3LKNA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1918 strain
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lknA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lknA01
5CEYB 4YR6B 5JW3H 4NCDA 1UB5B 5DEGB 1IE5A 4OBRA 4XI5D 4PLKC 4PJEE 1IBGL 3RY6A 1HEZA 1IAIL 1NANH 3RL2B 4NQEE 1PD6A 4IMKA 2VL5B 2AK1H 3PHQA 1SEBB 2G2RB 2D0HA 3U9PL 3WLWC 1JZ6A 1IEAB 3HE6B 3HI6H 3MJ9H 2BNQE 1KENH 2K7PA 3PWLA 4BSVB 3F7YA 4D0CB 2GJJA 4HIIB 2APTA 5D7JA 2YN3A 4HG4J 2OMBA 3OKKA 2ADGA 4QGYA 2EIZA 4XCFL 4XRCB 5DTFB 3EDJA 3L1OL 1UJ3A 1ZWIA 2WLYA 3P9MB 3PABB 4W70A 3S3SA 3N50A 1HQ4B 1OT2A 5B8CA 3V7AE 5DJCB 3O11B 1GH7A 4ODSL 5A40E 1OAUH 5HYJD 5CLTA 3L5WA 3CFDB 1X4ZA 3TV3H 2X89A 4LPWA 5CLWA 4MD5A 4G8EA 4G6MH 2Y06H 2Q87A 4GRWH 1QRNA 3MCG1 1A6TB 3ULUE 4UINH 2XWTB 5CUSH 1WZMA 4LGRB 2EKJA 4LHQB 1QQDB 1JNLH 2PF6A 1IL1B 5BRZA 1J12A 2P42B 1B3JA 2C9AA 4FFYL 5L9DL 1I9RH 1R3LB 2R2BB 3V0WL 5CGYC 5F7HA 3AY4C 4W4OC 4XBPB 2RFXA 3KR3L 3IDXH 3KPNA 2KL6A 1KCSL 5D7KE 4TULL 4RQQA 4M62H 5JO5B 1J1OH 3HZKB 1S7UA 1A64A 4HF5H 4HXBL 1TJIH 3ISWA 4YHZL 2PETA 5DJYB 4P46A 1FGNH 3DX6A 4WEMB 3DECA 4EI6A 3CDCA 4WHYG 4Y1AA 5SWQA 3IDNA 3RAJH 5F1IB 1GGIH 2HFGH 1EGJA 1B2WH 3P4OB 3SKOA 5J13C 4XMLH 5IGXL 5KZCB 3SO3C 5J89A 5DHVH 4Z8FH 4LF3A 1DL7L 1WIOA 4PJAF 1AKJB 3KLDA 3MNZB 4R96B 1P7QD 1F58L 3ME0A 4F2MA 1ED3A 4ZFOA 3C9NB 4KKCC 3CSPA 3MBEC 3MRIA 1VFOA 3C5ZA 4JN2A 2R23A 5HD8D 5K59F 3DHJA 5HDQH 4KK5D 1TVBA 5J9PA 4LGSB 4MMXC 4UBDC 4N68A 5J3HC 3WO3B 1KC5H 2MQCA 3MRLB 5BV7B 4ZSOB 3BESR 2XKSA 4OAWB 3D3VE 3G5ZA 5I6XC 3WS6C 5E9DB 1HE7A 3PWPB 2H32A 1YMHB 5C09D 1S7QB 2HYMA 3HTLX 4M8QB 5CINH 1L7TH 1CDYA 4IIQC 3VFSB 4S0UC 4ZO7A 1TCRA 1S7TB 5MENE 4MQTB 3GMRA 1NBZB 2IFGA 2X44D 2X4OA 3KLAB 3GMMB 4NRYA 4O5LH 2PKDA 4Z7UE 5F89A 3QHZH 1K4CA 3QDGA 1A6VH 3FN0H 4XXDA 3RZCB 4JZNA 1RIUH 3LPGA 4L8CA 2VZUA 1WISA 4KKAD 3IS0X 5JTWA 4YWGH 4K2UH 5C0NC 5HHNA 3CC5B 3Q3GB 1W72A 1PG7W 3QZWA 5GIRB 3TO2B 2PYED 3KPPA 4HJJL 3MJ7A 4D9LH 3SY0B 3MUY1 1CGVA 3QCTH 5JA8B 4LPXA 4L3EB 1CLZH 2ZJSH 1GIGH 2YPLA 4V2BA 1NSNL 1L8JA 4H1LG 1EIBA 3W9DA 3M1BB 1NGWB 2ZKHL 1PQZB 1L0QA 4JFDE 3Q48A 1U8LB 3BKJH 3TBYB 3P77B 3VW3H 2DLGA 2ADFH 2B4CH 3SDCB 4NNXA 1S9WB 4X6EA 4FQHA 4I48A 1TTFA 4QRTB 1D9KC 4K3HA 4X7SH 4XNZB 5L6YL 1MFAH 5I1JH 2ZCKH 4UTAL 1JZ2A 4QXGH 4U1HA 3TNNB 4YXHH 5IQ7H 3SE3C 3SKMA 5DR5H 3WIHL 1XT5A 2KDGA 1ZHBB 4YDKL 3QXTA 2BJMH 2BSTB 5ESQB 4RMVA 2YD7A 3SDAC 5DMIH 2X4UB 5DMKA 4I18C 3GHBL 4WWKB 3X17A 4J3UA 5KOVC 2Z8VC 1I85C 4YO0A 2AGJH 1JV5A 4PS4H 3P30H 3KPQA 3MRBA 4XPTH 3AMKA 4WTXA 5EFIB 5TH2B 1ZGLM 5GS0H 1NFIB 4NKDA 1ACYH 5ANMB 4OF0A 4UV7H 1FC1A 4HULB 4F7MB 1IM9B 2OTUB 2GYSA 1T1WB 2H9GA 1CQKA 2NXYD 4UTBH 1WWCA 4Z7VE 2EDXA 1N59B 4R0LA 5HI5C 4M7ZB 2HN7A 2MQ0A 4PJBA 1P7HL 1XF4B 5C7XL 1EBPA 1MHPH 1QLEL 4KAQH 4NZUL 2AJZA 4EN3C 1FPTL 3F5WA 3BP7B 1YDPB 1N7MH 2NY0D 3QIBD 4C4KO 5DURD 2XA8H 2IAMA 2WIMA 1IC1A 3U0PB 2A9NH 4ZDHB 4DKFH 1RZ8B 3O4LA 4KUCF 4EQ3A 1F4WL 1A7RL 3INUH 3KXFA 3OAUL 2BY3A 4NZRH 5DRNA 3CXDH 3I02B 4M1CD 2Z8RA 4CDGC 5KTEH 4TSAL 1X3DA 5JHDA 1ES0A 4S1DD 1KSRA 4I8DA 3WHE0 1NAKL 1A02N 2VKXA 4X9IA 3SBWC 2EKSB 5HPOA 3C09C 4ZNEE 4Q6IC 4YHOH 2HTLD 1BJ1J 3JWDL 3UTTB 4H25A 4H1LH 1QBAA 3OGOE 3FQRB 4N8VA 1G7LA 3VE0B 4NQSA 2WUBL 3FRPA 4HPYL 2RQ8A 4NQDE 1YNKL 4U3CA 1AXTL 2ZUYA 4RGOH 3H9SE 3RWIB 1JPSH 3WHXA 1EGJL 1MFEH 4Y4KC 1INQA 1ADQA 1XF3B 4JRWA 4KRLB 1RI8A 3MJGX 3L95A 1BJ8A 5IJVB 4FG6D 3WFHA 1QPXA 2WW8A 4HAGA 2WBJC 1VA9A 3VXSD 1KEML 1ZLWK 2BHYA 5HGDB 1A1MB 5FO7A 1XR8A 4X99A 3GM0A 4LKXB 3MYZA 2Q6WA 1PZUB 1U8NA 1GAFH 3LN4B 1YZZA 1IFHH 8CGTA 1RPQA 4M3JA 2Q20A 3DVGB 4PTUA 2JJTC 3QUYB 2V2WA 1G7PB 3JTSA 2Z35A 3LH2L 5E24E 1R24B 3LRHA 5AUMB 4Y19A 3KPMA 4CMHB 3MSPA 3U1SL 3TLRA 5CS7A 5IB4A 1DP0A 1CGWA 5JDSB 1CXLA 1NUFA 2DBLH 3RTQB 4IRJA 1MY5A 4FS0A 1J5OH 1EHAA 1MF2H 1J0HA 1T5WA 1OLLA 3IFNL 3LPWA 3VFTB 3ZDYE 4CKVX 2P8LA 2FR4B 4ZFGL 2DMCA 1M1SA 1F4YH 1TNMA 3GSXB 5I2IB 5IV2A 3WD5H 4K8RL 1MCEA 4JN1L 3BGMB 5EZLB 4MNQD 2V17L 4ZAKD 1OGTA 1TETH 5IB1B 5D1XD 2GAZA 5IW3A 4X5WB 3OGCA 4X6CE 1DDHB 5IMKA 2FWOA 1R3JB 1W72L 4V1DA 6CGTA 4R2GB 1DLHA 4BFGA 3OWEA 4LASL 5EOCH 3WN5B 3MLRH 4LVNC 1MCSA 1AGEA 3GSNA 3O2DH 2P5WB 5E2UH 3WBDA 4IDLA 3D25A 3SDYL 5BQ7A 4JANB 3A6BH 1JN6A 1FZMA 1EHLL 1MY7A 3DSFL 4PJHA 1QZ1A 4PJBF 5IHUH 1RUAL 1U8PB 3E8UL 5INCB 4G9DB 4I2XE 4I3GA 3NAAL 1IARB 3W5MA 3W0WA 2A77H 4GXVL 1JZ5A 4EOWH 1NPUA 3QA3A 4YC2B 5EORL 1LEIA 1SEQH 2ITDB 5T3ZD 2BVYA 4KJPD 4KMTL 4RGMB 5H2BA 4PJGA 2FO4B 2IF7A 1RFDL 3EDEA 3H6JA 5EBWA 4FTVB 3L3DA 3TA3C 1R5WB 1QYGH 3MMEB 4PJ8A 1FFNA 1S7RA 3IETA 2IANE 4ODHH 3B9EA 4PJ7B 4Y5YB 5J12B 1ETZB 1QLFB 3DUUA 5K9KB 4G9FB 2MFNA 5CSGA 2WY3A 1F11B 1KTDB 3VWJB 1G7HB 2BMKA 3CUPB 1XF5A 1PX4A 4HFWA 4J8RA 4MD4B 3MRRA 4MCZB 2J8UF 2V6HA 4NO0A 3CFKA 2W0FA 4XMKL 2E27H 5TDOB 3ZKXC 5D96B 5I1EL 4P49A 4NQCB 1DBAH 2J6EA 1ZLVH 5CJOH 3B3IA 2M2DA 4OZIA 1JRHH 3BEWA 1FE8H 2BFVH 1V3JA 3JV4B 4KQ4H 1S7WB 2R69L 1RJLB 2EDEA 3IJYB 4TUKH 2F9BT 1T04A 2PCPA 1DQDL 5IESL 2QR0B 3D39A 3LS5H 1FFPA 4AZ8A 5CD3A 1T2QH 2UWEB 4U2ZA 3IKKA 3AFLA 5B3JF 3S8WA 3QDJD 5JR1H 3GSVA 1MHCB 1UT9A 5M7QA 2NY3B 3DRTB 3V5KB 4NO2B 4MJ4A 2OP4H 5D4QA 1SBBA 4JO4L 3RGVC 1WFNA 1MFDL 3PDGA 1E4WH 3DXAA 4MAYB 12E8L 3RVTC 1HQRA 3BUYB 1EK3A 1U3HB 1JRHI 2BNRD 4POYA 3GGWB 5SX5H 1S5HB 1CE1H 1T3FB 4FQ2L 5KSBE 4LPVA 2D03H 3AXLA 4P3DB 1YC7A 4LLWB 2IQ9H 2W65B 2PUQT 5D93C 4YXLH 3RNQB 3CFIC 1IC5L 5I1DB 1QOKA 2EO9A 1CU4L 2ATKB 4PUBL 2ZUQC 1IEBA 1CXIA 4QNPE 1RUPL 1I3RA 4ODWA 2FJFA 5EU4B 3STZB 5MEPB 1Z2KA 3KPLA 5F88B 4LARH 1ADQL 2HKHL 3MROA 4AT6A 4PGDB 4IS6A 4UV4H 2DKMA 4IMLA 4QOKE 2D7TH 2X2YA 3VXUE 1VDGA 3MJ9A 2XKNA 4NQED 3QQ9D 2GJ6A 4GBXB 5F3BA 3CVIL 4N0CC 4WJ5A 1IKFH 1DFBL 3FONA 3P0GB 3UJJH 5LXGL 1DQQA 1NGQL 2OM5A 4XWGL 4G59A 4HLJA 2ESVA 2R1WA 1KPRB 2NY4C 1KCUL 2JKXA 3RNKB 1EO5A 3ARDB 4LAJH 3WIIL 3IVKB 1MLCA 1SMAA 5E70A 4NZDA 1MIEH 4ALAH 3M8OL 4NJAL 4TTDC 1FFQA 1U93B 4XPGH 3T08A 1BOGB 1FL3A 3BXNB 5DD1L 2CGRH 2FIKA 4LSSH 2VO5A 1YQVL 5C0FA 5FAAA 4PJGF 5I19H 2VXVH 1NLDL 3TC9A 1YN6A 2VZOA 4PLJD 3O6FC 3W82A 4D8PA 5I8OL 4S2SA 3ARVA 4HWNA 4Y4HD 3SE4A 2V7NA 3RA7H 3QO0A 4BZ2L 5D6CA 4HH9A 3QXDB 3C87A 2NW3B 1CFQB 1A22B 3QRGL 5HHQA 5B21A 1OPGH 3PUCA 4W81A 2B2XH 5CSZB 1FNGB 4S1SL 3BGFC 1BD2D 4HGMA 1FLRL 3NIGF 3WL9A 4P59H 1JNHB 3GSNL 2F5BH 1AXSB 1BX2A 1LK3L 1KJMB 3EYFB 2HH0L 3TEUA 1ZHKB 4PJXA 4CU7A 5DK3A 5EU6D 3QJFB 1T66C 4JPWH 4F3FA 4AL8L 4KJQD 1WCBB 5C0BB 1E6JL 3MRNB 5A3ID 3VFPA 2ZPKH 3PIQB 1QFWH 1E28B 3Q6FA 4FABL 5IEHA 5DHVA 1JYNA 2AK4A 5L0QB 4XX1E 4JAMB 3ZKNC 4OZIF 4HIEB 4NFDA 5IHZA 2DJSA 1TENA 4WV1A 4ERSL 3O9WD 2C7UB 5CEXB 4XC1L 4DKEH 2IQAB 2IH3A 4FQCL 3IGAA 3DX7B 3BP5B 5EUOA 1QBMH 4P5KB 1TPXC 4HUWB 1PLGL 4PJAB 5IBUG 1RZFH 5EOQH 3T4YB 1N0XH 3F6IA 1H3UA 5IW6B 3MC0A 5SWSD 1P53A 4BFBD 3NPZB 1OW0A 4GXUM 1P7QA 3ESVF 1U8IA 3ZT7A 1KEGH 4YFLI 1XZ0A 4OFPA 1LO4H 5AAWA 1NCAH 3IJSB 1TFHA 5IB2B 3MRGB 2Q1EA 2D31B 4XH2A 2HG5A 2DQTL 1AIFB 3VFVA 2D0GA 2W60A 3HC3H 1A8JH 3GK8H 4WFEE 2D4DA 4TPRH 4DKAA 4JRYE 5DJ8B 3ILQC 5FOJA 5BS0E 3S88H 1S7VA 4ZG1A 3B9KC 4R7DB 5E8DL 3C6LC 5C09A 1B0GB 2A0LD 4HIHA 5MEND 1IC4L 4PBVC 5CCKL 1IVLA 4S1QL 4LRIA 2PTTA 1HEZB 4MXWH 3ARGD 5D1ZB 3I2CL 1GL4B 1X4YA 4XTRD 1EAPB 3E0GA 2FATL 3PHQB 2KQNA 4L4VD 4PGEA 3VXMA 1BF2A 4DUXA 2CH8A 1YMMD 1FVCB 1HINH 1VGEL 1LP9E 4HPOH 4ORZC 1F2XK 1FRGH 1TXKA 3PWLB 3F7YB 4NSKA 1T20B 4KRPD 3X3GH 5GXBB 2OK0L 2WZPD 4FFEX 5D2NC 1ZANH 3OKKB 5DJAA 3FO2A 5ENWA 2E9IA 2MKLC 1DJSA 4RMRA 1VACB 3FQTA 1UJ3B 3PHOA 5MP6H 4WFGD 4ZFFA 4TUJA 3LQAC 3HG1D 5LWYH 2DKUA 4WI3A 5B8CB 3HI5H 2YD9A 5KSUA 4QEGA 5FV2A 2GSIB 1G84A 5JW3L 2X4NA 2DMKA 2HVJA 4XPFL 1EO7A 3RVVC 4MD5B 4G8EB 5HDBE 4ZUSA 1YNLH 3BWAA 3IKCB 2G5BA 8FABA 2DQDH 1JP5A 3PV7A 2XA3A 1A6ZA 5C0JB 3HI6L 3U79A 3BIBX 1IM3A 1KENL 1FIGL 5BRZB 3CU7A 4Y8AA 3D69A 4YAQA 2P5EA 5IEKB 2AEPH 4PJDA 3TN0D 3RUGA 3L5JA 4AM0B 3OKEA 2VDOH 3KPNB 5IVXA 4PJXF 3MRHA 1GSMA 1S7UB 3V7MA 3QFJE 3RWDA 1F4HA 2ID5A 2Q3ZA 2PNDA 4P46B 2IC2A 4Z0BL 4IOIA 1OSZA 1OAXH 4EI6B 1AP2A 3CFCH 4Z7WA 1AJ7H 3TV3L 4HUUB 2Y06L 2NR6D 3NCYS 4K9EH 1YY9C 1OD9A 4UT9H 4FZEH 5JIPA 4NJ9H 1W8NA 3SKOB 3IU4L 2BSED 3WSQH 5EUOF 5CUSL 2LVCA 1JNLL 4LF3B 1T22A 4P2QE 5IB5B 1I9RL 5FGRA 3RGHA 2QSVA 4YQXL 4PB9H 1BREA 5IFJB 3BGAA 2R0WH 3MGTA 3QPQD 4F2MB 3VFRB 4BSWA 1ED3B 3IDXL 4ZFOB 5FGSA 1AGFB 3I9GH 4H5SA 1J1OL 4EIGB 5EWIH 4P48A 2R23B 3RFZC 4JY5H 4H1LA 4HF5L 5J9PB 3FB6A 3S96A 3HE7D 1LK2A 1RUQH 4LNVA 1PKOA 4FQQA 4ZD3H 1FGNL 3LVEA 4OT1H 3BZ4B 1ZA6B 2XY2A 1A5FH 4HGWA 1KPUA 3RAJL 5E03A 1IT9L 1GGIL 4DCQB 2HFGL 3JBG7 1B2WL 3R4DA 1CD9B 1D7FA 4XXCC 4XMLL 2FSEB 3H9SD 4Z8FL 4CN1A 4JQIH 1JNJA 2B1HH 1TCRB 3GMRB 4KDTA 5F89B 4NRYB 2B5IB 1MOEA 1K4CB 2BHUA 1TJGL 3QDGB 2EYRA 3GMOA 4XXDB 3OG4B 2I60H 2V5SA 4JZNB 2BVUA 4L8CB 3T2QA 3AS3A 3M07A 5HHNB 5M95B 5J6GA 5HDQL 1W72B 3QZWB 3I84A 2AQ2A 4EIZC 5IK3A 3LKRA 3MJ7B 2KUTA 1KC5L 5C0CE 3VXSA 2XOTA 4MD0B 1AO7A 4JFHD 4KFZC 5EU3A 2YPLB 1F3RB 2E7LC 2X4TA 2JIXB 4JFZH 1IAOA 3W9DB 5ESAA 4NQTA 1F4XL 1L7TL 2W38A 5BW7C 5D2LE 4NNXB 4X6EB 4I48B 4O5LL 1QLRA 2X4RA 3QHZL 1A6VL 1A4JA 3FN0L 4MB4A 3TT3L 4L8BB 4NN5C 1RIUL 2Z9TA 4PRBB 4W68A 2O61A 3SKMB 5L8JB 4LLAA 1MFBH 1G0XA 3OXRA 5EC2A 1BVZA 3FN9A 4FQ1H 4D9LL 5I15L 1FYTB 5D2NE 3QCTL 2DICA 3O2DA 3CDGA 1VFMA 3RZCC 1CCZA 1CLZL 1KG0B 4YO0B 1WT5C 4PJDF 5HTSA 1GIGL 1JV5B 2P1YA 2B8OT 4YXKL 3RUGF 2HT3C 3KPQB 2YC1A 3MRBB 4AQOA 5HHMA 5IVXF 4DGIL 3L5HA 2VLME 1N6QL 4NKDB 2JB5L 2YMXH 4NC1E 2UV3A 1FGVH 3BKJL 2VYRE 5JPNA 3VW3L 1XGPA 2ADFL 2B4CL 4GO6B 4YNYA 4AEEA 2FRGP 2H9GB 5EBGA 5F7EL 5KN5A 4Z7WF 3ULVH 3DURA 4X7SL 2VLJE 3BW9A 4R0LB 1MFAL 3VFUB 5I1JL 4LIQE 2ZCKL 4PJBB 2XZCH 3KPRB 3GB7A 3PF2A 4M93B 4QXGL 4YXHL 5IQ7L 1JTPA 4NWTH 1KTRL 3VD3A 4LL9A 5DR5L 3C08H 5IVNA 3SDCC 1LE5A 3F5WB 2BJML 5K9OA 5F93C 5EOCJ 3GBMH 3EYQC 5DMIL 4XBGA 1RURH 4YFEA 2V2TA 2IAMB 3KHQA 2AGJL 5DVOA 3O4LB 2LE9A 4PS4L 3P30L 4XPTL 3KXFB 1A9EB 5GS0L 4MCYA 4UV7L 5JHDB 5IJKC 1ES0B 2ADIB 4YHIA 1NUGA 3LOWA 3QUZA 5T1MA 1JPST 4AY0A 3B2UD 5I73B 1F6AB 3VFOA 4UTBL 4F7EA 3WFEH 1FAIH 2BVEA 2NX5A 1G7LB 4TNVF 2ATPA 2J8UB 3GUTB 1MHPL 4NC0B 3VGHA 3KJ4B 1BQHG 5K9JH 1FCGA 4KAQL 5MERB 3RI5K 4S10A 3HNSH 1O7VA 4N5EA 4OIIH 4GS7B 4A6YB 4ELKA 1G6RH 1N7ML 3TH4T 2XA8L 3WHXB 1G9NL 4M7ZC 3DGCR 2A9NL 1ZV5A 4NBZB 3RY5A 4OLEA 4DKFL 4KTYA 3X3FH 3L95B 4K94H 4NZRL 3CXDL 4MJ6A 3G6DL 3WFHB 2AABH 4U7SA 1AY1H 2R56H 3PE9A 5KTEL 4OFIA 4XHJD 2Z8SA 1CLYH 5KVEH 4RRPG 2FEEI 1EFQA 1XR8B 4X99B 5C0RH 4ZUTA 2YA0A 1U8NB 4CADA 4Z7OE 1RMFH 2CDFA 3QDJA 1ZLSH 4IRSA 1ZLWH 1ZE3C 3H42H 2V2WB 5IBTH 4Y5VA 1ONQA 4J4PD 4HKJA 4YHPA 4RGOL 3JTSB 2I9TA 2P43B 4Y19B 3KPMB 1X6LA 2BNRA 1JPSL 3W11C 5IB4B 3IXAA 4PP2B 4O9HH 4AEHH 4HH8A 5DRZA 2VLKA 1Q72H 3P3YA 5F1SA 1A14L 1M7DB 2R4SH 5KVDH 3E3QC 1T5WB 1FZOA 1K2DA 2XG5A 5DVKA 1OAKH 3OF6D 1KIPA 1CD1A 2P8LB 3QJHA 3MV7D 5T1KD 2OJZH 1FIEA 5IV2B 5EU7C 4QOKD 4IM8A 4Q9CA 3VGDA 3IFLH 5LVEA 4XX1G 2E7LE 2MTPA 5C0AD 2NZIA 3D1MC 4NPYA 3OGCB 5IMKB 3LMJH 1IFHL 2AQ3A 2FWOB 2YS4A 4V1DB 5TQ2L 1DLHB 3FFCD 1V7NL 1AGEB 4MS8A 3AB0B 3D25B 3BRDA 3ES6B 3NVQA 1XIWA 1BECA 3HR6A 5BZWA 5E9DE 3PWPE 5SWZA 1FZMB 1I8LA 3F7VA 5B4MC 2DBLL 3B8SA 1J5OL 3HPLA 3QUYC 1MF2L 1ITBB 3AAZB 4LPYA 1A3LL 1HIMH 3SCMD 1M7XA 1LEIB 2X09A 1F4YL 4CMHC 3WD5L 5HXMA 1TDQA 5H2BB 4PJGB 1TETL 5EBWB 4HUXA 2QQKH 2JB6A 5F7YC 1VEPA 4XPBH 3L3DB 2UUDH 3BO8A 4PJ8B 3SGDH 4DFIA 4FFZH 1QP1A 1S7RB 3IETB 5EOCL 4RMSA 3S35H 3U7AA 1F8TL 2X4PA 3O2DL 3G5YB 4N1EA 4L29B 4L3EE 1P5VA 1NEUA 1R5IA 3FO9A 3O41A 1S9VA 2IALA 3DUUB 4QTIH 3A6BL 2DAVA 4JKKA 1DANU 1MHEB 4HIXH 2BMKB 5GQBA 3ILPA 3QWRA 4R2GC 1XF5B 5IHUL 4J8RB 1A21A 3H9HB 5FYJH 3D48R 3LQMA 3MRRB 1IRAY 3NFSH 1MSPA 1V7MH 1BD2A 1T1YA 2IBZY 3WN5C 3CFKB 2W0FB 1IGTA 4WU7B 3L3JA 3FCTA 3VGGA 4EOWL 4YX2H 1SEQL 4R3SA 3SGDI 3ARQA 4PREB 2O26U 2N56A 1D5ZA 5EU6A 4WRLA 3FT3B 1C5CH 3B3IB 4OZIB 4Q2ZA 1QYGL 1DQMH 4GRLB 4MX7A 4BQBA 1T04B 4ODHL 4YC2C 2KZ1B 1K3ZA 1G0DA 3NTCH 3D39B 4EDWH 1FFPB 5HGBB 5CD3B 4OD1H 4RGMC 2BY2A 1RQ5A 3GSVB 3T3MF 2D9CA 5JOPE 1YN7A 4M4RA 5ANME 2J8OA 3HZYA 1NEZG 4TQEH 3TCXA 5SWSA 3UTSA 3DXAB 5JXED 1VEOA 3I50H 5KG9B 4Y5YC 5J12C 1Q0YH 1HQRB 4QTHB 1KB9J 5D6DC 4K71B 2VMFA 1LNUB 3MO1A 3RIAF 1GJIA 5FA4B 3RHWK 4JFOA 3VWJC 4PLOB 5FYKE 1DBML 1DBAL 3P40A 5E4IA 3TNMA 1FVEA 4JFYA 1K8DB 1JRHL 5DJXA 1FE8L 1T83C 2LTQC 4KQ4L 3JSSA 2DS4A 4U6YA 5FFLA 2ARJB 4TUKL 2PTUA 4RWYL 3UPCA 4ODWB 2FJFB 5D96C 1OVZA 3S35X 2G9HA 1DQJA 1T2QL 3MROB 4AT6B 1FO0H 3IDUA 4IMLB 4QRPE 2XKNB 5FDWB 3MACH 4X9FA 2GJ6B 1HN1A 5CJQL 1S3KL 5TDNB 5F3BB 5JW4M 2XZZA 4MAUL 1C5BH 2OP4L 3FONB 3ARGA 3BYYA 2X6MA 2SEBA 3CAFA 3L3IA 6FABL 1GC1H 4HS8H 2ESVB 3BWUC 2R1WB 1CE1L 4G8GA 1OT1A 3UTTE 1YMMA 2VIRA 1CICD 2D03L 1MLCB 1UKQA 4P2OD 2NY3C 1UQSA 2IQ9L 4XNQB 4YXLL 2VWEC 3CZFB 4GAGH 5IVOA 4JKLA 4X7TA 1G9MC 1FL3B 2FIKB 4IJ3B 5EU7E 3UTPE 3OHXA 2YUWA 4PGCA 1S9KC 4FQPA 5E99L 5C0FB 3MRQA 4UV4L 3QHFH 1YQ2A 3T3PF 3CMOH 2NLJA 1YN6B 4PGBA 4NYLA 4D8PB 2DYPD 4S2SB 2AKRB 2CKBB 2GUOA 3MV8D 2OR8A 1GCFA 1FL5A 3QO0B 5T1DH 5D6CB 3IDJA 4HH9B 3T2PA 5BJTA 3IDIA 4K7PL 4RA3A 4HKZA 4RNRA 5HHQB 1U58A 2A6DA 1UWEH 1T2XA 1LHZA 3AGVA 1BM3H 3QI9D 5HHVH 1MIEL 4ALAL 3WL9B 2EH7H 4XPGL 1BX2B 1HKLH 3DI2B 3TN0A 3QIUD 4YFLF 1P6AB 4PJXB 5FHBH 3QFJD 3ARDC 1U8MA 1AGCB 1UFUA 4F3FB 3KYAA 5C3LD 3KLSA 1CK0L 3VFPB 3TBVA 2EH8L 5IHZB 3RA7L 4UNVA 3IGAB 4NKMA 5F7FA 5EUOB 5E5RB 4OF7A 1OPGL 2GTZA 4NRZA 4Z95H 2B2XL 3A67H 1JZ3A 43C9A 1VESA 3MUGB 4KMQA 5D5MA 4U1SB 3QFDA 4P59L 3PL6D 4UOW1 2P5WE 2F5BL 2IBZX 4WTZG 1P7QB 4GOSA 4XP1H 2J88L 1U8IB 1TJHH 1XZ0B 1G9EA 4ZS7H 3OJ2C 4R90L 4JPWL 1TZGL 2GEEA 4M6OH 2HG5B 2ZPKL 1QFWL 4RMTA 4F7PA 2F5AH 2ZUVA 2W60B 1HCFX 2FB4L 4KZDH 4WTWA 1X5AA 5EIVA 1NCCH 5DFWH 4DK3A 4XWOC 3TYGL 1S7VB 4DKEL 5IOPA 3UC0H 1EEYA 1QBML 2FECL 3KLHC 3VCLA 5C09B 5FK9A 4HIHB 2VDQH 4FTVE 1RZFL 1T6VN 5EOQL 5C6TH 4GKNA 4MQSB 5I8CA 1N0XL 3T0EA 5L0QC 1OTSD 1I1AC 2PTTB 4PG2C 1DN2A 4PJ7E 1Q9KA 3PWNB 1H8OA 2AJVH 3PJSB 1M05B 4G9FE 1KEGL 4PGEB 5TDPB 3LDBB 3L3HA 3STLA 2ZSVA 5T3XH 1NQBA 2ICWI 2C3VB 3WO4B 4MA3A 2HJFA 3HC3L 5FYLD 5DJAB 4XCNA 3FO2B 3GK8L 5ENWB 4F15B 2VJXA 4NQCE 4PD4K 3PHOB 4ZFFB 4TUJB 4WEBH 2VAJA 4L4TA 3ELAT 5KSUB 3UP1A 1LE9B 1MCWM 2X4NB 4JFED 3VD4A 2FL5A 4JRXD 4Y16D 4EEEA 5FYLH 1FV1A 3BWAB 4P9MH 1T89C 2XQYK 4QHKI 2UWEE 2G5BB 4ELMA 5TQ0H 1CI5A 3BDYH 1A6ZB 1JL8A 2QTEA 2DQHH 1IM3B 3OKYA 1YPZA 3X3GL 3D69B 3RY6C 1DVFD 2VWEE 4YAQB 2EYTA 5D1ZC 5EN2A 3O3BA 3SE9H 4I4WA 2W1NA 2Y6SC 3N9GL 1VGKA 4IMKC 4PJDB 3DBXA 1ZHNA 5TFSH 3RUGB 3RX5A 5IVXB 4XP4H 3NIFE 3V8CA 5MP6L 1W8OA 2D4FA 2CUHA 2C4XA 3MRHB 2V5TA 4E42B 3HI5L 4WUUD 3RWDB 3L7EB 4L1DA 4HG4K 4XAWH 3BQUC 4LCCA 4IOIB 1OSZB 4X8XA 4N0YH 2VLJD 3HCVA 4N0FA 4Z7WB 4P2YA 3UTQB 4L4JA 4KHXH 2NXYB 4M7KH 1DQLH 2QBWA 4Q58C 1UJ3C 5C9JA 1OWRM 5B8CC 4D9QD 2VDRH 3GJFK 4JPKL 3QNZB 2APVA 1D6EA 3N1MC 3DVNA 3HE6D 3ZKMC 5KS9A 4WVRA 2NY0B 3SKNA 2AEPL 4PJFA 5D5MF 4K07A 4BSWB 3RVXC 2VDOL 4K3DH 1VB9A 3GFUA 4H5SB 4MZ2A 3S7GA 3AU1A 2XWJA 2F58H 4H1LB 5ICYB 4QXUH 3FB6B 3S96B 2FLRT 1LK2B 4FQQB 3OB8A 1OAXL 4LSRL 1AJ7L 1KPUB 1G6RA 2FLBT 1EHXA 1F00I 4UT9L 3MLTA 3EFFA 4YHYB 4NN6B 3MBXH 4C54A 2DQIH 5HDLA 3WSQL 1MAMH 4JPIB 5CEZE 5J11B 4BSJA 4P46C 4N5UA 3QUXA 3S37X 3TM6A 4KV5F 1Z3GH 4PB9L 4WUKH 2IBGA 2R0WL 3P73A 3UTZA 2EYRB 3GMOB 3L3OA 5A2LH 3I9GL 2CKNA 4FQJH 5EWIL 4X4YA 3FMGH 5J6GB 4JY5L 4CVWA 2RBLA 1FORH 4Z77A 1J0KA 1JWMA 1RUQL 4ZD3L 3EO0A 4OT1L 3VXSB 2EIEA 1D3CA 2Y07L 2I24N 4GUPA 2BOBA 3UJTH 4J6RH 5EU3B 2X4TB 2IWGA 5H37G 3W5NA 5HJ3B 3NIDF 4OCXL 4A2MA 1PEZA 1IAOB 4PYHA 2Y4SA 5ESAB 5C0BE 1SBSH 4WW1A 1T21B 4CN4A 4X9GA 4JQIL 2B1HL 2ENYA 1CDHA 3DX8A 4J4PA 3HC4H 1QLRB 3O6LH 1ZEAL 1IMHC 2NY5C 5BOPA 4W6YB 3MNWA 1A4JB 5DD5L 4BK5A 5C9KA 3MOBL 2I27N 2O61B 1MPAL 2EDTA 2VLLB 4KI5F 3ZDYF 1GOGA 3OXRB 4GG8A 3VXPA 5EC2B 2VXQH 1IAMA 2B5IC 3DETD 2EICA 1YPZF 3MV7A 4M9OA 5FF6A 4HK3J 1J11A 2AP2A 3CDGB 4NRXA 3ABZA 5K59E 4MNQB 4DTGH 4ZAKB 5CZXD 4GQ9L 1YEIH 3QULA 4JFZL 5HHMB 2DLEA 3ULVF 4JFFA 3BE1H 3FFCA 5JPNB 1XGPB 5E00A 4YNYB 5GGQH 1S78C 2C3WA 1VHPA 2OSLA 5KN5B 4CJ1A 1CDBA 3DURB 4TVPD 4RWHA 5F9AC 4HUMB 4JZOB 4DGYH 3PGFH 4MXQD 2UY7A 4PRPD 4OJFL 1LE5B 3EJYD 4XBGB 3DMMC 4FQ1L 3K74B 1L4IA 3SCMA 3V6OA 2QKIA 3UXFA 2V2TB 4PJFF 4XP5L 3QUML 3K46A 5J7CC 4NP4L 3ZHLA 4MCYB 2RB8A 1HYRC 2CMRH 1AC6A 1FGVL 4ONGH 4GH7B 5T1MB 2XYCA 3VFOB 4GQPH 1NGZA 4F7EB 1H15A 3ULVL 3ULUH 2XZCL 4G6AD 3W2DH 4I3SL 4NWTL 3TFKC 2ATPB 1MJ7H 35C8H 4QHUA 1H0DB 3GBML 4ELKB 1RURL 1UVQA 5CMAA 1QRNE 1CVSC 3NGBB 2A9MH 3WUWG 1J1XH 1R3IH 3IF1B 3D9AL 4M93C 1GHFH 3QIWD 5BO1H 5BRZE 4WWKD 1A1NB 3EYUH 5TE6H 4MJ6B 1A2YA 4PV9B 2X1OA 5BVPH 1IGFH 4RMWA 2IAMC 4LDEB 2DM2A 5FXCH 2ZG3A 4XNYH 3BP6B 5DGRA 4P9HC 3RVWC 5E6ZA 5F3HB 4CADB 3FZUC 2I5YL 1FAIL 3DPBA 3QDJB 1IM9D 1TTGA 4OI8A 1AQKH 5K9JL 3OQ3B 4Y5VB 3HNSL 3OJDA 4HKJB 4YHPB 4OIIL 3EO9L 2C1PA 1G6RL 2I9TB 2AXGB 2BNRB 3O8XD 4YHNB 1CLCA 1O5DT 4MJIA 5DRZB 2YK1H 1FO0A 1YYLL 3X3FL 1REIA 3KJ4C 2AABL 3DROA 1RU9H 1AY1L 1U8JA 2W59A 1K2DB 4PP1D 3QJHB 1KIPB 1CD1B 4GS7C 5KVEL 2DWEB 3U7YH 2OQJA 4KKLC 4QRPD 3TCLB 2HTKC 1Q0XH 3U6RA 3K2MC 2ICEA 1PFCA 3UO1H 1NFDA 2P4AB 4QRUA 4UT6L 3H0TA 1GGTA 1X5HA 5IROA 4NPYB 4U6HA 3MLUH 1RMFL 3IRPX 5IHBA 1J8HD 1ZLSL 2E7HA 3OAZK 3V4VH 3OXSA 5C0EB 5E1AB 4KGJA 4YJZL 3CK0H 5IBTL 1IKNC 1Y18B 2L7UA 3LKNA 4JM2D 4RIRA 1I1YA 4FN0A 4XNMA 3TF7C 5EC1A 4AIZA 2N7AA 4AG4H 3FAWA 4LSTH 5C07D 4K3JH 4O9HL 2O5YH 5FB8A 3F7VB 3Q1SH 3OSKA 3T77A 2B0SH 2R4SL 5KVDL 3HPLB 2AJUH 3V0AC 2OCFD 4U1LA 4X0KB 3HKFA 3KNBB 5I1CL 2OJZL 3QDGE 3SPVA 3IFLL 3EW3B 4HUXB 3T0WA 3LMJL 4CW1B 3BO8B 2VRAA 5HGGS 2FJHA 2DYPA 3X12A 5D9SA 3SO5A 4G8IA 4U7KA 3S36H 3MV8A 2X4PB 1NEZA 1UEYA 2YPLE 4K55A 4PRAA 5C2UB 1S9VB 2XQBH 1NDMA 3BN9C 3EOTH 1ZGLP 3ILPB 3OTTA 4QHLA 1DCLA 2LU4A 4HBCH 5D1QA 2AEQL 1M7IA 1BD2B 1T1YB 3MRFB 4Y4FD 1IGTB 2HRPL 3L3JB 1R3HA 3FCTB 4H8WC 3ARBA 1DLFH 3AB0C 3VFWA 4R3SB 3RTQD 4HLZG 5TF0A 4NQVA 1D5ZB 5EU6B 3VRLF 5EO1A 3GMPB 1IGYA 3UPRA 1VADA 4XPBL 1A6AA 5B3NA 4Q2ZB 4FFZL 2HT2D 4MX7B 1FYTE 1A4KA 3HAEH 2QLVB 1QSZA 3O9WB 4JO2H 4W6WB 5DJ2A 3MCLL 1ACZA 4LLUA 3AS1A 2VLRA 4HDIA 3C2SA 1D5BA 4N9OB 4QTIL 3U4BH 1XR9A 2EE3A 3FQUA 1U8HB 1MVUA 1YN7B 2R2HA 5TF1H 4LCIH 4LU5L 3KPTA 2IMNA 2OZ4H 5FYJL 3HZYB 3LCYA 2I9LA 2JJSC 2WLZA 1SJHA 5SWSB 2IH1A 3E1F1 4OB5H 4J1UA 1UCBH 2JK5A 3TO4D 2ICWA 2GKIA 3MO1B 4PJBE 3DWTA 4JFOB 3KPRE 5DD0H 5CKGA 1S9YA 2X7LA 4F7CA 5EDXA 1C5CL 4U1JA 1XGQA 5DJXB 4M1GH 1DQML 1F5WA 4HKXA 4U6YB 3ZHKA 3CSGA 1NJ9A 3MV9A 5I1KH 3PV6A 3OKNA 3NTCL 3RWFA 3S36X 2G9HB 1JWSB 1GGBL 4EDWL 3DX9B 4FTVD 1DQJB 3O4LE 5F44A 4OD1L 1EFXD 1KCKA 3KXFE 1NFDF 3MBED 1H9VA 5MENB 3LAFA 5FYKU 4ZXBD 3BIKB 3PXJA 1JWUA 4GRLC 1KOAA 1X5FA 2M1KA 4PGZA 5JHDE 3L9RA 3K3QA 1E4KA 4TQEL 3ARGB 3GKWH 3L3IB 3B4NA 4UIKH 2ICWJ 1Q0YL 2JTDA 5CWSA 2HMIC 1DN0A 1L7IH 4NO5B 4NKOA 4L4VB 5DD3H 1GOFA 2VQTA 5FECB 5LGJA 2VAAB 1J0ZA 1YMMB 1F3JA 2J8UE 3VDBA 3O6KH 4KRPB 3H7BA 2XZAL 3KG5A 3AROA 4X7TB 1KULA 3BKMH 2NTFA 1RZIB 4K71C 5HI4D 1NGYA 3OHXB 2COQA 4FHBD 5J4MA 3O81A 4ZOBA 1NAML 4HLZH 3HG1B 4OCRH 1JNNH 3MRQB 3C8KA 5KW9H 4BQCA 2NLJB 5DC9B 2R1XA 4JVPA 4U1IA 4JFEA 1S7XA 3ALWA 1TITA 2F19H 4IEFB 3T04D 4JRXA 1A7QH 1C5BL 2NY7H 4MZ3A 3H8NA 1FL5B 3EUUA 5B3JE 2NW2A 1GC1L 2N1KA 4PFEA 3G6AA 2YXMA 2CIKB 5DC4B 1AGDA 5JNYB 5GS2D 4HKZB 4RNRB 5JIHA 1T7YA 1U58B 2A6DB 3MZTA 5J1SC 3MLYL 3P4LA 4GXUN 4MAYD 4XI5C 5B39A 4XGZA 1R5VA 1U3HD 4ODXB 1P9MA 1A3QA 1EBAA 2EE6A 4GAGL 5E6ID 2D7PA 2F53D 3TN0B 2IPKA 4DZ8A 4YEFA 2CO6B 4Y19E 4KWUA 2MCPL 3QBTB 3CX5K 3V2AR 3BJLA 4NCC2 1GRWA 3OKLA 4OCYH 1U8MB 1ZMYA 4I1NB 4ZTPH 1CIDA 4JFXB 1MIMH 4X98B 1UWXK 3KPSA 3QHFL 3O3EA 3CMOL 4FFWD 5F8RC 3TBVB 3K8MA 3MRJB 3IXTA 1IAII 4IJ3C 1FFRA 3MYJA 5T1DL 1TCMA 1WAAA 4WI2A 5DO2D 2HWZH 5ADPH 1OLZA 4JFPA 1UWEL 3EIFA 4V1DE 3QG6B 1BM3L 5HHVL 2XQYG 1EERB 43C9B 4UDUA 4LFHG 1EPFA 5D5MB 4MDIB 2EH7L 3SE4C 5ALBH 1HKLL 4QRRD 1OM3H 3SHSA 2LAGB 4YBLB 5C08A 1NCWH 4MMZC 5FHBL 4HMCA 2RAMA 5F6IB 4HK0A 3UROR 3HE7B 4PGJA 4F7PB 4AIOA 5FA3A 3CFBB 1YA5A 3JVGC 4FXLA 5IOPB 1RJCA 4DQOL 4PJGE 2PO6D 2ICES 5FK9B 4QT5A 4GKNB 4HX1B 1QTYT 2EDJA 3T0EB 5I8CB 3A67L 4ODBD 5DT1L 5B38A 3GO1H 1IQDA 5KVFH 1U3YA 5JW4R 2GK0B 1ULVA 1Q9KB 1P84K 5IGXH 4JPVH 1TJHL 4DUVA 1DL7H 3STLB 1FVDA 4OFKA 2ZSVB 5DJZA 5EG6C 2HFFA 2VDKL 2XTLA 3OBAA 4ZS7L 3CDYA 3QISA 3NIGE 2VDPL 4JREB 4M6OL 1HHKA 2HJFB 1LO3L 4I77H 2FZ3A 1OW0C 2F5AL 4KMLB 3UYOD 4XCNB 1N6UA 4KZDL 4QCIA 3U46B 1NCCL 4I13B 4QRQB 2BHZA 5C0BD 4JHBA 2D2OA 1XH3B 5HD8C 2MOVA 2VDQL 3MA7A 4KK5C 5FUZH 4OZIE 5J1AA 2FL5B 5DDHB 1CZ8H 3KYNA 5DVNA 1FV1B 2APWA 1T1XA 4LFHD 3ZYIA 3U9UA 1BMGA 2BSRA 3D39E 1ND0A 3FL7A 1JPGB 4DFHA 2E8YA 2AJVL 5D7LD 3IDYB 1JHKH 4PRDA 5T3XL 2J12B 3MRDB 2CDEA 1YEKH 1OAQH 2D0FA 3BPCA 3QHTC 3E2HA 1TMCB 1YPZB 4P99A 3MRCB 2EYTB 4XPHH 5EN2B 3O3BB 3DXAE 1VGKB 4PJEA 2CRZA 1B90A 1ZHNB 1J18A 3DBXB 5IM7A 3HNVH 1P1ZA 3LDBC 2H2PD 4QHNA 2KKQA 2BNUA 4KKAC 4WEBL 1B6UA 2F74A 3WO4C 3B2VH 4YEEA 3MRPA 3MLXH 4R4ND 4NGHH 1C5DA 4LCCB 4U1NB 4BFIA 2VSCA 4RAHA 3HCVB 5FYLL 2CR3A 4HKBA 2HJLA 3ZE2F 4P9ML 4F15C 1RJZB 3I6LE 3FQXA 4ZODA 3RP1A 4JQXA 5C9JB 2DKSA 1BPVA 2NNAA 2YR3A 4OTXH 1WAAF 3BDYL 5EO0A 3UZEA 4DW2H 1QA9A 5AWNH 2DQHL 3QYCA 4WI7A 2GJ6E 4PRPA 4HUNB 3N85H 4P5TA 1K6QL 1D6EB 1KIUA 4R97B 1DEEB 3PGCA 4OKDA 3SKNB 5TFSL 4PJFB 4M43L 1H3PH 2AXHA 2ESVE 3GHEL 5A2JH 3WIHH 2YKLH 2JELH 3GJFH 4XP4L 1RZKC 3G5XA 2VDNH 5D7JD 3AU1B 2XWJB 1B0WA 1YECL 2QQNL 4LEXH 3RKDD 1A6UL 1NLBH 4JO1H 4XAWL 4EVNB 4PJCA 5I16A 3CSYA 2E6JA 4Q9BA 1G6RB 4M7KL 3VXQB 3MLTB 3EFFB 3FO1A 3X11A 3ROOB 5I75B 2EE2A 4YPJA 3OX8A 4Z78A 2JLLA 1EEUA 4OI7A 3BIAX 1QRND 3QUXB 3KYMB 5FM5O 1DBJH 2NXYC 1RIHH 3P73B 3UTZB 1UH3A 3DRQA 3KHOA 3L3OB 4YLQT 5C7XH 1ZXQA 4X4YB 2V5YA 2F58L 2AW2A 4YK4B 2IJ0C 4QXUL 3D85D 1JWMB 4UQ2A 5CIPH 4B7IA 3EO0B 2NY0C 3QIBC 4WO4D 1F4WH 5EU5B 2BOBB 4PJXE 2GSGA 3OAUH 4C57C 2V9RA 4Z7OF 1UB6A 3MBXL 1PW3A 4WW2A 4ZUVB 4FP8H 2DQIL 4Y1AD 4M1CC 4DWHA 5D7IA 4F33A 4C83A 1KLGB 2FX9H 3QO1A 4P4KA 4S1DC 3NFNA 3DX8B 3PP4L 4WUKL 3JWDH 1DBBH 1IGCL 3NA9L 4YHYC 3MNWB 3O8XA 5EUOE 3QXUA 4YBQD 2HTLC 4MJ5B 2GJZA 1G6VK 4FQJL 2E8ZA 1KLUA 1AXTH 4LBEA 4CN6A 1RK1B 5J11C 2AJYL 2H1PH 1U8KA 3VXPB 2UVFA 4KDTC 2YSSA 1IGIH 3MV7B 5T1KB 2MWCA 1K5NA 3C5ZD 4NDMB 1OD7A 4Z7UA 1AR2A 4HUKB 3UJTL 4J6RL 2WIIA 5C0AB 4XCCH 4X9BA 3QULB 4U1KA 1KEMH 1KT2B 4FG6C 1OTTD 3FFCB 1G7JA 2EDQA 4KK6D 5E00B 3EYOA 2EXWD 5I66A 5I71B 4XZUA 3ZE0F 2OSLB 3HC4L 3O6LL 3MCKA 3G6JA 2DJUA 4X5LA 1NMAH 5FO9A 4Z0XA 4AMKL 3LV3B 1ZVSA 3WUWA 3TIEA 1U8QA 5C09E 1T5XA 2YHGA 3WJLC 4J3TA 3LH2H 3LS4H 1ZT1A 3H3KA 1S9XA 2DDQH 4HQQL 3U1SH 4K8RD 1P7KB 3GSRA 3PWJB 3DVIA 2OTWB 4GSDH 3RWJA 3SCMB 2QKIB 2XPGA 1KCVL 2X70B 4DEPB 4ODUA 3VXME 3I6GA 3ZZ1A 4DTGL 2E9JA 3IFNH 3ZSSA 1DTUA 2HRLA 5I0ZA 4JG1H 3RX8A 3CVHH 2HLAA 3BE1L 1MFNA 3U36A 4NO3B 2NY1D 3BPLB 3W39A 3OAYH 1RV6X 4O2CA 3EOAA 1C8PA 4PJCF 1E4XL 1NGZB 1F6FB 5EA0H 1H15B 2ZOLA 4JJ5B 5IMOA 2H2SD 4ZAKC 4WENB 2DWDA 5D1XC 3KDMA 4DGYL 3PGFL 1J10A 3ARWA 3T0VA 3QWOA 5H35A 4G6JL 4N8VG 1KB5L 4NBYB 1UVQB 4F8TA 5CMAB 3PNWA 3HAEA 1JGLL 4QGTA 3K4DA 1BGXL 1RUAH 3E8UH 5GZND 1BLNA 1B9ZA 4D0BA 1OOAA 1HWGB 3QCUH 3MOQA 5CSBA 5JZ7D 2OZ4A 2CMRL 3EBAA 4ONGL 1BVLB 4Y5XC 5C2BH 4KMTH 3C5SA 4PJDE 5DZLA 3RUGE 2OXGA 3AY4A 4W4OA 4KJPC 5IVXE 3E6FA 2EECA 3ULUL 2P49B 1H8NA 4GT7A 2CLRA 2K7QA 1R3KA 3D0VA 1DUZB 2O93L 1MJ7L 35C8L 4WW2F 1FSKB 3UZVB 1X5JA 4UAOB 5D7IF 1KXVC 4YIQB 3OJDB 4Z7WE 1A47A 2V7HA 1SJXA 2XXCB 1WV7T 4OCSL 4L3CA 3TIDA 2A9ML 1PGRB 4RAUA 2BVTA 4MQXD 4IDJH 4D0DB 1Z9MA 1FO0B 3OB0K 4XVJH 1DUYA 5BO1L 5IMLB 4HWZB 1VERA 3EYUL 5TE6L 3IFPA 3MGOB 3DROB 1QR4A 1U8JB 2NY2D 2B7DT 5I1EH 2EC8A 4G80B 5BVPL 1IGFL 1NDGA 3NGBC 1BJ1H 2OQJB 1X5GA 4XNYL 4R4FH 1JK8A 2ICEB 1NFDB 1EFXA 1PSKL 4QRUB 3H0TB 2Q7NA 2R69H 4U6HB 1M6OA 1ZT7B 3T0AA 3N1FC 2HJKB 3MBEA 4ZXBA 1ZVHA 2A1WL 3IJHA 3GSQB 1KJVA 4OI9A 2DN7A 1O7SA 3REVA 3LKNB 1XAUA 2OJEB 4RIRB 1I1YB 4XNMB 2VZ3A 5EC1B 4PJIA 4AIZB 1RVFH 4I5BB 5L7XL 3G6JF 1SVCP 4UNUA 3OAZH 1NGXA 4LCYA 3G04A 3IDGA 1Q9LA 4G6FD 4P2RA 4FXGA 5DQ9A 1MFDH 1CICB 2YK1L 3QDHA 3JXAA 3WS6A 4P2OB 5F6HI 3T77B 3QEQA 5ERWA 5GRYA 1RU9L 1HHHA 3PQYD 4U1LB 1CE6A 1CXKA 3RZWA 3H9ZA 3U7YL 2R0ZH 2OL3H 3SPVB 1JHTA 1F02I 1HI6A 5ISZA 3K4AA 4JZJC 2BVQA 3SDDD 3MUHL 4B50A 4M00A 4PUBH 3MLUL 5IUSA 4XAKD 5IF0B 4JHZA 2X9WA 1AH1A 2FJHB 2DYPB 5TPWH 3CK0L 3X12B 1XF2A 4G8IB 3ZHDA 2HKHH 3VXSE 3MV8B 1NEZB 4LOUD 1AO7E 3D2UD 3K81A 2Z92B 4XBEL 4DGVL 4AG4L 1NDMB 4LSTL 2A2QT 4K3JL 4LEOA 5E56A 5E7FA 1Q9WA 1KJ2B 3BKYH 1XCTA 3Q1SL 4YPGA 2B0SL 1NGQH 1M7IB 3B9VA 3DJ9A 1ZLUK 5E6IA 3FTGA 1R3HB 5I1IH 4D9RD 1KCUH 2ZG1A 1C1EH 3QIUB 3WIIH 3VFWB 1CBVH 4IRJD 3AS0A 4UB0H 1C08A 1D9KA 4ZMAT 2WBWB 1I8LC 1U36A 3LQAH 5EO1B 4F58L 1IGYB 4B41A 3UPRB 5I76A 3KPOA 1A6AB 5DD1H 2LAAA 3SE3A 1TQCB 2EXYC 5JOEA 3ETBF 1A4KB 4KHTL 3SDAA 3QNYA 2DTSA 1R0AL 5DJ2B 4I18A 2Q86A 2FX8H 1ZGLA 4LLUB 3VXOB 1UH2A 2XQBL 4LIQH 1I85A 5HHME 1GGUA 5I8OH 1XR9B 3FQUB 1MVUB 4PLJC 4G7YH 3Q6GL 2PXYD 1T1ZA 2I9LB 3A6CH 3ARFD 1I3GL 5FO8B 1SJHB 2WUCH 4Y4HC 1BZ9A 4GW1A 3I3DA 2IH1B 4KQ3L 1DLFL 2IANA 1WK0A 5IBLD 2ICWB 1T2JA 2R9HD 1WWAX 3W9EA 1EV2E 4S1SH 2ORBH 5GSVA 4G8FA 3QCVH 3CCHA 4LAQH 5F97E 1S9YB 2X7LB 4ZPTA 3W0WD 3VGBA 3PGDA 3K0WA 5GRUH 2YXFA 3OKDA 2H3NA 4U1JB 1LK3H 1XGQB 4FMFA 2HH0H 1HK6A 4CNIA 5JLZA 1NFKA 4JHAL 4EN3A 1EVUA 3OKNB 5T3ZE 2VN7A 4OCWL 2DQEH 1MRCL 3U4BL 4YHMH 2PO6A 3SGKA 5DJ0A 4KJQC 2J3SA 5A3IC 4ERSH 3QXVA 4LCIL 2OZ4L 2Q76A 1HXMA 4XC1H 3L9RB 4OUOA 5KBNC 3RX7A 3FOLA 3QXAA 3O9WC 1PLGH 1QR1A 5CWSB 1DN0B 3EO1A 4NKOB 5I8EA 3CXHJ 4UILH 2D7QA 4PJIF 4BELD 3Q5OA 2DBJA 3LKOA 4NO0D 3SBWA 1D5MB 1F3JB 2RHEA 3OR6B 4N9GA 1W0VA 1R6VA 4M1GL 2FHFA 1HYSD 2R1YA 4PP8C 1KB9K 2J4WL 2NTFB 1FH5L 4TNWF 3BVNB 4L5FL 5I1KL 4F9LC 3VI4F 4LNRA 1NGYB 1I9JH 1YNTA 3VH8A 1UXWA 5HVHB 5GGUA 3C8KB 4Y4KA 4B7LA 2HT4D 5DSCB 2R1XB 4U1IB 1DSFH 1S7XB 1MCCA 4JFEB 4JRXB 4Y16B 1UA6H 5E8DH 2WBJA 3GKWL 1BZ7A 3G6AB 3TPUB 3MLSH 3MLPA 3T3ME 1CXHA 1AGDB 3SJVA 5DD3L 5F71A 2MMXA 3QDJE 2A0LC 1QFPA 4YBHA 5HPMA 2I07A 4FFVD 1I9EA 3EYSH 4TN9A 3O6KL 4I0PD 1FZKB 1R5VB 4XGZB 2FATH 2DOCA 1DVFB 2Z31D 3ARGC 4LDLB 4OLVL 5ICZB 4PJ5D 4PRNA 4PRID 4R26H 2JJTA 4PD4J 3BKML 1VGEH 4XTRC 2DQJL 2IPKB 4DZ8B 1I7RA 2BNRE 2VL4A 5IG7A 4WI5A 4MB3A 2WSKA 2Z91A 1CWVA 4LCUA 3OKLB 4QYOA 2VLKE 2CO7B 4JLRA 5AYQA 5KW9L 3KPSB 2Y25A 4WUUB 1CD0A 4PYGA 3RWHA 1IEHA 3IXTB 2NY7L 2Z8WC 2FJGB 3WXVL 1L0XA 1GZPB 3MYJB 4DAGL 3X13B 3R1GH 2CK2A 3O45A 5L8KB 1UWXH 2GJ6D 3WIHA 2XNAB 3GJFA 4XPFH 5F7DA 1QD0A 1T0NA 4JFPB 4QHMA 4XCEA 4X8JB 5HSFA 4UDUB 5ID1A 4M7JH 2ESVD 1BVKA 4M8VA 1N5YH 4UNTA 2ZUTA 5BMFH 1FIGH 3RVUD 4YDIL 4ISVA 1MCPL 4HS6B 4OCYL 2GFBA 1U6AH 4MYWB 3B6SA 4HK0B 1MIML 4ZTPL 1JFQL 2C5DC 2KBGA 5FM4A 1FN4B 5J1TC 1YY8B 4HHAA 5FA3B 4XNXL 4PY8J 5JORA 3TN0C 2L7JA 4NWUL 5CJ8A 1NANI 4K9EC 2EYSA 1YEDA 4NUJA 1L0YA 3MJ6A 2HWZL 3T3PE 4K3EL 4Z0BH 5ADPL 4QT5B 5E8EA 2V2XB 1Q8MA 5KSAD 2WV3A 3DIFA 4M5YH 4L9DA 5EO9A 2YUZA 5B38B 4N0UA 2W9EH 1EH9A 2NR6C 5CIPA 3IU4H 5ALBL 2Y36H 7FABH 3H9YA 1OM3L 1QFUL 4N8PA 1NCWL 5DJZB 2HFFB 4YQXH 4H0GA 1TLKA 1CDGA 3PHSA 1T4KB 1HHKB 3REWB 1BD2E 3GIZH 3G9AB 4KROD 2FZ3B 3D85A 4L8DA 3U30B 4GG6A 4OBSA 4YBLC 3QPQC 4WO4A 5HYSA 3BP4A 1MUJB 3TH2T 1NCNA 1IJ9A 5EU6E 2AK4D 5F6IC 3ZSTA 3MA7B 4H0HB 1NKOA 5J1AB 1QSVA 1A1OA 3HE7C 3GJEA 3KYNB 1AD0A 3WFCH 1IT9H 3GO1L 3VG9B 5KVFL 1WEJH 5F7NC 1T1XB 3FB5A 3DYPA 2BSRB 1ND0B 4JPVL 1FQ9C 4WI8A 4GJTB 2B39A 4PRDB 3QEUA 2F8XC 2CDEB 3BPCB 3E2HB 4RDQG 1E27A 4U31A 1TJGH 4CGTA 4ONOA 5SWSE 2XWBA 4I77L 5E8PA 2E7MA 3BT2H 3LEYH 2ED7A 5IM7B 1EO8H 3RGVA 2GT9A 2WAHA 1P1ZB 1WTGT 5T5NG 2DLFL 4QHNB 2BNUB 1T6WA 2F74B 3U0WH 5DFVD 1LP9A 4JREC 4L8SB 3MRPB 4X4XA 5FUZL 3MXVH 1CZ8L 1C5DB 4BFIB 1X5XA 2FDBP 4HKBB 2CIIA 4KJWD 1F4XH 2R15A 2NNAB 1JHKL 2VZTA 3O4OB 3L3KA 1QA9B 4TRPH 4XC3H 1YEKL 1OAQL 4PRPB 3CVHA 4P5TB 5ADOL 3NZHL 2GY5A 2X42A 1MLBB 2K9UA 3ECBB 4XPHL 1V3LA 4M4PA 3TT3H 3VXMD 3BPNB 3PGCB 1JGVL 1OP3K 1KIRB 3HNVL 4L4VE 3P0YH 3G5XB 4OLZH 1YMME 2X10A 4K23H 1XGUA 1HOCA 5I15H 4KGLA 1FFOA 3QWQB 3B2VL 3MLXL 4NGHL 4PJCB 3WJJC 4YXKH 5DVLA 2ARJQ 5EZOL 5I16B 2BX5A 4KK9D 3CSYB 4FQXD 1VFBA 1JCKA 5H8DA 4OM0L 4DGIH 1N6QH 3FO1B 2JB5H 4WFGE 3X11B 2KH2B 3HG1E 4OTXL 3U2SB 1U0QA 2C1OA 1DEDA 1FJ1B 4RCAA 3OX8B 4DW2L 5AWNL 4MNGA 3WNLA 2XN9D 5F7EH 1VKXA 4KK8D 3N85L 2FHCA 1H3TA 3O6FA 1KELH 3B43A 2ZUUA 5IT2L 1JF5A 5FUCE 4RGND 1H3PL 3DRQB 1U95A 1BF8A 4FMKA 5GS0D 2YKLL 2JELL 3MFFB 4G42A 2VDNL 4FRWA 2P5ED 1WZ1L 4XVUD 5GJSH 3QIWB 1XGTA 3N1PC 1X5LA 1WZLA 4LEXL 2V9TA 2DQFA 1NLBL 4JO1L 4R97C 3T65A 1MWAL 3VG0L 4KU1A 2AJSH 2YD6A 4GG6F 4NIKB 1A0QL 1QHPA 2BSSB 1BWWA 2EIBA 2ZP0T 1B4RA 1UB6B 3N1GC 5DZNA 4WW2B 4OLUH 4XMPL 3F7RA 2C26A 3VJ6A 5D7IB 4OIAA 4C83B 4YZFE 1PG7H 3UAJD 3NFNB 3B2UC 1DBJL 4L3AA 1RIHL 3O8XB 3ARXA 5I75C 4M48L 4PJ9D 4LCWA 5JIIA 3LN5A 3ROLB 1KLUB 4LBEB 4LK4A 4IRZL 4K94C 2OS7A 4ZUUA 2NZ9D 3NFPA 5D5ME 1T03H 1G9NH 2YSSB 3MRMA 1UACL 1K5NB 4ZNCD 5HHOD 2Y7QA 3LD8B 4IOFD 2WIIB 4QRPB 2Z4QB 3G6DH 3LHPH 4JY6A 3FHQA 4U1KB 4YK4C 1J8HB 4FP8L 3R06A 4MVBD 2OI9A 1UZ6F 3WE6A 1ODAA 2XG4A 2QEJA 4XHJC 2FX9L 3G08B 3EYOB 1H5BA 4XZUB 4JM2B 1RULH 3G6JB 3ULSA 1DBBL 4Y88A 5F6HJ 5FO9B 4MDJA 2OL3A 3ARPA 5MI0B 1ZVSB 3F12A 3WUWB 3TIEB 5C07B 2EDWA 4CRPA 4DUWA 3B9KA 2EDDA 4KV5E 3T0EE 3DNKA 4L1HA 2H1PL 2YD2A 1EJ6A 1S9XB 3NN8A 4J4PC 5JDJA 3GSRB 3PQYA 1IGIL 3CH1A 4JQVC 3X14A 1JJUA 4JDZA 3RWJB 1P4LB 4KRNA 3S9DB 2XPGB 3SOBH 1A14H 3R8QA 2BVOA 5C8JA 4XCCL 3SDDA 1ZA3A 4GW4A 4QXTA 5L2JA 4EDXA 1VEMA 3H2WA 3F8UB 3U36B 1AO7D 3M17B 1Q9OA 3W39B 1JFMA 4LLDA 1X5YA 4O2CB 3QEGL 3EOAB 1EAJA 4X80H 3NIDE 3D2UA 4JFHE 1WBYB 1I75A 2ZOLB 5IMOB 1NMAL 4ZO6A 5TQ2H 2DWDB 2ZUXA 3D18B 1N3NB 1V7NH 3KDMB 1UYWL 1CQYA 4G7VH 3V79C 3VFGH 1SY6L 4U4BA 2ITCA 4WFFE 3LS4L 3QWOB 5H35B 5I71C 4OZFG 1KXTB 2DDQL 4Y4FB 5DJDB 3V52L 2P24A 4ZOCA 1G9MH 3PNWB 4GSDL 2VISB 3LKQA 4OV6F 3GNML 4S0SD 5DA0B 3FRUB 5F9OL 4ELME 4M6AA 1LQVA 3BN3B 5C1MB 5HHPB 1BLNB 1C16A 4KI5E 5CP3A 2J8HA 3GSOA 1A3LH 4D0BB 4JG1L 2H8PA 3CVHL 1YPZE 1J86A 3VD5A 4YR6A 2VXSH 1UB5A 3ZO0A 2VH5L 1TVHA 3C5SB 3SCMC 3S3JA 4AH2A 5HHMD 5I74B 3TESA 4DEPC 1I1FA 4YGAB 5EA0L 3E6FB 3ULVE 1SEBA 5LGHH 4GAJH 5HVWA 2CLRB 1F8TH 3BJ91 4YUEH 2ILLA 1OP9A 2PXYA 4M5ZL 4D0CA 3ARFA 2Q8AH 4PB0L 4U0RB 2V7HB 3O2VH 3S5LA 4L3CB 3EDFA 3TIDB 3TO4B 4APQD 4POUB 2FBJL 5L88L 1DBKH 4GLRH 3DSNA 5DTFA 4RAUB 2UUDK 3HFML 3QNXA 3IFPB 3QCUL 5CD5D 5JA9A 3O11A 5GS1B 5C2BL 2BZDA 2YOCA 4PJFE 3S97C 1QFOA 2XTJD 3RJQB 1AD9B 1JK8B 4F9PC 3VDAA 1A6TA 3K80A 1EFXB 3OB0H 2ADJA 4UQ3A 3IS1X 4RFEA 2OLDA 1H3WM 1MQKL 5ITFA 3QUZD 4LQ1A 3MBEB 4ZXBB 2XWTA 5CEZH 3IJHB 1KFAL 1KJVB 2WWMD 4PRHA 4UUJA 1QQDA 2XFXA 4HXAH 3REVB 2R2BA 4K7PY 5FM8A 5DQDH 4PJIB 4XBPA 2NX5D 5IIEA 3RPIA 2NPLX 4OCNC 4OV5A 2VNCA 2UVEA 4LCYB 3G04B 3IDGB 4L9LC 1Q9LB 3VGAB 4P2RB 4FXGB 4IDJL 4N5ED 5DQ9B 5LCVH 4XVJL 2PW2B 3QEQB 1FSKC 4UAOC 1RSFA 1HHHB 1NUNB 1J1PH 1RZGA 2PW1B 4LLQA 4OZFH 5JXEC 1YEJL 5EIQA 2V9QA 1DBMH 5LG1A 1JHTB 4R4FL 3A0OA 4GKSB 5ISZB 2BVQB 5CJ5A 4DK6A 4Z6AT 4RWYH 4ZUWA 1XF2B 3MNZA 2R2EB 4ZQKA 3LKPB 4IRSD 1RVFL 5F7LB 3V8OA 5DZOA 1FL6A 5CJQH 1S3KH 3MQIA 4LEOB 3Q5TA 4MAUH 1LO5B 1Q9WB 2E7LA 1D5XB 2MHAA 3L3GA 1XCTB 3WNPA 4YPGB 1ZTXH 6FABH 4I0PA 4OF5A 4HGKC 5JMRA 2Z31A 4J3VA 5C3TA 5E6IB 5GRZA 3FTGB 4PJ5A 2F53B 4PRIA 5BW7A 3IAGC 4O58H 2VLKD 3H3PL 3MRLA 2R0ZL 2OL3L 5ALCH 4ZSOA 1KYOJ 1D9KB 5A16A 3Q2CA 3F6LA 5E9DA 1CICC 1P4IH 3ORJA 3PWPA 5I76B 3EZ8A 4P2OC 5IR1B 1ZLUH 3P9LA 4RMUA 4M8QA 5TPWL 4C59B 3CFEB 3MV7E 4POZD 4QLRA 1WC7A 5EZJA 1IILE 5E99H 3QNYB 3K4ZA 4I18B 3BEVB 1YC8A 1ZGLB 5C0AE 3UBXG 1MAJA 1WT5A 4JE4B 3EAKA 3TT1L 4Y2OA 3HB3C 3BKYL 3MR9A 3FFCE 4MS8D 2AJXH 2DM4A 4XNUH 1T1ZB 1XIWD 3CC5A 2GTWA 1QNZH 5GIRA 1U91A 4K7PH 1BZ9B 3I3BA 5SWZD 1BFSA 4LVHC 5I1IL 3CX5J 4QRRB 3VWKD 5IFHL 1C1EL 3MFGB 1CBVL 3W9EB 4NQUA 4UB0L 4NM4H 4PJHF 4R6UA 1MJJA 5KJRL 3LQAL 3PGDB 3OKDB 3QI9C 5ACMA 3NCCB 5DJ6A 3M1BA 1FBIH 1NGWA 1ZT4A 4CNIB 5JLZB 2YUXA 3P77A 4HS3A 3V6OE 3QIUC 4HUVB 1N26A 1NC4A 2FX8L 4CL7A 1CK0H 4FQIH 1A7PH 1OHQA 3MRKA 4LIQL 2EH8H 2PO6B 2A6IB 3WDIA 1I8KB 4KVNH 3CIQA 5ID0A 3SQOL 3TNNA 1YEGH 2PYFA 4G7YL 5KSAA 2Q76B 1HXMB 4NCC1 3A6CL 3V9FA 3FOLB 2BSTA 1CG9A 2WUCL 5FKPA 3QXAB 4OF8A 1EDQA 5IJKA 3GRWH 4P57B 1QR1B 1XGRA 4XB8A 2YEZA 4PTTA 3EO1B 4JGMA 4KC3B 3QWRD 5I8EB 3LB6D 4BA8A 2EZ0D 2ORBL 1FNSH 2IGFH 3LKOB 1G7IB 3ZMRA 3QCVL 4LAQL 4N9GB 32C2A 5GRUL 5TH2A 1N64L 4ZO9A 1V8HA 2FEDD 1CL7L 1NFIA 5HGAA 5K9QG 1TQBB 2J88H 4NFBA 1JVKA 3PL6C 4ORGA 1I7ZA 3BD4A 4F7MA 2OTUA 2QSCH 3ZDXF 2APXA 5M94B 4R90H 4LNRB 1WBXA 4LHUG 1YNTB 3VRLE 3TYFA 15C8H 2HP4A 4KKNA 1TZGH 5GGUB 2DQEL 4YHML 4LVOB 4GKOA 2FB4H 2ZWLT 1ZOXA 1CTOA 1TTUA 3TYGH 4O4YH 1WF5A 1P84J 2W0KA 3B5TA 3BP7A 1BZ7B 4K7PX 5CZKA 5E5MA 3O3UN 2LU7A 1EHNA 3DYOA 5D7LB 3V6FA 4GAFB 3SJVB 4UILL 3U0PA 1OQOA 1WWBX 5DUMH 1ZKAA 5HPMB 1AHWB 3UTSD 1YJDC 4KXZH 1UADC 2UYLB 1OTSC 3CLEH 3J8F7 1E4KC 1QFWI 4PRNB 3VXNB 1Y6NR 1I7RB 2DQGH 3MOAH 1I9JL 3ARZA 1EVTC 4DN3H 3MNVA 4JLRB 5F9WB 1EJOL 2FECI 5JQHC 2CRIA 5EIIA 5J0BA 1DSFL 4HJ0D 3RWHB 3VE0A 1I8IA 2LVEA 4KY1H 4WIQA 3E3QA 2D7NA 1U3JA 1UA6L 3UBXI 3QR2A 4PDCE 4KXZI 1Y6KR 5GPRA 5GJTL 5JQ6H 1NFDE 3MLSL 3RWIA 5HVHC 4DZBA 3GJFB 3HN3A 5F7DB 4P2CG 5F7UA 5FEBA 1ZAGA 4QHMB 4XCEB 3QQ3A 5GZOD 3EYSL 4Y16C 3B9DA 3GDBA 5ID1B 5IJVA 1BVKB 2CJUH 4G8GD 1NCUA 4R26L 4DVRH 4E41D 1ORSA 1Q38A 2NYYD 1PY9A 1BQUA 2OBGA 1H3XA 3MV01 4LHUD 5D7JB 4ISVB 3P0VH 1XMWA 3B6SB 3N9GH 1BHGA 1PEWA 2ADGB 3QH3A 1KTLA 1DVFC 2EIZB 3SDXA 4HHAB 1BQLL 2YPVH 1ZWIB 3QUYA 1TZIA 5HDOA 4GRWF 5T5FL 4FQXA 4QXWA 2VZ1A 2EYSB 1G7PA 4NUJB 3R1GL 4GW5A 3J7HA 4NC1C 5DMGD 4MLIA 3L5WB 2Z93A 5E8EB 4RZCA 5FIEA 2XN9A 4H20H 5AG9A 4OZHA 1QRNB 5EO9B 4N0UB 4M7JL 2DQCH 3VFTA 3MV8E 4GMSH 5CIPB 2VUYA 2ZNWA 3CPLA 2GI7A 1N5YL 2BP3A 4W4NA 1UZ8A 5BMFL 1DZBA 4JPKH 5K9QI 1CR9H 4YGVA 2IBBA 5EZLA 5E95B 4OZGA 1WUNT 4JEGB 4U33A 1RHHA 1U6AL 4X5WA 3GKZA 2RFXB 1R3JA 5KVMC 3P4NA 4FOMA 1AR1D 3D85B 4L8DB 1PAMA 4GG6B 4RQQB 5D72H 3WDJA 3HE6C 3WN5A 4Z76A 4WO4B 5BZDA 2MKWA 3BP4B 2FBOJ 3DX6B 4Y1AB 1HILA 4LSRH 2CLZA 4YHKH 1A1OB 5SWQB 3IDNB 4Q9QL 2ARWA 3GJEB 1AD0B 4M5YL 3Q0HA 2GHWB 4HWBL 5INCA 2W9EL 3FB5B 1E6OL 7FABL 2Y36L 3QPXL 2FCBA 4PJ9A 3QAZB 3QEUB 1HDMA 4M7LH 2VR5A 3GIZL 2XWBB 4ZS6D 3MMEA 2X1QA 5ICXA 4XB7A 3MRIB 3C5ZB 4JN2B 4Q6YA 2GT9B 5HHOA 3UMTA 2GW5A 4PJ7A 4Y5YA 1ETZA 2A38A 3NCYP 1TVBB 4X7EC 1QLFA 5GISL 4P9HH 3HRZA 1PKQA 3VWJA 4MVBA 2Y07H 3VFNA 3CUPA 1BEYH 3WFCL 2WP3O 2EC9T 3G5ZB 5D93B 2QQLH 1WEJL 3FKUS 3MV9E 2R29H 4OCXH 3QDAA 5L8LB 1IZJA 2H32B 1BBJA 1K85A 1KBGH 3T0ED 4NQCA 1EEQA 4JFQA 4PIRF 5T3XE 5FYKL 2X4OB 1ZEAH 2J5LB 2P7TA 1V3MA 1ZSDA 3TJHC 5DD5H 2X1XR 3MOBH 4A6YH 1RJLA 4U6TA 4CBPA 3BT2L 5D8JL 1M71A 3LEYL 1EO8L 1MPAH 2FD6H 2G75A 2QR0A 4YE4H 2YRPA 5SX4H 1ZK9A 1CN4A 1XGUB 1CLOL 3KPPB 3U0WL 1FFOB 3GMQA 1MHCA 3MXVL 1OP3H 2P47B 2NY1B 1JGUH 3DETC 3NPSB 4NO2A 2XXMB 3V5KA 1SMOA 3FT4A 1AFVH 4GQ9H 4PV8A 5FYLE 3SDXF 3EDKA 1VFBB 4L4TD 3QDMA 5HYIA 2XRAH 5CZXC 5DC0A 2VQ1A 4WFFD 1S5HA 2CK0L 5DUPL 4TRPL 4XC3L 4L8SC 4FQHB 4MNGB 1VKXB 4JFEE 5BV7C 1GGCL 1N2RA 1ROWA 4HWEH 4JRXE 4P3DA 3AM8C 1V5JA 4OGAD 1J05A 3O6FB 4OZHF 2JE8A 5FHAH 1NCBH 4UIMA 4U1HB 3FB8A 4KI5D 4RDQF 1JPTH 4XVTL 3TGXA 3TPUE 3RY4A 1U95B 5EU4A 5MEPA 3P0YL 4OJFH 1K4DA 2XT1B 4XT1C 4OLZL 4G42B 3O4OC 1WGOA 4K23L 4MXQC 4P3WA 1UM6L 1SYVA 5DMKB 4OZGF 5T5NF 3HRPA 3ZDZE 3EJYC 1OCWH 1X5IA 1K3IA 4XP5H 3BPNC 3ULVD 2Y5EA 3EJZD 2XZQH 3QUMH 1CFNA 3B83A 3UX9B 5IWLC 4NP4H 4Q97A 5ELIA 1PY4A 2XY1A 4EBQL 4LPCA 1LILA 3KPSE 4WUUE 2C3GA 3IVKA 3BHBA 5GGSY 2EDBA 3ZE2E 4EI5D 1KXQE 2R2CA 2HN7B 1KELL 4H8WH 3NCBB 2R4RL 1WAAE 1RZJC 4I3SH 4APQA 1MCJA 5GRVK 2F54A 4LCWB 3VI3F 4G6AC 2AJZB 4D9QE 3LN5B 5I8KL 5GJSL 5F9JA 3WNMA 1JUFA 2APBA 4MGXA 3NFPB 2NY2B 4XNZC 2VZSA 3MRMB 4OSUH 3D9AH 1T7ZA 2AJSL 2Y7QB 5HI3D 5DRNB 3RDTD 5BVJA 3O2WL 4Z5RA 4JY6B 2NW3A 1CFQA 3QIWC 1J7VR 4WWKC 4OLUL 3R06B 2OI9B 1BWMA 1FNGA 1PG7L 4NUGL 1AE6L 1H5BB 3V0VA 3HLAA 4OZFA 3ULSB 2Q3AA 2I5YH 4H25B 4X6BA 4N8VB 2OL3B 3LRSA 4NQSB 3ZKQD 3F12B 1ZHKA 1L6ZA 3QUXD 3WIFA 4I3RH 5CKAA 3MLWH 4G6FB 2BC4A 3B9KB 3EO9H 1WCBA 3NN8B 3MRNA 2QADD 3PIQA 2UY6A 1T03L 1UKTA 3PQYB 4X7CC 1INQB 4JAMA 3X14B 1I1AA 4JDZB 4HIEA 4PG2A 4CJ0A 3O8XC 1YYLH 3V6BR 5FGBC 4KVCL 1P2CA 5CEXA 3LHPL 2IQAA 3DX7A 3SDDB 1ZA3B 3BP5A 4P5KA 4QXTB 3EGSA 4PJAA 5JHLH 4EDXB 5L2JB 4OGXL 4W6XB 1Q9OB 5FO7B 2Q8BH 4PP1C 4U1GB 5IW6A 1IGJA 4LLDB 1QSED 4UT6H 2Q6WB 1RULL 4PY7A 1NMCB 3LD8C 3D2UB 4J12A 1LQSR 3ZE1F 4PTUB 2CUIA 2ITCB 2AEIT 2Z35B 3MRGA 5IB2A 1T80A 4JM2C 3JTTA 3SOBL 1WBZA 5MI0C 4IRJB 1T89A 1JPFA 1LD9A 1PJ9A 1AQDA 1MFCH 4R7DA 3GSOB 2H8PB 5I1CH 2UZIH 2NXZD 3MZGB 5BXFA 1QHOA 1TVHB 5MEQA 1MI5D 1OGTB 5D1ZA 5FOBA 4AH2B 2GAZB 2Y72A 2DI9A 1I1FB 4X80L 1EAPA 2ZCLL 4JFFD 2LV4A 1HHJA 3WS3A 1FVCA 1MCRA 4G7VL 3VFGL 3GSNB 1OAZL 1RIVH 1UEMA 4TSCH 2PXYB 3TH3T 1RK0A 3ZE0E 1T20A 5BQ7B 3ARFB 4KZEH 5C6PB 3P11L 3BQUA 1JN6B 2YRLA 1G9ML 4TYUA 3S5LB 3VWKA 1CGYA 4PJHB 4TVPE 2AEQH 1VACA 2HRPH 3W0WB 3QNXB 1HZHL 4PRPE 3HUJA 3QA3B 2GSIA 4Y4FC 2VXSL 1QBLH 4G3YH 4RAVA 3SGJA 4OCMC 4DN4H 1I3VA 3GRWA 3ARUA 3RTQC 3U7WL 3KJ6L 3FAXA 3IKCA 5LBSH 2ADJB 4Q0XH 5CGTA 4DVBA 4UQ3B 5FYJD 5LGHL 4RFEB 1INDH 1FFNB 2PTVA 2APFA 4GAJL 5ITFB 5TJWK 1XGYH 3MLVH 3LEVH 4YUEL 5C0JA 4PRHB 4UUJB 2XFXB 1GXEA 3MCLH 3ESUF 2BCKA 2HT2C 4PJCE 2Q8AL 1BIIA 2CKBH 3C8HA 1XCQA 5I74C 5IEKA 3O2VL 1MCFA 3SQBA 3EYVA 5IIEB 4AM0A 4LU5H 3RPIB 1SQ2N 4OV5B 1DBKL 4HFWB 4NO0B 3TZVD 3FO0H 3JWOC 1SM3H 2XICA 1JIBA 1RZGB 4LLQB 1G1YA 4U0RC 3TO4C 5AG8A 4HUUA 4GKZA 5DRXA 5AYUL 5E2WH 3SKJH 4ONFL 3BEWB 1Q94A 1MJUH 3UBXA 5CEZL 3DUHA 5GS1C 5CP7A 3VGFA 2PCPB 2CPCA 4ZUWB 1GGBH 4HXAL 1MRDH 5IB5A 2E7BA 4ZQKB 5DQDL 1UKSA 3C2AH 5EH1A 4JGUA 1TZHA 5IFJA 5E5UB 3VFRA 1FL6B 1AGFA 1RUKH 4ZXBC 2MHAB 3L3GB 1UH4A 4OGYH 5D7IE 4RFNB 5LCVL 1XEDA 4I0PB 2Z31B 1MCOH 1J1PL 4PJ5B 4PRIB 5K93A 3BUTA 4MJID 3BZ4A 1ZA6A 3L6FA 3AXLB 4BQ6A 5A16B 3VGAC 4DCQA 2XZAH 1NL0H 4NN5B 1IEBB 3MUJA 5GGRY 1I3RB 3P9LB 2FSEA 4NNPL 2BOCA 3KPLB 1CS6A 5EZJB 1WC7B 1NAMH 2ZOKA 4LLVA 3VD9A 3PP3K 4IS6B 5HI4C 5CBEA 1P4BH 3IRZA 4C56A 3B5GA 5CZVH 4BQ8A 4WJ5B 1J8HE 4Y2DD 3MR9B 5F1NA 4LGPB 1ZTXL 2AV7A 1DQQB 2YA1A 1FNFA 2GTWB 2KPNA 1U91B 2P46B 2LFGA 2GY7B 3G6JE 3WHE1 4O58L 1IAIM 3MLYH 4E41A 2XKUA 4MD0A 5KAQG 5ALCL 4NT6A 5C07E 3IB4A 1MJJB 4LHUA 4F57L 4P3CH 4DKDC 2JIXA 1P4IL 4MAYC 5DJ6B 1ZT4B 1U3HC 5DF0A 2MCPH 2WWKO 4GRWB 5E6IC 1I1CA 1UENA 3HUJF 3G5VA 1OB1A 1MCNA 4HS3B 1FYHB 1G7MA 2X1WL 4J7RA 3DMMA 1NC4B 4QKXB 1SVZA 4WHYH 4M03A 3BYTA 4M1DH 5E4EB 3MRKB 4L8BA 5ID0B 4PRBA 4FFWC 2PYFB 5KSAB 2AJXL 2V7NB 4XNUL 4Z7QF 1JYVA 3CGTA 1EXUA 1QNZL 1CG9B 5FKPB 1AI1H 1XGRB 1FYTA 2YEZB 4PTTB 5DO2C 2AEWA 1RUML 5IQ9A 2Y23A 1KG0A 1OGAA 4GBXC 2DLIA 5D1QD 2FGWH 1RZKH 4NM4L 3VRJA 5I1HH 1S7SA 2EDRA 32C2B 1CF8L 3ARBD 4AENA 5HGAB 3WFDH 1FBIL 5FGCB 3TFKA 2EDOA 3I3EA 4KROB 4ORGB 1I7ZB 5FYJU 3CLFH 4ENED 3VXRA 4JDTH 2EO1A 1RY7B 3U83A 1WBXB 2JJVA 3TYFB 4WHCA 4FQIL 5IEHB 3Q6FB 1A7PL 5DHVB 3VFUA 2AK4B 4KVNL 3KPRA 1CFTA 3ARED 4WHDA 1YEGL 1CXFA 4WV1B 1KIQA 4S1RH 3VMNA 3JTCA 2AI0L 1KNOA 1V05A 2IH3B 2VLRD 4DQOH 4S0TD 3GRWL 5E5MB 3V6FB 5IHLB 2QL1A 3OKMA 2PO6C 3SGKC 5DT1H 1FNSL 2X4SA 2IGFL 3DLQR 5DXWA 2PN5A 1A9EA 3VMPA 4JHWH 1MELA 4NHUA 3NCMA 2F8VA 4I9WD 2VDKH 4U6VL 2ADIA 2QSCL 4BFEA 5B39G 3CXHK 3HR5A 1F6AA 2VDPH 15C8L 3MNVB 4XH2B 1LO3H 3WNOA 3TBTA 4X6DA 3VFVB 2EE9A 3GBNH 5EIIB 3MV9D 4RISH 1TQBC 3BH8A 3QP3A 4U7MA 2J8UA 4HT1L 3GUTA 1I8IB 1JGEA 3T09A 5MERA 4O4YL 5EZIH 4A6YA 5A1AA 5T3XD 3FOMA 3MODH 4DZBB 4CUCA 5CJXC 4LVOC 5DUML 4P23D 1EMTL 1WCQA 3QQ3B 4ONHA 3CLEL 4O2EA 1OP5K 4LMQE 3NABH 3VXMB 1NBYA 1NBVL 4PJIE 1IKNA 2DQGL 1ORSB 3EFDL 2D9QB 3MOAL 3TF7A 2RGSA 4ZFOL 4NSKB 3FQWA 3TJEH 4DN3L 3GIVA 1U41A 4P2RE 1AHWC 5D71H 3F7PC 1NC2A 3QEQE 5BOZG 3DYMA 3QH3B 1KTLB 2EDYA 3SDXB 3VI4E 4KY1L 1U2HA 3FQTB 1TZIB 4FQXB 1HKFA 2NY5L 2H2PC 5EB9A 5JQ6L 5ISZE 4GW5B 5LJYH 3HI1A 4OFYA 2HVJB 4M02A 4C4KT 4PP2A 5F9WC 2Z93B 2FNBA 3MA9H 1HHIA 4ZUSB 4RZCB 2XN9B 4R4NC 4OZHB 1SYSA 1M7DA 1FNLA 3U82B 2CJUL 8FABB 1Z9OA 4OLXL 3CPLB 4DVRL 4RGNB 5F72S 4KTEH 5B38G 1UZ8B 3QUMA 1FC2D 1OSPH 4YGVB 3ALXA 4QWWD 1JF1A 4OZGB 1K6QH 4ZFZA 2P5EB 3P0VL 2W9DL 1RHHB 5DVMA 4M43H 4UOW0 3OKEB 3P4NB 5GGTH 4EJ1C 3DO7A 3GHEH 1UWGH 2F53E 2OR7A 2YPVL 5FUOH 2WMPA 3LPFA 5JXAL 1BFVH 4Z76B 5BZDB 1YECH 2QQNH 4KDWA 1FP5A 3KPSD 3ES6A 1A6UH 1MCKA 5D7JC 4URTB 1M4KA 4JCLA 3O3AA 4M7LT 4NKIH 3RKDC 5ITBH 1AP2B 1HILB 3CU1A 2CLZB 4YZFF 4H20L 2A6KA 5ABDE 1P6FA 4G43A 4EI5A 4BZ1H 3KWWA 5A43C 2DQCL 3BH9A 3AAZA 2C4FT