2 1JNNH 3HC4L 3KGRA 4NC2B 1G6RL 4CADA 3MRDB 5BRZA 3LPFA 4PTTA 3BDBA 4O2FB 3BQUA 2G2RA 1SVZA 1AE6L 1JFMA 4TPRH 2W91A 2X4TB 5KSUB 1OAUL 4ORGA 2FYYB 1T0MB 1FG9C 1I3RB 3CX5K 4FNLH 2BSSB 3T0AA 2MPAL 3AMKA 1CDHA 2NYYC 3NFNA 2XZAH 4QT5B 1KCRH 3K81A 4X6DA 1R3JA 4ONHB 1HWHB 1DN0A 1AI1H 3RHWK 2IALB 4TOYH 1J8HA 3ET9F 4LCWE 4LLWB 5JTWA 5HHMA 3BJLA 2XZZA 3NIFE 4RBPK 5E5RB 4Z7NE 3VXMD 4AMKH 3I85A 5DEGB 3ZE0E 5HVFB 4QWWD 2NW3B 1VDGA 1G9NC 3PGDA 4OLYH 2DBJA 3EOBA 1BX2B 1ZLWH 3TJEL 4M7KH 1DQQA 1Z5LB 4U6TA 3UYPA 4LCWB 4UI2A 5D2LB 5CEYA 5C0FB 1CZ8H 3I9GH 5T3XL 2ITDA 1CFQB 2VLLB 3MTRA 2HVJA 4P5MA 3BIKA 1MCBA 3BIKB 4P5MB 1S9XB 2A6JB 4ZAKA 3O2VL 3KYMB 1D5BB 2ICWI 2FECI 3TZVB 4J23A 4LKCA 4KMQA 5FGBA 2DIJA 1G7LA 5I1HL 1X6NA 5CEYB 4JJHA 4WEMB 4NWTH 1RUML 2EYRA 3EYUL 4M6NL 1LQVA 3QEGL 3EOBB 4FZEL 1JVKA 4ELME 4UIKL 4NKIL 2NW3A 3PHOA 4MNQB 3MROA 5HJ3B 4XC3L 3M07A 1WT5A 1WIUA 1H3PH 3QQ3B 1JPFA 5HDLA 4YAQA 4JO4H 3DUSA 1FORH 1UM6H 2PW2A 4UNUA 3VXSD 2XXCB 4OZ4A 5GSRB 2XKSA 1DL7H 3QWQB 1ZVSB 3QZWA 1VERA 5JHDE 3FQWA 3P0YL 2BHZA 3O9WA 4KAQH 4LGRB 1OP9A 4UIMA 4HK0B 5C6TL 3CX5J 4XCNB 4G9FA 4HWEL 1IC4H 3G5YA 4R97B 4QYOA 5JMRA 1D3CA 4Y5VB 5TH2A 4I5BA 4CVZB 1ZHKB 2RQ8A 1OM3L 4C56D 1I1AA 2WWKO 4GKNA 5C0IB 4WFGE 4YIQB 4QOKE 4ZFOB 1T03L 2E6PA 2ZZUT 3HUJB 3V6OA 4FRWA 4PJ5D 4PGEB 3W0WD 2D31A 1MCPL 4Y4HB 1YN7B 3QEGH 2R69H 3MCG1 1EAPA 4V2BA 4ZOAA 5DQJB 4O2CA 3RBSA 2OYPA 2I07A 4YZFF 5T5NF 2PXYA 1GGYA 2H9GA 1OT1A 4X6BB 3RWEB 2P8LB 3ZKXB 5MEQB 4BQ6A 1IC4L 1WCBA 1RIUL 1K4DA 4BJLA 2V17H 2DWEB 1UWEL 1CVRA 1CIUA 3MRIB 1MFEH 3GBNH 1UWGL 3KS0H 5IV2A 1H5BA 3G04A 2ICEB 3VD4A 2QQNH 1OAZH 1EMTH 4NZTH 4RGOL 3NIFF 2J88L 3I84A 4GAGH 2GJ6D 4G80A 3OJ2C 4YHOL 1IM9A 1OGAA 3CFBA 1KJ3H 4A2MA 1UM6L 1P7QA 2NNAA 3CC5A 5DJ6B 2N7AA 3GFUA 4U6YB 3WYRA 2YK1H 4EI5A 3P77A 1CYGA 2HT2D 3HE7A 3CMOH 5TE7L 1OHQA 2AV7B 5FV2A 4XNZC 5I1GL 3SDYH 4NO3B 5D7LD 3RPIB 1KIRB 3U48A 5JOEA 1XF1A 3HI6H 3ARWA 3VFVB 4XTRC 4QRPE 4QXUH 1QR1B 4NN5B 2X4PB 3QRFM 3W39B 3CSGA 4P2RE 3GB7B 4JKWA 4PJ8A 1YQVH 3TVMA 4HH8A 3NACL 5FYKU 1E0OB 3TPUE 2YUZA 4UT7L 1GGBH 1JNNL 3WUWA 5HDBF 4Y5YA 1R5IA 2DQEL 4AM0B 3TIEB 1R24A 5D7LB 6FABH 3EZ8A 1FIGH 5FCSH 3MA9L 1TJGH 3WL9A 4P46A 4LL9A 1CLCA 4LU5H 4OCXL 3QJFB 4XBPB 1T1XB 2BNRD 3D39A 1T2QL 1JGDA 4YWGL 5JORB 4WUUB 5F8RC 2GW5A 3CXHJ 4BZ1H 5HTSA 3OJDA 2WWKT 3V5DA 1NANH 3IJHB 4TUJA 3QDJD 2A0LD 1I1YB 2DDQL 4N8CL 3LDBC 1S7QA 3O6KH 3O4OB 4IEFB 1KPUB 1NPUA 4YHPA 3LKOB 1KENH 2R23B 2BVYA 5EBWA 3BQUC 4I0PA 1RHFA 4PJXA 5IM7B 3P0GB 3ZL4L 1YMMD 4YDLB 3HZMA 3MMEB 1NBZB 1YEGL 2K7QA 1HK6A 4QHNA 2VWEE 4HZAA 4EBQH 3JXAA 4XRCA 5GGSY 4JVPA 5LJYH 3LKPA 1U8NA 3V7AG 3S6CA 3VRJB 1QRNA 4YX2L 1E28A 3HFMH 1W72B 4M93C 4PJ9B 2C4FT 4OLXL 2FHFA 1C5CL 3EDKA 4GW5A 2PNDA 2ZG3A 2IH1B 4WUUD 1YNLH 1Z9SA 5FECA 2NPLX 5IJVB 1U8QB 2VITB 3O45B 5D6CA 4M4PA 5IMKB 3FB7A 5IOPB 4MB4A 2KZWA 3I6GA 4BSVA 4HIIB 5M94B 5D71H 5GPRA 3K4ZA 5MP6H 1DLHB 2DYPB 3TFKD 3JSSA 5KAQF 1K8DB 4ONGH 1KG0B 5B22A 3EFFB 4L8SB 2AGJH 5I15L 2XZCH 3CFJA 2RAMA 1F4WL 2A9ML 1R3IH 3FRPA 3EO1B 4F7TA 1R3LB 1JBJA 3B9AA 3QRGH 3MUHL 3PP3H 4MVBA 2JJTC 4GQ9H 5GGRB 4UT9H 4LSUL 4YC2C 3P9WB 1CTNA 5DD1L 3GMRB 4R90L 3MRRA 4POYA 3FB5B 5J57B 4IOSD 4Y2DD 3WIHL 4JFEE 1AXSB 4HF5H 5I0DA 2NXYB 1QFHA 3VRLE 3BE1H 4NO0D 4K9EC 4WW2C 5C8JB 2YRLA 1TNMA 3F7VA 3O3EB 1FV1A 3GSVB 2ARWA 1N59B 4M1GH 4HXBL 1GAFL 1LDSA 1YJDH 1CG9A 1EGJH 1FGVL 5IW6A 1EJOL 3CSBA 1QD0A 1CGXA 1RFDL 3BT2L 4OV5B 3B9VA 1AXTH 3TNNB 4HCRL 1PVHA 1QTYT 2VLKA 1FP5A 2K9UA 5IMLB 1YZZA 3KG5A 1TFHA 2Z93A 4U6XA 4HWUA 3OG4B 3QIWA 4G6AC 5ICZB 4FTVB 3Q5OA 5EU6A 4PBVC 1AD0B 4X5XA 3ULUC 1M7IA 4TVSa 4YPGA 4FFVC 3PWPA 5EOQH 4R4FH 3VXME 2YC1A 4OZHB 3MLVH 5C09D 3OQ3B 1MREL 3UYRH 1BQHA 4O5LH 4XCFH 2AXGA 4OFVA 3GM8A 2Q8AH 1LILA 2B1HH 3EFDH 5DR5H 5LGKA 3DVFA 3VFPB 5F7HA 3R06B 3QCVH 4HFWB 1QSFB 3X3GH 2VMFA 1KCLA 1ACZA 3IF1A 5GRVK 3KYAA 1FH5H 3TCXA 3MV7E 3RTQD 4MD4B 1JHKL 5TE6H 4DCQB 4PJDB 1S7VA 1NC4D 4L4VD 3JWNC 2CK0L 4PUBL 4GAJL 4L3CB 2AV1B 5IB5B 3KXFB 1J7VR 3GMQB 1WIPA 1CLYH 4H1LG 3IJSB 5C0ND 5KS9E 3W82A 4L3AA 1RULL 3G5VB 5KSVB 3RDTC 1UEYA 4LCYB 5GRXG 2AK1L 2FGZA 4HJJH 1YYLH 2F53D 2ILLA 4KV5F 5LQBL 2R0KH 3JZ7A 2EDXA 2D7MA 4A6YL 2KUTA 4CAGA 4M3KB 1C8PA 1AGCA 4QCIB 1MEXL 4WO4A 1DFBH 4I18C 3AB0B 1FDLH 25C8H 5EORH 4JY6A 2A6DB 2GEEA 5A40E 3FFCD 1RUAL 4LNRB 1RZJH 1JFQH 4LLQB 4PY8I 2OI9C 1M7DB 2EKJA 1DBBL 1CI5A 4PB9H 4QTHA 1LO2L 1QR4A 1C08B 3KPRA 4GRMA 1PZ5A 1NCBH 1U58B 1RHHA 1ZT7A 4U1NA 5CP3H 1XMWA 1AC0A 5GGVH 1A14L 4O58H 4DVRH 5IK3A 1FVCB 1OOAA 3BP5A 5E5MB 3SKNA 2B7DT 4AQ1B 3EO9H 2PYEB 4EOWH 2CLRA 5DS8B 3CVIH 5I30H 3OKMB 3B8YA 2VXQH 3WLBB 1HHHA 3PL6A 3IRPX 3TO4A 2WBJB 4PTUB 5DVKA 1FYTD 4QKXB 3FL7A 3CDGB 2NY4B 4PGDB 4ZUTB 2NY1D 1CICC 1ZLWK 4U1KB 1NCCL 1SY6H 2ATPA 1CXLA 4ZUWA 2QADD 4I3GA 4KV5E 4J3WA 5CEXA 3QZWG 4Z7WF 1FL5A 5HDQL 3E8UL 5GIRA 4BK5A 1T20B 2GJ6E 3E0GA 2JB6B 3OV6A 4PPTA 3K8MA 5HHQA 3EYSL 2DLGA 4LKXA 3BD4A 4UU9A 3AM8A 4G43A 4WI6A 1BVZA 4G6JH 1PY9A 2Z4QB 2GSIA 4DGYH 3VD5A 2A1WL 3DECA 2DJ4A 3SQBA 2FBJL 5T1DH 2GQHA 2IAND 2X41A 1DEDA 3L7EA 4F33A 3SHSA 4DOHB 5DMIL 4XAKD 4TTDD 3QIBC 2AEPL 3CXDL 2AI0L 4JZNA 1LK2A 4MLSA 1A2YA 2D4DA 2VDQH 3BDXA 4C54A 1MCFA 2VDOH 5I1JH 1ZT4A 4NNXA 4MQXD 4IRJB 4NO0B 1OWRM 2HT2C 3IDYB 2FH6A 1WTLA 4H0GA 3NFSL 4LQFH 2OJZL 4N0YH 1ERNA 2R15A 1MCWM 1A6VH 4K8RD 4FZ8L 5DVNA 4HQQH 2ZCKH 4B50A 5F3HB 2H1PL 2HFFB 1PSKL 1EBAA 4G8GE 3IDYC 4S1DD 2MCPL 1NGPL 4LVNB 2RIKA 2EDJA 2VLRB 2XWTA 5DD5L 4Q6IB 1ZEAL 4LSTH 5LGHH 4ODXB 4LPXA 3MV8B 5DJ2A 2X1WL 3QBTB 1F4XL 1P6AB 3V6OE 4RQQA 1RK0A 4LLVA 3OR7B 1S78C 3P11H 3WNOA 3D3VD 1B9ZA 2UYLA 2OSLB 2OZ4H 3BUYA 1H9VA 3MLYH 3KYOA 3E6HB 3EYFA 2FX8H 1KB5B 2HJLB 4OGAC 3L7FB 3VFSA 4HC1A 5LWYL 3PP4L 1QRND 4NM4H 4QRPD 4H5SA 3LSOB 5LGHL 3NN8A 2DBLH 4LARL 4RGNB 3RGVB 3FKUS 4NHUA 3UAJD 3ARRA 1FZKB 2MCPH 4LPTA 3BQUD 1M6OB 2A77L 1QYGL 4GRLB 4Y2DB 1A0QL 2K7PA 5EA0L 4W4NA 1T7XA 1YPZF 4R96B 4AQOA 5B3JE 4JJ5B 5EDXA 3U0TB 5E9DD 3T1FB 4XCEA 4C58B 4Z7QF 5TPWL 2LU7A 3L5XL 3RZCD 4YFEA 4HX1A 2W1NA 3ZYZA 3C60C 1NAMB 2AS5M 4X6FB 5BS0D 2BOBA 3P4LA 1MWAB 4DAGL 2VDOL 4L9LA 5M95B 5TDPB 1CFSB 1WZLA 3MRGA 4NYLA 3IKCB 2VDQL 4GG8A 5E4EB 1BQSA 2I25N 3DXAB 3OAZH 4GG6F 1CDBA 5C0DB 2QQQA 4OZGA 4HT1H 4OZIF 4DGYL 1RVFL 3BP7A 1JWMA 1I7UA 1ZTXL 4OM1L 3RVWC 1DQJA 3KR3H 5IKCA 4WUKL 2A0LC 3U9PL 4UDTA 2O5XH 1NFIB 1MNUH 4NZRL 2V2WB 2APBA 5HYSA 5AYUL 1RMFL 5GSVB 4G7VL 4M7LL 4PYHA 3T08A 4UTAH 2DQDH 5INCA 2YXFA 2P5WA 4F9PA 4LLMA 5FYLE 5HDQH 3F12B 5IQ9A 4L4TE 1RUPL 4W81A 1EV2E 2EDQA 1UZ8B 2G75A 3UDWC 1T7VA 1YY8B 3P0VH 1SY6L 3T04D 4R4NC 4W4OA 2HYMA 1FBIH 5F89B 3WIIH 5E8DL 2VDNL 1B4JH 4ODWB 3OR6B 5F1NA 4KC3B 4QOKB 4CRPA 5HY9B 4HIEB 2I9TA 3H9YA 4XVUC 1MCEA 5D9SB 1L7IL 1ZHNA 5CJOL 4JZOA 4NNYA 2VXQL 3D85D 1ZKAA 3ARED 3QQ9C 2VKWA 1QLRB 4UTBL 3LZFH 1RZ7L 2YSSB 1OY3B 2Y9RT 4DZ8A 3Q3GB 4I9WD 3QPXH 2I26N 4WW2F 2ZP0T 1HNFA 1ZK9A 4L1DA 1VADB 5C0BD 3QFJD 1ROWA 1AGEB 2OMBA 4O58L 1U3HB 1HQ4B 3H9SE 4KVCL 3UTSE 1K8IB 1HI6B 1QRNE 3RVUD 5C0BA 1ZA3B 4R97C 1T0PB 5IFAL 3B5TA 4LIQE 3IB4A 1GHFL 3LS4L 5E5UB 4FQCH 3RVTC 4EQ2A 1L8JA 3ARDD 4D0DA 4D0CB 4TUOB 2YPLB 4YDJA 1NC2A 1PAMA 3IU3B 4CN6A 1FDLL 2FEDC 4PG2A 3NCMA 1TQBB 4NQCA 2W0FB 4KRMB 4WI2A 3EJZD 2DQFB 5B39A 2JIXA 1H5BC 5I8CB 2VDMH 2N7BA 5LQBH 3ULUF 3GSNA 3L3DB 4KKAD 1HHKB 1WISA 3VXOA 4GAYA 3QDME 4FHBD 2Y6SC 1YYLL 2WINB 1LGVA 2X1PA 1QPXA 4ZPVA 4U2YA 4GXVL 1U8PB 3ZE0F 2ZSWA 1RULH 3O3AA 1NUFA 4M02A 1OGTB 4U1SA 3IFPA 1CQKA 2X70B 2IFFH 1WCQA 4W6YB 2Q20A 1C7TA 4HLZH 4ZDHB 3QWOB 3UDWA 4M6ML 4Z0XB 4KDWA 3RL1B 1T1WB 4OIBA 3TH4T 1UJTA 3ULUH 3CFEA 3GNMH 3QUYB 5LCVL 1JHKH 5TE6L 5IHUL 5EIIA 5D1XB 3MLZL 1FH5L 5FEBA 3X3GL 2C1PB 4PJ8C 3N1FC 3TVMC 4NZUL 1PLGL 4JFYB 3QCVL 4WFEE 3RTQA 1IFHH 1HZHH 3QUZD 3HR5A 5DGQA 2R2EA 2NY2D 4KUCD 2CIIA 4GH7B 5J13C 2XIDA 4JQVC 2EH7H 3HA0A 3QEHA 4JKMA 1I9EA 4PJ7B 4EI6B 5FO7A 4KJYB 5D1XC 3MA7A 3UXFA 2Z8VC 3U1SL 4LP5A 5ACZA 5DJDA 3C6LD 1A1OB 1R3HB 5DRXB 4FA8A 4AY0A 1OQXA 3LKRA 3I6LE 5A2IH 3JTSB 3KJ6L 3B43A 4XNYH 3T0EA 2HT3C 1I8KA 1WFOA 4OQTL 3C5ZC 4HGWB 1NBYA 1DQLL 3CUPB 3O6LH 3H9HB 2VDKL 3C60A 1DR9A 2EIZA 3ARGB 3HI1B 1FZJA 3DROB 1YNKL 4O9HL 3ZTJG 2EDTA 1HSAA 5C3LD 1N8ZA 1RFDH 3VXMA 2DKUA 4XX1E 1C5DA 1MAKA 3C5ZB 2ENYA 4QRRD 1MFAH 5E8PB 1J05A 1EBPA 4X80H 1G6RB 3H9SD 4R2GD 1ZWIB 1EGJL 5F9JA 5IHLB 5FA4A 4XBGB 2FBOJ 5A1AA 4APQB 1S7XA 1GAFH 4HXBH 2B5IC 2BP3A 1B0WA 4JFZH 5C71A 1RPQA 2DKSA 1QFWH 4XPTH 4QXWA 3BXNA 4S1RH 1SBBA 3BE1L 1IGYB 4Z7OE 1T3FB 4APQC 1T66C 4YHYB 3ZYOA 4HF5L 4WUUE 1GGIH 1EJ6A 4LCCC 4RIRB 4JFDD 1T89C 4OFYA 4LLDB 2IQAB 2W60A 3UTOA 1DBML 5I8KL 1DLFH 3NABL 1XZ0A 3QG7L 3SKOA 3TBSB 5KW9L 2IC2A 4WGVB 4FMFA 5FHAH 3QRGL 3QXDA 4JFDA 5HGAB 1XGUB 4TVPH 4OCNC 1XF5B 3G5ZB 5IJKA 1BAFL 2OLDA 3PE9A 4HWNA 1A6AB 1MH5B 4F7PB 3MBXL 1PEWA 4JEGB 4MWFB 5MP6L 1TQCB 5IFHL 1QSFE 5KS9B 4S1SH 1FNHA 5KN5B 1T22B 1QSEE 3L5IA 5DD6B 2RCSL 4PG2C 3L6FB 1MWAL 4AEIH 5HGHB 3JWDL 4YHKH 1VB9A 5C0EA 4YC2B 4AEHL 3QUKA 3WNLA 35C8H 3FO2A 2FHBA 1YUHA 2YPLD 1X5KA 3D0LB 1EA9C 4OGYL 5I8EB 4KQ4H 3QH3B 3REVB 2FGWH 1QBML 4RAUB 4HEME 4WW2B 4YX2H 3DHJA 2IADA 3D2UA 4KROB 4EUPG 4OBRA 3WJJC 1DUZB 1GGCH 4QNPE 3FOLB 5IEKB 5E2WL 4RX4D 5JHLH 3P4OA 3CVHB 5D2LF 4NN7C 3U7YH 3VGEA 4JQXC 5J9PA 1J1XL 3M8OL 2N4IA 4S1DC 5GGQH 1AR2A 3HC0B 3VCLB 1AH1A 4G42B 2XA8H 5D1QA 3B9EA 4JCMA 5D7SH 1Q0YL 3DV6B 3BX7C 4ISVA 2QBWA 5D93C 5GS1B 5H35A 4G9DA 3QCUH 2W0LA 4KXZI 4PY7A 2BERA 1S78D 2PUQT 2FDBP 4UOW1 2BDNL 3MNVA 2HLAB 3QXWA 4OF7A 4MDJB 1P1ZA 3BI9X 3FCTB 4HJ0D 4MA3B 4LHJB 43CAB 2YXMA 5DJXB 1PYWA 4YBQD 1T2XA 3STZB 3NGBB 4OLWL 3X3FL 4QY8A 4ZUUA 3S98A 2CDGB 2XWBB 2BY2A 3N9GH 2WV3A 4LU5L 1LO4L 3QQ4A 2ORBL 4FQQA 1CN4A 4OQ1A 1J5OL 3EHBD 4D9QD 5CILL 1GPOH 5D7JA 3MV8E 4XH2A 3WN5C 4N5ED 2J3SA 3DNKA 1H15B 5K9JH 1NFDF 5C0RL 3LKSA 4RMQA 5BOZG 3IETB 5C08B 2NZ9C 2NW2B 3V5KA 4DJMA 4F57L 1NC4B 4JRXD 4JKLA 3WMSA 5EBLA 1MHEA 1DP0A 1W0VA 4J2XA 3CMOL 2UVEA 4FQ1L 4GMSL 5FUOH 2A6KB 3CAFA 4ZODA 2V7NA 1U3JA 5F1IB 1D6EB 4NJAL 4RA3A 4DKFL 2QQLL 5E2TH 4RRPA 2DQHL 2O26U 3D85B 1UM5L 4CU8A 4YDKH 3VXTB 2XRAH 2DQUH 2OZ4A 2YPVH 2P8MB 4DN4L 4Q9BA 4Z76A 1S7RB 4J8RB 4DOHE 3MODH 3U4BH 4BH8A 3L3OB 5CBEB 1J1OL 2EXYD 3LMJH 5JQ6L 3ARFC 4OCWL 2BNQB 2ZOKB 1WWAX 4XB7A 4MSWB 4L1HA 3LQAL 4F8TA 5C07A 4MHHI 5E9DE 3VXQB 3MFFA 3PHQB 1F00I 5JR1L 1TZHA 4M7ZC 1J0IA 5TDOB 3GMOA 4JN2B 1I8IB 4UBDC 4OF3A 1VESA 4CBPA 1LE5A 2H26B 1BWMA 2Z9TA 5KVGH 4I18B 2VSDA 1T0NB 2AXJA 2ZOLB 3DXAD 1S9WB 2MFNA 3FRPG 3WCYA 1JWUA 3QUXD 3CXHK 2P24A 4ODUB 4OV6F 3EJJX 5KOMC 5DK3A 4OF5A 4NBXB 3PWUA 2OI9B 5IWLA 4XVTH 5E56A 3ARGD 1GSMA 2FJGA 2BJML 4JPIA 1FHGA 4DVBB 1Z0NA 3RZCB 3KLAB 5GGVY 5K9OB 1HKLL 2QR0B 3I3EA 3U2SB 2F74A 3AC0A 5HDBE 1XCTA 2N1KA 4KKLC 1BVKA 3IFOB 5DT1H 4Y19D 5EU4A 3RZCC 1TCMA 3SDCD 1YYMH 4ODSL 1FFPB 3RUGE 3LKNB 3P40A 5E2TL 4LSSH 4PRPD 4HFUH 4GG6A 1XF4A 3WS3A 2WAHA 2WZPD 4PV9B 4QGYA 4AIXA 2IQ9L 1BZ7B 3ARDC 4GMSH 3C6LB 4NKIH 5I1DB 3LRSA 4TQEL 3EYUH 1UJ3C 1G7MB 4JM2D 5J89A 3AGVA 4JVWA 3AY4A 3MRLA 4N9GA 5F7EL 3WN5A 3E2HA 5C0RH 3MRPB 1MCSA 4NZJA 5D70L 1MFNA 1PQZB 1A6ZB 3LQAH 3WSQL 4P9HC 1J5OH 1QO3B 4PRBA 2BY3A 3ZE1F 5I1DA 1ND0A 3F7PC 4NKMB 1FL6A 4HKJA 1H0DB 3Q5YA 5C6WH 5KS9F 1OAYH 5IW3A 5CFHA 1I7TA 3T2NL 4YFLF 2BVOA 3ULSA 4U49A 3RVUC 2DQUL 1MF2L 4YQXH 1AI1L 3WHE0 5D5MB 2J12B 3HG1B 3TESA 3CSYB 5D1QC 3MRMB 2P7TB 4KKCD 1A7OH 1MLBA 2YKLL 4Z0BH 1HDMA 3KLAA 4PR5B 1T21B 1KCUL 3BPCB 1M05A 4TPRL 3OKDA 4Z7UB 1K5NA 3WBDA 4N68A 1T7YA 3PIQB 3BPNC 3HNTH 4WWKB 2NTFA 3ZHDA 1CU4H 1U8LA 1QBMH 4MAYA 1J0YA 4WW1A 3RGVC 5LGJB 1DZBA 2VAJA 4WHTA 2WANA 4OSUH 4FQXB 3BO8B 3KPSB 3RDTD 4WO4C 1P2CA 2EE9A 1MHCB 3LCYA 4G8GB 2H26A 3RI5K 5DMKB 1GXEA 2VISA 5T3XE 3ARBC 4LEXL 2EKSA 3QPQC 5JW4M 1BBDL 5BVJB 3S36X 3IU4H 3TGXA 1NGWA 1NJ9A 1NFDB 4XPFL 3RNKB 3THMH 5JXEA 2NR6C 3GZKA 3QUMH 2Y25A 4S1SL 3CLEH 3RWFB 1TVBA 3MXVH 1F13A 1S9YA 4HUXA 1Q9OB 3OG6B 4JFEB 2DRUA 3UTZB 3H3KA 4I1NB 1Q1JL 4JZJC 1NKOA 2HRLA 3QG7H 5KW9H 5CBEA 1W0WB 2ADJA 4BH8B 2CRYA 5D2NC 4LSRL 1ZANL 4L4VB 4JFED 4IRSD 3BRDA 1GGIL 3EDDA 3EBAA 2SEBA 4Y2OA 5C0NC 3ARFA 1MFBL 2F8XC 4JZJB 3NMEA 2BOCB 2FGWL 4HAGA 3KVQA 5ESVB 3K4AA 1T5XA 3UC0L 1ETZA 3PG2A 3FO0L 1MAML 3LY6A 5E03A 3FFCB 4L4TD 35C8L 1W72L 3Q6FB 1BOGB 5IEHA 5T1KA 1YDPB 5IFJA 3Q0HA 3BEWB 3WS6C 2EYTB 1NC4A 1S7TB 3PWLA 5DQDH 3TN0B 2VR5A 3MLSH 4HPYL 2JK5A 1BD2A 3IDGA 1EK3A 3IETA 1D7FA 2OTPA 5C08A 3W9EB 1KIUA 4PB0L 1IC5H 1UQSB 3MSPA 2HG5B 3QA3A 2Z8WC 2FATH 4TUKH 1PDKA 4Z78B 4XMLH 3RQ3A 3D39E 4WTXA 4GRLD 2GITA 1JPGA 3MCLH 3OL2A 5IGXL 1I9IH 3OKYA 4PFEA 5JPMA 4WTZA 2CLVA 5IB1B 3F8UB 3AREA 2EIBA 3AAZA 1IGCL 3ZDZF 1KYOK 5IVOA 3BSZH 4ZUUB 5TGBB 4X99B 5ENWB 2DM2A 1WT5C 5FKPB 4IDLA 4U31A 1E4XH 3QHTC 4WDIA 2V2XA 1P1ZB 4UOJA 3IGAA 1H3TA 1D9KB 4HS3B 3VE0A 2FD6H 1A1NB 3WFDH 3RNQA 3MJ7A 5H35B 3T1WA 3MX0A 2GFBB 3MR9A 4JRYD 5IVZA 4N0UB 1U41A 5EG6C 2IGFH 5L6YL 2Q1EA 2G9HA 3VI4F 4U1IB 3ZLQC 1A6PA 5TQ0H 4DEPB 3CVHA 1MCRA 3MUGB 1EEYA 2VAAA 2YBRA 1IQDB 4M6MH 1DUZA 1KELH 4I4WB 4MQ7B 4X7SL 5IBLC 3GSXA 4RAVA 4LRNH 4NQSB 4EDXA 3QUXC 4LSPL 4X8JA 3CK0L 5DFTA 4GRWH 2ADGB 4IS6B 2EIDA 5F9OL 4XAWH 3GO1H 2VZVA 3FQXB 4P9MH 3RAJL 43C9A 4CUCA 1SJEA 2AKRA 4KTDL 2A6IB 1X5JA 3D0LA 1NEUA 5MEOA 1MCHA 2CGRL 5BVPL 2OK0L 4Z9KB 4XC1L 3KXFE 1CT8A 4GW4B 3VGDA 1A1MB 4UINH 5EZOL 4IHOA 4P2CG 2J8UA 5EU6D 3A67L 5CJQH 1CFNB 3U0WL 5MEOB 1LO5B 2PO6A 3OX8B 2P42B 3WUZA 2A83A 1FL3A 2IPKB 4LDOB 3HC3H 1VGEH 3HE6D 5C09A 1SJEB 1INQA 4P4KA 2ZJSL 3FQXA 3G5ZA 3NZ8B 4PBXA 5J12C 1GHFH 3FO1B 4X4MA 3CH1B 3SCMB 1R5WB 1MFCH 3O3BB 4EZMA 4OF0A 4HWZB 2JCCA 2ZCHH 5L2JA 4ZAKD 1JRHI 2IMNA 4Y4FA 3SKOB 2X1QA 1X5HA 3OAUH 1HXYA 5J12B 5IJKC 5TE4L 1LEGA 2G9HB 4HIXL 3I6LD 2QADB 2EDHA 3LN5B 4CL7A 3UPRA 3ZTNL 2FCBA 1SM3H 4E42A 1UACH 2D3VA 2B0SH 1I1FA 5FO8B 2QSCL 2VDLL 4G8IA 3RNQB 1A1NA 3GMPA 1O7SA 2OJEB 3WKML 1VGEL 4UDUB 4OAWB 3KPOB 2D7OA 3WDHA 3KYNA 4NSKA 1LEKA 2NY5H 5HI4C 3VXRD 1MELA 2OTWA 3MRHB 1YEHH 2A9NL 3HI1A 3SDXA 3TNMB 1IARB 4LBEA 2CGRH 5I1EH 2CO6B 2EXWD 2FR4A 2ZPKH 1G9NH 1XGTB 1JZ3A 3GI9H 1LEKB 2Q8BH 5J4MA 2HG5A 4KDTA 3ARGC 4WEBH 5FV1L 3KPOA 5HHXL 3GO1L 2C26A 4HUVA 3PWLB 4LSPH 1I1FB 5FO8A 2FZ3B 4E42B 4MS8A 3TC9A 2ESVD 3NTCH 4EI6A 4ZNEE 3D69B 3EAKA 1BWWA 1GC1C 1LEGB 5I0ZA 2BOCA 4HULB 4QRSB 3MYJB 1P4BH 1QSFD 3QUYA 3CFEB 3GSNL 3PQYD 2XKNA 5DI8B 1QSED 2X4UA 4FXKA 5D1ZD 3M17B 1I75A 3T0VA 3CH1A 3SCMA 1T2JA 3VFRA 3MLRH 4Y8DC 2PYED 4XP4H 5D72H 4Z7WE 1JRHH 2MOVA 3IFPB 1OGTA 1FL3B 2DQTL 2AJXL 1JPSL 2GTZB 4JN1H 4OIIL 2A77H 1H3WM 1ZV5A 3QNXA 3Q1SL 4ZPVB 5BZWB 5F71A 2WINA 4OCYL 1IC1A 1MCIA 4KK9D 4PJDF 5IQ7L 4K23L 1NUDA 3F7QA 2XOTA 2O5YH 1RVFH 2COQA 2A6IA 3FMGH 1EVUA 3PDOA 3FT3A 1MQKH 4KGJA 1F58L 4IS6A 4YDLC 3SGEH 3KPSA 5IB4A 3MUZ1 3GSXB 4RAVB 2VDRH 4I4WA 4MQ7A 4HUKB 5C86A 5DJ0B 5C70A 3JV0A 1U8LB 4PJ8D 4XNQB 5E7FA 3TVMD 3UTTB 4OD2A 3HNVH 5FKAA 4ZXBC 3IJYA 1HI6A 2CUIA 4FABH 4XVUD 5ITFA 2QSQA 1QSVA 4CDGC 3DI3B 1NGPH 5TPWH 4Y1AA 4OQTA 3R8QA 3WFEH 2OP4L 4WHCA 5JOPD 1A9EB 4L8BA 2H1PH 2MKLC 4LHUA 4NQXB 1T21A 4G9FE 1A6VL 2WMPA 1X5LA 5GRUH 3HMWL 5DWUH 5JMOC 3W5MA 4RMRA 3VW3H 2V2XB 3I02A 4G6ML 3RUGA 2OX5A 1IM3B 4X99A 5FKPA 3JBG7 2H6PB 1YPZA 3WFBH 3HAEB 3PL6D 1J9CT 2DLTA 3C87A 5JPMB 1Q94A 2M2DA 1I7TB 2CUMA 2FX8L 4PP2B 1XR9B 2APFA 1LVEA 4QRUB 3O6FB 3C8HA 1JE6A 2Q87A 4JO3H 4XNXH 3D3VA 1I85A 4G6JL 1MVUB 3IDGB 1BD2B 4H20H 2VN7A 1MI5A 1F4XH 2XG4A 1A6ZA 1PQZA 2CSPA 1U8KB 1P7HL 4MHHG 4K8RL 4OSUL 2EYTA 4PRAB 2OMNA 1AC6A 4UDTB 1YDPA 3WN5B 4N8VA 3GUTA 4N9GB 2R8SH 4ZTPL 2FHCA 1FAIH 3OZ9L 1MCNA 4JLRA 1MJUL 4ELMF 3VXPA 1CD1A 1Q8MA 2GIYA 3B9KA 1RUQH 3V6ZB 2PW1A 3RJDA 1KF9B 1BF2A 3CPLB 3ZDYE 4DW2H 3ZO0A 1R3KA 1BZ7A 1NSNH 3NFSH 2AAVA 3ARFB 1OAXH 4Q74A 3IKCA 5IBTH 5HHOE 5TFSH 3VWKA 3GI8H 4HPOH 1FFPA 3DURA 4Z0BL 5CLWA 4MD0A 2BOBB 1NMCC 1A6WL 5F8QC 3NCEB 4MJIB 1WBXB 4BK4A 5BMFL 3ARPA 2J4WH 3ROOA 3MJ6A 3MLUH 4YE4H 2BXYA 5SWZB 4E41E 4RA0C 4I9WE 4FFWD 4OTXL 4CKVX 3GSQA 5MEND 1AIFA 1NMCB 4UMGA 2E3VA 4O00A 2FBJH 4UOW0 5T1DL 5CD3A 3BN9D 4M48L 1NH6A 2HFGL 1FFNA 3QWRA 3SE9L 2QTEA 3X13B 3RGVA 1Q72L 5GISH 5GHWH 2CD0A 5HHVL 2HKHH 1G9NL 2ZPKL 4PRID 3STLB 4L8DA 4TRPH 4M3JA 3R4DA 4LVHB 5EZJB 1RUAH 1KTRL 5E2JA 1E6OH 1NLBL 4I18A 5EORL 1YEHL 3V4VL 4MAYB 3KYOB 4JVUA 5E8OB 4ZS7H 2X09A 5GS0C 4P23C 3CLFH 3KPLA 1YJDC 3HLAA 1BEYL 1FNEB 2UUDH 5EIVA 4ODXA 4MJ5A 4LPVA 2X4SB 5E1AA 1ORSB 1UACL 1A8JH 3RDTB 3T2PA 3OHXB 2XKUA 4NDMA 5GJSH 2YA1A 5F7MC 1NCWL 1AO7E 1T7WA 2P7TA 5EZLB 1WBXA 1KJ2L 2H32H 4R6UA 5F7FA 5HI4D 4MJIA 3OKEB 4PRHE 3FB8A 4KU1A 1FFRA 3HTLX 3QXVA 3KJ4C 1ZT4B 2WBJC 2AJYH 5DDHA 1R3KB 3GJFH 1ND0B 3LEVH 1HHJB 5F6IC 5HHPB 5SWQA 4NIKB 1U95B 2VLRE 2V7NB 5GRJL 3KJ4B 1JGLH 1WBZB 4Z18A 1Q0XH 4QRQB 1EGJA 1RY7B 2GJZB 3PXJA 2B1HL 5DR5L 1W0VB 4B0MM 1WV7T 1DFBL 1F3RB 4O02H 3F6IA 2A74B 3CH8A 4CVXA 1LP9E 3MV7D 4R4FL 1JGUL 2P5WE 1MI5B 2R0ZH 1G1CA 2EICA 2C9AA 3VGGA 5BXFB 5DMYA 4HJJL 1CFTB 3FN0H 5FGSA 1D5ZA 4NQTA 4DUXA 4D3CH 3C6LA 4KI5F 5JR1H 5GIRB 5D7JB 3FQUA 4PP2A 5C08D 1CIDA 2HRPH 2F53B 3UPAA 1XIWC 2ATPB 2B1AL 2JB5L 3BWAA 3KPPB 4LRNL 2F5BL 2VO5A 4DQOH 5IESL 5KSBF 1T83C 5I16B 1BZ9A 5FA3B 5AZ2L 2DI8A 1CICB 3I02B 1PYWB 3LKQA 4ZOCA 1F4AA 1BVKB 2CRMA 4K9EL 5ISZB 1XCTB 3GRWH 2HN7B 1JK8A 1KTKE 3QUMA 5GRYA 1T6VN 5BW7C 5K9OA 5DF0A 3MGTA 4F2MA 4I2XE 4LHUB 4NQXA 1BFTA 5D1QB 3ROLB 5IP4A 3UTSA 2X9YA 1XH3A 1CE6B 4IMKA 3EFDL 2UZYB 5EB9A 5LXGL 5ITFB 1DCLA 5J11C 3MLVL 5EUKB 4XHJC 4HJ0C 4OD2B 1OP3H 3A6BL 3VH8A 3RJQB 4UT9L 4GQ9L 1JWUB 5C7XL 1S9WA 1BFVL 2OXGA 5DD0H 4FQPA 1M7DA 5J11B 2HTLC 3MACL 3VMOA 3FT3B 4O2EB 1NBVL 4XMLL 3QJHA 5TDOA 3SDDA 5FCUL 1HSBB 3K74B 5CILH 3PQYE 1EJOH 4QCIA 4OCMC 2K3TA 1JZ6A 1LO4H 5A2LH 4EVNB 1FGVH 1FC1A 4NUGH 5C07B 3WHXB 4MSWA 3QNXB 5FXCH 4TULH 5DUMH 3UTPE 5KSVA 1A6AA 4F7PA 1INEL 1OD7A 4IJ3C 4IM8A 4KPHL 1YQ2A 4NT6A 1UH4A 4F37F 3DGCR 3M17A 2EE2A 3QCTH 1YC8A 5H94A 1Q0YH 5DI8A 4XT1C 3VXTA 4MNGA 5ACMA 5CEZL 4A2LA 4M62L 4MD5A 2IQAA 4LLDA