3HE7A

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
281
Chain Sequence
YTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMPIEIQLSAGCEMYASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
total genus 79
structure length 281
sequence length 292
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3he7A01
4MAYA 5D8JL 4WEBH 1GYAA 2VWEC 2YKLL 3KXFE 4I3SL 1F4XH 5EZLA 5K9QG 1FL3B 3MBEB 4ZMAT 3QI9A 4WI4A 2X4RB 3QEQE 1YNTA 4JCMA 2KZ1B 3ZO0A 5FOBA 1JZ6A 3RGHA 1F97A 3P4NA 2VR4A 3UC0H 4D9RE 5C9JB 4Z7QE 5TE4H 1AQKH 2HLAA 1VADB 1N59B 5F6IB 4NDMA 3QIWA 4YHLL 4CBPA 4HD9A 3KPPB 4ELMA 4XBEL 2DLGA 3HMXA 4IIQA 1MWAH 4AYFA 3QNYB 1F5WA 2Y6SC 1XF3A 2XZAH 3FQWA 5IB1A 2E3VA 3JV4A 2C3VA 5EBLA 1YN7B 3CVHL 3C60B 2VRAA 5JW4N 2DQIL 2NY0B 4KJYA 2DQDL 4OB5L 3K8MA 3H9HB 3F8UB 2EIBA 3IGAB 1EGJL 4W6WB 1OTSD 1BQUA 5C08A 1ODAA 3G6AA 4ODTL 3U2SA 4Z95H 3HR5B 5GZNC 3SE4A 2DLIA 5EU3A 2QSCL 3CIQA 5L6YL 2PCPA 1S5IH 3A0OA 3FOMB 4QCIA 3RVTC 2EXWC 3O45B 1YN6B 4PV8A 4CW1B 12E8H 2GFBB 1CFNA 4ZNCD 5GJTH 3RVUC 5SX5K 1UM6H 2XFXA 4LCIH 5CP7B 5EA0H 5E2TL 3QCTH 4KUCD 3IDIA 2Z0BA 4ZS7L 3PP4H 4WW1B 2J1KA 4KUZH 4OQTH 2LVEA 2F74A 4RAHA 2V2TB 2F5BL 4PY8I 3QIUA 4KK9C 3E8UH 4KRPC 4IHOA 1TDQA 4F57L 3KPRB 5EC1A 3IDJB 1Q9KB 5FYKD 2EYSB 1UXWB 1BEYH 2FSEB 2FD6L 4QWWD 1UEMA 1KJ2H 2ADFL 2XKNA 1KJMB 1N64H 1VEOA 3RJDA 4OZGB 1Q9LB 4QRRB 1IEHA 2C4FT 2IAMB 2DQEL 4G43B 2VZUA 3NMEA 5LBSH 5BOPA 1I7UB 3X14B 1F3DJ 2OJZL 5IEHB 1JI1A 1R24B 3SGJA 2YD1A 1DL7H 3K4DA 4OLZH 3EOTH 4JFYA 3I85A 4M1DL 4JFOB 4ODVH 2ADGB 3MLYH 4FQHA 4HF5L 3KAAA 1XF5A 3X13B 2GSIB 3I6KA 1T7VA 3KPTA 2BVUA 3TJHC 1AHWA 1F6AB 2JB5H 3IKCB 1QSED 5T3ZD 4KHXL 1DE4A 4H1LB 4ONGH 4X6CA 4Y4HB 3B83A 1NGYA 2AEWA 1EFXD 1FL5B 3Q48A 4PJGE 5IESL 5FHBL 3SQBA 4GBXA 4GKZA 4MJ6A 2B1AH 1QFWI 1NGXA 4LL9A 2VZOA 4FQ2L 4N0CD 4YFDB 2VLJA 4JHBA 1A7QH 5F7NC 3WFHB 3FMGH 1U8IB 1I1FB 1WITA 1UH4A 3LZFL 4KJQD 5I0ZA 1U3ZA 1OY3B 4FFEX 1EAPB 3SO3C 3VFGH 5CGMA 1IARB 4P2QA 5T1LD 3MRHB 4I2XA 3HB3C 1BIIB 3SBWC 1F4WH 2VZSA 4MS8A 1OD9A 2F15A 4RIRA 4YHKL 4C56A 2E7LC 3D25A 3M8OH 3MRRA 3SN6N 3RZCC 5B3NA 3VJ6A 5IW1A 2CRZA 3BKYH 4IS6A 2UWEB 3L5XH 4XP6H 4Z76A 2A6DA 1XGUB 4AMKH 1PY4A 5D1ZA 4R7DA 2EIZA 3E3QE 3LS4L 4PREA 5TDOB 2ED9A 3OBAA 3NFNB 2D31A 1ONQB 3WNNA 1FCCA 1B0RA 3FO2A 3IJHA 1LWRA 4U0QB 5KG9A 4MAYD 4JY6A 2IQ9H 4U7MA 2CXGA 1ETZB 3I75A 4A6YB 2P24B 4MJ5B 5KVFL 3KYMB 1GZQA 3B5GA 2CUIA 3SDCB 5I71B 3MROA 4WFED 3QEUA 5AYQA 4LPTA 3WNKA 1FNGA 3O3DB 4XMKH 3FKUS 4NCC1 1KIPA 4LLUB 3EOYG 2O5XH 3G5ZB 1N0XL 5LGHL 4MNQD 5HVHC 4ONOA 2ZCLL 4IRJD 4K07A 4RGNE 2IEPA 3RI5K 3X12B 4DTGL 1JF5A 5ALCL 3WN5B 3UP1A 1BVLA 2GK2A 2J12B 4Y8DC 3V5KB 1P9MC 4ODSL 1JIBA 3N85L 5I9QB 3B5TA 5ITBL 3MXWH 2FIRT 1Q38A 4TVPH 3H7BA 3W0WE 4YWGH 1FV1B 2KUTA 5FB8A 5DZLA 1C08B 4NKOA 2NY3B 1TCRB 4X7CC 4LLYA 1ZXQA 2MQCA 1NCUA 4RMUA 5D8JH 5T5NF 1A7PL 1JHLH 4YK4C 5FUCE 3NOIA 4RFOH 4I3SH 4CJ1A 3ZLQC 3HMXH 2VDLL 4DW2L 4Z18A 3UX9B 5DRNA 2IPKB 4HZLB 5CUSH 3T4YB 2FJFA 5C70A 1VPOH 5SWQA 1PYWA 3ZKMD 5IG7B 1L6XA 2X1WL 4PJFB 1A6TA 5KANI 4R90L 4TPRH 3RVXD 1LO2L 4MXQC 5KZCD 4G6AD 2JCCF 3PJSA 5GS2D 2FR4A 2D7OA 3MJ7A 4KZDH 3WJLA 1G7PB 5CSZA 3NGBC 4LIQH 5HVHB 1J8HB 2C9AA 4MLSA 4XGZB 3PWLA 2HRPH 1NSNL 2PYFA 1U3JA 3G5XA 5FXCH 3FFCB 3LN9A 3L9RA 3GJFA 5D5MA 3H0TA 4FZ8L 1WC7B 1LP9E 4S1DC 5D2NB 2AJ3A 5E7BA 2IADB 3ARBB 4XVJL 1N7MH 3DVFA 4JJHA 5K9KA 4MWFB 3MGTA 4GG8B 1I1YB 2PTVA 3GKWH 3VW3H 2KH2B 1F2XK 5DYOB 1BVKB 1U8HA 4ZSOA 3AS1A 4K7FA 3DO7B 4N8PA 4H5SB 2OYPA 4N1HB 4FQLH 1KXVC 1QA9B 4PLKC 5B4MD 3WFCL 2Q6WA 5GZOD 2VDOH 4BQ8A 3W2DH 2FX7L 3WDJA 2L7JA 1S8DA 3CLEL 2PTUA 3EDEA 3ARGC 3QB7C 2JJTA 4HFWA 3MACH 3ARPA 2W60B 4LP5A 4PJ7A 1EEYB 4KTDH 1BBDH 1YQ2A 5I2IA 4RWYL 1GOGA 4OT1H 2ICEB 3LS5L 1YEEH 4WW2C 1JPSH 1JGUH 4Z7UE 3S35H 4BH7B 4XNZC 5IM7A 3RDTB 3QXVA 1GXEA 1CXHA 1FYTE 2XT1B 4P46C 1GC1H 4ZS7H 3VI4F 4HH9B 5E4EB 1NPUA 2GITA 4LSUH 4M7LL 1RZIB 4P2RD 3PWPA 2VISA 2YOCA 3CFCH 1M6OA 1QSFB 2F5BH 4M93C 5E6YA 1SM3H 1NBYA 3BJLA 5D1QC 5C0NC 5C07E 3GSOA 4NFDA 3MUZ1 2BC4B 5CJOH 4H25A 5IB3B 4ZTOL 1U2CA 2AKRB 1H15B 1INQB 5FA3A 2CH8A 3AB0C 2KDGA 3QUZB 5F6HJ 2BXZA 1KJVB 4X4ME 4FABH 5M7QA 5LJYH 1U6AH 1T04B 3D48R 3LKNB 1NUFA 2P8MA 3BQUA 4M1DH 4M7JL 4P2QD 3MJ6A 4ZDHA 1WZKA 4C56D 5H2BA 4RCAA 1S9WB 1BZQK 3EYOB 5CJQH 5F9AC 4JY4A 1UWGL 4WDIB 5E2VH 2X42A 3H3PL 4UTBL 4S0UC 3MNZB 1JHTA 1WZ1H 2V2WB 3IFNL 4JPKL 5DEFB 3RHWK 3ULVL 1A4KB 4OZHF 4Q74A 2BDNL 1UYWL 4GKOA 4P46B 2AK1L 4XNUH 1INEL 5FHBH 4QO1A 2PXYB 5FHAL 2G5BB 5IW6A 1VHPA 2IJ0C 3VXSA 1J0ZA 3GDBA 5A40E 3VXUE 3T0VA 1CT8A 3L3HB 5IWLA 3HI1A 2W0FB 1IEAA 4MZ3A 1OTSC 4ZODA 3BKCH 3LHPH 5D2LF 3LZFH 3D0VB 1U58B 4JG1H 5LGKA 1G7QB 5E99H 3RL1B 4JPWL 3T3PE 1CLYL 5I75C 3QAZB 5CD3B 2GTWB 2J6EL 1EX0A 3IDNB 4PP1C 5FM5M 2R2HB 1T89C 1A7RH 3KPMA 1AY1L 1MAMH 3N06B 3OG4B 1NBQA 3BP7B 2O93L 3ROLB 5DLML 5FUOH 1A6PA 3M17B 4OUOA 5I1AB 2WUCH 4CRPA 4EOWL 2DDQH 5HHPB 5EFIA 4OZIA 1A3QA 3HE6D 1UA6H 4ACPA 2UVEA 3RWIB 3SDXE 4MB5A 4M3JA 3LRGA 1EEZA 5C0CA 4NYLB 1S9YA 1MCQA 1X7QA 4HWUA 2GEEA 1ZANL 1UJ3A 4O2FB 4PJHB 1WCBB 5HPMB 3E0GA 1B4JL 3DWTA 3KXFB 3DXAE 1P4IH 4QWWC 5I17A 5IR1A 2OQJB 3MQIA 1EO5A 4OJFH 2ZPKL 3OSKA 1R3IH 2X1QA 4P4KB 5HGGS 2J8UF 4UOW1 2BVQA 2BJML 1FGNL 2ZCLH 4W4OA 2NR6D 4XBPA 2F53E 1E0OB 2V5YA 5KW9L 3TN0A 4HKJA 3PQYE 4PJXF 5GSRA 3REWA 1JNHA 3B3IA 4HIIA 1M7IA 1G7IB 4HIXL 4EUPB 4HK3J 1Y0LA 3ZDZF 2X4NB 4K8RD 5ITBH 4BKLA 1NMBL 2VOTA 5SV3A 2PYEE 3NPSC 5IJVA 4UMGA 3DUHA 5KSBE 1S7QA 3ELAT 5KOMC 4Q0XL 2P46B 3L3JB 5C09D 5E08L 1LHZA 3T1FB 2ESVD 4MQTB 4OZFB 1KXTB 5BV7C 5C0BE 1FZOA 4LSDA 4P57A 5ACMA 3MRPA 4U1KB 4KRLB 4GRWF 1HI6B 4QXWA 4X9BA 4NN5C 5BS0A 3QFJE 3H9SE 5B39A 2FECL 3GJFH 4N0CC 4EXPX 3O8XB 3PGCB 4OBSA 3CU1A 1LO2H 3BEWB 3B9DA 2DAVA 3O2VL 1OTTD 4KV5F 4MA3B 2H45A 1IC7L 2Y23A 4KJQC 2DMBA 3QDGD 1JK8B 4XX1G 2YBRB 2HKFH 4J3XA 1CICD 4NRZB 3R8QA 4EUPG 4RSVA 3PGDB 2RBLA 5C0EB 2NMSA 4U6XA 1R5WB 3N0PB 5DEGA 3NCFB 4XH2B 2DLEA 1PEZA 5J1TC 1XCTB 3LKSA 1ZSDB 4FZ8H 3VMNA 3RFZC 5BRZA 4P9HL 5E6IB 3MOAH 3ARDA 3MOBL 3GSVB 4GKSB 1I3GH 3GSQA 4LLQB 3NPSB 3TBTB 1KT2B 2YPKA 3D9AH 3QQNA 2HA1A 1CG9B 4EN3A 3HG1E 5AZ2L 1TZHB 4YGVA 5IEKB 4G6FD 1QLEL 3PWUB 1M4KA 1BJ8A 4DVRL 1QHOA 2CR6A 4NM4L 3CXDH 1BWWA 1TQBC 3QCVH 4GG6F 4GRWH 2WM0A 3OTTA 4OFIA 2PR4H 3O4OC 3L1OH 1E28B 4JN2B 5EIIB 1FFNA 4MA7H 3S96A 2QHRL 2BHYA 1MLBB 3P11L 4GRLA 1HHKB 5FGCE 4J4PA 3BP4B 5J56B 1WWBX 3O6LH 2CRMA 3UTTA 1WVZA 3GSNL 3LS5H 1HIMH 2IGFH 2OSLB 1MJJA 3D5OF 2ZKHL 3MRLB 2QSTA 4N9OB 5B38B 3ULVF 4BK5A 4IRJC 4PD4K 3MV7A 4UDTB 5H37H 1NUNB 2I26N 2A9ML 5ALBH 4YQXH 4M7LH 4CAGA 4NZTL 2DBJA 3GSUA 3KYNA 3EAKA 5L8KB 4PLJD 3ULUH 3FB5A 5KVGL 4PY7B 4PJGB 1RIVH 4NQED 1S9XA 1CQKA 4LSVL 1S7SA 1WAAF 2E27L 3QO1A 3NIFE 3HPLB 1R3KB 5SX4H 1K8DB 3VE0A 5ERWB 2CIIB 3SJVD 1JGVL 3WEXA 4L3CA 3VFOB 3QZWA 3ZKMC 3BEVB 2QSVA 1HKLH 1DUYB 2VC2L 4OQ1A 3U0WL 4G6AC 4RISL 5B38G 1TLKA 5HHOE 3BH9A 5HI5D 1F00I 2NY5C 3V5HA 3HMWL 1H3WM 1BM3L 1YUHA 4OGAD 1RJZB 2VUOA 3WLWD 1FO0B 1NDGB 3GMOB 4Y4FB 4APQB 2H41A 2HFEA 2V2XB 4MJ4A 5I8EA 3DSNA 3EGSA 2GCYA 5T1MB 4PJIA 2VXVH 3RZWA 4HS8L 5HHXL 1LO0L 3GJEA 3OPZL 3VA2C 4U1SA 4HUVB 2BNQE 2I25N 1JYWA 2WBKA 3L5HA 5IOPB 5TF1L 1IQDB 5L2JB 2GAZB 4BK4A 3HZKA 2OTUA 3KLSA 1QLFB 3FONB 3LIZL 1CLYH 3VH8A 3I2CH 1ZOXA 2J88H 5B4MC 5GZOC 1YJDC 1Y18B 4NWUL 5IMOB 1M1SA 2J6EH 3N9GL 5E9DE 1S5HB 1FE8L 2AI0L 3TN0D 1AY1H 5EUOF 1CFVH 2SEBA 4E41E 1S3KL 3KPNA 1N6QL 4RGNB 3SKOA 2NY4B 1TVBA 2YMXL 1UXSB 3D18B 4FFYH 4R96B 4FQXB 4GKNA 4AL8L 1H5BA 4PGZA 3MUHL 4UAOC 4EOWH 1T0NA 1S7UB 1WQVT 3OMZA 4EIGB 1NANI 3FFDA 1HHIB 3W0WB 1QOKA 5BW7A 1DDHA 3I6LD 1HILB 4G6MH 4FTVA 3HE7D 3D2UD 3FB8B 3HI6H 1T2QL 3JV5A 1JWSA 5D72L 2X05A 4JN1L 4QTHA 1QRNE 2K1MA 2ZCHL 4N90E 4NKQB 1GPOH 4RRPA 2OCFD 3HZMA 4KFZC 1LE5B 2ZPKH 1SBSL 5GRZA 2HFGH 3DVNB 5E5RB 4TUKH 3WIHL 2Z8WC 5HYQA 2R0WL 3SPVA 3AM8A 1INDL 1MEXL 4NO0A 2CKBL 1NGWA 4I5BB 2W65A 4DOHE 3OB0K 4J3VA 5ICYA 3HZVB 2OL3B 4HX1B 5ESQA 1ZLWK 4TUJA 4RGMC 2XQBH 1OGAE 3D1MC 5JNYA 4P2CG 4P9MH 5JMRA 2V7NA 1PAMA 3RVWD 5E2UH 4UNTA 3AC0A 1NC4A 2Z91B 1IC1A 3UPCA 4Y89A 3C5JA 3G04B 3IDMA 2FYYA 4ZOAA 3EHBD 3RI5F 4RFNC 5DMKA 5GS0D 3DMMB 3O4LD 3K46A 4F9PA 2DKMA 1JPTL 1LP9B 1GIGH 1U93B 5C0JB 3G6JA 4LPYA 1JFQL 4QGYA 5JW4Q 1D5XB 1IL1A 5HDBE 4JRXD 3MRIA 5D9SA 1P69B 4WV1A 4AEHL 1RD6A 1YEKH 1Q0XL 2IQAA 4LPCA 3CFBB 5EZJB 2Z8RA 3MJGX 5CWSB 1FN4A 3X3FL 4LHUG 2ICWA 2BMKB 1MCWW 3QXUA 1FVEB 3K1DA 3EOBA 4LF3A 3KPLB 2EC9U 3HNTL 1AD9B 3S4SB 5D6CB 2GJ6D 1ZA3B 5FGRA 1FDLL 3ARSA 5GXBB 5TFSH 1NH6A 5C0AA 5J9PB 1T03H 1MFDH 3FO0H 4QEGA 1IBGL 3FN0L 5GRUH 4MA1B 1KPVB 3BZ4B 5F21B 1WWAX 4Z7UB 5AAMA 2K9UA 2YD5A 5F3HB 1FYTB 2ADJA 3KLAA 3U0TA 4PLOB 5FV2A 2LQRA 1OW0C 1LQSR 2IMNA 4QNPE 2XWBB 3HE6C 3BT2H 4M43L 4TULH 2WINB 2NXZD 4FNLH 1G0YR 5C07B 3TIDA 3NIGE 3FHQA 4WJ5B 1DTUA 3X3GL 4UTAH 4UZGA 4UT6H 4J1UA 2D7TL 1O7VA 3BUYA 4PRDB 3HAEB 3DETD 5JIKA 4AEEA 1RZGA 5JHLL 1S9VB 1Q1JH 4J3OC 4UI2A 5KVEL 1HK6A 4JY5L 1L7TL 1JMXA 4KPHL 1A6VL 4XVSL 4AIZA 1DEEB 2NR6C 3WJLC 3QXAA 3OR7B 4PJEF 3MMEB 3WHXA 5EBWB 2D03L 4OM0H 1HINH 1WEJL 4GXUM 5IVXA 4K8RC 4GS7B 5GRYA 3OX8B 1SYVA 4BQ6A 1FZMA 4N8CL 1DZBA 4A2LA 1YEDB 3ZKND 4M4PA 4JVUA 1NJ9A 1DQDH 4V1DE 1FL6B 1R5IB 4CVXB 4CKVX 4BQBA 4LFHD 4HDIB 2E27H 4LSSH 2MHAB 4EJ1C 3MGOA 5I30H 2VIRA 2QV2A 5ESAB 1ZEAL 1NAMA 2MTPA 1T20A 3KYOB 5CD5D 1QSZA 3VXUB 3SDDB 1KLGA 2ZUXA 3MV8A 4NZRH 3V52H 4ODWB 2Z8SA 4LEXL 5KSAD 3S88L 3QUXD 2VC2H 1JWUA 2D0FA 4JKKA 4RISH 1K9TA 4R7NB 1OTTC 4O02H 5L2KD 1J11A 3HUJE 4GFTB 4DAGL 4D3CL 1CICC 1GGYA 1IGCH 4MD0A 4FFVD 5BZWB 1RMFL 1U8NB 2CR3A 4ZD3H 5I16A 1FHGA 1HHGB 2QHLA 3LMJH 3BP6A 4WHYH 5GGQH 5SWZA 4F7CB 2Z4QA 1RVFL 3T2OA 4L8CA 3AAZA 5HHXH 3MA9H 1PQZB 4W81A 4NHUE 1BFOB 3ABZA 4Z7VE 3DX8B 4C55A 4WEUD 3SDXB 1XF2B 3RHWF 4F8TA 1RUML 4N0YL 4G5ZL 2DQHH 5HDQL 3O6ML 4Y16B 2J5LC 3G5YB 1KEGH 1S7RA 1LEKA 5IUSA 1D5ZB 2WANA 3VD4A 3O3EB 2IANA 4ZFOB 3DXAB 2W0LA 3QR2A 3TNNB 5K59E 5EZIL 4NJ9L 3T0ED 2DQUL 1IC4H 4JKPH 1OCWH 4YPJA 2DQFB 3QYCA 3EDDA 1EAJA 2I9LB 3C08H 3TWCL 3MX0A 3GI8H 3AUVA 4Z7WE 5DJ6A 4L4VA 4Y2DC 4PRPD 2F53B 3TPUE 5F93C 1VKXB 3PQYB 1A9BB 1FLRH 3O2DH 1DBMH 1JWMB 4OCRL 4AIXA 3BVNB 3FB7A 5C0FB 2PYEB 2R1WB 3UDWA 1A02N 3GMRA 1A7NH 4TVSa 3L95A 4JFFA 2XWTA 3NACL 2WBJB 5KSBB 3NH7H 4EBQH 4XP5L 5KSVA 3NTCH 5I8CA 1NUGA 4PJDF 2FHFA 4BYHA 5JIPA 4PLJC 1T2QH 4MDJB 5D72H 3WJJA 3OR6B 5C0BB 5BVPH 1II4E 3SE9H 2ZCHH 4NBXB 4U3XA 5ESVA 4CGTA 3UTQA 2AQ2A 1D6EA 3QFJB 4E0RA 3H9SB 3N1FC 4DEPB 4NHCL 3X11B 4DZBB 2WQ8A 5DJ8A 2R0WH 1INDH 3BGFC 4DCQA 4PG2C 1JPFB 2AV1A 2R0ZH 4HUWB 4MNGE 3S3SA 1ZA6B 3ES6A 3M1BA 1MHEB 1QUNA 1ZHNB 4IRSD 4QHUB 1AGFA 5FO7B 4TTGA 5L8JB 3CLFH 3V0VA 2R29L 5HI5C 3TYGL 3HC4H 4N0FB 5F8RC 4L9DA 5ILTL 3P4LA 4MXVF 2CDGB 4ZFZB 5CEZH 1XIWA 3E2HC 4G42B 3NFPB 1RULH 4XP9H 2DWEB 4JDZA 3ARUA 4OGAC 1TJIH 1JPTH 2ZJSL 3WLWC 2EDRA 2JIXB 3VA6A 4NT6A 2J7LA 1J0HA 4FP8L 1U8LA 5DD1L 1I8IA 4LQ1A 3RX7A 4X99A 1RFDH 3HG1B 3LAFA 2C26A 1LK3H 3DARA 4M7KL 3RWJA 1ORQA 4YE4H 3TO4B 4JDVB 3EYFB 3H3KA 4DKEH 1RIUL 2XZCH 3WSQH 3S6CA 1K8IB 3A6CH 3E6FB 4YLQT 4U6HA 1MFEL 1Y6NR 2VQTA 4ZUTA 2D0GA 5DJ0B 5EOCJ 4XAWH 5DVMA 4J2XA 4QHMA 3GBLA 1UKTA 3P2TA 1MY7A 1PBYA 1KN4L 5FGCB 4YEFA 2XA8L 5IGXH 4G8IB 3FN0H 1PEWA 1SJHB 1FNSH 1YNKL 3TN0C 1FC2D 4OLYH 2R0LH 2A0LD 4TUOB 2P5WA 3D69B 3IJYA 2A6KA 2DLHA 3GFUA 2XXCB 1FCGA 3GO1L 1F3RB 4LLMB 3MV11 1C5BH 5DS8B 4ZUSB 4YAQB 1QPPA 3LKPB 4D0BB 4WWKA 4OGXL 1RI8A 5T1DL 2AEIT 1JYVA 1EHAA 1M71A 4YGAB 3DRTB 1T83C 1JZ2A 1HWHB 1T2JA 1ZTXH 2EE2A 1DQLH 1Z6JT 2UZXB 3HE7C 5EU5B 4A6YL 5C1MB 1XGRA 4LBEB 3QA3A 5JW5B 4F3FB 1L8JA 2YPLA 3V4VL 2Z92B 3PGFL 2D4DA 3NVQA 1NLBH 4FXKA 4JY5H 2ZSVB 1WFOA 5C3LD 3O6KH 4XVSH 4OSUH 1AD0A 2R1XB 2PKDA 3BD4A 4HAFA 1LEIA 2Z9TA 1AKJD 4CNIA 4PGCB 4RDQG 2D03H 1UT9A 4D0DB 1NAMH 2XN9A 5HHOB 2P7TB 3Q5YA 1CD9B 1WEJH 5IQ9B 4EDXB 2EEDA 1ORSA 3DURB 5EUKA 2KQNA 2BOBA 4F7TB 1TETL 1QO3A 1I1AA 2AJYL 4AH2B 2NY1D 3RVWC 5BXFB 4NZUH 2OS7A 5FA4A 4CMHB 4DGIL 5IFAH 5A2KH 3SE8H 3SDYH 2VDQH 1EO8L 3EHBC 4X6BA 5GS0C 1QFWL 1CGWA 2DD8H 1I8MA 4P5MA 1NFIB 1N0LA 1MF2H 2XNAB 4LGRB 1XGYL 3G5VA 1TMCA 5E0QA 3TNMA 4ZO8A 1T4KA 5EWIH 4S10A 5D7JA 1KCLA 3VXNA 1C7SA 4JO2L 3SGDH 1AO7D 1BF2A 2BNQB 1MCRA 4Y19D 1J18A 2QQLL 4L8DA 4PTTA 3BRDA 3DVGA 4YBLC 1XH3A 3MLTB 3U46B 3RQ3A 5I73C 2RAMA 4MD5B 2Q86A 4RMTA 4GQ9L 4NKDB 4UQ3A 3PWJB 1OF2B 1OTUC 2VLRD 3QDJA 4Y5VC 4MVBA 4JHAL 3GEWB 4MDIB 3P4OA 3OKNA 3H6JA 5E9DB 3FAWA 3G6DL 4R4NC 1WBYB 1T1XB 4K94L 4WFEE 1LO3L 4E41B 4TVPE 3DIFB 2W9DH 1G7LB 2F54A 5E5MB 5A2JH 2XZZA 3QQ9D 1NGZB 1EVUA 1J9CT 1YC7A 3UYPA 4C83A 2Y5TB 5HHMD 4HK3N 1RU9L 3MCKB 3OKYA 4ZUUB 3MR9A 3OXSB 2FBJH 2H9GA 4LQFL 5LXGH 2NY6B 4LPUA 2W59A 3UJIH 3L6FB 1PZ5B 2NXYB 4OZGF 1Q9OB 3L5WA 1IRAY 2NXZC 1I9RL 1HHJB 5EN2B 3QJFB 3GM8A 2XWJB 5JLZA 3QEGL 4YIQB 1QRNB 5EU6A 4HKXA 3IXAB 4FQ1L 5C9KA 4MAUH 3WMSA 2D0HA 4LIQE 1CN4A 1CIUA 2GTZB 3NABL 3DETC 2BVPB 5DZOA 3P77B 5C08E 4D0CB 2WV3A 1BQSA 2LAAA 1U95B 4M8QA 1M05A 4Y5VB 5GGRB 1VFAA 3QFDB 3ROOA 4DOHB 1S9KC 3QQ3A 4E5XB 5ID0B 5IKCB 1NBVL 3QCUH 1OGAB 2VXUL 2J8OA 1OP9A 1CGXA 1U8JB 4PYGA 3KWWA 4DQOL 4HXBL 4HGMA 4XCFL 1KB5A 3KPSA 3BH8B 3OAYK 2QBWA 2Y36L 3QUMB 2YSSB 3ZKNC 1MJUL 2C7UA 1MOEA 5DUMH 5FYJH 1GOHA 1F13A 1NC2A 3C8DA 1MVFA 4LGPB 1L0XA 4OUUA 4WUUA 5D2LA 4G8EB 4NHCH 4ZTPL 1L7IL 2AGJH 3LSOA 3B4NA 4J7RA 3ZYOA 1RIHL 3WO4B 4XVTL 4HGKC 5ACZA 2GIYA 2YEZB 4PRIA 1KC5H 4LAQH 4NJAH 2YD8A 3MODH 5INCA 5KSAC 1BQHB 2DICA 4LCWA 3QUXC 2EE9A 4FQCL 5ELIA 4Q9RL 3LH2L 2UWEF 4C4KT 3KNBA 4CU6A 5F1NB 2NW2B 1C8PA 3ZT5A 4YDVB 3DX6B 5ILTH 2X4SA 5IJKA 4FFVC 1AGEB 4Y5YB 5HVWA 1P7QB 5DR5H 3GSRA 5DD0H 1P4LA 32C2A 3C8HA 3JUYA 5I15L 2ITCA 4WU7B 4I18C 2Q76A 3SO5A 1A0QH 1FJ1B 2YUXA 2VXQH 5HI4D 3F12A 3A67H 3EOAA 2XPGA 4MHHG 3VRLF 2KQMA 1H3PH 3HNSL 1RIUH 4YDLC 2H3NA 2Z31A 4X6CE 5HD8D 3Q6FA 1AR2A 3KHQA 4XXDB 2EH8L 4NNXB 5E70A 4X5XA 3FHAA 3CFIC 5ID1A 2IPTL 4UOW0 4OD3L 3SHSA 3OHXB 4LNVA 4S1QL 1NFDA 1A6WL 2I5YH 3MLXL 3T0EC 4M1GH 4QRUB 4KHTH 4PJXA 2VLJE 5ENWA 3VGGA 1YNKH 3D3VA 5B3JF 3FO1A 3WS3A 5J12B 2XN9D 4NQXA 5IBUB 1F4YH 1IKFH 1O5DT 1CIDA 1CZ8H 3C6LA 1NKRA 5INDA 1N5YH 3EJYD 3MRDB 5HGBB 1ZHLB 4ENEC 4I4WA 4X7TA 1WIUA 4LEOB 4P2QE 4NKIH 3ULSB 4I2XE 1GVIA 1IEBA 2P44B 1I7RB 3OB0H 5F3BB 3JWOL 1C5DB 1ZAGA 2X4PB 2XA3A 2Z93B 2AJZB 4ODHH 5MEPB 4HHAB 3VFTA 4B7LA 4XCNB 4I0PB 2EE6A 4V1DB 4YZFE 4F37K 4PJFF 4OFKA 5GS1A 4WFFD 4UINH 3QEHB 2UYLB 2ATPB 1LD9B 4NQVA 5GGRY 5MEND 2R23A 3P9LA 1LMKA 1MCNA 4MSWB 4YDJA 5HYJA 5DJCB 5KJRH 1OM3L 2PO6D 3RWHA 3MLVH 5E4IA 1KULA 1W0VB 4Q6IC 4IRSC 2Q3AA 4ZPVA 3THMH 4OAWB 5MEOB 1M7DB 5TDNA 3WDIA 1YYMH 4ZG1A 3HUJB 5F7FA 5KVDH 1WT5A 1UQSB 2N7AA 5C7XH 2YUWA 3SCMA 1G9NC 5JUEH 3MBXH 4K9EL 1XR9A 1FVDA 3UYRH 4X80L 2DKUA 4NN7B 4PJ5A 4X7EC 4HIJB 3MFFB 5DSCB 1XGYH 2IH1B 4N8VG 4TOYL 4EI6B 1ZVSA 1JGLL 1XZ0A 3GMNA 1VFBA 3FQTB 4NO3B 1LVEA 3D0LB 4JO2H 4L29B 2YS4A 2ZCKL 4NHUB 4UQ2A 4Z7VB 5DRZA 2BSRA 3O3AA 3KS0H 3MJ9L 4R97B 5TE7L 4U6YA 3BESR 1QZ1A 3TT3L 1MIMH 3FN9A 3GSWB 5E8OB 5H94B 4P3CL 3TH4T 3KDMA 2AQ1A 5GSVB 1KV3A 1U3HB 2AXFA 4O5LL 3BW9A 3U4BL 1MWAB 1JN6B 3C6SB 4H8WH 3TPUB 4YHPB 1DBAL 3BYYA 5GRJL 2W9LA 2A0LC 5EO9A 4P5TB 4BFIB 1A9EB 3CXHK 3KPSD 2G2RB 1G1YA 2R2BA 2VDRH 1ZGLP 1D5MB 2H26A 3BPOB 5F1OB 1YEGH 2VH5L 1LK2B 1RZ7H 1NCCL 1KUMA 3PL6D 5JPMB 3MJ8B 4G9FA 1DVFA 3MO1B 1HZHH 4WEMB 3BD3A 3ZTNH 3FCTB 1K5NA 4F33B 5D5ME 3WXWL 2Y1VA 3EO9L 5JW3H 4JFPB 3QWQB 4WUUD 3SGKA 4Z5RB 2JJVA 3VXTA 1JFMA 1HXYB 4Y5XA 2FATH 5CINL 1RJLA 1KB5H 2NX5A 3HN3A 2JJSA 2X1OA 2RFXB 5CSBA 2QR0B 1V7ML 5EO0A 1LNUB 4JM2B 2CO6B 4MXWH 5DD5H 2R69L 4ZSOE 2DWDA 2Q8AH 5DRXB 3C2AH 5T5FH 3R06B 4MNGB 3RTQB 3BPNC 4ZXBB 1B2WH 4XPFH 5F1IB 1OSZB 1H3TA 4KXZH 1SJVA 1NBVH 5GGSA 2IF7A 2R2EA 1G7HB 1ND0A 1UZ6F 5DD6B 5D96C 3V0WL 3BRFA 2Y07L 3IDGB 2O61A 3CFJB 1FRGH 5EU7E 4PJ7E 4KMQA 2NY1C 2Y36H 4OV5A 3UJTL 1MJUH 1LO5B 5CBEB 4NNPL 4WCYH 35C8H 4ZAKD 5ITFB 1GGCL 2GK0B 1NCWL 1XR8A 3BYTA 1T66D 2VABA 4YNYA 1KJ2B 4XB8A 3O9WB 1RV6X 4YXHH 2V5MA 3IXTA 1PZUB 2P8PB 4LSPL 1PLGL 3V6ZA 3PWPE 4KAQL 3B6SA 2AEQH 1HH6A 3LQAC 4OFYA 1PG7W 1T2XA 1OPGL 4ELKA 1W8NA 4L4TD 3I6GB 2E6JA 5JW4M 3BWUC 4HCRA 5FO8B 2I9TB 4DN4H 4XCEA 1WGOA 1KJ3H 3D3VD 1A7OH 2X89A 4L9LB 4PBWD 5IB5B 3W9DA 4PRBB 3QDMA 4PJ8A 5E56A 3C6LD 4MB3A 4WI5A 4HJ0D 5BQ7B 2JK5B 2HN7B 3QQ9C 1FO0L 2BNRA 5H35B 3ULUE 2EDXA 4PJBA 1AI1H 3JWNC 4HUUA 4JFXB 4M6OH 4PRHD 4XP4L 3RWGA 3OKKB 1A6AA 2A83B 5JA8B 5IMMA 5IMLB 4PJHF 5ADOL 5FECA 3IVKB 4M3KB 3VG9C 2EYRB 4U33A 1YNLL 1P2CB 1TZIB 1DANT 2NLJA 1C5CH 4OIIL 5J1AA 2HTLD 1CD0A 4Z0BL 3P30L 3CGTA 1DUZA 4LAJH 4Y1AA 3H2WA 3OF6D 2R2CA 2JELL 4S1QH 4D9QD 3VXSE 3TA3A 2MNUA 4P2YA 3IDUA 4Z7QF 2ICES 3P4MA 1JGEA 4QY8A 4XCYB 3WUWA 4QXGL 1AP2B 4X6DA 5DK2A 2PW1B 1JF6A 3FO9B 1DCLA 1WBXA 4TQEL 4NZJA 4GMTL 5F9DC 1MHHB 1SMOA 3RU8L 4AEIL 1MCDA 5I8OL 4GAYA 2O5YH 4I48A 4ZS6D 3SCMD 4Z0XA 3OKEA 2XTJE 3ILPB 4PJ5D 4BH8A 1OOAA 4F8QA 1U2HA 5I6XB 2HVKA 2BVYA 3V4PH 4IDJL 1J5OL 4YR6A 5JXAH 1WUNT 4NQSA 4OCNC 2XG5A 1WZLA 4OCYL 2Q8BL 5I1LA 3TP4A 4M5ZH 3VD9A 1X5FA 1WZMA 5DQJB 1VFOA 3HC0B 5JO5A 5EU4B 5C0CE 1KCVL 2CLVB 4BA8A 3IDYC 1FIGH 3S36X 2HLFD 1OB1A 3ULVD 4UT7L 2E6QA 2EKJA 3OGCA 5JOPD 1PG7L 2OL3L 5EZLB 4EUPH 2ZOKA 4R26H 2D3VA 4JRWA 3QI9B 4JO3L 1YNTB 4W68A 2J8HA 3TVMA 4XC1L 3V6FA 3HCVA 5FOBB 1R0AH 3P4NB 1I3RA 2J3SA 1RUPH 4LHUA 1X5XA 4G6JH 1IAOA 4ZO6A 3Q5OA 5EG6C 2ZUQC 1RUKH 2HLAB 2BSTA 3IKKA 3Q2CA 4NDMB 3QIWB 1ZLVK 5FDYA 1G6RA 1F4AA 4LASL 4IIQB 1V3KA 5HI4C 2WWKT 3MRCA 3WFEL 6FABL 4N9GA 3WNMA 4UT9L 1BAFH 3IRPX 4U1GC 1MHPH 3CFEA 3FQWB 3TT3H 5IB1B 4F9LC 1FG2A 5HD8C 1MUJA 2NX5D 3JV4B 2C3VB 5EBLB 1D6VH 4XC3L 5IHUH 4LVNC 15C8H 1BZ9A 5D71L 1FIEA 2FX8L 4KJYB 4LMQI 5BS0E 3MC0A 5EUOE 4J12A 1IT9L 4MA8H 4KQ3L 5C08B 2EH7H 1KTLA 3G6AB 4BSVA 5F7EL 4P2OD 3C2SA 4AY0A 1NDMA 2DLFL 2DTMH 4NP4L 1BFVL 1BJMA 3WXVH 3U7WL 5EU3B 5I8KH 1BF8A 3W81A 3RA7L 1N3NB 3AREB 3EJYC 4KRNA 4LCUA 1CXKA 2APBA 2XQYK 1CFQA 4PJGF 4QCIB 2BP3A 4WTXA 2A77H 1JMZA 4GW4A 4FQPA 5JPNA 4JFED 2UZIL 1TZGH 4WI8A 4PV8B 5L7XL 2EDQA 2NW3A 1CFNB 3ME0A 3S37X 3EO9H 4ODBD 2E9JA 5BRZE 5F9WB 2NY2D 5C6TH 4NQDD 2XFXB 3TIEA 3SDAD 2ID5A 3PXJA 3LEVH 5CINH 5CSGA 1HHHA 5FAAA 3FB6A 5ISZD 5IK3A 2MCG1 5I18L 1WIOA 1MCHA 5I1JH 4M4RA 1N4XL 1YEHL 4YBQD 5ICZB 2Y06L 4KH2A 2UY6A 2F74B 3TV3L 2E9IA 5DK0A 2EDLA 2X4UA 2B4CH 4R0LA 2FL5B 3DGCR 3VXQA 3QIUB 4Z78A 4HC1L 1JPGA 1LEGA 4IHOB 4LVNB 3S97C 2X89D 2VZTA 4MX7A 4F15B 2PO6C 3PDGA 4PJ8D 3RGVA 2XKNB 4FZEL 1X5GA 4ZFGH 2IC2A 1WK0A 1KBGL 1H9VA 3BDYH 1NGPL 3LQZA 2I27N 4NO5A 4RGOL 4OGZA 4K71C 4HKBA 1DLFH 2BNRD 3UTTE 4UIKL 4QXUL 5CEXA 4KY1H 4FXGA 3JWDL 5I74B 3E6HA 2H32A 1HYRC 4QRPD 1J10A 2X9YA 4JFYB 1MNUH 4OLWH 4FQHB 4JM4L 3MV7E 4NWTL 1XF5B 1Z0NA 1NCWH 2QQKL 1IAMA 5EIVA 1J0KA 4JO1L 3VXMD 4ODUB 4WI2A 5A43C 4LKCA 1AHWB 3HI5L 5DTFB 1T21A 4LSPH 3NBNA 3NAAL 1QP1A 1S78D 1BZ7A 3CK0L 4IMLA 1YC8A 1DE4B 2ERJC 4X6CB 5FF6B 1B9ZA 1W0WA 2EICA 2FO4B 3EKCA 1NGYB 5DO2D 5JHDD 4GO6B 5FKAA 4F80A 1JNNH 3GBNH 3WIIH 5AUMA 4F7PA 4GOSA 3BHBA 3RBGA 5FYLH 2CMRL 4GBXB 4YHOH 4GKZB 3DBXA 1FORL 1NCBL 1NGXB 2PTTA 3ARXA 2VLJB 4X8JA 4UOJA 1KCUH 4WHDA 3I50L 5J89A 4DKDC 2ATKA 3IU4H 3S34H 2CLRA 2R0KL 5F96L 1XF4A 4TSAL 5A3ID 3PWVA 1F90L 4DKFL 1VACB 4HKZA 4I2XB 3T65B 4KVCL 4RIRB 3MRQA 1D9KD 3D25B 3PL6C 3C5SB 3MRRB 1IM9D 4H26A 2FJHA 1MI5B 1WIPA 4Y4KA 4XBGA 3VJ6B 4KZEH 5IW1B 3CH1A 3GB7A 4IS6B 4M6ML 4Z0BH 3C09C 4Z76B 3GHBH 2A6DB 3IFLL 4QOKD 4GW5A 3T3ME 1A2YA 2HKHL 1AGCA 1ZLSL 3B9VA 5D1ZB 4PJIE 3TZVD 1YY8A 4R7DB 2EIZB 4PREB 3EYQD 4TRPL 4ZFOL 2OP4H 3UPRB 2DMCA 4JQVC 4YH6A 2D31B 4PDCE 1B0RB 1R6VA 3FO2B 3IJHB 4WWID 5DI8A 5KG9B 1QKZL 4F2MA 5AYUH 1IGFL 3P0VL 3RU8H 3ZHKA 4AEIH 1TXKA 4I77H 2XRAL 1KTDA 3QEUB 4RAUA 5D7LA 4AJ0A 1FNGB 3T0AA 4GXVL 5C6PB 5E7FA 1KIPB 1LP9F 5IJKC 1TVHA 4K3DH 1P84J 1YQVL 5D1XA 1OP3H 4IDJH 1DQJA 4Z8FL 4PB9L 4P99A 3K2UH 5HVFB 3O81A 1NEZG 3MLWH 1BVLB 2GY7B 4ZAKC 3GMPA 2H8PA 4M5YH 5LQBH 3TYFA 3MLRH 4CUCA 1DLHA 3AY4C 1YY9D 1KCVH 4NKOB 1VERA 1TTGA 4FTVE 2P1YA 2YA1A 4IJ3C 5FK9A 5J6HB 5I1GL 4LLYB 2BVOA 3RKDD 4LSQH 4F37F 4LARL 1G6RH 2OL3H 3ALPA 1ZS8B 4Z7UF 4PJ9A 2QADB 5C2BH 5DGQA 3DX9A 1I8LA 3CH8A 5DRNB 1HEZA 2FJFB 1VSCA 5SWQB 1PYWB 1YEIL 3Q1SH 3C6LC 1T7YA 1A6TB 1E4KC 4WO4A 2HH0L 4HJ0C 4HT1L 3MUGA 3PJSB 4X8XA 3CDYA 3N1QC 4G3YL 4M6NL 4CDGC 2FR4B 3UMTA 3MJ7B 5DHYA 5CSZB 2OI9A 1IMHC 1NCDL 5DJXA 1X5YA 2ICCA 3ARFD 1XGPA 3PWLB 1YEFH 1CDGA 6FABH 2PYFB 2DBLL 4FA8A 3G5XB 4XTRD 4XWOD 3INUL 3GJFB 3H0TB 4L8SC 5C9JA 2BFVH 3LPWA 3WFDL 2AJ3B 2HTLC 3G6JE 25C8H 1JNLH 5D71H 1IAIH 3VRJA 2P5EA 5K9KB 1CXIA 3MGTB 4NBZB 2NZIA 3O6FD 3U4EA 5BCAA 2BOCA 3QNYA 4KQ3H 3OAUH 4QRTA 2P43B 4LCCC 2CJUL 1U8HB 4ZSOB 4Q2ZA 2QEJA 4QKXB 4K7FB 1MCLA 4S1RH 5J1SC 5CEZE 4QYOA 1YN7A 3C60A 1ADQL 2Q6WB 4AK1A 2WY3A 4G6KL 3NFSL 5T3XD 3RA7H 2VLKD 1S8DB 1CBVL 5F7HA 5KS9A 1W72A 4ZS6C 5C0AE 3SCMC 1CD8A 4HBCL 1CGTA 1FSKB 3MPCA 4PJ7B 1MCOL 3T09A 3QUYD 3HR5A 3RWCA 2WBWB 4XAKD 2ZZUT 1KPRA 4MJID 4ERSH 5IM7B 5MHSE 4FQQA 4FG6D 1Q94A 3HC3L 1XCQA 3FQXA 2GITB 1G9ML 3VU2A 3QIBD 3T3PF 3WKMH 2FLBT 2VTFA 3PWPB 2VISB 2ZNWA 1M6OB 4GRMA 1J1XL 4HC1H 1NBYB 3RUGA 3GSOB 4JDTL 3GNML 1H8OA 5EBMA 4H25B 5CP7A 4KKCD 2HLFC 4FZEH 1ZV5A 1BOYA 4HWEH 1MRCH 3ULVC 4NQCD 3OJDA 3MOQA 3JV6B 2A73A 5FA3B 1CFSA 4LCCB 1UCBH 1AJ7H 5CZKA 4UIKH 1UWEL 4QXUH 4YJZL 4JFDD 4LDOB 3O0RL 3BQUB 2X7LA 3IDJA 1Q9KA 2EYSA 3SDXF 4ZDHB 3NZHH 2HWZH 3RIFK 2QQKH 4U6VL 1Q9LA 3OKLB 2NY7H 2C3WA 4JY4B 5IVXE 5MI0B 2N56A 2E7BA 2YRPA 3VG0H 1H0DB 1I7UA 1JHTB 1ZE3C 2YZ8A 4EZMA 1G0XA 4U3CA 4HUKB 2VLMD 5CJXC 2ZUTA 1T6WA 1WF5A 3OZ9L 2B2XL 2F8VA 4TSCL 1DN0B 5GHWL 1AXIB 3VXSB 4LVHB 4AENA 3IKCA 3WFBH 3MV8E 1CT8B 3HI1B 1IEAB 1QG3A 1CGSH 1ZHKA 3LCYA 5D7LD 4P2OC 3EUUA 5DZNA 1RK0A 4ZNEA 1IQWH 5KSBF 1SBBA 3GRWL 3BIKA 3VWJD 5M94B 4KVCH 3KJ4B 4OLXL 5D1XD 2XTJB 4BSWA 2X5PA 1IGML 3KPMB 1PSKH 1OAZH 3BKJL 3C9NA 1CR9L 5SWSA 2JJUA 5SWZE 2NY2C 1UB6B 1ZLSH 2EXYD 3DROA 3SDAC 5HI3D 1BIIA 1J1PL 2J2ZA 5EFIB 2XXMB 3ZHLA 3BPCA 4PB0H 5L9DH 5ADPL 1H3UA 4YBQC 1B0WA 2AV7A 4Z7NE 1JZ7A 2I60H 2VAAA 3BISA 1EEZB 1ULVA 5C0CB 3VWKB 4OFPA 1YMMD 4QLRA 1T80A 5E95B 1S9YB 1X7QB 4AM0A 2FJGA 3TJHA 1UJ3B 4X9FA 4JFHE 2D9QB 4JB9L 3JZ7A 2IANE 3TBYA 2XICA 1E4WL 4PJ8C 3VXRA 3AS2A 5I17B 5IR1B 4KDTC 1A8JH 2FB4L 2EEAA 4RFEA 1K6QL 3D85A 1T6VN 3ALWA 1YQVH 1IGTA 2BVQB 4L4VE 1HWGB 4M48H 4QF1A 2X2YA 3HRZA 4XBPB 5EORH 5JDSA 3MBED 1HDMB 2NQCA 4HKJB 5BZDA 3QUML 1QBMH 4WI6A 4JG0L 5GSRB 4KU1A 1EEQA 1JNHB 3B3IB 4HIIB 3REWB 1M7IB 3O3DA 3ZKXC 3GSXA 2OMNA 5F89A 4BKLB 5IJVB 4JFFE 1S7QB 4LLWA 5HBBA 1AFVL 5TQ0H 3MRBA 4QRSA 3SBWA 5MEQA 1AC0A 2CK0L 5DO2C 1FZOB 2E7LA 4P57B 5HY9A 3MRPB 4YHMH 1YYLH 3RZCA 3DI2B 4P9HC 4JJ5A 2CKNA 5BS0B 2OJEB 5EUOB 5B39B 2ED7A 3C60D 4ODXA 1C08A 3RWDB 3NCCB 1Z9OA 3BKML 5DDHB 2NY0D 5BMFL 2HH0H 3NCEB 3CDFA 2OZ4L 3KR3H 4YDIL 3B9KB 2CD0A 3OKMA 3NCJH 1MSPA 4GMSH 5A3IC 5FYJE 2F19L 2N4IA 1F3JA 1GGIL 5ETUA 1B6UA 2IPKA 4DKAA 1KLUB 2VDKH 5B8CC 2DBLH 4FFZL 5DUPH 4U6XB 5DEGB 3NIFF 1D9KC 1FGVL 3LKSB 4JHZA 2R8SH 5BRZB 1KCRH 3ARDB 2YXFA 3DVIA 1QLRA 5DFVD 5DD3L 5DJZB 5KTEH 3DPBA 3GHEL 3GSQB 4JRYA 1W72H 3CPLA 1T5XA 1CDJA 3CFKA 1SJEA 2AXGA 3TZVC 3EYQC 2NNAB 4EN3B 2OR9H 4FMFA 4GAJL 1KOAA 3BIBX 3P0YH 2CJUH 3U9PH 4HK0A 4HUNB 2VJXA 1HQ4A 1P9MA 4AG4H 3RPIA 4DZ8B 4Z9KB 4KK6D 4PFEA 3VFNA 4G6KH 3BZFA 3SKUD 4XRCA 1RZFH 3LEYL 2ZUUA 4W6XB 1CBVH 1FFNB 4MWFA 3S96B 1RSFA 3IRZA 2KKQA 1A5FL 3MXVL 4GRLB 3KPRD 4R4BA 3T4AA 4H20L 5F9JA 1U3YA 3UTTB 1FAIH 4JKWA 2I07A 5ANMA 4QRRD 4K2UL 4HUXA 1MJJB 5FCUH 2P5WE 1OD7A 4LSTL 1IE5A 4OCXL 4OF5A 2IAMD 3MV7B 3ESVF 5AZEL 5DWUH 1A7BA 3BN3B 1Z2KA 3B43A 5KAQG 1CDIA 3FT3A 2W60A 4BUHA 3VXPB 3KYNB 2G60H 2ICEA 3IFOA 1YY9C 2YN3A 5DMGD 4QRQA 3FB5B 3RY5A 4BH7A 2YZ1A 3W5NA 1CS6A 1S9XB 3EIFA 4XPHL 3S37H 1S7SB 4N8VA 5CMAA 3RKDC 3P0GB 4I9WE 1U42A 3QO1B 4Y4HD 5F8QC 2YPLE 2MPAL 2ORBL 2UY7A 5EO1A 3VE0B 5IQ7H 4M62H 1RURL 3WEXB 3I9GL 4L3CB 4YC2B 3LVEA 3QZWB 1X4ZA 1H8SA 1HH9A 2BC4A 3UTSA 4P3DB 3KPQA 1H15A 2AJSH 1QYGL 5J6GA 5AAWA 1HE7A 2A6IB 1I4FA 1P1ZB 5D70H 3V5HB 2NPLX 5DJYA 4WEBL 3ARFC 1YUHB 5DVOA 3VRIA 5CZXD 4XTRC 4XWOC 5I1KH 3HPJA 4E42A 1N2RA 2BCKA 2HFEB 4IRZH 1YDPA 5I8EB 3EGSB 2GCYB 3WLBA 3EYOA 3JV0A 3UC0L 4JREB 4WDIA 1G7MA 4U1SB 5TE4L 3TJEH 4WW2A 1AQKL 2ADIA 3O6FC 1NAKH 1NMCB 4JZJC 4NUGH 3HZKB 4P46A 5BJTA 1MWAL 3GRWH 4GJTB 3QDJE 4PJCA 3VH8B 1KB9J 2XZAL 3D87B 2BNUB 4OLXH 2ENYA 2ICWI 5D1QA 3MUJA 4DWHA 4UV7L 2DYPA 5F7KC 3SDCD 1A14H 3KYKH 2SEBB 2A38A 2BX5A 2IG2H 5HDBF 3KPNB 4QTIH 2FLRT 5EC2A 2F54E 5D7KD 3SKOB 1TVBB 5C0IA 1U58A 3QUYC 1G7QA 3ZDYE 4G7VH 4GKNB 4ONFL 5J4MA 1H5BB 5EBGA 1FNFA 4Z95L 1T0NB 1MFBH 3R4DA 4FG6C 3LEXA 2IFFH 1YPZF 2C4FU 2HYMA 3IDNA 5J13C 3FFDB 2JB6A 2VERN 3QIBC 3Q5TA 1R5VA 2Y5EA 4JQIH 1MREH 1L0YA 4FTVB 3BXNA 4BFGA 1OAYH 4P59L 2Q3ZA 1JWSB 2R1YA 12E8L 4NM8H 3QQ4A 5EU6E 4KKCC 5GJTL 2FB4H 2NY3D 1AXSA 1UM6L 3HZMB 1PGRB 4XPTH 3QISA 2DIBA 1QEWA 4LCIL 2Q7YB 5EA0L 1FP5A 5K9JH 2YD7A 5HYQB 3SPVB 1C12A 4QNPF 3PP4L 4NO0B 1NGWB 5B21A 2W65B 1CLCA 3QUMH 2BZDA 3IFPA 5GGTH 2YA0A 1WCBA 4KUZL 5ICYB 4OQTL 5ESQB 4TUJB 1MCKA 5T1KB 3NIGF 3E8UL 3VCLB 5JNYB 3VGAB 5LGJA 4ESKA 4ZPTB 2V7NB 1BEYL 1OSPH 3MREA 1KJ2L 3GI9L 1NC4B 3NN8A 5CEYA 1N64L 5FIEA 3C5JB 4JVWA 1T5WA 3IDMB 4PJAA 1GHFL 2VLLA 5DMKB 1J8HD 3QDAA 4C58B 3AXLA 5K9QI 4GW1A 1HXMA 3G6JB 1T89A 1CFBA 1DL7L 4OD1H 4S11A 3FFCD 3EOTL 4MMXC 1IL1B 2AXJA 4NRYA 1KLFA 3MRIB 4ODVL 3MLYL 5D9SB 1ZT4A 1J05B 5FYKL 4S1SH 3BMWA 2IQAB 3L3KA 1VGEL 1FN4B 3ARBD 5BMFH 4PRIE 2ICWB 2JB5L 3T1FA 4LF3B 4LCWE 3EOBB 4ZO9A 4ETYA 2VR9A 4ONGL 5E6ZA 3U7YH 1BHGA 4NO2A 1F8TL 5J06A 4R6UA 1YZZA 3VWJC 2HFFA 5C0AB 1BLNB 2PF6A 1ZMYA 2EO1A 2EDJA 2B1AL 2WMPA 4KTEL 3ARWA 3EO0A 2ITDA 2LU3A 1A7QL 3SGDI 3FMGL 3SKMA 5JORA 1XGQA 3KLAB 3U0TB 2EXYC 1E6JH 4NRZA 1OL0A 2MCPH 4GAJH 2YPVH 4POZD 3VFGL 5L88H 5C0EA 1BWMA 4UILH 1R5WA 4XH2A 3L3OA 3RDTD 5J11B 3U30B 3UPAA 3V0AC 1F4WL 2YC1A 3HUJF 5KSUA 3TIDB 3GSVA 4NNYA 1CE1H 3M8OL 5L0QC 5DJAA 3TBTA 3W9EB 4KJWD 1DR9A 2FX9H 4W70A 1QSFD 4CJ0A 4QHLA 4HZAA 3BKYL 3GJFK 3PNWA 3L5XL 2VDMH 1QSEA 1X6NA 2IBZX 3BUYB 1T1ZA 4R3SA 1NFDE 4AMKL 5IEKA 1RZGB 4U4BA 1GGBL 4AIZB 2AQ3A 3B2UD 4Z7VF 5LWYH 4RBPH 2V5RA 2V9QA 5DURB 2V7HA 1AE6H 3QUZD 3QXAB 1E28A 3MBEC 3WHXB 2IQ9L 3GIZH 1T1WA 1WFNA 1A6ZA 4PLKD 4N0CA 1Y6MR 1MLBA 5J7CC 5IVXB 1S7TB 2C1PB 4OFDA 1SYVB 5K59F 1FZMB 4JANA 5HPOA 4XMKL 1MQKL 1QR1A 3FQUA 2O5XL 5I76B 5F6IC 1NJ9B 3GBMH 5T1LA 4UDTA 4U7SA 4Z7WF 3U36A 3T77A 4N68A 4X4YA 3QHFL 3MGOB 3LRHA 1VGKB 1NAMB 1T20B 3VDCA 4P46D 1KLGB 2RR3A 1RURH 3U9UB 3MV8B 3U1SH 3VFPA 2PXYD 3EDKA 1FFPA 2OR8A 3TGXA 5HYJE 3MXWL 4CN4A 4IBLT 4TVPL 1JWUB 3CX5J 2NY0C 2VN4A 4RA3A 5D1QD 4YWGL 5C0ND 1QYGH 1LO4H 1R3KA 1EHXA 2LU7A 3T0BA 1EPFA 1JHLL 4RFOL 4MD0B 3HMXL 4NUJA 1AR1D 1V3MA 1DUYA 1QTYT 5I66A 1KTRL 5CUSL 3BP6B 4PJ5E 4CDHA 5SWZB 1VPOL 4FFWC 2Z4QB 1WV7T 3ORJA 2L7UA 4JM2F 5F88A 5DFVC 2WP3T 5I1DA 4U2ZA 3AAZB 4TPRL 3BAEH 5CILH 4XX1E 3WL9A 4MNQA 4WFGD 1BGXH 2Y7QA 4IRJA 4KZDL 3B9AA 3TCXA 3PV6A 3EW3B 4OM1H 4LIQL 2HJFA 2V5TA 1S7RB 1LEKB 2HRPL 4P49A 2AW2A 3MRKA 4P4RA 2IANB 2FHCA 3CDCA 2ZG1A 4KK6C 5I1CH 4UV7H 2BK8A 5L2JA 2EDKA 3QT2A 1N7ML 3KXFD 4L4VB 4ZOBA 3GKWL 3VW3L 3CAFA 3EZJB 2P8LA 2AP2A 3MRFA 4ONFH 4P4KD 3QRFM 2IAMC 3I84A 5FDWA 1UC6A 2CDEB 2X1PA 3FB7B 4DN3H 2P45B 4FQLL 4D9RD 5F71A 4G9FE 3VDBA 2VDOL 2VITA 4JFFB 3W2DL 2XWTB 4RAVA 4PP1D 2G9HA 1AXTH 1KXQE 1UXSA 5I8CB 4HPYH 3MACL 4X4ZA 1F58H 1KNOA 3GGWA 3EYSH 4P59H 5T33H 5DMGC 4KTDL 1BBDL 3FRPG 4OT1L 1WWWX 5IIEA 5HYFA 1YEEL 1JPSL 5ESVB 1JGUL 5DXWA 3SKJH 4MD4B 4NN6C 4Y4HC 3S35L 1D6EB 2DN7A 4JHWH 3TBVA 2ZG3A 5DJ8B 1HILA 1GC1L 1IC5H 4DCQB 1PFCA 3ZSTA 2CQVA 1HKFA 2G75A 4LSUL 4HIHB 1J12A 3FB8A 3ES6B 3CFCL 3M1BB 4YO0A 5FUZH 1PKQA 1AGFB 3VGFA 1SM3L 3O8XD 1LE5A 2K7PA 2YRLA 2MKWA 4JLRA 3DHJA 1HYSD 5CJOL 3GI9H 5GPRA 2E7MA 1LILA 1T3FA 3CDGA 1XIWB 5D7IE 1GHFH 4O9HH 4JDZB 4PG9A 1T7XA 2AK4E 5CZXC 3HZVA 4FABL 4DGYL 4NT6B 1U6AL 4N0RA 1I8IB 1CD1A 5DT1H 4U1MA 4X99B 1FZJA 5E6ID 4HQQH 1J1OH 5FYKH 1JI2A 3V6BR 3CU7A 3RWJB 1VGEH 1ORQB 5CJQL 5E2VL 1E4XH 3DMMA 2IPUK 1FBIH 4U6HB 1WZ1L 4ZUTB 1CXFA 4NN6B 3TLRA 3F6IA 2WW8A 1F8TH 1MCCA 2D2OA 3F58L 4P2RA 3TBSA 4XNUL 4O58L 1C7TA 4LSRH 3QDME 5C92A 1TJGL 3L7FA 3SDCC 4KTEH 5I71C 2P5WB 3IJYB 2A6KB 5HHQA 3PXHA 2CSPA 3P9MA 2BNRE 5T3ZH 4FRWA 1FH5L 4PJBE 1RQ5A 3BKCL 3LHPL 3VFRA 3WD5H 4JG1L 4WWKB 1JHKH 5J9PA 2VKXA 1H3VA 1UEYA 5E99L 5BV7H 5FYLE 1CGUA 3EDFA 3EYUH 4S2SA 3WN5C 1UM5H 1M71B 1EJOH 3F7YB 4Z7UA 4NKMA 5C0RL 5F6HI 1A7RL 5I9QC 1MJ7H 1MAML 2CXKA 5C0DA 4JQXC 1NEZA 4Y1AE 1XGRB 3L7EA 3QA3B 4HWBA 3T8XA 2YPLB 1TQCB 2NY3C 2VE6A 1GGBH 5FUOL 2YD6A 4FXKB 4H0GA 2WUCL 4P0DA 4X6DE 3UBXG 2DDQL 5C07A 4K55A 1UA6L 4NQUA 4DK6A 4NOBA 2EZ0D 1Z9MA 5FEBA 3HZYA 4J3UA 1TPXB 1ORSB 5EUKB 2BOBB 2D4FA 1IKNC 3QUKB 4LNRA 1QO3B 5EOTB 1I1AB 5FCSH 4JZOB 4MQXC 3STZA 1P4IL 3L5IA 3V6OE 4YFLI 5FA4B 5A16A 1MQKH 4OJFL 5T5NG 1DEEA 2ZOLA 1R3IL 4HFUH 4N5EC 3OR7A 4X6BB 1IM3A 5HJ3A 4K94C 1I8MB 4P5MB 5GGVH 2YA2A 3G5VB 3QHFH 3TNMB 3DX7B 5D7JB 3VXNB 3OJMB 4Y4FD 4APQD 1P7KA 4KI5E 5HYEA 4HXAH 3ZKQD 4R4FL 1ZVYA 4KQ4H 1X3DA 4OCWH 3CMOH 4PTTB 3DVGB 1EUTA 5D2NC 1XH3B 1DQMH 4KXZI 4YHIA 4GUPA 3ARBC 1OW0A 2Q86B 4PUBH 4UQ3B 3QDJB 4HDIA 1A1NB 4LPWA 3HE6A 5DMJB 5ESAA 1RJCA 3P4OB 3OKNB 4WGWB 4MGXA 3SDDA 5GS3A 4KGLA 2ARJA 1UM4H 5I1EH 3CCHA 2BSSB 1MPAH 4JGJA 2F54B 4NGHH 4O4YL 1IZKA 2BY0A 2HT2D 1AQDB 1EVTC 4RGND 2NY4D 1EMTH 3MR9B 4V3DB 4FQXD 4WI9A 4POZC 2H1PH 1FC1A 1ED3A 3E1F1 4GAGL 2HKFL 3RDTC 3L5WB 3VGEA 4WUKH 2LFGA 3GMMA 1C1EH 1CVRA 3AU1A 1A3LH 5HHNA 3JTSA 4YXKH 5E4EC 2X70A 3W0WD 5JLZB 3RKPA 2FWOA 3IDXH 5EU6B 1JF1A 4HKXB 3UTZA 4U1NA 4KJWC 5HGAA 3MOAL 1RUQH 4HG4J 1KELH 4MJ2A 2HG5A 1I3GL 3QULB 3QWOA 5GS2H 4ZUWA 3I3EA 2HJKA 3D9AL 1V05A 3C8KA 5C09A 1GGTA 2NY5H 2ESVA 1D5IH 1C16A 1VFAB 1MHCA 4K23L 3ROOB 4LGSB 3B2UC 3QQ3B 2HVJA 3L5JA 5JDJA 2QKIA 4OF7A 4X6CF 3QUZC 2C4XA 3KWWB 3CXDL 3QCVL 2GQHA 2PR4L 3L1OL 1KB5B 1P53A 4HS6A 4MA7L 4PGBA 2P4AB 1DBBH 1EZVX 1LQVA 1B6DA 1DEDA 2F53A 1VKXA 1RHHA 5BOZG 3L3GB 3QDGA 1A9BA 2C7UB 3O6LL 1TJHH 3VI3E 1JWMA 1CICA 1NC2B 3BVNA 4HW6A 4XMPH 1HIML 2IGFL 4OCSH 4KMTL 4M00A 3ETBF 4OUUB 3ARTA 4HMEA 3DMMD 4ZOEA 2E9WA 1YJDH 3T0DA 1TFHA 5ALBL 4G7YL 4LDLB 4YQXL 5ACZB 4PRIB 2PXYC 4OI7A 3RNQA 5INCB 3UO1H 4LCWB 3ZE1E 4JGUA 1K4DA 3MTRA 2VL4A 3VFSA 3QNZA 3ULUL 1BX2B 3BSZH 3KNBB 4NC1C 4ALAH 4YZFF 4L8BA 1RIVL 4JCLA 4Q58C 1IAKA 3M45A 1TNMA 5T3XE 2W0KA 5HTSA 4YBHA 1KIQA 4HUWA 5D93B 1SEBA 4WY7H 1PX3A 3H9ZA 5E5UB 4CMMA 1QQDA 1AR1C 4DGYH 3GSRB 3QAZC 1P4LB 4M61A 4XWGH 32C2B 4JAMB 5F9OL 2ITCB 4LLDA 2Q76B 1HKLL 3MYJB 4R9HA 4Y2DA 3OL2A 3F12B 2XPGB 1UACH 1VDGA 4LRNH 1FYTD 1KIRA 2H3NB 2Z31B 3KVQA 3Q6FB 3QXDA 5LCVH 1PX4A 2JIXA 1N6VA 2VXTL 4X5XB 1NCAH 3JWOC 1W2KT 5ID1B 3F58H 2EYTA 4UB0H 4O58H 5F7UA 4QGTA 3HG1A 5C07D 1TJGH 1XT5A 5ENWB 2DQCH 2VXVL 4FQJH 1MCEA 1YECH 3FO1B 4NQEA 1XAUA 4NQXB 4UBDD 1K8IA 3AROA 1YEJH 5DJ0A 4HWBH 1FH5H 3LKRB 4G9DB 5INDB 2X4QB 4I4WB 4P4KC 4X7TB 5K9OA 2ZNXA 5A1AA 3SJVA 1FFRA 4X7SH 1IEBB 4PG2A 4XI5C 1UB5A 5E8DH 3I2CL 2J88L 2P47B 2DLTA 4MQSB 2ARWA 2DF3A 3CMGA 3F7VA 3VFTB 4AIOA 5C0RH 5CAYB 1Q72H 3UTPE 1SY6A 3LDBB 4K3HA 4FN0A 4O00A 1CFVL 3S9DB 4RZCA 5GS1B 3E2HA 4K9EC 1WISA 3BPLB 1OVZA 4FFYL 2APTA 4NQVB 1RK1B 2QQNH 1GZPB 4YDJB 3DRTA 1X5AA 5FGBA 5HYJB 2YK1H 1BJ1H 1BQLL 4HLZG 2FBOJ 5EU5A 1MLCA 3RIAK 3RWHB 3SDDD 3VXUD 4KVNL 1E6OH 4G6ML 5D5MF 2E8ZA 4F3FA 4ZPVB 5D7LE 1Z9LA 5IF0B 5TDNB 3O8XC 1I1RA 3V7AG 1JVKA 3HI6L 4KKNA 4MNHB 1NL0H 1HYSC 1HQRA 3WDHA 2YWYA 1GPOL 4Q97A 2AJUH 1FVDB 3QEQB 2HFGL 3NZ8A 3MCG1 1X5IA 4HMDA 4TUKL 5EDXA 1LE9B 1P6FA 5IQ9A 1NCNA 1TTFA 1VFBB 3GMNB 3LKOB 3DJ9A 1ZT7A 3KYAA 3TFKD 5DRZB 1I9IH 4YDKH 2BSRB 4AH2A 3O3AB 2VDNH 2XQBL 4R4FH 5E6IC 4NCDA 4P9ML 4L3EE 4L5FH 4TTDD 5IVZA 1CU4H 2HT3D 5E2UL 2MMXA 4OGYL 3NA9H 3MLZH 4PJ7F 3OKOA 2XNAA 2DQJH 3QG7H 5CHNA 4ONHA 1IAIM 2DJ4A 3W82A 4Y16D 1T83A 1GIGL 3KDMB 1G6VK 3HE7A 4F58H 2AXFB 3BW9B 3D2UA 3DXAD 3MLTA 5D4QA 4K8RH 4FQIH 4F7EA 4O4YH 3EO1A 5EO9B 1OF2A 4X4XA 5JXED 1YEKL 2EO9A 4JPIB 3SE3C 1I7ZA 2H26B 2F53D 3RAJL 4G9FB 1A3RH 1DVFB 1ZT1A 3PQYD 5C71A 3DIFA 4GAGH 5F1SA 3KJ6H 5TDPA 3BP5A 3H42H 1NGZA 5TFSL 1T03L 2PYED 4YHYB 1MFDL 2M1KA 3FO0L 3VXTB 5GRUL 5DQDH 3LRSB 4Y5XB 2WBJD 3ARZA 1RJLB 2P5EE 2VN7A 1ZGLA 3ULUF 2AJXH 3ZTJG 5EO0B 1Q9OA 3O4LA 5C0BD 2EKSB 3C5ZC 2ZWLT 2DWDB 4K23H 5JA9A 3BT2L 3QFJD 3H9SD 4YIQA 4JRXA 4TULL 4AEFA 3KLHD 5IB4A 5GGSB 4FNLL 3QHTC 4DJMA 2EZ0C 1ND0B 1ACYL 2L0DA 5E1HB 5KS9E 1PJ9A 3IETB 2O61B 1EIBA 5LG1A 4D9LH 4UTAL 1EFQA 5D7IB 4UT6L 4Y5VA 4RMRA 4OV5B 2VWEE 2Z35A 2AK4B 4Y2DD 2GJ6A 1Q1JL 3M07A 1J7VR 2UUDH 4KMTH 3B2VH 1FG9C 2VABB 3GMQA 4YNYB 3FTGA 3ZE0E 4APQC 4Y4FC 2XZQL 3IXTB 2JIXD 4D94A 4OM0L 3V6ZB 4G7YH 1HINL 3B6SB 3ARQA 1HH6B 1X5HA 3GMLB 2H6PA 3E3QC 4ELKB 3RUGE 3HG1D 3TO4D 4XCEB 3C5ZB 5CZVL 1DQDL 3QDMB 1WICA 1A1OA 5IT2H 4G80A 4Y88A 1W0YT 4LSSL 1TCMA 5I30L 3BFOA 1KIUA 4OZIF 4P23B 1JTTA 2OK0H 3V6OC 4NZRL 2BNRB 5F9OH 3V52L 4PJBB 4HUUB 4U1LA 1A6AB 2HT2C 2F5AL 5IMMB 4F7MA 5FECB 1A47A 3WKNA 4RGNC 3O3BA 2NY4C 3HR6A 4FQXC 4O02L 5TGBA 3VD5A 1U8PA 43CAA 4EKXA 3MV01 2NLJB 2KL6A 1MFAH 2VXTH 5J1AB 1IGCL 2R39A 3OJVC 3HS0A 4S0SD 1A6UH 1DUZB 4Y1AB 4ZD3L 2LTQB 3LMJL 4XPBH 3TA3B 4KKAD 1EHLL 5GGQL 4JO4H 3P4MB 1JGEB 2DQTH 3J8F7 4I0KA 1BBJA 3DHMA 4X6DB 3MA9L 5DK2B 1NBZA 1SY6H 5FUCC 4J3WA 3TH3T 1WBXB 3WNPA 4NNXA 4ZNEE 5IFHH 2DQHL 4R2GB 1MIEH 3QPXH 1KEGL 4I48B 5CIPA 4Z0XB 3OKEB 1JE6A 2IWGA 5KSAA 3QUXA 1NGQH 5BVJB 5L8LB 2VQ1B 5HHOD 4CADA 2O5ZH 4UIMA 1IC4L 3BX7C 2HVKB 4JKPL 1OCWL 1IAII 3C08L 5SWSE 3U0PA 4EI5B 3GI8L 5L2KA 2CLZA 2VNCA 4NQSB 4I3RH 1FLRL 1VFUA 3O2DL 1DBML 3V4UH 1KGCE 4LRIC 4Q9CA 3DMMC 2AJZA 2VZVA 5JO5B 1BQLH 4I18A 3WUWG 1A7NL 5GGSY 4V1DA 2Q1EA 2BNQD 1BD2E 1OB1B 4KVNH 3OGCB 3NH7L 4EBQL 3NTCL 3TM6A 3VXRE 3EYVA 3QEHA 2ZOKB 4OZ4A 5D6DC 5HDLA 5BVPL 3SE9L 1QVOA 3TVMB 3U83A 5HYSA 1IJ9A 3HCVB 5CCKH 4LHUB 1IAOB 5E9DD 1U92A 3T0EA 3B8YA 4E41D 2R0ZL 3MLUH 4MA1C 1G6RB 4GSDH 2VR5A 4PRPA 1UQSA 4ZUVA 3MRCB 1I75A 3DI3B 4N9GB 3CLFL 2RCSL 4M7ZB 4U0RB 1UH3A 3I02A 5TQ2H 1KFAH 1FG2B 3R1GH 4RMVA 1WTLA 4OGYH 1MUJB 3HC4L 2NY6D 4PRAA 1ZHBA 5CEZL 4EI6A 3IU3A 4LKXA 4NO3A 2VXSH 3K80A 1RULL 2NXYD 4PP2A 4XP9L 2E7LE 3D0LA 1BZ9B 1EUUA 1Z3GH 3PHSA 1TJIL 4NHUA 3UZQA 5J8OA 1JUFA 1SVZA 4K7PY 3BJ91 1KTLB 2FNBA 1QRND 1P6AB 3PHQB 4BSVB 4N90D 2CRYA 1G84A 5HXMA 1RFDL 1AIFA 1LK3L 1NDMB 4UBDC 1GSMA 5HYIA 4LCYA 4YE4L 3KLDA 4DKEL 4LHJB 1FQ9C 2XZCL 5J0BA 1G9NL 3WSQL 1OTUD 2IALA 3RAJH 1YPZE 3A6CL 4LCUB 5FV1L 1CCZA 5GS0H 1CFQB 5GSVA 3REVA 4HWZA 1I7TA 4GW4B 3UXFA 4XAWL 3FN3A 4PGEA 1JN6A 4A2MA 3MNVA 3SOBH 1OGAD 4R4ND 3TPUA 1DFBH 2NW3B 4Q6IA 4IRSA 3ZDXE 1MJ8H 1KN2H 2DS4A 5IGXL 4GLRH 1REIA 3G9AB 3TIEB 1FNSL 2CO7B 4JRYE 4GS7C 3QRGH 1D5MA 3MV9E 1HHHB 4OLYL 3OKDA 2R0LL 3JWDC 1LK2A 5IK3B 5JPMA 1FPTH 4XMLH 4PBVC 5IFJA 1A4JA 1C5BL 5DK0B 2X4UB 2CIKA 4R0LB 3VXQB 3QHZL 3P40A 4Z78B 4RQQA 1JPGB 1LEGB 4Z5RA 3CX2A 4MX7B 2V17H 4XPGL 3SDDC 3RGVB 2FIKB 1ACYH 1AGDA 4PGDB 1ZTXL 5DJDA 3ARYA 5CKGA 3T3MF 1DQLL 2QR0A 3LQZB 4NO5B 4PJIF 3MRMA 3MRJA 4OIBA 3WUZA 4FXGB 5DRXA 3JBG7 5ANME 3QH3A 1NLBL 5C6WH 4AQOA 3O6KL 3K3QA 4OSUL 1G7HA 1I8KA 3IF1A 5DD6A 2EDEA 4LKCB 4U1IA 2ARJQ 1P7QD 2XZQH 4KROC 1T21B 2A9NH 3TFKC 2AJVH 1NAML 2GT9A 4IMLB 1UENA 4OI8A 1OAUH 2GKIA 1S7VB 3DUUA 4TTDC 5CBEA 5FKAB 4EEEA 3V79C 5DFTA 2HT3C 1CLOL 2YRZA 3LPFA 4NZUL 5DF0A 2EC8A 4OLUH 5IFAL 2GK0A 3HFMH 4F7PB 3BHBB 2C1OA 3SE8L 5CZVH 3SDYL 2VDQL 3V5DA 5JQ6H 3DBXB 2PTTB 4Y16C 2DD8L 2QSQA 5EOQH 1MF2L 3O11A 4X8JB 5EWIL 5DHVA 4WNQA 2OTWB 2ATKB 1PVHA 2CLRB 4KK8D 3TF7C 3SKNA 2YD9A 3UTSE 4WFHE 1XF4B 2I9TA 1HOCA 5GGUA 5JXEC 3PWVB 2F5AH 2B5IB 4HKZB 2X4TA 3MRQB 1JZ5A 1S7XA 1AKJA 2FJHB 4H26B 4Y4KB 5BQ7A 4XBGB 2JK5A 4OF6A 1JRHH 1MAJA 4O51B 3CH1B 3GB7B 4ZOCA 4KKBD 2FRGP 4GW5B 3ZYJA 5CIPH 1AGCB 2DMKA 2W9DL 4KROB 1YY8B 43C9A 1EHLH 5IMLA 2WBJC 3HNVH 3CUPA 2R15A 3TO2A 4I0PD 4V1DD 2WIIA 4EDWL 4CVUA 1WTGT 6CGTA 1MCPL 5DI8B 3WYRA 1P2CA 2W1NA 1IGIH 2FBJL 2I24N 4F2MB 5LXGL 3UJIL 4OD2A 4X9HA 4YX2H 3DRQA 1DSFH 3DECA 3OQ3B 4HWNA 4PJCE 4M03A 3FRPA 1AO7A 4DEPC 1JYXA 1UKQA 4RAUB 5D7LB 2XYCA 7FABH 1EXUA 3MRGA 4Y19A 3KLHC 1T22B 5TPWH 3LQMA 4XCYA 3G6JF 5DC0A 2E6PA 2PW1A 2R56H 1LDSA 3GIVA 4JPVH 5IBLD 2VLRA 4MAUL 3UZVB 3JTTA 1MHHA 1RJYA 4IMKC 3BGMA 3TBWA 5LKNA 3GMPB 5HGHA 3U4AA 4N1EA 5GISL 4ENED 3QNXB 4JR9H 4Q9QL 3NIDE 4AT6A 1DLHB 3QCUL 5FO9A 4L3EB 4HH8A 3MGAA 2APVA 4QHNA 1E27B 1K4CA 5TF0A 3S8WA 2QJDA 5FK9B 5HHMA 1X5ZA 3IJSB 3P73B 2BVOB 2F58H 5ECJE 2AEPL 5EZOL 3MA7A 3TESA 4PJ9B 4LVOB 3TO4C 1GOFA 5DUML 3VFVA 3DX9B 5FYJL 1HEZB 2A74A 4OKVA 5DQJA 1ITCA 3V7MA 1FAKT 4WO4B 3RIAF 5GQBA 2AGJL 3MUGB 2UVFA 3O2WL 3PABA 1U3HD 3LD8B 5DHYB 1KC5L 1K2DA 3A6BH 4LAQL 3F6LA 4JFZL 4NJAL 2OI9B 3MODL 5DJXB 4J8RA 2E8YA 1XGPB 4P5TD 2EDWA 1OAKH 2RCSH 2WWMD 3F7PC 4CVZA 4PJAE 5IB2B 1CL7H 3DTXA 4W6YB 4YHZH 2ZUWA 1MCBA 2CDFB 4UUJA 3VRJB 2P5EB 3O3UN 5JIIA 5DR5L 5DD0L 3U4EB 5E1AB 5FGBC 2BOCB 4KKAC 3MCLL 3ZYZA 4QRTB 5C86A 1NLDH 1FYHB 1A0QL 4IOIB 3JUZA 4Q2ZB 2VXQL 5IVXF 5GJSH 2AXHA 2Y25A 4HPOH 4HV8B 3A67L 4QYOB 1G9MC 3RWFA 1H3PL 4BSJA 4C57C 1G9NH 4NIKB 4JM2D 1MFCL 4X6FA 1JZ4A 5KS9B 1W72B 2X4OA 3RTQD 1AC6A 2GJZA 3WIFA 4ZXBD 4GAFB 5HHVH 3TCLB 1EJ6A 1VESA 1X4XA 5FYKE 3RWCB 3UBXA 1JGDA 2I5YL 1KPRB 4M1GL 4KHTL 1RZJL 2ZUYA 3CVHA 1WSST 4FQQB 1Q94B 3QBTB 1N3NA 1EV2E 1XCQB 1YMHA 2R9HD 2XACC 3AREA 5GRVK 1F4YL 2IH3B 1IKFL 3FQXB 4CMHC 4OIAA 1CZ8L 5E94A 1N5YL 4WTZG 4YEEA 2Y9RT 1EGJA 1IZJA 1I9JH 3KPOB 3QHZH 4GRMB 4NKIL 1X4YA 1CE6A 4X98A 2LE9A 1CK0H 3RUGB 4G8FA 4P3WA 3O9WD 3ZE2E 5EBMB 4XPGH 4C54A 1T0MB 4BZ2H 4ODHL 3OJDB 5DMIH 4YXLH 2A73B 1CFSB 1OAQH 1QSEE 5T3ZE 5ICZA 4F9LA 2VSCA 1FNLA 4TSBH 3F5WA 5I1HH 2FL5A 4ISVB 4MCYA 1CDUA 4UINL 1U0QA 2JCCA 2X7LB 3IYLW 4OKDA 3Q3GB 4U31A 1MQ8A 5E8EB 4Z7NF 5IHZA 3GKZA 3EFFB 3QO0A 4OFVA 5KJRL 1J0YA 2A1WH 3H3BC 4PV9A 2W91A 3MLVL 1J86A 5DHVH 1FZKB 5I19L 1QBLH 3THML 4KKLD 4OF3A 3ZL4H 1YYML 5KVDL 2PUQT 1CLOH 1BOGA 3FT2A 3PHOA 4XP1H 5C7XL 3K2MC 2NY6C 5TH2A 3CNKA 5E8NA 5JUEL 3MBXL 3AFLA 1SHMA 4ODUA 3UYRL 4JKLA 2NXYC 5DTFA 4AENB 4GH7B 4WENB 5IBTH 1BFSA 2DQGH 2KPNA 3RY6C 5FF6A 1ZHKB 4PD4J 3CSBA 2FO4A 1RK0B 1KENH 2CGRH 4NPYA 5CS7A 3D6GA 3IS1X 4MHHI 1RAMA 2VZ3A 2DM7A 3BIKB 5MENA 5DMYA 2D7MA 5A2LH 1HSBA 1MIML 4KRPB 3WBDA 4BSWB 1T0PB 2PO6A 3GK8H 5C0GA 4PS4L 4Z7OE 1F3DH 3C9NB 5SWSB 3TH2T 3LQAH 3MFGB 3DROB 4H8WL 1VACA 3T65A 1HN1A 2ZP0T 3BPCB 4MNQE 4BFBD 1DQQA 5E8PA 4EDWH 1MCPH 3C5SA 2VDRL 1MI5A 2AV7B 2VAAB 1YEGL 3OJ2C 4ELME 1RZ7L 4MQ7B 4H1LG 2X9XA 4AM0B 2FJGB 1BD2B 2MOVA 1HZHL 3TBYB 4ZQKA 5LAXB 3ZTNL 4DVBA 3VXRB 3UPRA 2FGWH 5JW3L 3C87A 3WO4C 4RFEB 1I3VA 3D85B 3IT8D 4E9LA 2FATL 1ITBB 1KB5L 3FZUD 1IGTB 2X9WA 1OGTB 1AGBA 4QF1B 4ZYKB 3HRZB 3FRUA 5I1IH 5JDSB 3CVIH 3QI9D 5BZDB 2HTKD 4MXWL 5DD5L 1U41A 4HBQA 3FOLA 3K81A 2Q8AL 5GISH 4TVPD 1QHPA 1UGNA 3C2AL 3GSXB 4HIEA 5T5FL 3HLAA 3KGRA 5F89B 5TE6H 3DGGA 4YPGA 1B2WL 4XPFL 4Q9QH 4RX4A 2B1HH 4Y5YC 1Q9WB 4K7PX 3SO3B 1CLZH 1U8KA 4OZHA 5JIHA 1IFHL 4BFEA 4LLWB 3QIWD 4RWHA 5HVGB 4LU5H 5F7DA 1PY9A 3MRBB 4QRSB 1XGTA 1FRGL 5MEQB 1OLLA 4QHKI 2AEPH 2MQ3A 5EZOH 3PL6A 1UFUA 5HY9B 4P5KA 5JOEA 3RZCB 1IGYA 4JJ5B 5EULV 4WCYL 1A21A 4X7DC 2ZSWA 35C8L 2B7DT 4DFIA 1GGUA 1SEQH 3AVEA 3OWEA 4ODXB 5SV4A 5J6HA 1DANU 4Y7MA 4YXHL 4HAGA 4DFHA 4JQVA 3PE9A 3O2WH 1KSRA 4KK8C 2YKLH 2GSGA 1PKQE 2AEQL 3OKMB 5C08D 4JFZH 1ZS8A 3DV4B 1YPZB 1D5BA 1F3JB 5J12C 5ETUB 1OP3K 4DN4L 3O41A 1F2QA 1KJ3L 1A7OL 1QFUL 3RNKA 4WU5A 3ARED 4G59A 4D8PA 1QLRB 4MYWB 4KKBC 4JRYB 3CPLB 3MV9B 4YHLH 1T5XB 3CFKB 3FT4A 1SJEB 4XBEH 3DV6A 2VL5A 2AXGB 3MCLH 4PY8J 1AI1L 4M6OL 4I0PC 2WUBL 4HK0B 3PIQA 4RNRA 4ZAKA 1HQ4B 3RPIB 2FEDD 1B0GA 3CVHH 3CZFB 4V2BA 3VFNB 3BZFB 1MFCH 2DQIH 1R3LA 4XRCB 2GY5A 4LMQE 4NFBA 3AY4A 3QIUD 1C5CL 2DQDH 4OB5H 4P2RE 1EGJH 4X5WA 2J8UA 4XZUA 2IFGA 4R4BB 3T4AB 5F9JB 4ODTH 4L4TA 3L3IA 4YK4B 2I07B 5ANMB 4HUXB 5DJ2B 3ET9F 1RZJH 5IBLC 1CDBA 2QSCH 5L6YH 1UG9A 5CBAB 5DUBB 1OLZA 2C3GA 4NSKB 4URTB 1U8MA 2Q20A 5CGYD 1RUAL 3DOSA 1RZ8A 2A2QT 3FT3B 1KPUA 3CFDA 1E4KA 4WRLA 3WHE0 2F8XC 2O5YL 4NN7C 5DRWA 3RWEA 1ES0A 2RQ8A 4ETQB 1I9EA 3IFOB 4C56E 3NGBB 3BMVA 4TNVK 4QRQB 4PRHA 1I85C 1CXLA 4WHCA 1T1YA 5E2TH 3FQNB 3RRQA 4LOUC 1S7WA 1G9EA 4YHNA 4N8VB 5CMAB 4UDUA 1NQBA 3V4PL 4R97C 3ZDYF 3PDOA 5EO1B 3G08A 4L8SA 5JXAL 4B5EA 3MNWA 3DNKA 4JZNA 4O2CA 1F4HA 3R8BB 4F57H 3KS0J 2E7HA 4GBXD 4KDVA 1HH9B 3K8LA 2FD6H 3OF6A 2ADFH 4M5ZL 3UTSB 1NKOA 3KPQB 2VLJD 1JV5A 1SYSA 3JV6A 4BJLA 5J6GB 4LCCA 1U3HC 1FIGL 1I4FB 2DQEH 5DJYB 5A2IH 2OJZH 5I19H 2N7BA 1TIUA 4KGJA 4P5TC 3VRIB 4R26L 3SY0A 2XKUA 2WWMC 4KTYA 3HPJB 4HF5H 4E42B 3ARGB 3BPOC 2BHUA 1N2RB 2BCKB 3OXRB 4MS8D 1YDPB 3RL2A 1VB9A 1R0AL 3OKLA 3WLBB