3HE7A

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
292
structure length
281
Chain Sequence
YTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMPIEIQLSAGCEMYASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 79
structure length 281
sequence length 292
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3he7A01
3UO1H 2KKQA 1P7QB 3RNKB 5C07D 4HF5H 5IMLB 1A6AA 5I1DA 4U31A 1PX3A 4YO0B 5JMOC 3GRWL 5TFSL 1Q9OA 4B0MM 4HIHA 5FYJL 1NPUA 1RZJH 3QWRD 1H0DB 1A9EA 3VFNA 2E7LC 1SJHA 5KG9B 4PR5B 1S3KL 4U0QB 1J8HB 1J0JA 5JQHC 1I7TB 3QIUA 2FL5B 5C0BE 1WISA 3V6ZB 3PWPD 4G6JH 1V05A 1FPTL 1QFUH 3ARXA 3TPUE 1XIWC 3MNWB 4QNPF 3BRGC 2R8SL 2IH3B 3PWLA 3BIAX 3SKNB 5C6WH 2OR9L 3PE9A 2B20A 4NUJB 5EBLB 3WFDL 4MX7A 3IDUA 1X5YA 2Z92B 5KJRL 3TIDA 1CICD 1HHKB 3GK8L 4DKEH 1D9KB 3QQ3A 3DUHA 2ZNWA 3MRFB 5DRWA 4FFWC 1FL6A 4PLKD 5KN5A 2VZ1A 1DP0A 3OR7B 5T1KD 1J0YA 1HEZB 4WFEE 4QY8B 5H37G 2YUXA 4LLYB 1JCKA 1U2CA 1TZIA 2WW8A 5IK3A 3MXVH 4JDTL 3ARBB 4MD5A 4BFIA 3P30H 2UWEE 2WWMC 1FO0B 2F58L 4YE4L 3C6LB 3KPRE 3U4EB 3CFDB 2GQHA 4KVNL 1G7MA 3NIDE 2VIRB 4WO4B 4E41D 3HE7B 1ZXQA 5CZVL 1KC5H 3FFCB 5EU6A 4I3RH 3UYPA 1WITA 3GI9L 4PRDA 4P2QD 4TVPE 2HJLA 4KDVA 5C71A 1BF2A 3L3GA 4S10A 3IDYB 5EUKA 1QRNA 3MQIA 4IM8A 1CTNA 2DN7A 1NANH 4LKXA 3BW9A 3NA9H 4LAJH 4HIXH 5FF6A 3ZE2F 4AENB 5F8QC 5HI5C 2XWBB 3MV9A 1ZWIA 3BGMA 5ITFB 1U8MB 4KTDL 1JMXA 3RVUD 3S37L 1MHEA 3SKOA 4Y4HB 4H5SA 4FQ2L 2XXCB 2IMMA 4YGAB 5TQ2L 3V6OA 4P46D 5A3IC 1CGUA 2ZCHL 5E8EA 4MD0B 4JFDE 4EZMA 2PXYB 3OKKA 4KH2A 5GS0H 3NCBB 3GUTB 5HHNA 3V7MA 1AD9A 5T5FH 1EMTL 5I17B 3MTRA 2BJMH 4LHJB 4PLKC 5J89A 2Q7YB 5FECB 2VN7A 3O9WB 1IEAA 3QDJB 3W39B 4OIAA 1MFEL 4LGPB 1NSNH 3DRQB 5CEZL 4HFUL 2CMRL 5EUOA 1Z0MA 4ISVB 2OSLA 3SDCB 5IKCA 1UVQB 3VXOB 4EVNB 3RJDA 3GRWA 3MRLA 4JLRA 4QGTA 1YN7A 5C0FB 5F1NB 4WVRA 2XKUA 5F7KC 1FG9C 2HFEA 1JHTB 4PGDA 4QXGL 3Q3GB 3UZVB 3CU7A 4Q0XL 1SMAA 5DD6B 4FTVD 2Z35B 1A9BB 1MCWM 1RZ8A 2R29L 1J8KA 1X5IA 4OZIE 5D7KD 5FCSH 4N5UA 4OJFL 2DLFH 1HN1A 1C5BL 4L4JA 5IEHA 1JNLL 4OZFG 2ZOKA 3MLYH 1G7LA 5D7SL 3RIAK 4YDLB 1E4JA 3BJ91 4E42B 2FLBT 3VGAC 2F5AL 3HCVB 1HSBB 4P57B 3U9UB 2NNAA 3MFGB 4KV5E 5DVOA 3GDBA 5KSBE 2CDEB 5HHVH 4XPGL 3RNQB 3M07A 4JHAL 1AXTL 1JGDB 3GMNA 2DYPB 3IRPX 2DOCA 5IFHH 2DQEL 4JZNA 5FKPA 4PJDF 5DUPH 4Z7QE 4PTUB 5C9JB 4P46C 4J2XA 4G8IA 2C7UA 4JDZA 3WN5A 2QSTA 2FHBA 4MWFB 2AK1L 4ZUTA 3CMOL 1MQ8A 3CSYA 5DA4A 5LBSL 5I8OH 3CFJB 2GSGB 3U48A 4XMPH 3KJ4B 5HYJA 1GOHA 3JZ7A 4FABH 4PREA 2MTPA 5GGSY 1Z3GH 1J5OH 4YXHL 2EE6A 1EHNA 1PQZA 3FMGL 5GS1C 1ACYH 1HHHB 1ETZB 3QEQB 4K23H 5EZOH 5HVHC 5F3HB 4JFEA 5L2JB 3JUZA 4KKLD 3U9PH 1VACA 1PAMA 5I76B 4KKCD 4XNUH 4M1GH 2N1KA 1JF1B 4JG0H 2QSVA 3PWJA 4FQQA 5JOFA 3NZ8A 1VPOL 1T03H 4DGIH 3MA7B 4H20L 1T89C 1KPUA 4I18A 4WHDA 1PJ9A 3HN3A 4YZFE 4X98A 1N4XL 1A4KB 1I85C 3HAEB 2XZQH 4Q6IA 1NGPL 3IJHB 2VWEE 1WC7A 4G5ZL 3DHMA 1Q9LA 3E2HA 4M02A 4PJHF 5DJDB 3SE9H 3LKPB 2GTWA 4XP6L 1DFBH 5FYKE 4NUGH 1D5ZB 1P4BH 1LO2L 3TP4A 5JZ7D 3HG1E 4X4YB 4OKVB 3GSUB 2RFXA 3VJ6B 4OD1L 4UILH 5HDBE 4TUOB 2H26B 2FATL 3CU1A 1BMGA 5HGHA 3LEYH 4HLJA 4NQCE 1L7TL 2X6MA 4LU5L 3Q6GL 2F5BH 1NCWL 4JQXA 3MLSH 3G6JF 3RKDC 4V1DA 1IAII 4XP9H 3L3IA 2VC2L 5DZOA 2YPLA 3JUYA 4KZEL 4P3WA 3HR5B 1RIVH 1Q9WB 1ZHBB 2H1PL 4GKOA 3GMRB 3QCUH 3HPJA 4CADA 2D7TH 3JTSA 2BY2A 3BKYH 4HK0A 3MPCA 3RBGA 4DGYL 3DURA 2AJXL 2R2BA 5DTFB 1LNUA 3CFKA 2ICWI 1R3IL 4KKCC 5HHOA 4GMSL 3Q48A 4RA0C 5L0QB 5AZ2H 2NXYD 2ERJB 4POYA 4QKXB 5I15L 5F7NC 5IHUL 4GKSB 3D85D 1I1RA 2JLLA 1MCKA 3ULUF 3ZHKA 2R2CA 5I1LA 4FQCH 5F89A 3IRZA 4L29B 3H3BC 3X12A 3TF7C 2NLJB 5SV3A 4MNQA 1IQDB 4U7SA 3RVXD 3RGVB 1KN4H 5LXGH 3LEVL 1N59A 1UB5B 4GG8A 1F3DJ 4DOHE 5C7XL 4BQBA 2B5IB 3JTTB 1C08B 3IT8D 1T7VA 3GI8H 3MA9L 2ADFL 4X6EB 3CK0H 4M9PA 4EI5C 3QDMB 2ICES 1FBIL 5AAMA 4Z77A 5F70A 3LN4B 5DJYB 2QADD 4L4TE 3BVNB 1MY5A 3WHE1 4RNRB 1D6VH 2FH8A 2FO4B 1P6FA 4OFPA 1KIPA 4U6TA 4QHUA 3I9GL 3PABA 4JM4H 3C8HA 5HY9A 2R0WH 1X5XA 1DUZB 4OI7A 5JPMB 2IH3A 5B4MC 4DFHA 2VLMD 1E6JL 3GSXB 4KZDH 1BGXH 5IBUG 5E6IA 3NH7L 5ID0A 3DBXB 3I6GA 3RL1B 1S9VA 1HNFA 1BAFH 3DSFL 2DQFA 4QRUB 2A77H 1UKTA 2IJ0C 2D31B 4LLYA 1OCWH 2NXZD 4PG9B 3RX8A 2AI0L 3L5WB 2YZ1A 2FGZA 4K94L 4IMKA 1AFVH 5IMMA 3FRPA 4ONFL 2PO6D 3FB5B 1W0WB 4F7PB 1XIWB 5MP6L 4FQJH 1FNSH 1WT5A 3IKCB 3J7HA 4K3EH 4C83A 1RJCA 3U4EA 4UDUB 1U8PB 4MJ6B 1BOYA 4UUJA 2XTJD 2ZNXA 4HEPG 1FE8H 3FFDB 2Z8VC 4WO4A 4OCXL 1YNTA 3K4DA 3REWB 2J2ZA 2LVCA 2CLVB 4K3DH 1NGQH 2ZSWB 3VG9C 5MERB 4A6YL 3RUGF 4U3HA 1HDMA 3LD8C 2DQDH 1VEPA 3QCTH 3KDMB 4WHYH 2OXHA 1XCTB 3RWHA 1K4DA 4H0HB 3O6KL 3OR6A 1BBDH 2R1YA 5C07B 1BLNB 5J4MA 2EYTA 3BWUC 4Y4HA 5IW1B 2JK5A 1EV2E 4Y1AA 3C60A 2F54D 1KV3A 4MD0A 1PKOA 1U41A 5D2LE 1DLHA 2BOCA 1G7IB 1F4HA 3MV7D 2R2EA 4Y2OA 1NCCH 2OJZL 3P11L 4MDIA 3EYOA 3GJEA 2RGSA 2Q7YA 3IXTB 3QUXA 3S98A 1PKQB 2NY4C 2IMNA 3QDJA 4FXGA 2HJFB 4U3CA 2KH2B 4OLUL 2VLKA 3PWPB 1OAZL 1MI5D 4LBEA 3UJTL 4PY7A 5GSRA 3S35H 4WFHD 1QFWL 4UIKH 2PO6C 4KKAD 3KYOB 4AJ0A 4PIRF 5FHAH 2DI8A 5D1XD 3V5HA 4YFEA 2OTUA 5FA4A 3TN0C 3VFTB 1JHTA 3HZYA 4HKXA 1CICB 2CUIA 1EZVY 1RIHL 1DQTA 2PF6A 4IIQA 3AY4C 2VDOL 2XTJC 2I60H 3PNWA 4NDMA 5I8KH 1SEQL 5T1KB 1ZLSH 4EN3D 1U9KA 3LKNB 2JJSA 4OF5A 3RP1A 1BZ9A 2ZJSH 2OTWB 5DD5H 1F8TH 2BOBA 2OI9C 4HUUB 4JY6B 4CVXA 5DJ2A 5E5UB 2OK0H 4KMQA 5D2NB 3U9UA 1DL7H 3T0ED 2CIIB 3NFNB 3GBNL 3BAEL 4WTZA 3H9SA 4XWOD 2F19H 4KGJA 1C16A 1T7XA 1U8HB 1F3RB 3C5JA 3ROOB 1QBBA 1MFDH 4JRYA 3MUGA 4W6XB 1D5IH 3WD5L 3LS4H 1KCVL 5C70A 1N0LA 4P2QB 3LRSA 3FO0H 2GSGA 1XGPB 3D25B 4K55A 1V3KA 4KDWA 3DX6B 2AEWA 3VGAB 2Z93A 1T04A 2FEEL 2FWOA 2X7LA 3HKFA 4UT6L 2VE6A 3RL2A 3QHTC 1OAUH 3FB6B 3T0DA 3S34L 2O5YH 1G9NC 1RZIA 4PBXA 3EO9L 5T3XE 5BMFH 4AYFA 4P46B 3RVTD 1QSFE 5CP3A 3MRGB 4G8EA 2F15A 2NW2B 1T0MA 2VXSH 2YBRB 3WFEH 2VSCA 5I76A 1AI1H 4JKPL 4A6YA 1BVLA 2IQ9L 4PJBE 2J12B 3KXFE 2DM3A 4EN3C 3HUJE 4JAMA 4YBLC 4O9HL 3BSZH 3QT2A 1J11A 1RQ5A 3GMLB 4MLSA 3D39D 4JGJA 2PW1B 4M6ML 5F1SA 1IZJA 3IU4L 2BNRD 3U0WH 5BS0D 5DVKA 3VFUA 4ZUSA 3NFSH 1KJVA 3HAEA 1ADQL 4O5LH 2N7AA 4GQPH 4XC1L 2H8PA 4CW1B 2E6QA 1QBLH 1DEDA 2AEPH 1HHJB 1A6ZB 3LKPA 5F6IC 3BT2L 4CAGA 4N8VA 3T0EC 4MZ2A 2BC4A 5CHNA 1G9EA 3ARRA 4XWOC 4I9WE 1RUQH 4FTVB 4G9FE 3RY6A 4GH7B 2AABL 3IJSB 4YXKH 5DMGC 3UBXG 5H35B 1W8OA 1FZKA 1RK1B 4ODUA 5EZLB 3TH4T 1CLCA 1DVFD 3HNSH 1S5IL 4F9LC 4NKMA 5ESQB 3WLWD 3ALWA 1JZ4A 4NC1C 3MCKB 4RWYH 1OTSD 1WIUA 5C6TH 4P9MH 4CMMA 3BRFA 1IC5L 4YGVB 5I1EL 2ZUVA 2FEDD 1QUNA 3RU8L 4FFEX 3IGAB 3QIWA 4RAHA 3O45B 3KPOB 4Z7UE 5IUSA 3DECA 1Q0XH 3U1SL 2YXFA 5IBUB 4JCMA 2OR8A 3GMPA 5ELIA 3VFRB 5DT1H 1NUFA 4KKBC 3EBAA 2DQGH 2MQ3A 3G5VB 5CWSB 1BIIB 3ESUF 5GRVL 3HZMA 1G1YA 4H8WL 3S97C 4DUVA 1MAKA 4PJXA 1NLDH 3QCVH 4D9RE 3CVHL 2YMXL 4GKSA 1QLRB 3ARGC 3U2SA 3MGTB 3OB0K 2WUCL 4FQXC 3WIIH 1LEGB 2MHAB 5CUSL 1MCBA 1UH4A 3MRIB 4UV7L 3JV0A 1L6ZA 5J6HA 5BZWA 3NBNA 1UB5A 5IVXA 4NRXB 5TGBA 4Z7NF 1IC7H 1VA9A 5ILTL 4YWGL 3VH8G 3QDMA 2VDPH 2ZZUT 4KY1H 4PRPE 2F53E 5MI0C 3LN4A 2X1PA 4PRBB 3WLWC 1NFIB 4ERSL 3BVNA 5BVPL 3ARPA 1S7VA 3L3KB 4RNRA 2OR7A 1NANI 4MXQD 1XR8B 3PUCA 2JTDA 5D71L 4NRYA 1REIA 3T0BA 1KGCE 3B8SA 4UU9B 1EFXB 4JO4H 4TTDD 4GW4A 1ZVSA 2AXFB 3LCYA 4NWTL 4HDIB 1MFBH 2AJVH 1V7NH 4S0TD 2DF3A 3U4AA 3HZVB 4EI5B 1ADQA 1IGIH 5DO2D 1UWGH 2E7LA 4UIMB 1XR9A 5GRUH 3UTSA 1LDSA 5JA8B 4BH8A 4JFFA 3LH2H 3SY0B 1F3DH 1KCUH 3BEVB 2V7NB 3QDAA 3L5WA 4LARH 1HWHB 4GFTB 5AG8A 4W68A 3FB5A 4Z0BH 1RUKL 5F96L 5JQ6L 1QYGH 3HR6A 2R0ZL 1R3LA 3JVGC 5ESAB 4NBYB 4ZS7L 5FHBL 4YDVA 5DD0H 1M71A 1FNLA 4K7PX 3OKOA 3GMOA 5KSUB 1YEDB 5GZOD 1OAQH 2J6EL 2DQHL 4WHYG 3MODL 3TCXA 2NXYB 4F8TA 1QBMH 2XACC 3S5LA 4OGZA 2CLVA 3BIBX 3D85B 5ALBH 5MERA 4TYUA 3QXWA 3HI6L 2A9ML 3VWKD 2UZXB 5HD8D 3REVA 1F3JA 35C8L 4PDCE 3LHPH 4PJGF 4U6VL 4MXQC 3V4PL 7CGTA 4LDLB 1RSFA 3O4LA 2RJMA 2IH1A 3DX9A 3IAQA 2CDGB 4JO2H 3I50H 1XF4A 1MWAB 3AGVA 4UINL 1ERNA 3ARUA 1KCSH 1E6OH 4KRPD 3CVHA 4RQQB 4C56B 2DJSA 1FGNH 3K81A 1Y0LB 1T2QH 5BRZD 5DO2C 3BZFB 3JWDC 3LD8B 3NIFE 3QI9D 4CDGC 4UDTB 2QADB 5F6HJ 3SO5A 1T5XA 4LEXL 2XA8L 1GYAA 2I5YH 1KPRB 4MCYA 4OD2A 4C4KT 5JTWA 1PDKA 4KJWC 3RVWC 3GKZA 1HHGA 2YWZA 4M6OH 5DDHA 2BHYA 1E4KC 5TE6L 1J1OL 3JTCA 5AYUL 4ELMB 4QYOB 5DSCB 5I16A 2ZCLL 1IGCH 3P2TA 1KB5H 5HYSG 5D7JD 3TA3D 4PJ9D 3WFCL 1MJ8L 1RMFL 2ZUYA 3QPQC 4R4NC 3P0YH 1NMAH 2NY2D 4I48A 2EEDA 1SY6L 1UADC 3MRHB 3W9DA 1FN4B 1UKQA 3QA3B 2NXZB 5FUOH 2UYLA 3SGKC 1ZA6A 3FQXA 2PO6B 4CGTA 4GUPB 3NCJL 1LK2A 4P2RB 4YHKH 5HD8C 1UYWH 2JJTC 4Z7OE 3KPQB 1AGDB 5TFSH 5FYJH 1XMWA 4OBSA 2XTJB 5F7EL 4WUKH 3SDAC 3L3OB 3EDDA 4WI5A 3O3BB 4HXAH 2DLGA 1S3KH 2VO5A 2FNBA 2YA2A 3DIFA 3FO1A 1NGWB 2NR6D 4PJIF 1ZLWK 5GXBB 4TVPD 3TVMD 4WHTB 1FPTH 3W0WE 1SYVA 3HC4L 1RHHB 3MRDB 4GAFB 5BW7C 4LLAA 3T4YB 2XN9E 3TZVD 1TJHH 2WINB 3VFMB 4N5EC 4DCQA 4NYLB 4FZ8L 3FB6A 1FLTX 1NC2B 3O2VL 3SDYL 3FAXA 1MHCB 3WFDH 1QD0A 2GCYB 4Y5YC 1LE9B 1QRKA 4NQXB 2J6EA 3PGFL 1OTUC 4LLWB 3I02B 3IFLL 5C0NC 3T77B 2F54B 1KN2L 3BPNB 4XCEB 4PGCB 2HTKC 5EA0L 3SGEH 2AQ3A 3TA3C 4PJ9C 4LOUD 5FOJA 3MV7B 4KK6C 4AL8L 5FUZL 3WLBB 3EYVA 4JDTH 2V17L 4XCYB 3RRQA 3HC0A 4QRTB 3T4AB 1CK0L 3I3DA 3ARYA 1H15A 3FOMA 1R3HA 1L0XA 5INCA 3ARDD 1MI5B 4D8PB 5J0BA 5GS1A 5DS8A 1I9IH 2GJZB 5GISH 3SE4C 5CZVH 5D1XB 3J8F7 4RZCA 4I2XE 5EDXA 3O2DH 1BVZA 4YDJB 3GI9H 5EOCJ 4Y4FD 3VFSB 4R7DB 1QP1A 1U8QA 4WFGE 4G59A 1I3VA 1X5GA 3RZWA 1VKXB 1FZJA 4EN3B 2EKSB 5CBAB 5IJVB 1Q94B 4OF6A 4XRCB 1NEZA 2DS4A 1U3HD 1MCJA 4I4WB 1I7RB 2AXGB 3V0AC 2AJ3A 2UUDK 4KTDH 4OLVL 5DGRA 1FZOB 2CUMA 5ERWB 3TBTA 2W07A 4FQ2H 5F6IB 5GJSL 1NC4D 3T0EB 4WW1A 1I1AD 1CDYA 1H3WM 4JREB 1HQRB 2PYFB 2EXWC 1VGEL 2P5ED 3BZDA 4YIQA 2VQUA 3CH8A 1SY6A 1TQCC 2JB6A 4TUKL 1EMTH 1P4IL 2V7HA 3LSOA 3VXSE 3STLB 5L6YL 3E6FB 1G6RH 1MFEH 4LOUC 5CEZH 1F6AB 2CMRH 4HFUH 2GI7A 4ZAKA 1MCDA 1IC4L 1V7ML 3ZDYE 3I6KA 5DURD 4TUJB 2ATKB 5BXFB 4ZUWA 3LQAL 3ARDC 1I3RA 1QLRA 1EX0A 3MLZH 2JCCB 3IDJB 4MJ2A 1BD2E 5TDOB 5HJ3B 3M45A 4NRZA 2W38A 4HUVB 5JW4N 4NKDA 1OW0C 4G43A 1J1XL 3QAZB 4OJFH 4AM0B 2HP4A 1QO3B 5HGBB 3VA2C 4PJFB 3GBMH 4MNGB 3MO1B 3EYFA 4OZHA 4RX4A 4G3YH 1A5FL 5K9OB 4WU5A 1V5JA 5K9JL 3TH3T 2F5AH 3D39B 1D5BA 1JUFB 3R0NA 5L2KE 4Q6YA 1X44A 4UOJA 5BS0B 4XPGH 1O7VA 4HBCH 3PHOB 1MHPL 4JHAH 2E7CA 3RTQA 2VLRE 4XCFH 4UB0H 1S7WA 4Z7VA 3JWOC 1TTFA 4FQXB 3U0TB 3I2CL 4J8RA 4JVWA 2CUHA 1I9RL 1GGBH 1I9EA 4NQUA 4LNRB 3CMOH 2QHRH 1EFXA 2Y6SD 5LBSH 5FYKD 1INEL 5ECJE 2I27N 4HS6B 2YD3A 1FFNB 5J1SC 4LLQA 5DK3A 2O61B 1KPVA 3P9MB 4HKJB 2Y72A 1U95B 1JZ3A 3UAJD 1DVFB 5GGSB 5MI0B 3F7YB 5CSZA 1HCVA 5E8NB 5JLZB 4GRLD 3QUZC 3FMGH 4K2UL 3KAAA 4R8WL 5DUML 4PJEB 4NKIL 1AO7A 5L8LB 4HKBB 3O8XD 3BPCA 3LV3A 1K6QH 1FVEA 4GAGL 1A7OL 1JNHB 3NGBC 3T0VA 4MA3A 5ESAA 4X7SL 4NPYA 4X7TB 1JPTH 5LGJA 3QBTB 5K33A 3ZTNL 4H20H 5FO9A 4RBPK 3U36A 4DGVH 4WNQA 5CAYB 1FP5A 4JO3L 3UC0L 4I13B 1K5NB 1FH5H 2Q1EA 5ENWA 2QQLH 1B0WA 1D6EB 1YECL 2J8OA 4PUBL 4WJ5A 4Z95H 4Y2DA 5EFIB 5H2BB 4JRXE 3D69A 3F62A 1VGKB 4N0CA 4XP6H 4ETQA 5EU4A 1HKLL 3FQTA 4X83A 1UA6L 5ICZB 2N7BA 2H6PB 4L8BA 4U1NB 3QRGL 4OD1H 4OT1H 1YPZF 4XMLL 4XP4H 5EU3B 2FATH 2Y36H 4FXKB 3GSRA 5HI3C 1KJ2L 5D5MB 2ICEA 4ZSOA 1LEKB 2AS5M 1NCWH 4FA8A 1KF9B 4L4VD 1FFPA 4KQ4L 1S9XB 4G80B 2R1WB 4NQSA 3TESA 1E0OB 3VWJA 1NBYB 2OL3L 4I5BB 4G6AD 4WWKC 2XQYG 2VC2H 1Y0LA 4KZEH 3H3PH 3BZ4B 3VXME 3UAJC 4X5WB 1U8OB 1A7PL 2VDQH 3IDGB 4Q7DA 4BQCA 2H1PH 1TJGL 1L0YA 4OFIA 3U6RA 5I8EB 3KYNA 3UTZB 5KVMC 3WFHB 2D7PA 1OLLA 4NFDA 5CMAB 4DGYH 3FT3A 2D7QA 3O8XC 2OP4L 2AJXH 4RGNC 5B39G 4AIOA 5JPNA 4XWGL 1HH6B 4ELMF 4LMQI 3ARQA 3ABZA 5LGKA 5DSCA 3MZGB 3ZHLA 2C1PA 2I07B 1LP9A 3OHXB 4GMSH 1SYSB 1AR1C 2IPUG 3U0PB 5C09E 4MAUL 2EDXA 5IHUH 3K80A 3QWQB 1U91B 2Y5TA 4JO1L 4QF1A 1B6DA 1OGAE 1QPXA 1I4FA 3RPIA 3UCRA 2IANA 2YOCA 1F2QA 4UQ3B 1ZLVK 2EC9T 2VDKH 1SJEB 4XGZA 5KBNC 2NW3B 3O41A 1WZLA 4P2RA 1SHMA 4QXTA 3LEVH 4KHTL 2R0KL 4YPGB 2BNQE 3TN0A 1IVLA 1QEWB 3TJEH 3AY4A 3EFFB 1E4XL 3HC3H 2ADFH 4X99B 2X4UB 4GS7C 5JIPA 4G42B 5T1LD 1XGUA 1FBIH 4HWZA 2Z8WC 5T3XH 1FDLL 4U49A 4HMDA 2FSEB 3BP6B 5HXMA 4XNQA 3DXAE 2CJUL 2OI9A 4WHTA 5C2BH 2EDYA 4G6FD 2X4QA 1Q72L 5KVFL 3I9GH 2FIKA 4DZBB 3NIGE 2MJWA 1CFTA 4LSQL 1E6JH 3GSQB 4L8DB 1ZVYA 1MHCA 3NH7H 1LE9A 2NY6D 3QIBD 3CPLB 1PLGL 3SDAB 2R69H 3MV9E 2C1OB 5LVEA 2VTFA 3DSFH 5T5NG 4XCEA 3ZE2E 5DRXA 4QCIB 4KRPB 3BGFC 1WLHA 2YD4A 4U6XA 1YEGL 4UV4L 5BRZB 1H5BC 1YY9C 5E7BA 3ZDZF 4ONFH 1ZT7B 5FOBA 5MP6H 5IW6B 3T1FA 1INDL 1KJ2A 3ULUL 4D8PA 1JZ2A 3MROA 1YQVL 4Y5YB 2V6HA 3BN3B 3O6FA 4HX1B 2GJZA 5KSAD 5EUOE 3V8OA 2OL3A 3HZKB 1P53A 3B2UC 2CQVA 1LMKA 2X89A 3TA3B 4PJ9B 3VFSA 4YFLF 1X5AA 3MLVL 1PEZA 2NY2B 1SEBA 3R06A 1I1FA 4QHMB 2BVTA 5JMRA 1J1PH 2CDFB 1JGVL 1W8NA 4UT9L 1Y6NR 3IDNA 1TTGA 1IFHL 4L8CB 4X6BA 1R5VA 4XRCA 1NGYB 1YEJL 4I4WA 3AXLB 1DEEB 4WUUA 1K4CB 1WF5A 3HE6C 5SWZA 1RZJC 1AIFA 3U30C 1FZOA 1MH5A 5IP4A 5EO0B 2Z9TA 3MR9A 3G6AA 3OB0H 1U3ZA 1LDPL 4X80H 5MEOB 4S1RL 5KANI 3GMMB 1MUJA 3QIBC 4LLVB 2VITB 4PJCB 5D9SB 2P5WA 4L8SA 5E4EB 5T3ZH 1WQVT 2NZIA 2B2XL 3T2OA 1IAIM 3FT2B 1OAKL 2J8UF 4WV1C 5EU5A 3S6CA 4C59B 4F9LA 3UJTH 3TVMB 2GSIB 1ORSA 3PWVA 4TSAH 5EOCH 3W81A 4Y5XA 3TZVB 1QFWH 5E9DB 5C8JB 5HYJE 2JCCF 1Q0YL 1FJ1A 3C5ZD 3BI9X 5TDNA 1KSRA 1TQCB 1RIHH 2WLZA 2C26A 2OJEB 1JYNA 3M17B 4GG6F 5IF0B 4HJJL 3G6JA 1A1MA 3FCTB 5I2IB 3EDJA 1AQKH 1QSFD 3D0VA 4PFEA 1G9ML 2ICWB 5JR1L 2FX7L 3MO1A 3D3VA 4PLOB 1IM9D 2DKSA 3L7EB 2YUWA 5D96B 4M7KL 2GK0A 4GO6B 3OKNB 2V9QA 1OF2A 3ARDB 3ARGA 1B6UA 3GBNH 3BAEH 4P23C 2IWGA 2DM2A 2D3VA 1QVOB 3VGGA 2GJ6A 2VQTA 4U1SB 3QXDB 1TCRB 2ENYA 3WD5H 1WZ1L 5E5MB 1GGIL 1KCVH 3QXUA 4Y4FB 4MAYA 4F7TB 1DTUA 3R8QA 4UI2A 4I9WD 4RFNC 1VB9A 1U8KB 4G9FD 1CD0A 4KJYA 3P4OA 3VMPA 3MJ7B 4NHUB 4Z7WE 1U3HB 1Z5LB 5GGSA 3GBLA 4JDVB 4PJEF 1UG9A 4ELKB 4HWBL 3NAAL 3TYGL 5GS0C 1FHGA 3EO9H 5JW4M 1NC4B 1I1AB 1Q9KB 5ANMB 1EUUA 5FYLL 4V1DE 2JIXD 2YPLE 2P5EB 3FN0L 3HNVL 4NM8L 4QRQB 1IT9H 5IFJB 3GSWB 4CU8A 3DI2B 4OCLC 1UWEL 4X6CB 2B0SL 4X7TA 2BMKA 3HS0B 1A6UL 1EK3A 2ZPKL 5EIQA 3B5HA 2AJUL 3IU4H 1D6EA 1ADQH 3WSQH 5IHZA 2D03H 4XC1H 5DURB 3VXPB 1DANT 3MMEB 4MJIB 3BT2H 5CJXC 4EDXA 2Z91B 2VLJA 5MHSE 1X3DA 3K4ZA 1YMME 1WWWX 2EO1A 1EJOH 1YMHA 4EEEA 3KLHD 2XA3A 3JVGA 1GHFL 5D5MF 2A6IB 2AABH 2V2WB 3FQRB 3C08L 3HMWL 1OGTA 1ZGLM 1OQOA 4GW1B 5BV7L 3OAUL 5E2TL 1BZQK 1KCRL 1WV7T 3EFDL 2J4WL 5E8PA 2PTTA 3BP7B 2ZKHH 5F1IA 1UQSB 3IDGA 2DTML 3LMJL 3T3PF 5CZXC 2X40A 3UTZA 1ZHLB 1RUAL 4PRPD 5JO5B 5CMAA 2NYYC 2F9BT 2EYSB 4Z9KB 1M7DA 4ZPVA 1J8HE 4LRNL 1B88A 3U1SH 1GIGH 2M8XA 5E2WH 4IDJL 1L6XA 2VZUA 3SPVA 4KVCH 4MD4A 3GM8A 1NDGA 1KGCD 3P77B 3GB7A 4H8WH 3VXQA 5C08A 1CD1A 1DDHA 5HGAA 3RUGA 3D48R 3BZEA 1LK3L 4M1CD 2P47B 2YMXH 3SGEI 2J88L 3RX5A 4AZ8A 1U91A 1VFBA 3HPLA 3BMWA 1OPGL 4TTGA 1PSKL 2W65A 4OLZL 5K59F 4OSUL 1KLUA 3EGSB 5D7IB 1T20B 1R5IA 3O8XB 5LAXA 1YEHL 4L3EA 5E8OB 4U6YA 5CUSH 1OLZA 1EXUB 1R24B 4UV7H 2CIKA 4GXUN 4PJ7A 5F9WC 1OAXL 4X6FA 1P1ZA 4P3DB 5FK9A 1GJIA 5FUCE 3DVNA 3WUZA 1WZMA 5AD0B 3BYYA 5I19L 4LSRL 5ILTH 4HWBA 4YWGH 4BH7A 3MYJB 1TVHB 4X6DB 1AJ7L 1Z0NA 1X5JA 4QHLB 3TO4C 4XPAL 3BP6A 4JM2D 4Y16A 4JPKL 1ROWA 1JTPA 5F9OL 3FFCE 5SX5K 4KI5E 3QH3A 4QRPA 3SGKA 5EPMB 4K8RH 2WBJD 4NNPH 2HLFD 4OM0H 4DVBA 2YD1A 4QTHB 1AQDB 3GIZL 5AZEH 3E8UL 3T65A 1P2CB 4XX1E 2JJTA 1IBGL 5TPWH 1MCFA 1L7IH 3THMH 4P2OC 2CO6B 3ZT5A 1PX4A 3CPLA 1VEMA 2OYPA 1XF2B 4L4VB 4JZJC 3D9AL 3OJMB 2Y7QA 2XRAL 1T7ZA 1OM3H 2D9CA 4P5KA 2E8ZA 4GSDL 3L5HA 4DOHB 1XF5B 3PHQA 4RFOH 2JF1A 3QEHB 3KYMA 4XT1C 2GHWB 2NY0C 2QQQA 5BW7A 3Q5TA 2ICCA 3H9ZA 3V5KB 2QQNL 2H3NB 2UUDH 4ZS7H 5FHBH 1BFSA 1T66C 3EO0B 2W9DL 3QDJE 3L95B 4S2SB 4MDJB 4JFPB 4HFWB 3JWOL 4WDIB 3O4OC 3BGFB 4H25A 3K0WA 4BZ1L 3QG6A 3MODH 4AG4L 1HINL 1JK8A 2BFVL 4GAJH 1KXTB 3EZ8A 3RWFA 3SDDD 3ULVE 35C8H 3AXLA 5IROC 1K4CA 2WBJC 2WUBL 2H9GB 3V4PH 1DE4A 1NAMB 1A1NB 3TYFB 3WKMH 5IESL 5E94A 1DQJA 3SE4A 2UWEF 4LSPL 1G1CA 4X7DC 1E4WH 4EJ1C 5I6XB 4UINH 3ILQD 3NTCL 1Z9SA 5C0AD 1MAML 4YH6A 4X7FC 3MV8A 2Q7NA 3SKJL 4XXDA 1HE7A 5FGCB 1M7XA 2DQCH 3DNKA 5T1LB 3VXTB 5LQBH 4GRMA 1HXYA 3FT2A 5L88L 1YNLL 3IVKB 3DO3A 1BQLH 2XA8H 4LEXH 3ROLB 4JRYE 3MRPB 4XBPA 3DYPA 3WEXA 2BVYA 2ZUQC 5I0ZA 4G7YL 5E6YA 5DQ9B 3H42L 4G6FB 5CBEA 3S7GA 4YR6B 5DR5H 4PJAB 4ZUVB 1AR2A 5BJTB 4CKVX 5E9DA 3VXRA 1QSEA 2B7DT 3W0WD 1ZT1A 2ZCLH 2CO7B 4F9PC 2XN9D 1GC1L 3QIBB 3WFCH 2HJKB 4P49A 5F7UA 3ZHDA 4NQEA 3AROA 1A4JB 2ITCA 2QSCL 3M17A 3EYQD 5FGRA 3IAPA 2ARWA 5I2IA 4J3UA 2PN5A 3MX0A 4KROD 3ARED 3VD5A 3WIHL 3SCMA 1QBAA 3KNBB 1XH3B 1BOGB 2DIAA 2E5EA 3C6SB 3V4UL 3NCJH 3UX9B 1KEML 1A1OA 4GKZB 1D5MB 5TF1L 1WJ3A 1W72B 5I74C 3C87A 3PL6C 1A3RL 4WFFE 3FO2B 5GGVH 4P48A 5J11C 2J5LB 4MQ7A 5F7EH 4EUPG 2ADJA 4U1SA 4QRRA 1EHLL 3QXDA 2P8LB 3O11A 4NN6B 5CCKL 1BECA 2SEBA 1P5VA 3ILQC 3WO4B 2NTSP 1MY7A 3OJ2C 2GY5A 15C8L 2DLTA 4APQD 3BX7C 3MLRH 4RBPH 4KMTH 1ZHNB 3F6LA 1J87A 4WFGD 1FORH 1I1YA 5EBWA 4OZIF 5D93C 4R0LA 1NL0H 1WBZB 1A7QL 1T6WA 3RIAF 3HC4H 1XGYH 5I1GL 1A7RH 1RUML 1S9YA 3OAYK 4DQOH 3O2VH 4RAVA 5ICXA 3SDYH 3ZSSA 1UB6B 5IIEA 3IJYA 1T1XA 1A6TA 5EC1A 2EECA 3PGFH 4MVBC 3IFLH 4KV5F 5ANMA 5LCVL 5KSBF 2HVKA 3VGHA 2IAMD 3C5SB 4RFNB 4Z7QF 5E2UH 1WCBB 2V17H 4KRNA 4AEHL 2IPTL 2X41A 3DLQR 4KROC 3AREC 1UKSA 1HILA 5DK2A 5TDPA 4HWUA 3QUZA 2P8PA 5J9PA 1G0DA 5ISZB 4MJIA 5BZDB 4PV8B 1NGXB 2Z91A 3C5ZB 5C0CB 5JORA 3MNZB 1CFSB 2QV2A 3MRQA 4F80A 4M7LL 3IFNL 4HG4K 2K1MA 1IGMH 1DQQA 1ZTXL 4LSUL 1C8PA 2JELH 5TJWK 3VFOB 4M5ZH 1PVHA 4FQIL 1MVUA 1OVZA 3IFOB 1VHPA 4LHUG 5F6HI 3OGCA 4APQC 1IM9B 2OTPA 4YHOL 1FCCA 4PJBB 4ZFZA 5GJSH 1ZGLA 4YZFF 5IVXE 3WXVH 3KPTA 5ETUB 4ACPA 3ARFD 1ZHLA 4LQ1A 4TUKH 4Z7NE 3N1MC 1UACL 3QDME 3FONA 1ZLVH 2A83B 2GT9B 4PRID 3PGCB 3D87B 1ZHKA 4O2FA 3WIHA 3BP4B 4MJ4A 4WI3A 1P7KB 4KC3B 5T5NF 5IQ9A 3UTTA 5HDBF 1JV5B 1CDBA 4OZFA 4WWKA 4P5MB 3U4BL 3B9AA 1OTTD 1SMOA 4I1NB 4KK8C 1FQ9C 2X9WA 5AWNL 5CEYB 5EBMB 3LQAH 3PGDA 1J0KA 4YC2B 1EBAA 5CGYD 1N5AB 2YEZA 4AQOA 3EGSA 5D7IA 3LRHA 4Z78B 4R2GC 2JIXB 2GW5A 5A2LH 1J1XH 4JFFE 1CLZL 4F2MB 4NNXB 4AT6B 1R3JA 4HH8A 4EI6B 2A6KA 3ZL4L 3BYTA 2H41A 5DQJB 1BZ7A 5K9JH 1FAKT 4M9OA 1CT8A 1G7PB 4M1DL 3AU1B 3TIEB 3G6DH 1U8NA 1ND0B 4IOSD 2C5DC 4LSVL 4D0CB 1MSPA 2A6DB 3G5ZA 3GJFA 2X4OB 1AQDA 1UFUA 4QTHA 5F9WB 3VI4E 3KWWA 4LP4A 5DLML 2WBWB 4R97C 1INEH 4U1IA 4JKWA 1KFAL 2Q3AA 4RFEA 4ODVL 4FQPA 1DLFH 3TO2B 3RA7H 1ZKAA 1UH3A 5F97E 2DD8H 4AEEA 1XF2A 2HKFH 3H0TA 5C07E 3F12A 3TO4B 3RVVD 5A2FA 4FNLL 1OTTC 3RWJA 3SGDH 4K2UH 4R8WH 5DUMH 2HA1A 1BEYH 3P30L 3BMVA 4IOIA 2R4RL 4GXUM 1AGEA 4BK5A 2IALB 1A7OH 1ZE3C 5CGYC 3V5KA 4PRPB 3W11D 1FNFA 3AVEA 3PV6B 4LPYA 4X7SH 1PKQE 1QFWI 4P2OB 1KC5L 4RMRA 4I3RL 5F1OB 3ZTNH 3ES6B 4UNUA 5DHYB 1NFDB 9CGTA 2NCMA 2Z8RA 3PWPE 1EAPB 4JZJB 4JJ5A 5JOPE 4HFWA 3QIUD 3UC0H 5C92A 4PJIA 4AK1A 3QJFA 5D8JL 3V5DA 5AEAA 1U8IB 4R96B 4PBVC 3NA9L 1H5BA 2D9QB 3LKQB 1JIBA 4YAQB 4LCWA 4LCUB 1UA6H 1RFDL 1NDMB 3RAJH 4F7MB 5IVNA 3QRGH 3W9EB 1B0RA 4KUCD 1N8ZA 3V2AR 3S88L 2IADB 3BH9A 5GS0L 4HKZB 3O4OB 4JPIB 5IB5B 5J8OA 3RWIB 5D2NE 4YHMH 3QHFH 5JXAH 4F8QA 1X5FA 1TZHA 4QXWA 3EJZD 1NSNL 2J7LA 5IEKB 5CGMA 4M93B 4JM2B 3RVVC 1J86A 5KOVC 3X3FL 2WBJB 1K8DB 2HWZL 2EXYC 2FEEI 3HE6A 4P2QE 1AGBA 3N50A 4X4XB 5EU6D 3MFFB 4FFYL 4PJAA 1N5YL 4MZ3A 2X4SA 2V2TA 4N90D 1C1EH 2HTLD 3T1WA 5A40E 4PRAB 2LU3A 3FQNB 1NJ9A 1QRND 2HJKA 3GIVB 1ULVA 3QDHA 4N0FB 2APBA 3GSNH 5GIRB 3UEZA 4JCLA 2DLFL 3OV6A 2Y07L 3KLDA 5LWYL 2ZP0T 1WAAF 2EDWA 3S8WA 3ILPA 4JO1H 4WV1A 5D2LF 2G9HA 3MV9D 5BCAA 1CS6A 1ZMYA 1XH3A 3DYOA 1KTRL 2DL9A 4UTAL 3WYRA 3BUYB 1KCLA 4HG4J 3QZWG 1DSFL 5IFHL 1NLBL 1VSCA 4WI8A 3LPGA 1WTLA 2FB4H 3MYZA 3OL2A 4LIQE 5T33H 2VAAA 2VQ1A 4U2ZA 2IBGA 2P8LA 5DRNB 2UZIL 2WIIA 1A0QL 2EIEA 2OQJB 1FVDB 4XP5H 4F33B 3MCG1 3S4SG 3U46A 2YPKA 1TMCB 3UPCA 2CJUH 4RMTA 4FABL 3EJZC 1Z3GL 1A3QA 3MRNB 4CJ0A 3BDXA 4R26L 5IB1B 1WBZA 1Q72H 4XNZC 3SDDB 5KVFH 2I9LB 4N68A 1E28B 5DEZA 1J05B 1TVBB 4N0UA 1ACYL 4YHNB 4Y5VC 4P23A 5D7KE 5I74B 4K23L 4R9HA 1MCQA 4OGAD 4BYHA 3LQZA 1ITBB 4MA8L 4E0RB 3WL9B 2OZ4H 3KPLB 3MLXH 2WV3A 1AGFB 4AMKH 5C0AB 1FL5B 3HLAB 3X11A 4FP8H 2YA0A 3T0AA 4DGIL 1FV1B 1S7SA 2ZUWA 4LASL 4NIKB 3MRBA 3EAKA 5DEGB 1UXWA 3FB7A 3T0XA 4HMEA 5E03A 1Y18B 1WICA 1RZKH 5K9KB 1INDH 3ULUH 3M1BA 1HYRC 1MCOL 2EE9A 1X4XA 1FG2B 3V6OC 1DFBL 3PHSA 2VXQL 4NUGL 4F15C 3QNZB 2KUTA 4NC2B 5ISZA 1TENA 1PYWB 3W0WB 3MNVA 5C0CA 2XN9B 4M6NL 1CFSA 2E7BA 1RZ7H 3UTPD 4F57L 5HYEA 5HYJD 2R4SH 3MLSL 1JYVA 4UT9H 2BRRH 4KROB 3AREB 4F37K 4PRNB 1KLGB 3IFOA 1YEJH 4PJBF 3STZB 4PJ5A 1RIVL 3HUJF 3X13A 4JFED 3QCUL 3OZ9H 3MRJB 1T5WA 4OZHE 3BKYL 3OXRA 3TNNB 2YRPA 5DUBA 1LDPH 1KYOK 1MRFL 5FKAB 4DZ8B 3WNOA 2C9AA 3VRIA 4ZFOB 2NZ9C 3QHZL 3VXNB 4Z7VE 1OAKH 2CSPA 3BJLA 3IFPB 4MB4A 3SDXB 3VFVB 3VRJA 3B3IA 5AZ2L 1CDUA 4XHQA 5I1IL 4APQB 1JV5A 3QO0B 4FQCL 1QPPA 1W0VB 1V3LA 4W6WB 1S7XA 1HSAA 4P2YA 1DUYB 1E27A 1YPZA 2FYYB 4WU7B 5SX5H 1NGZB 5JXEA 1N5AA 1AP2A 1HNGA 5CEZD 1YA5A 1KN4L 1I8KB 4NQDA 4MMXC 3WN5C 1JGEA 4FQLL 3MGOB 3ZMRA 5LXGL 4HJJH 1I3UA 3TBWB 3OSKA 5F7DA 3IDMB 5DYOA 4BELD 4V1DD 1PZ5A 3QQ4B 2IAMB 1D7FA 3LKRA 5JNYB 4XZUA 3GI8L 1G9MH 2YPLD 1WFOA 4Z7UF 5KSVA 2LABA 1R0AH 1SM3H 2APTA 2FX7H 5GS2H 5JR1H 3RWGA 4C54A 2IFFH 4M7KH 5FYJU 1LILA 3OB8A 3D18B 2PW2B 3EDKA 3WNKA 1WFUA 4JM4L 2R0WL 2D0HA 4R2GB 3WXWL 1S5HA 4D0CA 4LK4A 4LCCA 2XKSA 3DOSA 3GHBL 4H1LB 4KZDL 1S7QA 4IJ3B 1WZ1H 2XWJA 1GGIH 3FZUD 5CD3A 3PG2A 4IS6A 5DJXA 3LQMA 1G7JA 4HSQA 2FCBA 1BAFL 5INDA 1LO3L 2X4RA 3TO2A 1ONQB 5C2UB 2FGWL 4NKOB 4XVUC 3DJ9A 1S7TB 4Q6IC 2WLYA 1HZHH 1NMBL 3AS2A 3E2HC 3TO4A 5EOTB 2A6JA 4LVOC 4ZSOE 4HWBH 3NAAH 4XAKE 2BSED 4XCCL 4MNQD 1WBXB 4OZ4A 1SQ2N 1FNSL 2VLLB 3QDGA 4ODTL 5FYLH 4IMLA 4R4BA 3MRRB 4C56E 5HHPA 3ARFB 3FN0H 3HNVH 4R97B 4HIIA 5E56A 3GSOA 3DWTA 2YK1H 3HMXH 2DQIL 1UWEH 4PRIB 1FE8L 2MSPA 4P2OA 4JQXC 3M8OH 1J7VR 3UBXA 1BQHB 1A6UH 5MEPA 1J8HD 3PP3K 1I7ZA 3BH8A 4BSWB 2AJUH 1NGQL 4OZGB 4PV9B 1FNEB 4ELME 2DQDL 2L7JA 2VLME 5SWQB 5D7LB 1LP9E 2W0LA 3LKQA 4HH9B 3AC0A 1P84K 5B21A 4LF3A 1HQ4A 4EIGB 4OGXL 1R6VA 5E6ID 3N06B 1ZLUK 4JB9L 2C3WA 4PRHB 1NDMA 5F9JB 2QR0A 1CE6A 3QZWB 3VGFA 2EDEA 4NN5C 3C08H 2X1WL 3WNPA 3T2NL 4MHHG 3HMWH 4CN1A 4W6YB 1JPGA 3VFPB 3D2UA 1S8DA 2Y25A 5BV7H 4S1QH 2RB8A 5E2TH 1RJZB 2DDQH 3FT4A 2J4WH 4P2RE 1VFAB 3VFWB 5DJCB 2GAZB 1LGVA 3KJ6L 3O3AB 3S4SB 4JM2F 3CDGA 1T2JA 2DTMH 1MCEA 2NX5A 2XTJE 4CVUA 5FB8B 3S35L 3ZE0E 4KK9D 43CAA 5F7MC 4XVTH 5IROA 3KPPA 5IMKA 4Z5RB 1MLCA 4WO4D 4F3FB 5FHAL 4L9DA 4U6HA 2WSKA 2OS7A 3WUWB 3QUML 3SO3B 1NKOA 1ZS8A 1DBBH 2I60L 2PCPB 1IL1B 1T1YB 1A2YA 3GIVA 3L7FB 1QLEL 1I8IB 5GIRA 1CWVA 4XHJC 2EDQA 3VH8A 2GTZA 1LK3H 4KQ3L 4HJGA 1KIUA 1X9QA 5DD5L 3PDGA 1T0NA 1OPGH 4QLRA 2NY5L 1PSKH 4OLZH 4D2NA 4OSUH 2F54E 2OK0L 4XPFL 4Y4HD 1YEHH 1A6AB 5I1DB 4UBDD 1DL7L 3TT1L 4Y1AD 3BUYA 1MPAL 3MV7E 1OHQA 1Q9OB 2VN4A 3OAYH 4HIHB 1EEUA 4JHZA 4PTTB 1KOAA 4XI5D 4U1LA 4Z0XA 4URTB 4F9PA 1F4XH 3KPMA 1TITA 3KPSA 3KYAA 3VFNB 4S1SH 1EEQA 1D5IL 1SJHB 3QUXD 4ZS6C 3O9WD 2J8UA 3QDJD 1XT5A 1QACA 3FO0L 2HFGH 2YZ8A 2VLKD 3NPSC 4X4MA 2FDBP 4MMZC 4R4FH 2VKWA 3WNLA 2D7OA 4XPAH 5ACMA 5IV2A 4IMKC 4U1HA 1G84A 1TMCA 2BXZA 4EOWH 1KYOJ 3ZYJA 3PWLB 3GIZH 4MX7B 4TQEH 2VKXA 3E8UH 3TIDB 3CD4A 4MSWB 4KK9C 1TVBA 2VR9A 5DRWB 4GG6A 1FL6B 5KN5B 2EIDA 3PL6A 4YBQC 1U92A 5J6GA 2VXSL 4KJQC 3OG4B 4WUUE 3WFEL 4F7EA 3DX7A 1AI1L 1M6OA 3D9AH 1RD6A 1TZIB 5IK3B 2XRAH 1F6FB 5ABDE 5IG7B 4D0DA 4MD5B 4BFIB 2BNRA 4GSDH 3T0EE 3LZFL 1UJTA 2VB5A 5H37H 1T3FA 1JFMA 4QXUL 4E9LA 1J0HA 2VABB 3FQUB 4XNZB 3G5XA 1IAKA 3VCLA 3NFSL 3H9SD 2QEJA 4NZTL 2QQNH 3S9DB 2P5WE 1G7MB 1QBLL 2AEPL 3DGGA 3VXUA 1BP3B 5ICYA 1RUPH 5EU6B 3MUHL 4JRYD 3C60C 3VA6A 1N26A 1TETL 4MVBA 3CFBA 4KUZH 4PRDB 1PYWA 2HJLB 1FVCB 3T09A 3L3GB 4BZ1H 2PYEA 1T83A 5EUKB 1QRNB 1ED3A 4YXKL 5K9QG 4NO2A 2O5ZL 5IW3A 3ZTJG 4LKXB 5FF6B 3MLPA 2JCCE 5D6CA 3MV9B 4WTXA 1P4LA 25C8L 5FAAA 4BKLB 1BF8A 1ZWIB 3BGMB 1CCZA 3BWAA 5IBTH 4PRNA 3B5GA 1MHEB 3DUUA 3SKOB 5ITBL 1SVZA 1U42A 4H5SB 4XNXL 5C6TL 1EHXA 1SBSL 1AKJA 2WUBH 3QUMA 4PJFE 5IESH 5E8EB 3A0OA 3OKKB 4AIXA 4MNGE 5HHNB 3CX5K 1AD9B 1RK0A 2ED7A 4IIQC 5HYSA 1XFPA 1IEBB 2R1XA 3D39E 1TJIH 2FBJH 5F9DC 5CIPA 3SQOL 5DGQA 4DKFH 1IEAB 5BS0E 2LE9A 2GYSA 1NBZA 3IB4A 3ET9F 3OBAA 1N6QL 2OSLB 5IKCB 4WEBH 5L88H 1YNLH 3TBSA 4HK3J 3EOBA 5GSVA 4JLRB 4BQ9A 3ZKMC 3QCVL 5FO8A 4G7YH 5GGVY 3HRZA 1UC6A 4S0SD 4ZMAT 2HLAA 2HFEB 1W0VA 3NCYS 4PGDB 4ZOAA 3BQUC 2FHCA 3SGDI 1NKRA 3RDTA 1GC1H 1RZ8B 1YZZA 5HBBA 2YN5A 2VUYA 3P3YA 1RJLA 1UZ8A 4HBQA 2DBJA 3TBWA 5E2JA 5I8CB 4PJEE 2ZOKB 3IDMA 1G7LB 2MKLC 2CD0A 1IKFH 5E0QA 3MRMA 3NABL 1P84J 1QKZL 3T3MF 1CLYL 2VDPL 3WHXA 4X9GA 4KY1L 4OZFH 4YEFA 3V4UH 3GMNB 1Z9MA 1PEWA 3QIWD 3ZYZA 1KEMH 2XY1A 3DO7A 2D2OA 4JZNB 5FKPB 3NFPA 2Y9RT 4G8IB 3ZDYF 1A3RH 1ZOXA 4JDZB 3WN5B 1DZBA 1TFHA 3E6HA 2ADGB 3CSYB 3H6JA 3OWEA 4R6UA 2FLRT 5DVMA 5CCKH 1PG7X 1B4RA 1MFBL 1G0XA 5HYJB 2Y1VA 2AQ1A 3BKML 2G2RA 4CVWA 5M7QA 15C8H 1NCUA 1IGIL 4PREB 5F7LB 4XTRD 1ONQA 4NKOA 5SX4H 3BD5A 4J3TA 4OM1L 5GRUL 2GFBB 3QPXL 5FM4A 1RUMH 1XZ0A 3LH2L 3MBEC 4OCWH 4UNTA 3QFJA 4TVPL 2AEIT 1CYGA 3NZHH 3DARA 4JFEB 4Z0BL 1OSZA 3VDCA 1VACB 3U83A 1QYGL 5ADOL 4PP1C 3RI5F 3RY6C 5IT2L 2P8MA 4ZXBC 1NUNB 3PWJB 4FQQB 5JOFB 3NZ8B 4CNIA 5IB4A 3QRFM 3U7YH 3OKLA 5DD0L 3UYRL 3OAZK 1KPUB 4I18B 5F88A 5DA0B 4X98B 3QDMD 3DX8A 4L5FH 4B5EA 1OAQL 1BQHA 1WFTA 3T3PE 1JWSA 4Q6IB 2OBGA 3R4DA 1LVEA 1QBML 2EDRA 4BSWA 2XYCA 3KR3H 1Q9LB 3E2HB 4LPUA 4TNVK 4LVOB 3VWKA 2GTWB 5ALBL 4ZPTA 4YBHA 5E1AA 4M8QB 2V5YA 5D7LA 4X9HA 3QIWC 5GRYA 2RFXB 2RQ8A 4IRSC 1BM3L 1WBYA 3LHPL 3OGOE 5HHMB 4NCC1 1U93A 5IB3B 2DJUA 5F9JA 4UQ2A 3IFNH 1YEFH 2EH8H 1DN0A 4JO2L 1N2RA 4RWHA 1E6OL 4AIZB 4V1DB 3KG5A 3L3IB 3UTSD 3E1F1 1S7UA 3QFDA 4JFFD 1T2QL 4XBGA 4YHOH 4XTRC 1OD7A 1JF6A 3UJJH 1XGRA 5CSBA 3CXHK 3HPJB 5DJCA 4CADB 1EDQA 1J88A 2EDHA 3JTSB 5C0BA 2H2SC 2I5YL 3AAZA 4HK0B 1CXLA 3DURB 2R2BB 5FB8A 2UV3A 1UACH 1NCDL 3CFKB 4M6OL 4P4RA 3TPUA 5I18H 1B2WL 4NN5B 4FFWD 3B6SA 4Y4KC 1CGTA 1QNZH 3H9YA 1IGCL 5HHOB 1KB5L 1WWBX 4ZDHA 5LJYH 2NY3C 3P0YL 1NMAL 3TWCH 5CJQH 3LAFA 4YXLH 2IFGA 3U4BH 3HAEG 4FMFA 5TE4L 5I1LB 5F89B 3BHBA 4LIQH 5FUOL 4PGJA 3PQYB 2E9WA 3R8BB 3X12B 2A1WL 4YJZL 4MNQB 4X7EC 2YS4A 1A64A 4DVRH 2UWEA 3QISA 4Q2ZA 2YUZA 3CH1B 3O4LD 4YHKL 3WCYA 1UYWL 4RCAA 1N59B 4GG8B 3G04A 3IYLW 1CD9B 1YN6B 4L9LA 3KPRA 3DVFA 5D1QA 1CLZH 3K8KA 4PTTA 5BRZE 1FYTB 4PY8J 4WUKL 5C0DA 3ZL4H 4Z77B 3D6GA 3HI1A 4HXAL 4O58L 1T22A 2YC1A 2VDMH 4M1DH 1U8JA 4TRPL 3DRTA 5HI5D 5GHWH 1ZVHA 5JOPD 4GOSA 3T2PA 1KIPB 4MQXC 4PGBB 4QHUB 3PABB 3CX5J 2CK0L 5HY9B 4LSVH 3AB0B 1TJHL 4LGRB 4ZNEA 5CSGA 3TV3H 5A3ID 2HFFA 5FFLA 1MJUH 4LVNC 1JP5A 5E6IB 4OQ1A 5ID0B 4XVSH 5DLMH 3I6GB 4MSWA 4KUCF 1S9VB 1KFAH 3NPZB 4ODVH 4Z8FL 3LPFA 43C9A 4GAYA 2DQFB 1ES0A 4GXVL 4QT5A 4JFDA 3CNKA 4YNYB 1MCIA 5I66A 3NPSB 1KJ3L 3LIZH 2C3VA 5IG7A 4FNLH 5IMMB 2R4RH 4NQVA 2VABA 5IVOA 3Q6FB 3FQUA 2WNGA 4O00A 4C83B 4ODHL 4PJCE 4Y5VA 5KVDH 1I9IL 4UUJB 5GISL 4H8WC 1YNTB 2CKBL 1KB9K 3O2DL 2E7HA 2EZ0D 5KW9H 4LSTL 3ZDXE 1LWRA 3NIGF 1FVCA 3EIFA 3K7UA 1I1CA 1FRGH 5E9DE 5D8JH 4OZIA 1HDMB 4PJ8A 2XKNA 2BX5A 3RWHB 1K4DB 3L1OH 4BKLA 3OR6B 2R1YB 2ED8A 2EYTB 5E2VH 1RFDH 3BN9C 3UPRA 1KB5A 2JK5B 5B39A 4ODXA 4JZOA 4I3SL 4Y1AB 5KSBA 3C60B 4CU6A 3O2WH 4P99A 2BVPA 3S88H 1DLHB 4LHQB 1PG7W 2BOCB 3OKYA 1DR9A 4X8XA 4P4KC 1YJDH 2R2EB 1INQA 2ENSA 3BDBA 4MDIB 3EYOB 3GJEB 1IEBA 4ZTOL 4MQSB 2ZG1A 3QUXB 5E5RB 4FXGB 5EUOF 1OL0A 5J13C 1G6RL 1ZANL 4K8RC 1PD6A 2VLKB 4FRWA 3WJLC 2C3GA 4LBEB 1MQKH 4PY7B 4YX2L 4FMKA 5GSRB 4RDQG 2XY2A 1WSST 3ARVA 3X3FH 3D0LB 1D5XA 3BXNA 1A22B 1IMHC 3P9LA 2HWZH 3V5HB 1N5YH 2OTUB 4FFYH 1JGUH 5FA4B 3MLZL 3HZYB 4HKXB 2M1KA 4IIQB 1B90A 2VL4A 3PNWB 4NDMB 2UVEA 3QO1A 4A2MA 3IU3A 4YEEA 3H9HA 3EKCA 3OKEA 4NHUE 2EZ0C 1M05A 3LEXA 4L3CA 1BZ9B 2Y07H 4M7ZC 2BRQA 5LWYH 3GBML 4BFBD 2XQYK 5DMKB 4J3SA 5I8CA 2BOBB 3F58H 4OLEA 4G3YL 1NAKH 2GJJA 5ANME 4CVXB 5DJ2B 4JN1H 4OD3L 3OXSA 5I1AA 2P5EE 4UTAH 3S37X 3V4VL 4HBCL 3PXHA 3H9SB 4V2CB 4XCFL 4N1EA 4X6CE 3C09C 1C16B 1DSFH 1N64L 3C5JB 4UB0L 1CGVA 1NLBH 1X5HA 2L4OA 3IS1X 4Z76A 4JRYB 2XQBL 3MUGB 1KTLA 1GGBL 4DTGL 2Z8SA 2QHRL 3SE3C 4N8CL 2ADGA 3LRSB 2GUOA 3HG1A 4LKCA 3I75A 2UZIH 2RAMA 3FRUA 1A0QH 3F5WA 3RKDD 3CXHJ 4XBEL 2IPUK 2QTEA 4MJIE 4CN6A 4NQCA 2JJUA 2Z93B 4MS8C 1T04B 1XF3A 2FWOB 2WWKO 2X7LB 2VE6B 5E08L 3RL2B 5JA9A 1MLBA 4R26H 4UAOB 3O3UN 2GFBA 1A6WL 2CKBA 4LPTA 1RZIB 3O2DA 4HEME 1CZ8H 1K6QL 4G8EB 4FFZL 5JW5A 4MA8H 1T0MB 3HTLX 1KT2A 3W2DL 3N1PC 4A6YB 1BVLB 3AS1A 1ZLUH 2YA1A 1JPTL 4OLYH 2ARJA 4X5LA 4RX4D 4JAMB 1UEYA 1FC2D 3U7WL 4GLRH 4DGVL 2XI9A 4DUWA 4LASH 1MIEL 4W4NA 4ENEC 3ZE1E 4ZUSB 3VFUB 4Y8DC 1KJVB 1FH5L 4OF0A 2QQLL 4Z95L 2X1QA 3CMGA 2H8PB 2AJSL 1MCOH 4N8VB 3PP4L 3TBVA 2BC4B 5CHNB 2VXQH 3OKDA 4J4PC 3UTTE 4M8QA 1JPSL 3NN8A 4Z7WF 1EFXD 2IQAA 5D4QA 1QFWM 1JTTA 4M6NH 4OT1L 4ZXBB 3QXVA 1G6RA 4XP4L 5HHMA 2RIKA 2Y36L 4F57H 5J1TC 5IB3A 2YSSB 2Z4QA 4KI1A 5IWLC 1G0YR 1FZKB 4PP2A 4EI5D 4ODUB 4U0RB 4WGVB 2AERT 4ZAKC 5D7IE 4NKMB 2IGFH 4AIZA 3MZTA 1MRDL 4U7MA 4WW2C 3WHE0 5J1AA 4CMMB 3H3PL 1AO7D 1A14H 1V8HA 4JANA 1ZT4B 5HGDA 2VDQL 4RAUA 5KVEH 1BFOA 1MEXH 2EYRA 5DXWA 3FQWA 3QIWB 4L4TA 4IRSB 5B4MD 4HIJA 2R23A 3ECBA 5IGXH 1MRFH 4HT1H 1T1ZA 3LKSB 1GOGA 1Z2KA 3GMPB 4X6DE 3QHZH 2NTFA 3HZMB 4P2CG 2CGRL 4PJXB 3O6LH 4Y2DD 5I1IH 1GGYA 5F7YC 3HB3D 3UZQA 4N0CD 1CDJA 1Q8MA 3U2SB 1U6AH 1T6VN 5BO1H 3JV6A 1S9WA 3RTQC 2X42A 3PQYA 3BESR 3QEUB 4FQHA 4HW6A 1KB9J 5IOPA 4Q58C 2VDKL 2ZG3A 3MREA 4L4VE 1I75A 3BE1L 3CH1A 4FQLH 4XAKD 3ZKND 5J6HB 5IMOA 4Y4KB 1UCTA 3X3GL 1K85A 5BZWB 4HCRH 4RIRA 5IVXB 1YN6A 3QWOA 3DVGA 2NY3B 5TGBB 2HAZA 2ORBL 1N3NA 3TJEL 4C56D 4EDWH 1FYTA 3HC3L 4DW2H 1GSMA 3ZT7A 4I0PC 1EGJL 1XGQB 5J57B 4N0YL 4M8VA 1CXHA 5T3XL 2VDLH 1S7VB 3IKKA 1B0GB 3QNXA 4MA1C 5C0JA 2E7MA 4OUUA 4XB7A 3IXAA 5C2BL 3WNMA 3LDBC 4PGBA 4NRYB 2WAHA 4UOW1 2ZSVA 3KYKL 1S78C 1IAOA 1H3PH 3WXWH 3H3KA 4GW4B 1ZVSB 4OCNC 3GHBH 4LNVA 2ICWJ 1OWRM 1CDGA 3V0VA 4DK6A 5D72H 1IGJA 5E00A 4X5XA 2R69L 2XICA 1LO3H 2FGWH 2NY4D 5D2LA 1XR9B 1HXMA 3UTSB 4YNYA 3JBG7 1X6NA 4BH8B 1NMBH 1J0ZA 4JFFB 4Y2DC 5DEFA 4XPHL 3HB3C 2IAND 4N0CC 4XCCH 2GK2A 2MOVA 3GHEH 4O2EA 3DV4A 3RWCA 3N1QC 4P2RD 4ODTH 2X4NA 1R3LB 3SJVA 3Q6FA 1L9NA 1KELH 5HTSA 3TN0D 1ODAA 5FGCE 4YDVB 5B3NA 5CILL 1C7SA 4KI5F 1M71B 4B50A 2DQIH 3ZKNC 5L8JB 3TC9A 3OKOB 3GMOB 3INUL 1GZPA 3VWJC 1ORQA 5HPOA 3EZJB 3LQAC 3VFGL 3S5LB 4PJAE 2XWTB 2DB8A 1RJYA 2X70A 1J1PL 2DQUH 3REVB 1F3JB 1VDGA 4EXKA 1NC2D 4OGXH 2A74A 1C5DA 3LKOA 4L3AA 4JB9H 1RY7B 4NBZB 5CKGA 2H32H 3O4LB 3DX9B 2IH1B 3T2NH 1NQBA 1WAAE 1XF4B 3CGTA 4MXVE 4X8JA 4X80L 2AGJH 3CVHB 2D7NA 3W82A 3V52L 5J12C 2FR4A 2CK2A 4NT6A 2BSSA 5T3ZL 3G5YA 4JR9H 5ACZA 1BJ1J 2W60A 3KJ6H 1T5XB 5EU7C 3BPOC 4MCYB 4WI9A 4OD2B 4TSAL 5EOCL 4LEOA 2ZWLT 4OFYA 3O6FD 1HHGB 4GW5A 3D0LA 5DDHB 2Z31C 3A6CH 3MUZ1 1CBVL 5I16B 3O3DA 4TSBH 1EGJA 2X89D 32C2A 3QUMH 1DN2A 4P4KB 3IS0X 3ULVF 4I48B 1QSFA 2K7QA 5DJ0A 1QLEH 5J13B 5IB2A 1AQKL 4N0UE 3W9DB 5KZCD 4KQ3H 5CIPH 2UYLB 1GRWA 5DMKA 3KXFA 2PTUA 4WUUD 1HHIA 2NY5H 1ZA6B 2W0KA 4TSCL 3FQXB 5SWZD 5ID1A 3H7LA 4XPFH 1LK2B 5A16A 3MRKA 3TT1H 4N9GA 1MPAH 1UEMA 1YY8B 1I8LA 3BQUA 4LP5A 4KTEL 2P5WD 4ONHA 1FGVH 2YD7A 5DMGD 4YLQT 3DIFB 3FO1B 4LGSB 3MOBL 2C4FT 4G7VH 4G9FA 1AD0A 3OAZH 1OSPL 2WQRA 5ISZE 1SYVB 5C0CE 1NEUA 1OP3K 2FH6A 3GFUA 4J23A 3QQ9D 4DCQB 3T04D 2B1HL 1U3YA 4OB5H 5FXCH 3O6FC 2NMSA 4IRJC 4JKLA 2VXUL 4JVPA 2NY7L 2N4IA 3ESVF 3GGWB 5KAQG 2DWDA 2VYRE 4AH2A 1IT9L 1ZSDA 1UM4H 2XIDA 4KKBD 4U1MA 5DK0A 1CIDA 4PJ5E 4Z7UA 5F3BA 3EYVB 3EDFA 4DKAA 2PKDA 3D3VD 3CCHA 5DMIH 3LZFH 4LCIL 3HC0B 1F4WL 1H15B 4HLZH 3FOMB 1R3HB 4QXUH 5INCB 3MJ9H 2IG2H 2BERA 3ARGD 4HQQL 3WSQL 5GS1B 1BX2A 2D03L 3CDYA 4NZTH 5DS8B 1Q1JH 2CRIA 1LQSR 3MBEA 2PTVA 4FQXD 5HVHB 2GJ6D 4RZCB 1TETH 3EHBC 1FAIL 3UXFA 1KXQE 1EJOL 1CL7L 4MAYD 1U8QB 2P42B 1JE6A 3RHWF 1EEZA 4ZXBA 1FZJB 5GQBA 4KXZH 4J3VA 4L8SC 3BO8B 2YSSA 3P73A 2O5ZH 4TVSa 1NEZB 3V9FA 5FDWA 5SWSA 25C8H 2AJ3B 4Y8AA 3TH2T 2AQ2A 1P69B 2ESVA 4Y5XC 5JW3L 2ZKHL 4YHIA 5ITBH 3TBTB 4XNXH 3TFKA 1ZT4A 1SBSH 4RSVA 4WW1B 1VADB 2V9TA 3QQ9C 3IF1A 2F53A 4KDTA 4LLUA 3HI5L 4YIQB 1OD9A 2JB6B 5ACLA 3VDBA 4IRSA 3QUYC 2V7HB 1D3CA 3LSOB 2F74A 3ZSTA 1GIGL 4M7JL 3SQOH 3LKSA 2ITDA 4JFOA 5E2WL 2V5TA 4KVCL 4GKNA 4U1KA 2R9HC 4ZAKB 1T2XA 1N6QH 1CVSC 1BFTA 2B1AL 4ORZC 2VZ3A 4WW2B 4JY4A 3I6KB 3QQNA 3NOIA 4ZUWB 3LRGA 1B9ZA 1I3RB 2VLJD 4IHOA 5FM5M 1ZA3A 2L7UA 3HA0A 1WZKA 5EOQL 3QJHA 5IJKC 3QEUA 1BVKB 4NRZB 1G7QA 3ALXA 4NKDB 2VXTH 4G43B 4BFGA 4EUPA 4OV5A 5IVXF 4MAYC 1IGYA 4Y4KA 4I8DA 3SKMA 3EYFB 5HVFB 4OZHB 1UXSA 4WU5B 1RZKC 3ULUC 3NABH 4MCZA 1YEEL 1D5BB 5EORL 1QKZH 1XGQA 1CLYH 5DQDH 4ZQKA 5ESVA 3RTQB 2I9TA 1S7WB 4Z7VB 3HFML 1B0GA 1MCWW 4O4YL 1F58L 4CMHC 4K8RL 4J8RB 1NFDE 2BVQA 4MGXA 1C12A 4NNPL 3OX8A 4OM0L 5DRZA 4ALAL 4MXWL 5AZEL 1S7RB 4JN2A 3C8KA 4YUEH 2OLDA 4OAWA 4YHPA 5TPWL 4HAGA 1L7IL 2HT2D 1OT1A 5T1MA 3A6BL 1XGTA 3B9KA 2R15A 3THML 4LLQB 1F11A 5C08D 3BKMH 1KPVB 5H94A 4NO0A 4I0PB 2NPLX 5JHDB 4P5TA 3ARZA 4OGYH 1BBJA 3FHAA 1IARB 5CSZB 1H3GA 2JE8A 4OM1H 1OM3L 1JZ5A 5TH2B 1FIGL 3QPXH 4MA1B 3MJ8B 4P3CL 1AO7B 1HCFX 4RFOL 1CFNA 4LPCA 4L3ED 4RDQF 3L3JA 4TVPH 4KJWD 3BPCB 3LV3B 3NA4A 3RVWD 1FVEB 4NOFA 4LLMA 1JGLH 1D9KC 5IVZA 3TCLA 4MA3B 5ADOH 4GRWB 4NPYB 5IT2H 5LGJB 3QPQD 4R4ND 5FO9B 3U36B 4J1UA 3UYRH 4WNQB 4JFXA 4FZEH 2NX5E 2X5PA 3QXAA 2AW2A 2BVOA 3ARBC 1JYWA 2EKJA 3VI4F 1YEIL 1KIRA 4N8PA 4ZD3L 4NZUL 5ENWB 4WJ5B 4LHUA 3MXWL 4Z6AT 4Y16D 1V3MA 4Y2DB 5FYLD 4GAJL 4XCNB 3RY4A 3D69B 5JDSA 2E8YA 4XMKH 2XWTA 1CGSH 1B3JA 4QRPD 4ETQB 1UM5H 2FJGA 5EU4B 3FQTB 3C6LC 3N1FC 1F13A 4FG6C 4L8BB 3DGCR 5GGRY 1BM3H 4ZFGH 3GSRB 5JUEL 3ULSB 2ICEB 3WKML 1G9MC 4ZSOB 4ZUUA 3S96A 2G60L 1Y6MR 1E4WL 3SDAD 5BOPA 3CX2A 3IDYC 2RBLA 1FFPB 3GZKA 4NQSB 2HT2C 2H45A 3VWJB 4YHLH 2DQCL 1N7MH 3VG9B 4U1JA 2WANA 5LQBL 3QUKA 3U6RB 3KYNB 1BQLL 2ZOLA 4N5ED 3KPSE 1GGCL 5EC2A 3Q5YA 2ADIB 4K3GA 3O0RH 5FA3B 3FT3B 3P4LA 2AKRA 2PXYC 5JPNB 5DR5L 4RA3A 3UZEA 4PG2C 1NCDH 5IR1A 1OTUD 1X7QA 3KS0J 1B2WH 5C0ND 2JJVA 3D5OF 2HTKD 2C1PB 4GBXC 1LP9B 4M3JA 4P4KA 4KK6D 1DQLH 4P9HH 3PIQA 3U7AA 1IAMA 3PWNA 3L3HA 1R5WA 1DQML 2NY4B 2Y5TB 4QF1B 5TE4H 2AV7A 5LKNA 1WTGT 4XVJL 1I4FB 1BHGA 3ARWA 3WJLA 3BPOB 4Y16C 4OKDA 3RPIB 2A1WH 2IANB 2GITA 3JV4A 3ME0A 4V3EB 4Y88A 4KPHL 4XGZB 3VG0L 1JVKA 1MF2H 3S36X 2QKIA 3UMTA 2CKNA 3I3BA 3O41B 3QYCA 5C0AE 4QXTB 4QHKJ 3TN0B 4HHAA 2DL2A 4M4RA 4PS4L 1YY8A 5GGVL 3MV8D 5E7FA 4H0GA 1XGUB 2DWEB 2EEAA 4HWZB 4I2XA 5DJZA 4G6MH 3CJJA 4O58H 1CTOA 3DROB 3BDYH 4XNQB 1Z6JT 4TRPH 4B7LA 3MLRL 2OI9B 4KMTL 1FORL 2X4QB 4HGKC 1NL0L 2CK0H 1XGYL 2FIKB 5E9DD 1A7RL 1UJ3A 1GAFH 4G9DA 5E8DH 1HH9A 3GMQA 1IRAY 1QSED 4LLDA 1CFTB 4G8FA 2VL5A 4DQOL 2EXWD 5BVJA 2D0GA 3UBXI 5BV7C 1KTDA 4LL9A 5AYQA 1KJMA 4NQED 4S11A 5CP7A 4Z8FH 2GIYA 3TM6A 4GXVH 3GGWA 4K07A 2E27L 1F42A 5DRXB 3SE3A 1R3KA 4U6XB 1CXKA 4HLZG 5FYKH 2Q3ZA 3KPNA 3SCMD 1KJ3H 3VXSA 5E2UL 5J7CC 4DKDC 1F45A 4MS8A 2W92A 5FOBB 1AY1H 3T1FB 3P40A 1KJ2B 2QQKL 3MROB 1WIOA 4ODHH 3O6FB 5EN2A 3GO1H 2OL3B 3SDXE 4QRRD 4YPJA 2VISA 2CKBH 5DI8B 3WJJC 2Q86A 5BQ7A 3CC5A 4XH2B 4LSTH 3VI3E 3PDOB 1BD2A 4QWWD 8FABA 1SEBB 3R06B 1Z9LA 2XG4A 4GJTB 1IGML 1I1FB 4ETYA 4K7FA 4YBLB 2JELL 3T2QA 3BO8A 2B8OT 1HOCA 2V5MA 4M5ZL 3NVQA 4JFZL 4Y7MA 5KZCB 1JYXA 1PY9A 3IDNB 4M43H 4X6BB 2G75A 1R5VB 2FHFA 1TTUA 1FFOA 1LD9B 4WUUB 4TULH 5I1JL 2VDRH 5SWZB 1AIFB 3BFOA 1MH5B 4YFLI 1MOEA 5C0GA 5L2KA 3MR9B 4I3SH 1VADA 4OTXH 2F8VA 3WXVL 2BVUA 3G6AB 1QA9A 3FTGB 4J4PA 3ZO0A 4LMQE 2VLRA 2Y5EA 5CD5C 1MUJB 2W1NA 2AV1A 5DFVC 1DBKL 4MQTB 3T3ME 1U2HA 2P5WB 4L8SB 4ZTOH 4HUWB 3B2VL 4JY5H 5IWLA 5EU5B 1J12A 1ZANH 5C0EA 5KS9A 4PJHB 3SCMC 3KLAA 1ORSB 3PWVB 4YX2H 4Y5XB 4WW2A 4F37F 1K2DB 3QUZD 4EKXA 4HZLB 4FN0A 1LQVA 1CVRA 4NSKA 1VEOA 4QRSA 4MJID 3WV0A 1FJ1B 5TDNB 1QLFB 4W4OC 1J0IA 2W91A 3V6FA 2CLRA 1RURL 3QUYB 2WQ8A 1BVKA 3EO1A 1HI6A 3G6JB 1QFPA 1A1MB 1U58A 4X7CC 3D0VB 1UCBH 4OZHF 3QFJE 4QWWC 2A9NL 5FCUL 4F58L 4ZYKA 3D3VB 1UZ6E 4R0LC 4OD3H 3CLFL 1AGCA 2GK0B 4BSVA 3LN5A 3JXAA 1OF2B 3ARGB 3V4VH 2FD6H 3TGXA 4Z7VF 3G6DL 4PYGA 3RZCA 5E99L 1OB1B 3RGVC 4PRIE 1N64H 4JRXA 4DWHA 4D0BA 2GJ6B 1FFQA 2XQBH 5HI3D 3RI5K 1NAMH 5CLWA 4DTGH 2APWA 1S7RA 5IM7A 4MAYB 4N8CH 4OZGE 3W5MA 5GZNC 3Q1SH 3UTTD 5HHQA 3RQ3A 1DLFL 3K46A 1NCBH 4WWKD 4XBEH 1JPFA 5D7LE 2YD2A 3LB6C 1RZGA 3RA7L 5JOEA 4R3SA 4I0PA 3CZFA 5JHDA 1O5DT 4KJYB 4J6RL 2DD8L 3P4OB 4MA7L 2HKFL 4WI2A 5E08H 3T8XA 2BSTA 2FZ3A 3NCCB 4PRHE 1DJSA 4X9BA 5TH2A 1A6WH 1JWUA 3MJ8A 1BEYL 4CMHB 3VXMA 4G8GA 1KG0A 4RGND 1KIQB 4FFZH 1K9TA 1JL8A 3ELAT 4GRWF 2E9JA 4CJ1A 2VZOA 3W2DH 2BMKB 3K1DA 3IETA 4MJ5A 1AR1D 4G6KL 3U7WH 4UT7H 1MIEH 1MVFA 1CG9A 2YHGA 5IHZB 3DUSA 1MNUH 2AJSH 4QHNB 4XCNA 5C09A 4YDIL 1GC1C 3PP4H 4EDXB 2VLJB 2EC9U 3QULA 3EOAB 2DQJL 1OGAA 4NKQB 3WS6C 1JPSH 1YMHB 1JJUA 4UNVA 4POZC 3RAJL 3VW3H 1EO5A 2EICA 4WENB 5DWUL 1W72H 4HS3A 3ULSA 1OGTB 3CFEB 1YYML 4NJAH 1BWMA 1MHHA 3S3JA 3BKJH 2BNQA 5KTEL 1VESA 5ADPL 4ZFFB 1QR4A 5IQ7H 2UZYB 4YHML 5E8PB 1MRDH 2PTTB 3QHFL 4YHZH 5JXAL 5F1IB 1PFCA 5DF0A 3RIFF 2P24A 1CLOH 3B9EA 4K3HA 1A47A 1FZMA 2R56L 1HIMH 3K2UL 3DXAA 2BHUA 2ADIA 2DMBA 2PNDA 5E24E 3RWEA 5FA3A 4OIBA 1M7DB 4ZPVB 4CDHA 1FNGB 3FO9B 4NNYA 3IDIA 3TBYA 4NN7C 2Q8BH 1QR1A 1LP9F 1OP5K 3SPVB 4M61A 4MD4B 1C1EL 5KAQF 1LEIB 3VMNA 1NDGB 3GB7B 3VXQB 1K8IB 5C08B 1CD1B 1DDHB 2CGRH 4ZNEE 1U8LB 3GSNL 3N1GC 5HGAB 3RUGB 1ACZA 2AXJA 5CZKA 3BZEB 2IC2A 1YY9D 2CLZA 1VFBB 1VFOA 3HPLB 4LCWD 2PUQT 2W65B 4NO5A 1KLUB 1R5IB 4I77H 5LAXB 4L3EB 4U6YB 3KGRA 1CICC 2BK8A 1OP3H 3MUJA 2CIKB 4PJ7B 3BE1H 1XAUA 2Z31A 1A7NL 1HYSD 4X6FB 1P1ZB 3B2UD 3X3GH 5J3HD 4GBXB 2X4PA 5FK9B 2AK4A 2FB4L 3DVNB 3ZE0F 2ORBH 5T33L 4XAWL 4KKNA 1KBGL 3DMMA 4LAQH 5GRJL 1EGJH 4BH7B 2DWEA 4OCSL 4N0YH 4JQIL 3KS0H 3WS3A 4BUHA 3DROA 4XP5L 4Y16B 5D2NC 1TPXC 4KXZI 5EU6E 3STBA 3QH3B 4QRPB 5IHBA 3F7RA 4N90E 3HE6D 4DVBB 4OFDA 5EO1A 1NCAH 4NHCL 3KYKH 3VE0B 5HDQL 3T65B 3MOAL 2ATPB 2XPGA 1QRNE 1YC7A 4PPTA 5EZJA 2AJYL 1L4IA 4RGOH 1MJJB 2FJFA 3C2AH 5EB9A 2CRMA 2OZ4L 3MLXL 2Y7QB 3O81A 4AMKL 4JFYA 4P5KB 4FP8L 2HG5A 3V6OE 3PHQB 2HVJA 4XPHH 4D9QE 3E3QC 3RVUC 3KYMB 1MCHA 2B4CH 3OJDA 1RZKL 3ARTA 5I1CL 4PJDA 1CFQA 1K3ZA 5BV7B 3RFZC 3DTXA 3KVQA 4IRJA 5CILH 1C7TA 2UY6A 1OAYH 1HYSC 5DI8A 5J3HC 4H25B 3INUH 4XH2A 1RZ7L 3QG6B 3PDOA 1JK8B 5FYJE 2R4SL 3VFGH 2YR3A 1ZAGA 2M26A 1CF8H 3RWFB 4PGEA 1A6PA 1WEJL 2VJXA 2BRRL 4Y19A 4HUXA 1LD9A 5FM8A 4P23D 3WIFA 1EEYB 1NH6A 5JDJA 1JZ8A 1DE4B 5E94B 1DQJB 3OZ9L 3EUUA 2WBKA 2MCG1 4XP1L 3GSNA 3DV6A 3FTGA 4NGHL 1EO8H 3MV8B 3V52H 1LO0L 4XXDB 3OJVC 4YDKL 3BKCL 1CE1L 4HUWA 4GRMB 1HXYB 1NBVH 5MENB 2YKLH 5DJ6A 4XBPB 2X44D 3WEXB 4PJHA 4U2YA 4V2BA 2V2XA 4R7NA 2F8XC 4WIQA 1A6VH 5CBEB 5GS0D 1K2DA 4HZLA 1YYLH 3VXRB 5ISZD 4QOKB 1QSZA 3UTPE 4Z7WA 1QSEB 1CBVH 5F8RC 1ZT1B 5C0CD 1FO0L 1QLFA 3O3EA 1XF1A 1L8JA 1LE5A 4HWEL 1G7HA 4JPWH 4ORGA 3QUYA 4NQEB 2ITCB 3PWUA 4O2CA 2R2HA 3MLTA 3TNMA 4PJFF 3ZZ1A 4N1HB 5EIIA 1T4KA 5B3JE 5C0IA 4NFBA 3SCMB 1R0AL 4JFEE 3CLEH 1SM3L 2YD8A 4DEPC 5H8DA 3DPBA 4PJ5D 5CEXA 2I24N 4TSCH 1DANU 2IFFL 5D1ZA 2Q8AL 1A1OB 4FHBD 3H7BA 4OQTL 1KLFA 4KKLC 1OB1A 2OZ4A 1JRHL 5IJKA 3L3DA 3RGHA 4FQ1H 4MQ7B 2ADJB 4KTEH 4QRRB 2ZUTA 2V5SA 3O11B 4X0KA 4LDEB 4R90H 3V0WL 2SEBB 4EBQL 4HV8A 1YMMA 3MOBH 5HYIA 3CSBA 1YQ2A 1O7SA 1P5UA 4J3WA 1CDCA 4EUPH 4KTYA 5DMYA 4P0DA 1OSPH 1I1YB 1RIUL 2EDNA 5EBWB 1MCPL 4R0LB 1AHWA 5B38A 1WWAX 1P7QA 5HHME 2HFTA 3ARSA 3RNKA 1HZHL 3TLRA 1S9YB 5CEZE 2B1HH 4RAVB 5CZXD 5ICXB 3DSNA 5IMLA 5IIEB 5JXED 3IJYB 1T1XB 1A6TB 5EC1B 5CKAA 4YO0A 5JZ7C 1YJDC 2NYYD 2UY7A 1JHKH 2DMCA 2VXUH 4NQDD 6FABL 3MLUL 2NY7H 1KIQA 5J56B 2HVKB 1H0DA 4LDOB 2YK1L 3HMXL 3OKMB 5KG9A 4PR5A 4TPRH 2YN3A 1J8HA 3M8OL 5DZNA 1I7TA 2FL5A 4PB0L 3IDXL 3ULVL 4LCIH 3V6ZA 3ZT6A 2APXA 2M2DA 1F4WH 1GGTA 2VH5H 4NZDA 4HK3N 1HILB 5DK2B 5TDPB 5EBGA 4HQQH 3QUZB 2P8PB 3MNWA 4NCC2 5EWIH 3SKNA 5J9PB 4QHNA 4NUJA 5EBLA 5HHOE 2Z92A 5JORB 3EOAA 4LPVA 1HHKA 3NGBB 1FAIH 1D9KA 2AEQH 1CL7H 3MRFA 3MRQB 2DTSA 2YPVH 3OR7A 1YEKH 1L9MA 2D7MA 1HEZA 1DQQB 4QY8A 2NXYC 3CFEA 1EERB 3PQYE 1MVUB 2DI9A 4S1QL 3ARBA 3AM8C 4MNQE 3OGCB 2DDQL 3TO4D 4ZFFA 5JW3H 4ZFZB 1FO0A 4N9OB 4TNVF 1ZGLB 4CUCA 2LV4A 3C6LA 3QDGD 3RVXC 1SJVA 1GL4B 5DD3L 3CFDA 1FYTE 3HI5H 2VIRA 4H88H 3HE7A 5JXEC 3FFCA 3FONB 1IQWL 4XVTL 2CRYA 2R0LL 2P43B 3LPWA 1ZHKB 4P2OD 4O2FB 5C3TA 4I0KA 4JPVL 4M7JH 5DHVH 1FNGA 2DKUA 3FO9A 4QO1A 4RRPG 4LPWA 1TNMA 1IJ9A 5IQ9B 3UTTB 1DBBL 1LEIA 4OZFB 2B1AH 2MCPL 4WWKB 1K8IA 2QADC 2FX8L 1U8LA 1QFOA 3I6LE 5AG9A 4OQTA 4AENA 5B8CC 2XWBA 4OV6F 5ITFA 1U8MA 5F71A 4OLXL 3PGDB 4BZ2H 1QHOA 1GGUA 2NY0D 4D94A 4PJGB 5EOQH 1ZLWH 4AEFA 2YEZB 3NCEB 5D6DC 4Q9RL 1T66D 1JNNL 3K8LA 3QEGH 4OBRA 2PXYA 4PJ7F 4RGNB 4LCCC 4PG2A 3GUTA 4NN7B 3NCFB 5I17A 2WWKT 3UYOD