3GSRA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-m5v peptide variant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsrA01
4OLZL 1RSFA 4GXUN 2OS7A 5F8QC 3ULSA 3WXWL 4MNQA 4BH8A 3NFNA 5J6HB 4BH7A 4OLEA 3RWHA 5HI5C 1XIWB 1XR9B 2J8HA 2XWJB 5DK2B 1A7RL 2N56A 1HNGA 5A43C 2GTWA 3DBXB 1CE6B 3FFDB 4H25B 1G7MB 4ZDHB 1QBLH 4LBEB 4PR5A 5FYKE 1V7NL 4I0PA 3FCTB 4ORZC 1JPFA 4ZQKB 3PGCA 3SDYH 4MQ7B 4NCDA 2N4IA 2I07A 3BGFB 5FM5O 3CVHB 1VFUA 2BERA 4G6FB 1G1CA 4HXAH 3WCYA 5IROA 5SWZA 4MWFB 3V7AG 1DE4B 3NACL 3RWIB 3S5LB 1SHMA 3MJ9L 2E7LC 3VG9C 4OUOA 3LDBB 3MGTA 1OT1A 4WCYH 2BSTA 4YHKL 3WEXB 4ZFFA 4GXVH 1FH5L 2XFXA 1TVHA 2WMPA 4AENA 1ZANL 1QR4A 3VXPA 4HZAA 5ISZB 5CEXA 1Q9LA 1MAMH 4NDMB 3V4VL 4V3EB 4HCRL 4M62H 1Q72H 1A6TA 2WBJB 4JM4H 3REVB 4BZ2L 5I1AB 5C0AD 3BIAX 1G7JA 4N5UA 3MV9A 3MCKB 4FXLA 4QXTA 4LF3B 4MNGA 4ODXB 1E4KA 1S9XB 3CSBA 1I1AC 4WI2A 7FABH 4LEXH 1P4IL 5E9DD 4DGVH 3B5HA 1Q0YH 5IHUH 1QLFA 1IGJA 2D7TH 1LHZA 1FAIL 1H3PH 4NZUL 4RGNB 4KJPC 3HC3H 5C08D 2PTUA 1T2QH 1C5BH 3K1DA 4ZO8A 4RA3A 2NTFA 1KCSH 1Q1JL 3HG1A 4YGVA 3VXMD 1N5AA 5E5RB 1IGCH 2HLAB 4S1DD 3VFWA 5ESVA 2HVJB 1MWAA 3CCHA 1XCTB 3MBEC 4J1UB 1KPRB 4ELKA 5DQ9A 2GJ6A 1NUDA 4OZ4B 4TVPL 5CUSL 2CIKB 1MCOL 2DQCH 3TYFB 1JGVL 4QWWC 3RTQC 3N9GH 1ES0B 2IMNA 4CADA 2QBWA 1JI1A 3VRJA 5I74B 5F7HA 4YHIA 3BPCA 2CR6A 5T1LA 2MKWA 5E2JA 4RFEA 4TNWF 3MZGB 2EDFA 2OSLB 1T1YA 3ZDXE 2D7OA 3N50A 5DHYB 5JQ6L 1RUQH 3TNNB 1E27A 4XX1E 1QR1B 3SOBH 5HGHA 4LSTL 3WE6A 3O6MH 4MQXC 2IBGA 3Q1SH 4X98B 5I0ZA 4GT7A 3B9KD 4L4VA 1ZHNB 3L1OL 1LE5B 2VDKH 1PY9A 3MLZL 3LKSA 3B8YA 4KK6D 4OQTA 1WAAF 3OJDB 1AI1H 2NZIA 2QHRL 1IQWH 3B2UC 3BZEA 5IBLD 3DVIA 2JB6A 2Y72A 5DEGB 1OOAA 1MHHA 4KMTL 4WEMB 3WFHA 5B4MD 2IPTL 2V9QA 3EO1B 1H0DA 3LEVH 3BSZH 1LO4L 3DI2B 3RVUC 3QQNA 5I30H 1XF3A 1BX2B 2Z31A 4GAJL 1JGUH 1HILB 2DTSA 4PS4L 5IMMA 4WI3A 5MEOB 2P24B 2Z4QB 2JJSC 5GS0L 1RIHL 4LARL 4MHHI 1F58H 2G5RA 5T3ZD 1FVCA 4NKDA 3S7GA 4PJHF 1V3MA 4YC2B 2ZCKH 3ARYA 4HUWB 3SJVA 3A6BH 3Q48A 3OF6A 2IEPA 4APQC 4ODHL 3BKJL 4YLQT 4PJIF 1CICC 5D2NE 1ODAA 2VDPH 2D7NA 1HSBB 3DUSA 1UKSA 5J4MA 4DZBB 4LVEA 4JM2F 4KU1A 4J2XA 5KTEH 4YFLI 3GHBL 3VJ6A 4F7EA 2IJ0C 1MHCB 4U3XA 1NDGA 3QDJB 4JFHE 3GSVA 4JHZA 5D7KD 5C2UB 4FQLL 2KKQA 3GJFH 4N8CH 4GKNA 4K3DH 3VFNA 3C8KB 3VGHA 1A7QL 4M7ZC 3T77B 4JPKL 1QFOA 1CGTA 1WISA 5GGTL 2ZUXA 1CL7H 4OZIA 3MNWA 2YPKB 4WEUD 3PXJA 1WT5A 3ALPA 3MA9H 3U4EB 2R2BB 1DBMH 5FYKH 5D1QD 1UCBH 1IQDA 1J86A 1KIPB 4HWZA 1XMWA 3PWVA 3VWJB 1Z9SA 1NCTA 1TITA 1OAXL 3BMVA 2VR4A 5CMAA 1E4XL 3LOWA 3C2AH 2AXJA 2AEWA 3VFSA 3BAEH 5IOPA 1EFXB 1U3JA 2ADJA 5CEZL 3QUKA 5DD6B 1T0PB 1BFSA 1IEAB 4N0YL 4PJ9C 3RUGE 2KDGA 5EUOB 4B0MM 5T1DL 4H26B 1A6AB 3SDAA 4WFGD 4YQXL 4MAUL 1X5GA 3AGVA 4H0IA 3X12B 5I1HH 3MUGA 4TQEL 5FYLE 3QDMD 1EBPA 3WN5C 1T5WB 4PJEF 2DDQH 2IFGA 1JWSB 5FAAA 4U3HA 3X17A 2BJMH 4JZJA 2QQQA 4QXWA 1OY3B 2BHYA 5B8CB 2YD4A 4LCUA 4QRTA 2Z92A 5H35B 5HI5D 4NQDD 2AK1L 1GGCL 3BZFB 3OJ2C 4P9HL 3UAJC 3I3DA 3K8KA 2BSSA 2HKFL 3IF1A 4I0PB 5D71L 3L3GA 1RI8A 5EBWA 4QEGA 1HYRC 3W9DB 3WHE1 1FSKC 3PE9A 4R97B 1OAQH 3DIFB 4R7DA 3R0NA 2ED7A 4N0RA 4S0SD 2OZ4H 3H9HA 2X41A 4DCQB 4HUMB 4BQBA 3ZT5A 4MB3A 1MOEA 2ZJSH 3FT4B 1TVHB 5D2NC 2AK4B 3GI8H 5CEXB 3QNYA 1M7IA 1Q9LB 3E2HC 4JHAH 4Z95H 3MRRA 4Y2OA 1OCWH 1ZV5A 1QZ1A 3A67H 5GGUB 2R1WB 1MHEA 1D5XB 3V7MA 1YECL 5DI8A 4CVWA 3V0WH 1J11A 4HUNB 2ARWA 2YN5A 3PQYE 1NC2B 1EH9A 1RZKL 3FQRA 1B4JH 2O5XL 1U8HB 1YJDC 2JK5A 3DURA 5MENB 2VABA 1I7ZB 2V2WA 3P4NB 4JDVB 2MMXA 4X4ME 5ALBH 4WHTA 5ID1A 1I1AD 4YBHA 3ULUF 4ETQA 3L3JA 1AHWB 2UYLA 4QLRA 1JP5A 5EBMB 4NKMB 3HMWL 5C0GA 5J13B 4JVUA 1SMAA 4PYHA 4KJPD 1KXQE 1DSFL 5F3HB 2GFBB 3OWEA 3MRPA 3RIFK 2BVOB 3VFGL 3F58H 5C0EA 5E8OA 1QYGH 3EYOA 4KZDH 2AJYL 4NUGL 2VLRD 4JLRB 5GGVY 4ELKB 3MBED 4JFEB 4LSSH 3RNQA 2P5EA 3LMJH 1EJOL 2GY5A 3CZFA 3D25A 5ITFB 4XP6L 1YUHA 4LCYA 4LASH 3GIVA 5AYUH 5IMLA 5I66A 2AI0H 4QWWD 3L3KB 3RTQD 4CNIB 2NY2C 4QRUB 4RFEB 4LSQH 3GBLA 4NNXA 3SO5A 1JNNH 5HHMA 1HINH 4M43H 2EE9A 1QBLL 4POZD 1T1YB 3QXVA 3OX8B 2A77H 2GT9A 3CUPB 1HOCA 4HXAL 3UP1A 3ARDA 1T0MA 3BHBA 1ZVSB 1HNFA 3MBXH 4LCWA 1K4DB 1MCIA 4GQ9H 4L4VB 4LPCA 4U0RC 4MQXD 4UOW1 2IC2A 3LKSB 4OZHF 3UEZA 4U1LA 1K3ZA 5DVKA 4G9FA 1HKLH 4GXVL 3DSNA 1NFDE 3MC0A 3HUJF 2UZIL 1LO3H 4X6EA 4X7SH 3B2UD 2NY6B 3HRPA 1MAML 4C4KO 1F4YH 3BJLA 5DDHB 1WBYA 1JWUA 1UWGL 5T1MA 3RX5A 3PIQA 3MFFB 1FPTL 1TZGL 2ZOLA 4M62L 1Q72L 1XF3B 3OKMB 1CFNA 1AGBB 3QP3A 4JM4L 4OFYA 3TN0B 3MRHB 3SDXB 3RVUD 5HYSA 1TETH 2Y07H 2L7JA 2V2XB 1I8IB 5C6PB 5KVGH 4F7TA 7FABL 4LEXL 1WF5A 2ZUYA 4DGVL 4JZOB 3MRFB 1Q0YL 2D7TL 1QBAA 3SE3C 1H3PL 2W1NA 4APQD 5F21B 1CICD 4ZO9A 3EO0A 4H1LH 3BVNA 4ZNCD 5GISH 5IR1A 4RQQA 2C3WA 1KCSL 4DWHA 4Y89A 1Q9KA 2Z8VC 3G6JB 4ONFL 3OB8A 3QCTH 2I9LA 3CXDL 1F6AA 4Y8DC 3GSVB 2VSCA 5B22A 4LMQE 1BQSA 2XN9B 3VGDA 4GKNB 4OZGF 4N0CC 3VFNB 3GMLA 4JDZA 4Z8FL 2X4PA 4R3SB 2NY1C 1H3GA 1UKTA 3FQTA 3MNWB 3CJJA 2IADA 3QNZB 4PJ8B 3GSRB 4YWGH 5HY9B 3HC0B 1J87A 3N0PB 3N9GL 3U1SH 2NY7H 1VADA 3O3EB 4TNVF 4FTVB 2CRZA 3MRBA 5CP3A 3DNKA 3PWVB 2BRRH 3AREA 4M6OH 2AXFA 4NFDA 3W81A 4QTHA 4K94H 2ATKB 2I5YH 3THML 2PO6A 3FN0H 1CF8H 3IDXH 4ZODA 2ADJB 1EJ6A 3GO1H 4W68A 3OMZA 3QI9C 3LKQB 1AP2A 3MV7A 2VDOH 2X4OA 3C5SB 2WWMC 4MAYA 3SOBL 3O6ML 1P5VA 3PWJB 3Q1SL 3I6GB 3MUZ1 3O4LB 4PJ9D 1S7WB 1M71A 3T65B 4U6TA 4DFIA 1F13A 4PRNB 5EOTB 2VDKL 2AXGB 4JFOA 3WFEL 1X5JA 1CI5A 1AI1L 2VR5A 3CFBA 1FZOA 2V7HB 4TN9A 5D1XC 4XGZA 3CSYB 3D85D 1IQWL 2VNCA 3QQ4A 5F97E 4R96B 4IDJH 4OZGE 2UVEA 1HHGA 1HCVA 3L5IA 4TSAL 3HI5L 4OFVA 3LQAC 4KGJA 1U91A 3F12A 4LCCC 5C92A 5I30L 3IF1B 3UAJD 1JGUL 3WXVH 3JWDC 1VGKA 3ZKMC 1F58L 4TSBH 1U8PA 1WZMA 5HHPA 1PKQB 2D0GA 3A6BL 5FM4A 2XI9A 3H9HB 2A6DB 5J11C 4KXZH 1I3GH 1U9KA 2XKUA 2VDPL 4Y16A 2WUCH 3SKOB 3NTCH 1O5DT 4HGWA 4DW2H 4D0DB 3TBSA 4NJ9H 4NQXA 3UTSE 3SKJH 3DROB 4XCCH 4XVTH 4Z7OF 2EYRA 4PJBF 3HKFA 4HAGA 4NO3B 3T0XA 2P45B 3D87B 4N8CL 4OLYL 5KG9B 1HHKA 3NCYS 4K3DL 3SGJC 1B4RA 1CDJA 2FH8A 3MJ8B 4QT5A 3V7AE 1CL7L 2V6HA 4JFHD 2DOCA 1CXHA 4NKOA 4M1CC 3QYCA 4YR6B 2VABB 4PP2A 3RHWK 3MA9L 1MJJA 1DBML 4ETQB 4LNRB 4U7KA 3VA6A 5M7QA 3ULUH 3O3UN 5C0GB 3BE1H 3ERYA 3C2AL 5AZEH 1FNEA 4UU9B 4WWKA 1DQJB 3DRQA 5CILH 5BS0E 3BAEL 2E27H 2EEDA 3MRPB 4XZUB 3F6LA 3OBAA 6FABH 4Y5VC 5EULV 5DTFB 5E8OB 4JFFE 3CFCH 1IGFH 2NY3B 1JTPA 2APBA 5I8EB 5FV1L 5L8LB 3BPOB 5I1HL 1VKXB 5EN2A 1GZQA 2NX5E 4JQVC 3T2OA 3TPUE 1AGDB 1LEKB 2DDQL 1YUHB 4CW1A 1DDHA 5MEQA 43CAB 2BJML 4MJ6A 5MERA 2HJKA 2KQNA 3I02A 4YDJA 5EUKA 5FUCE 3KLHD 2DKMA 1N5YH 2IQ9L 5IKCA 5FYLD 1FFNB 4GW1B 5JHDE 2NY2D 4RNRB 2GEEA 3EYSL 1YN6B 3FB8A 4P99A 2OJEA 4IDLA 4Y2DA 1S8DA 5D7LE 4CRPA 1Y0LA 5HXMA 3DLQR 1HI6B 4CMMB 1JYVA 1OAQL 1RZ7H 3UTPD 5DJAA 1QA9B 1OGAE 3SGDH 2J8UE 2MTPA 3MRLB 4NKIH 1E6OH 4IOIB 4ZUTB 3QDGE 3KXFA 1OQXA 3MLYH 5HHOA 3M17B 4Z7NE 3H6JA 2ZJSL 1KPUB 5DJ2A 5AD0A 4MDJB 3TO4C 3GI8L 1T89C 3WIHA 1I1YA 4LDEB 3IYLW 4JHAL 4Z95L 1FVDB 3FB6B 5IBTH 1OCWL 2UVFA 3A67L 2VXVL 4PJDE 2OX5A 4NSKA 5EPMB 5B38G 5FB8B 2LFGA 2P5WE 3V0WL 3PL6D 4AIZA 4L5FH 2VXSL 1JGEA 2DQEL 1YMMB 2R9HC 2LVCA 3LKNB 2DQFB 1A0QH 5ALBL 3DMMC 5BZDB 3O2VH 1X4YA 3PQYD 2H32A 1ZA3A 3PV7A 1ZT1B 4HMDA 3MV8E 4YFDB 4M6NL 5F7EH 3EO0B 1CGSH 3BVNB 2DWEB 2XTJB 2OP4H 1JF5A 5BJTA 1Z3GH 4QHUA 1YPZB 5C8JA 3DVNA 1Q9KB 3CSPA 5GS1A 3UPRA 3CX5K 3F58L 3IXAA 2BCKA 2O5ZH 3I75A 2H8PB 4G42A 3BKYL 1BF8A 1I8LC 1N6UA 2XZAL 4JQXC 4E0RA 3PGDB 3P77B 3HHRB 5J1AA 4N0CD 4PJGB 3GGWA 3EGSA 5DD0H 3OZ9H 1SY6H 2NY1D 1U36A 1BFOA 4MA7H 1CDCA 3CC5A 5AYUL 5DEFB 1UM5L 2X4UB 2AI0L 4PYGA 1FORH 2GJJA 2PUQT 4MA3B 3MRBB 4BUGA 1XF1A 4WTZA 3PWPD 4X80H 2J5LC 4LSQL 4PJCF 1JNNL 4HX1A 3MRDB 2F15A 4X4YB 3RZCC 4Y4FC 1BAFL 2A77L 2XY1A 3QI9D 2V9RA 4GRLC 2B5IB 4KHXL 2AJUH 1M71B 2BOCA 4GQ9L 2WWMD 1NCWL 4OZFG 1TJHH 4Z7WA 4JFOB 4YHNB 1OD7A 3RL1B 3HAEG 1FZOB 3VH8A 2OI9C 1HKLL 3E0GA 4IS6B 4WEBH 5INCB 4HPOL 4YFLF 5D1XD 1J10A 3NFSH 1HHGB 1NC4A 5LGJA 3DX8B 1FZJA 1KLGB 3FJTA 3OHXA 1HN1A 1NGZA 1F4YL 1U91B 3F12B 2BNQE 1S3KH 3MV11 4J23A 1MCPH 4F7MB 5JLZA 3O9WC 1OB1A 1TETL 2DS4A 2Y07L 3I2CH 4JAMA 4R7NA 2VLKA 1N2RA 2FYYA 5HHPB 4EUPG 1MJ7H 2DLFH 5D7IA 5F71A 3ZKMD 4M8QA 3F7RA 5IHBA 4JY6A 5ETUA 5BRZE 4P23D 1FG2A 1XGUA 3BPNC 5DS8A 3K7UA 4HGWB 4Y5XC 3KS0H 1OSZA 3GDBA 3BUTA 4IMKA 1QRND 5IWLC 4FNLL 5GISL 3BO8B 2ORBL 4YNYB 2YRPA 3MO1A 3W2DH 4V3DB 4P9HC 2MCPH 4Q0XH 3IDIB 1B0GB 3ISWA 1X9QA 4GLRH 2ICES 2VDNH 1H5BA 4G59A 4JFYA 2HT2C 5D6DC 2EDRA 1RJZA 3SCMC 4YWGL 3BXNB 3L5WA 1OF2A 4PRBB 3O3AB 4UV7H 5DJ6B 4XP4H 1M7DA 1D5MA 3U1SL 1GGUA 2NY7L 2VO5A 2P8PA 4ODUA 2YPLE 4KTEH 4M1CD 2F9BT 2NR6C 1CXFA 2ATPA 2WM0A 2A6IA 4ZSOE 4M6OL 4Z9KB 2OL3L 3MR9A 4P3DB 1D5BA 1K9TA 3KHOA 1ZLSH 1YQ2A 5E6IB 2I5YL 4Q6YA 2GSGA 4N5EC 1U8MB 4YX2L 3D2UD 1G7PB 1CF8L 5F96H 4U7SA 2ITDA 4KKBC 3GO1L 1MNUH 1K4CA 5D2LA 2VDOL 5C0AA 2X40A 2JCCF 3BN9D 2NZ9C 3SKMA 4PG9A 1CYGA 4J7RA 2VE6A 3ZTNH 1T4KB 1RZKC 5E9DA 4WUKH 2R39A 4U1KA 43C9A 1MFNA 3WFDH 5K9OB 1LWRA 4QY8B 3F65A 3G04A 4KRNA 1YNLH 5MEQB 5CHNA 1A3LH 2VXQH 4MMZC 5C08A 2P43B 2HJKB 4IDJL 2FR4A 2IALB 3G6AA 3MXWH 4JKMA 4YXLL 3VXMA 1VFMA 2P8MA 3LHPH 1BLNA 4XVSH 4L4TD 3MZTA 4RFOL 2DKSA 3WXVL 4PRHE 3MRMA 1S7UA 2HJFB 4TSBL 2RGSA 2GI7A 4F9PC 3PWNB 4NC0B 4X9FA 5IM7B 1I3UA 3QUZD 1YEGH 1U3HD 1I3GL 1FC1A 3IU4L 4TVPD 2ZOKA 5DURD 3NA9H 4DW2L 3V5DB 4ONGH 5AD0B 4IIQB 3KLAA 4NJ9L 5SX4I 4BZYA 4XCNA 3QEQE 3IETA 1KXVC 3SGEI 2QSCH 3SKJL 4XVTL 1F5WA 3TO4D 5CIPA 3FFCE 3EDDA 1AJ7L 1AXTL 2XA3A 2NXYC 3MRJA 3UTSD 3UPAA 1JFQH 3MRQB 4CL7A 1I7UB 3B9KA 4PJXF 1T1WB 1R5WB 3KPQA 1H3TA 2A6KA 5E8NA 3PHQB 1DQMH 5C09E 3U79A 4EI5C 1OGTA 1K8DA 2YK1H 2R9HD 2FJHA 4QRQB 2H32B 5GHWL 4O58H 3SDDC 4XPBH 1A4KB 3DMMD 3ULUL 3BE1L 1IM9B 2CDFA 3GKZA 1N7ML 3LN5A 5AZEL 3DVNB 4GG6E 5GS1B 2E27L 2PW2A 6FABL 4XRCB 2WUBH 2BCKB 2B1AH 1IGFL 3AAZB 3O6LL 1GIGL 2OTUB 4N9GA 1GRWA 5HD8C 5EBGA 5JW4N 1A3RH 5ICXA 1TDQA 1VENA 1A1OB 4X9IA 4AMKH 1U3YA 4LAJH 5BS0D 3HZYA 2XWTA 4IRJC 4I48A 1EAPB 5C0JA 2RB8A 4JFFD 5I73B 1G6RB 4G80B 2J6EH 4Q97A 4YHPA 1HQ4B 3CC5B 1F6FB 5HPMA 5F88A 4MJIE 2CDEB 4MLSA 3TF7A 3ZYZA 5E94A 4PLNC 3GFUA 4H88H 2NX5D 2F19L 4BSVB 3QWOA 1I4FB 4OI7A 1KCRL 2FBJH 3EDEA 4N0UB 5F3BB 1CBVL 4ZUWA 3F7YA 1XGPA 5A2FA 3HLAB 1QNZL 2ADIA 2E9WA 3PDOA 1PZUB 3Q6FA 3NN8A 5JHDD 1VACA 2D31A 1RZ7L 1UH2A 4Y4FD 3V6ZB 1T66C 4U1MB 4ELME 1QLRB 2Q7NA 1E6OL 1J5OH 3WSQH 3C08L 2GJZB 3L9RB 4DZ8B 3C60C 3MLYL 4QTIH 3VGAB 1MQKH 3SE4A 4Z7VE 2HFEA 3WNOA 4RMSA 1KFAH 4DN3H 2CR3A 3IRPX 4AQ1B 2DJSA 1DN0A 5ERWB 1I9RL 3C5ZB 5IBTL 2FX8H 1NGZB 5JW4M 5J7CC 5FEBA 3DV6B 2GITA 5JLZB 4YEEA 4M61A 1CXKA 1AO7E 1BQUA 1ORQB 3N06B 5CEZD 2QR0B 4L5FL 3RU8H 4FQ1H 2VLKB 4LSRL 4NN6C 3O9WD 5AAWA 3QDMA 2AVGA 2BVEA 1OTUC 1A0QL 4PG2C 5EBLA 2LAGB 2BZDA 2P5WD 1CDGA 3O2VL 2QTEA 4NO0D 3I3BA 4ZTOH 1PLGH 5F7EL 1JPGA 1CGSL 2BDNL 4PLOB 5KSBB 1SEBB 2OP4L 1OT2A 4NQDA 3HR5A 3OKYA 3RVTC 1NGQH 3GSNH 3LS5L 5C7XH 1CVRA 2X70A 4OCSH 2FEEI 4WV1C 4ZXBB 1RHHA 1T6VN 2O5ZL 2YS4A 32C2B 4FFZH 3DO7A 3MV8D 4XPTH 1JTTA 1F42A 1T1XA 4EBQL 4LP4A 2AQ3A 4MXQC 3VFOA 4WW1A 2OJZH 3DGGA 2SEBB 2E6PA 5L2KE 1RJZB 4KRLB 3QXUA 4DUVA 3L6FA 4MSWA 1S7SB 3OZ9L 4K07A 1G6VK 3EOAB 4ZOAA 3SCMD 4MA7L 1YA5A 3E6HA 3NVQA 5J6GB 4K9EC 1FORL 2E7LA 3BIKB 3QBTB 4Q7DA 3UTQA 1SEQH 1MI5E 2D7PA 1MFDH 4GW4B 4NNPL 5IMKB 3TH3T 2F5AH 1IAOA 2NR6D 1IL1B 4Z7UF 1PX3A 3SDCB 1A9BA 4OT1H 1SYSA 1AKJB 1BBDH 4N5ED 2FECI 4MS8C 5F6IC 4U49A 1MEXL 4KKBD 4CMHC 3QUMA 1HHIA 2AJUL 3UBXG 2NZ9D 1TJHL 2VXTH 5IQ9B 1S9WB 3EZJB 2P8LA 4UB0H 3WV0A 3BP7B 2Q8BL 3VDCA 4D3CL 1I1AA 2FIKA 3WLBA 1C7TA 1KJ2L 2VC2H 3IJSA 4FQQA 5C08B 3NFSL 1Q38A 5F7MC 1JHKH 1NBYA 4UQ3A 2M2DA 1MCWM 3F8UB 3S3JA 4P5MA 1NAKH 3BQUC 5F6HJ 4MD4B 4Y4HC 2C3VB 1N59B 5JO5A 3SQBA 3DTXB 1MCPL 5FGCB 2VLRA 3G5YA 3MRMB 3MBEA 1S7UB 4X6DA 2J4WH 4MDIA 1C5CL 4FRWA 2GQHA 3EKCA 1U58A 5GGRB 2CMRH 3VXRE 3NCCB 1JF6A 3NZ8B 1CLYH 1QSZA 2PYED 3AMLA 3RTQA 5F72S 3QPQC 3SKNB 1WCBB 3VFTA 3W2DL 1CGVA 5BRZD 3HS0A 2GK2A 3FN3A 5EU6E 4FZ8L 4WUUB 3HCVB 3GSUB 2MCPL 4Q0XL 4HKXA 4LLQB 3DVGA 1WCQA 5J56B 5SX5K 2VDNL 3VFMA 4KI5E 2NXYD 1LD9B 4X83A 3PWUB 3V8CA 1FYHB 3C6SB 4HIIA 4QOKD 5F6HI 4XP4L 4KTEL 5DYOA 5BZWB 5IW1B 2ICWB 1UXWB 4UTBL 1DEEB 4KGLA 4R4BA 2FGWH 4EI5D 4M5ZH 4XWOC 2DI8A 3GMPB 2IPKB 5AEAA 4O9HH 4XNUL 4C54A 5K9KA 2FX9H 2CDFB 3OL2A 2X09A 3SDDD 1CWVA 4LHJB 5D96C 2F74A 2WIIA 2YPLD 2PW2B 1UA6H 4ZD3H 1U8IA 2VAAA 1ITCA 3VFPB 1MNUL 1BGXH 1TPXC 3ARBB 3WDIA 4K7FA 5LKNA 3D5OF 2CKBL 5E08L 1HZHL 2JJSA 3WUWA 4WUKL 3WIFB 4X8XA 2VR9A 5ITBL 1WSST 1Z0MA 5F9WC 4IRJD 3WFDL 2ITCA 1KIUA 5E00A 4YHPB 1YNLL 4APQA 1G9NH 1CICA 4Z77B 2VXQL 2J12B 3JWNC 4ENEC 3QIUC 1KLUB 4LOUC 5HYSG 3WUZA 1EXUB 2R4RH 5KAQG 3E6FA 3WL9B 3VRLF 2I26N 2Y1VA 1TVBB 4XVSL 3VD4A 1JVKA 4PY7B 1XGPB 1NEZB 1FYTE 5TDNA 1KC5H 3H9SB 2H1PH 3KYOB 2VITB 3S96A 3NCMA 3L3DB 2D31B 2BFVL 3BH8B 1ZGLM 4NJAH 4X6BA 1YEGL 1MY5A 5E24E 1A47A 1T66D 1IC7L 4KC3B 1YYMH 1J05A 1BVLB 2C5DC 1G0XA 3NA9L 3MLXL 3IVKB 4ONGL 3C60D 4QNPF 2CO6B 2Z35A 3TBVB 3OPZH 3GSXA 4OI8A 2QSCL 5FHAL 5K59F 5J3HC 3TEUA 4X7DC 4U2YA 5BV7H 5KN5B 5EC2A 3NIFE 1ADQA 4XT1C 3PV6B 1AQDB 4X5XB 5EUOF 4ZAKC 3QEQD 2Q86B 3QZWA 2GITB 1CTOA 1HKFA 1LK2A 3GI9L 4JO2H 4PJ9A 1NUFA 4QO1A 5DRWA 3FFCD 2AABH 4JRXB 4KI5C 3QQ3B 1DQML 3H7LA 4HS3A 1C1EL 5KS9A 3D85A 4U7MA 5J1SC 2YK1L 4OGXL 3WN5A 1OTUD 3TH4T 5HYQA 4XPBL 2J8OA 3Q6GH 4P4KC 1Z0NA 4AEFA 4M1DH 3REWB 3MGAA 1OM3H 2BOBB 5C09D 1EHNA 3TGXA 4KK5C 1IM3A 1FJ1A 5KSVA 1E4WL 4BSWB 3U0PA 3HC4H 4AQOA 3PP3H 1I9JH 1YN7B 3RVTD 3KPOB 5B3JF 4XPFL 4PB9H 5B39B 1HHHA 1T1XB 2UWEB 1A3RL 4QNPE 4AMKL 3D39B 3WFZA 5HYJD 5J0BA 4QRSA 3DGGB 1PW3A 5K59E 4FFYL 4MXQD 4Q74A 3MA7A 5JORA 5CD3B 5DGQA 5JIKA 3LKPB 3GB7A 3ILPA 1AD0A 3L6FB 3RA7H 1NLDH 5AUMB 2J6EL 4WJ5B 1PDKA 4HIJB 5FF6A 1GHFH 5I1JL 1INQA 3CAFA 3DXAE 3UTQB 3U46A 5E99H 2NY5C 4H88L 1HQRB 1KEGH 4JFDE 4IRZH 1LVEA 5D2NA 1RUPH 3BDYH 3P73A 3JTSA 5E56A 4N90E 3FOLA 3RWFB 2FBJL 3E2HA 4MNQE 4JM2C 3MRNB 5DJCB 3WNKA 5CGMA 5FECB 2X4RB 4MJID 2WSKA 1OPGH 4Z5RA 1TMCB 5IVXA 2C1PA 4I13B 4MS8D 4ODWB 3CFJB 4JN1H 1RZ8A 5JTWA 4QGYA 3BUYA 1CXLA 1NGYA 4NPYB 3IT8D 1J5OL 3WSQL 3V9FA 5J9PA 5FOBA 2DIBA 2H2SC 5EU3A 1CGUA 5T33L 2NNAA 3LY6A 3GSQB 5B3JE 3WLBB 1Z2KA 4DN3L 3D0VA 5GZOC 3NFPA 1QQDA 5SWZE 4UQ3B 1WQVT 3O3DB 4UNVA 2DQHH 1VEOA 5JO5B 5FDWA 3O6KL 1KCUH 5FFLA 4GQPH 5IEHB 1AE6H 3NH7H 4Y4HD 5JIHA 4KK8C 4R26H 5ALCH 3RU8L 4FQ1L 2RIKA 3LS4H 5IJKC 4NRXB 3ARWA 1NGXB 4TNVK 4RZCB 1U58B 3UTZB 3RUGA 1WWCA 1QFWI 5LGHH 2E9IA 3D3VE 3STLB 4RAUA 4K23H 5JW4Q 1AO7D 1ZGLP 4WI7A 5DRNB 4ZTOL 1PLGL 4DQOH 1TCRB 3LH2H 1UZ8B 4JZNB 5I8CA 3LAFA 3VFRB 3GJFB 4GBXC 1G7HA 1JL8A 3KPSE 4ZPVB 3GSNL 5C7XL 1SMOA 1ZHKA 2AGJH 4OCSL 5IBUB 1EO7A 4HG4J 2MFNA 4AH2B 4FFZL 3QNXA 5E6ZA 3BDXA 4XPTL 4Z76A 4PDCE 5K9QI 3RWJB 4LGRB 3TBWA 4HKZB 4YDIH 5DQJA 1RZGB 3MOAH 2OJZL 3LRSA 4S1RL 4NO2A 2CLRA 4JPVH 1WWAX 1H8SA 4LKCA 1VHPA 4UAOB 3V6BR 1RK1A 1LQSR 2BC4A 1JPTH 3BQUB 4X4XA 1N8ZA 4KTYA 1J9CT 4ODTH 1MFDL 5DZOA 3LB6C 3QRGH 2F5AL 2G60L 1LDSA 5K9KB 1J18A 4PY8J 2GUOB 4XWOD 1FP5A 5F89B 4B5EA 4OT1L 1SBSH 1QO3A 1BBDL 5C1MB 4YHYB 1GAFH 3CK0H 2NY0B 3PL6A 5FGBA 1FV1A 2DQIH 4D94A 4K7FB 2VB5A 4P2OC 2FJGB 1MCJA 1KT2A 1IEBB 1LO2H 4O2CB 3ZSTA 4PTTB 4CN4A 4ISVB 2NW2A 4UB0L 3BRFA 2Q3AA 3EFFA 1WBZB 3PQYA 5FHBH 5I1EH 2VC2L 4HK0A 3U9PL 4ONOA 4FS0A 4I5BA 1IE5A 1UENA 2EYTA 3D1MC 3ULUC 4ENED 3QIUD 4LOUD 3PNWA 1NAKL 3JV4A 4WO4B 4QF1B 3JV6A 1BWMA 5L2JA 5I1CH 4HIXH 2FB4H 4HPYL 5ICYA 4NYLA 5IB3A 5L6YH 3QSKB 3VE0B 1X3DA 2J4WL 4AM0B 4N0CA 4OZIF 4JHBA 5I76A 4PY8I 4YBLB 2CMRL 3STBA 4QRRB 4X6BB 4DVRH 2IG2L 3FB5A 4FQHB 1WZ1H 2HA1A 4X99B 1NGPH 2F8VA 5FK9B 1CLYL 1J05B 5K9QG 1UH3A 3C6LC 4JANA 2IH3A 2DLEA 5I0DA 4L9LC 2NY4C 4KWUA 3PWPA 3VXRD 4CVXB 4PJ5B 1IAII 1ZLUH 3FQXA 5I8KL 4OIAA 3SJVE 3EOYG 1A7PH 2WINA 3M8OH 1SJEB 3CFKA 1UZ6E 4JN2B 4H20H 3NCYP 3DX9B 3QI9A 3QZWB 4V1DD 2HTKC 1F11A 1KTDA 5EU6D 5KSUA 4ZAKD 1FL5A 2EXYD 4M7JL 4L8DA 4QCIA 4JY4A 3BW9A 1TIUA 2VLJE 3TYGH 4JVWA 1W72L 4G8GD 1KTLA 3QFJE 2QQLH 3U9UB 1JGDA 1U8OA 1R5VB 4KI5D 1IBGL 1FAKT 5I1LB 1R5IA 2YD1A 1EZVY 5K93A 1JUFB 5D1XA 3ZHDA 2FGWL 4M5ZL 1ZAGA 4URTB 5FYJH 3QG6A 4G8IA 2DI9A 2FZ3A 3EZ8A 3FOMB 3P0VH 4O9HL 5EZIH 2FX9L 3LN9A 1XF2B 5SWQA 3BPLC 1I7TA 1DUZB 1ORSA 2EO9A 4TPRH 5DA4A 1BIHA 4JO1H 3VI3E 4UIKH 2JIXD 1WFTA 4S2SA 1KUMA 15C8H 3PJSB 1NFDA 4U1GB 4LCCA 4KK5D 3VH8G 2CLVA 2EDWA 1HSAB 1X7QA 3V5HA 3O11A 4YEFA 1U8KA 4OD1H 1EIBA 3KHQA 2VISA 5D9SA 4LPYA 3T09A 1OD9A 4LSVL 1HEZA 1J8KA 5E03A 1KIRA 2EC9T 4P23A 4PV9A 4M3JA 3B9VA 4RFNB 3EO9L 5DUBA 3B9AA 5E4EB 4BZ1H 5FF6B 5I16A 2XICA 1QRNA 4WVRA 2R4RL 3CLEH 3MLTA 3RX7A 2IF7A 3K74B 1BEYH 3NAAH 2BY0A 5DVLA 5D7JB 5SWSE 4U1JA 4WENB 3S4SA 3HPJA 4I8DA 3EJZC 1KEMH 1G0YR 5F1IA 1TZIB 3SEPA 3I85A 4JM2D 3ZKSD 5IW6A 5MI0C 2H1PL 2C1PB 4KVNH 3IDJB 4LLUB 4P2YA 2XQBH 1RZ8B 3SGJA 2VH5H 1EEYB 4I18C 4UINL 1C5DB 3WD5H 1MELA 1H3VA 5BQ7A 2ZSWB 3QEHB 1ZSDA 3L3HB 2ZSVA 5EU3B 1FDLH 1DVFC 1AR2A 4XPHH 5JOPD 1LEGA 1MFEH 4W81A 2H2SD 5A2IH 3MJ9A 1AGCB 3D0VB 5EO1B 3OPZL 3K2MC 4Z6AT 1QQDB 4XBGB 3HZKB 4R9HA 3D2UA 5GZOD 3RWDA 4RAVA 4HZLA 4D9RE 5DR5L 3DRTA 4OUUB 2GY7B 1W8OA 4OKVA 4OLXH 5FDWB 1MWAH 4Y5VA 2PR4H 3L7FB 4PJHB 4JO2L 3OKLA 4EVNB 2VIRA 3ESVF 2RAMA 1TCMA 2FX7L 2IAMB 4KK8D 4XXDA 4PJIB 3KG5A 4L3CA 3DX6A 1UQSB 2F58H 4WY7H 5EORH 4H1LB 2ZKHH 2EDLA 1RUKH 4F7CB 1BZ7B 1NDMA 3CVIH 1AY1L 5IVZA 2DLGA 3Q6GL 4YDVB 4M1DL 5TDPB 5CWSA 3GSWA 2EECA 2IGFH 2X2YA 1FBIH 2GK0A 1EMTH 4L4TA 4GBXD 5F1NA 3HC4L 3BZ4A 1I9JL 3VRIA 2FSEA 2CUMA 3X14B 5DXWA 3FO9B 4DTGH 3G08A 3GBMH 3AM8C 3V0VB 4OJFH 3TBWB 1KJ3H 1CLOL 2W65A 4TTDC 5DD5H 4KK9C 5ACLA 1BOGA 1L7TH 3CVHL 4JFQA 4GOSA 4L8SB 3QUZA 4ZYKA 2HAZA 1ED3A 4IJ3B 1U3HA 4RMWA 4KROC 3MLPA 1DBKH 1FNFA 2VWEE 3RA7L 1NLDL 1T7VA 4YZFE 4OQTH 2BY3A 3OKOA 2QKIB 2HMIC 5E99L 1KEGL 1JGLH 1U6AH 2VZOA 1RUPL 3BDYL 1T3FB 2VDRH 1T89A 3LB6D 4G7YH 4NRYA 1DLFH 5IHZB 1QO3B 1OPGL 3UTSA 3DXAD 3CDFA 4M93B 5EU5A 3IB4A 3PL6B 4JFDD 3T4YA 4HC1A 3NIGE 5EU4A 4JN1L 5DD1H 1KT2B 4N90D 4UUJB 3VWKC 4PJEB 4C58B 1GVIA 5HHME 4P2OD 1RHFA 4XNQB 5C0NC 1KB9K 3DYOA 4FG6C 2YSSA 4FQXC 1NAMA 3DMMA 3T0EB 4PRID 5SX4H 3MX0A 1T20B 3SGEH 1JFMA 3O81A 3RGVD 4M4RA 4X5WB 1EFQA 4C55A 4PJAA 4GG8B 1UADC 3PNWB 3C87A 4XCEB 1GZPA 2X4NA 3S9DB 2ADGB 1KCUL 1WZKA 1JZ6A 5AYQA 1AE6L 1CFBA 3NH7L 5L8KB 5IV2A 3U30C 3DUUA 4R26L 5ALCL 3GSOB 3WO4B 4PJFE 2AEQH 5BS0A 1I8LA 1LNUB 2Q6WA 3LS4L 5J12C 4JQXA 3NA4A 2VDLH 3TVMC 2C7UA 2NTSP 5I76B 2HN7A 4JFFA 2A6JB 3OB0H 3VXOA 1YY8A 4FABH 3S37L 2FJFA 2A74B 2X4SB 3MCLH 4K23L 3P2TA 4KUZL 1GGBH 3MPCA 4QYOB 3IFPB 1LP9E 1T83A 2YBRA 3G5ZA 2NX5A 4N0FB 2ZNWA 3C6LD 1NCDH 3D3VD 4MYWB 2B1HH 2NY4D 2AGJL 3BI9X 2WINB 2PXYC 1I8KA 4UIMA 3U83A 4D0BA 1MPAL 1NFIA 2CXKA 3SE9H 1Q9WA 5ID0A 5JHDA 3UZEA 3KPSD 1IT9H 3BJ91 4Y4FA 1KV3A 1NMBH 2X4TA 2EDNA 2QV2A 3JV5A 2HTKD 3L3IA 2A9MH 5D7LA 2IH1A 2MPAH 4HW6A 4XBPB 2E9JA 4ZPTA 5EO9A 1X4ZA 4Q9QH 3L3OA 4HHAB 1AGFA 3NZHL 1R3KB 3IJYA 1R5IB 4FFWC 2J8UA 1CQYA 2DM7A 4ODTL 5GGVH 2H9GA 1AQKL 3TCLA 1R3LB 3QDGA 3BD4A 3QFDB 1IGMH 3BMWA 1WBXA 5IJVB 1SYVB 4WFFE 5DRZB 2XQYG 1SBSL 4F33B 1OTSC 1A6PA 1GAFL 1X7QB 1NEUA 2DQIL 5IF0B 3MYZA 1T0NA 5C6TH 1ACZA 3OKDA 1LO2L 3O9WA 3KPLB 2QQKL 4PJDA 3L5JA 2W9LA 1U8QA 2AV7A 1OTTC 5JQHC 2P5WA 2BSRA 4GS7C 2WQRA 4NO0A 3CMOL 5I1EL 1YY9D 4DKFH 4GKSB 3FAXA 4G8EB 3KDMA 3MLTB 4Y5XA 1CIUA 3OXSA 3KLDA 5E8PA 4OF5A 5GRJH 4HDIB 4YXKH 2IPUK 2AJVH 5L88H 3MV8A 4HLZG 4HIXL 3H42L 2FB4L 4M03A 4L1DA 1H8OA 4OD2B 1G0DA 2A83B 3ZT7A 2F5BH 3EJZD 1MLBB 4D8PB 2MHAB 3ARUA 3QIBC 4OV6F 1BREA 1CXIA 4OZHB 1G1YA 2VUYA 2DQTH 4KRPB 1QSVA 5D6DA 4DVRL 2Y36L 4HIEA 1P4BH 1WZ1L 3SCMA 1NGPL 1DQLL 1UJ3C 4PUBH 1T22A 1PVHA 3NCFB 3VD7A 4NHCH 3HUJB 4I2XB 2CIIA 4MCYA 2HG5B 3RKDC 3OR6B 1DVFD 3VI4E 3H2WA 1AC6A 5I17B 2VZ3A 3UTTD 2DM2A 2AKRA 1A7PL 5IB4A 3QIWC 3M8OL 3QUXD 4N5EA 1WUNT 4WFHE 5C0CD 3DRTB 5D1ZC 4H20L 1UJTA 1JRHI 2AJ3B 3VU2A 1JK8A 2V2TA 4B41A 3EOTH 4FQ2H 3QISA 3TYGL 1SM3H 4XXDB 4A6YA 1KB5A 5DUMH 5F8RC 4J3OC 3CDGA 5E2TL 3VXTB 4PRPB 2QQLL 3BKCL 4JKPH 3EBAA 4LLWB 2BVPB 2EE6A 5E2WL 5IVZB 5GGSB 4WDIB 2VLJD 4MZ3A 4QHNA 2VZUA 4TUKH 5FYJL 3UJTL 3P0VL 5EZIL 5TGBA 1FIEA 3V79C 2HRLA 2RBLA 4HSQA 2H2PC 2WP3T 4YHLH 4K7PL 3RKPA 1A22B 2D9CA 1MCKA 4UIKL 5IGXH 3MXVH 4U33A 1AD9A 5LQBL 3VD3A 4OZGB 1ZOXA 15C8L 5FGSA 5KSAB 2DIJA 3DHMA 3O45B 5T1KD 4OD1L 3SGKC 4WI8A 1NLBH 4OBSA 3MMEA 4XHJC 5IESH 4TTDD 1J0HA 2R0WH 4KK9D 5H37G 1X5AA 2PYEA 3MRKB 3OGCA 4M00A 1LO5A 1S7RB 4BZ1L 4KROD 2OCFD 3A6CH 4Y1AD 1MFCH 4F2MA 5BRZA 3EHBC 5FYJU 1BEYL 4UT7H 5FO8B 3JWOH 2HMID 1N4XH 4P49A 2MWCA 4NRYB 1JF1A 1KEML 3R06A 3T4YB 4NP4H 3P4OB 2XQBL 3D0LA 4P4RA 5INDB 5SWSD 4JQIH 4QOKA 1GCFA 3LKOB 3RVWC 3BP6A 4X6FB 5FXCH 5JDSA 1XGRB 1I7RA 5FGRA 3VWKD 1FDLL 4XPHL 3MUJA 4WNQB 4FZEH 4P57A 5C0ND 1MFEL 4EI5A 4NQEB 4FG6D 4OV5B 1N0LA 4G43A 4ONHB 4FQXD 1J8HE 2DQJH 5D6CA 3D18B 2YPLA 4YDLB 5I1DA 1FFPB 3CFIC 4OCNC 5HI3C 3WNMA 4OLXL 4ZSOA 1F4AA 3CFEB 5FA3A 3NIDF 3MRGA 1RULH 2PR4L 3W39B 3DUUB 3ZHLA 4FQJH 1T21B 5TPWH 1IC4L 2K7QA 1F3JA 1FL3B 3LQZA 4OB5L 4WY7L 4JFFB 4WFEE 5EORL 1HHJA 2J7LA 4LNVA 4IRSB 5T3XE 1LE9B 1YY8B 2ZKHL 3HE7C 4IRJA 3GMOA 2V7NB 4ZUVA 5IK3B 3TVMD 1RUKL 5IIEA 3CVIL 4KQ3H 4PGZA 4W4OC 4WHYG 4JREC 5ILTH 1UH4A 2YXFA 4QHMB 3TPUB 4PJBB 1NPUA 5CP3H 1ETZB 1IGTB 2X1QA 4U3CA 3RIAF 5K33A 3S34H 1EMTL 1A7OH 4QHKJ 5DK0A 4R0LB 3MREA 4G8FB 4EN3A 3P9LB 2PXYD 1NH6A 3GBML 4OJFL 5I1GH 3NCEB 4XPAL 2HJLB 5CZKA 5BXFA 1L7TL 2EEAA 2KPNA 3QQ9D 3FMGH 4Z7WF 3PHOB 2Y5TA 3L3IB 5D7LB 3T8XB 4BFIB 4M4PA 3VMOA 1DBKL 3IDGA 4JJ5B 4O2FB 2DWDB 5DF0A 5EO9B 4P0DA 3TBYB 2QEJA 1AGFB 3C60A 1OGAB 1KSRA 2IQAA 1XF4A 4NWTH 1UWEH 2F54E 4O2EB 1NGWB 1XR8B 2Y06H 2MCG1 2WNGA 1MRFL 4RRPG 2YC1A 3QDGB 3MJ7A 4FFWD 2OBGA 2IBZY 1JGLL 1U6AL 4NQTA 4QKXB 2VDRL 4Q6IC 5EZLB 5FA4A 2O93L 3H7BA 3I3EA 3QXDB 3IFNL 3U2SA 2AV1B 8CGTA 1Y6KR 2BVYA 2Q20A 1F4WH 1Y6NR 2HKHH 1PZ5A 3O8XC 3QEQA 5ESAB 3X3GH 3WJLC 4X6CE 1T0NB 1OTSD 4FXGA 4NRZB 3FFCA 5DD1L 5MP6L 3FB7A 3OKDB 4NFBA 5EZJA 5D7IF 4Y4KC 1X5IA 2ED8A 2FWOB 1UG9A 5ICZB 2RCSH 4QHKI 1CGYA 1MHPH 1R3IL 5F9JA 3ZKXC 1OTTD 4PG2A 2BNRB 5GPRA 2X9WA 1QG3A 1LK3H 5EA0H 4NWUH 1WVZA 1S7XA 5C09A 4CN6A 5EG6C 3OXSB 3HZMA 1HWHB 3PWLB 3W0WB 4MB4A 4MGXA 1OLZA 4WV1A 4A2MA 1TTUA 2AEQL 2A9NH 4X8JA 5I9QB 4P5TA 2NW3B 4HS6A 2VDLL 4MJ5B 4MXQA 4IEFB 1YDPB 3QIBD 5IMOA 3ROLA 3QJHB 5DC0A 5E5MB 4BFGA 3O3BB 4J3WA 1T22B 1RIUL 4U1NA 1GGBL 1JHLL 2CIIB 4PLJC 1NMCC 2EIZB 3QXAA 4DKEL 2FRGP 5ISZE 1LO0H 1CFQA 1FE8H 1NCDL 3RKDD 2G75B 1G84A 2D7MA 2Z93B 2AKRB 2R2HA 3O6FC 3UJIH 4MJIA 2K3TA 1I8MA 4DVBA 3QIWD 3SE9L 4TUJA 2LV4A 4O51A 3KYKL 2OR9H 4XVUC 4HJGB 4MS8A 1CLZL 5D1ZD 3BEVA 1IT9L 4DEPC 1NMBL 4U1SA 2A9ML 4A2LA 1TJIH 3NGBC 2VN7A 4L29A 3BD3A 4Q9QL 2VKXA 3ARGC 5F7FA 4PRDA 4RGNE 1MVFA 3HN3A 5CEYA 3TA3B 4OCXH 4ELMA 1FZKB 4YPGB 3WNPA 5GGVL 2WV3A 2Z91B 3VXQA 2EH8H 1IGML 5A40E 5AG8A 4Z7VA 1FGNH 5IB2A 1IGYA 3ARFC 1P53A 3F7VB 2H2PD 4MXVE 5ANMB 3RGHA 4F37F 3MNZA 4HS8H 4DKDC 4HFUH 4I3SH 4U2ZA 2WANA 4WFFD 2BNQB 3MMEB 1UYWH 5HI4C 1ZLUK 5LAXA 3CPLA 1AO7A 4XHJD 3I9GL 3G6DH 4Y5YB 5D2LE 5C0AE 4DKFL 3R8BB 4XC1L 4CUCA 2CSPA 4HXBL 1BF2A 5JXAH 1UXSB 1XIWC 2APTA 1OW0A 5GRJL 1S5HB 2BXYA 3WIHH 1BZ9B 3LRHA 4Y19D 4KJYA 4YXKL 4BK5A 3EHBD 3QO0B 3DX7A 5L88L 4H8WH 5DA0B 4JRYB 4P48A 5T3XH 2X7LB 3B5TA 3Q5TA 1VFAA 3OAUH 2PKDA 1S9KC 2DN7A 2F5BL 5L7XL 4XMLH 4P4RB 3BGFC 2OQJB 1BMGA 2FNBA 1P4BL 2R1YB 3RWEB 1QFWH 4LKXB 1I75A 2F53D 4GAYB 1RZJH 4PREA 5HVHB 3MOQA 3MUY1 3RVWD 4XB8A 3VMPA 3FRUA 5FM8A 2XQYK 3LDBC 4JVPA 2H32H 1C12A 4QXGH 4UQ2B 1QSEB 5D6CB 3W82A 3P3YA 2YPLB 5JIIA 1YYLH 5I1DB 4GW5A 1F02I 3B6SA 4NQVA 1HDMA 2VLLA 4BFBD 1INDH 5DEZA 3EOTL 3OG4B 2WK2A 5CSGA 5HI3D 2VL4A 5FKAB 1YMHB 2WBJC 4FQ2L 2GKIA 1JTOA 1DLHB 1OWRM 1F3JB 1BBJA 5DUML 3X13B 4K71B 8FABA 2D4DA 4G9DB 3K4DA 1JZ7A 4JKPL 4P2QD 4X7EC 4NCC1 3V5KB 3KYNB 3SN6N 5EFIB 3D48R 1ONQB 1JWMB 3GSNB 3QUYB 1UFUA 4J3TA 3HE7D 4PGBA 5C0FB 4OLUL 3U36B 4TUKL 5IVNA 4LU5H 3BGMA 3G9AB 4RGNC 4CU6A 3QIUA 4E41B 3B3IA 3AU1B 3MLRH 3QDJE 4X7TB 5DK0B 4HQQL 1QSFB 3MREB 3UZQA 4EN3B 3SQOH 1A02N 4NBXB 3TBTB 2R69H 1GYAA 4NQCD 5E1HB 1NLBL 3DOSA 2BVQA 3W5NA 4P9MH 1EHLH 4GKOA 2R0WL 4QGTA 2BNUB 4DGIH 4D9LH 4PRHB 5F7DA 3DV4B 1FN4A 3UXFA 1I9EA 1RMFH 5D8JH 1H15B 4NO5B 3N85H 3A6CL 2EDBA 3I50H 1XF4B 4L8CA 1MFCL 3VXRA 4E5XA 4LEOB 2VYRE 5I74C 4G6JL 2IAND 3JWOL 1N4XL 1MH5A 3AY4C 1D6VL 1DQDL 5C9JB 2JCCB 5TQ0H 4R2GB 1A5FL 5ESQB 4V1DA 2H26B 5J06A 3HMXL 5EU6A 4ZAKA 2CLZB 3O8XD 3EW3B 3ZL4H 5GXBB 1GH7A 1HCFX 4G8GA 4N8VB 4YUEH 1QPPA 5FCSH 3KPMA 1KYOK 4ZTPH 1A1MA 5TE4H 3TIEA 4Y4KD 1WJ3A 2ZUWA 2HFGH 4FZEL 1VFBB 4QHLA 4RIRA 1D6EA 2N7BA 2Y23A 5C0BB 1VERA 3CFDA 1X4XA 3RDTB 3KPRE 3GMMA 1IAIH 4ZS7H 1DBAH 1GPOH 1MY7A 3ULVL 2X1WL 1JV5A 2H3NA 2JIXA 3HZMB 3LRGA 3IU3B 4NT6A 2EZ0C 2GHWB 4CDGC 2G9HA 1G7QA 1W0VA 1RULL 1J8HD 4GG6B 5DHXB 3GMNB 5TPWL 4GAGH 1G7IB 4P5TB 4HS6B 5B38A 1JHTB 3MACH 2EIEA 2QADB 5TDOB 5IMOB 1NSNL 2YR3A 4P2RB 4KUCD 3OKNB 2EDHA 4KQ3L 4XNMA 3MGOA 5GJSH 2QHLA 4FMKA 2AK4E 5ILTL 4JKLA 4EQ2A 5GSRA 3IFLH 4PLJD 2GSIA 1R3JA 3QDME 1A7OL 2EDOA 1KN4L 4KPHL 1ZVYA 4H5SB 1F4XH 4DVBB 4JM2A 3O6FD 4OF8A 4PJXB 1BVKA 2C1OA 5I1GL 2EIDA 5HSFA 3L95A 3ZTJH 4U1IA 4NQDE 1FNSH 3P11H 3TT3L 5DSCB 2YA0A 3FMGL 5DD3H 1NBZA 4XVUD 4YHOL 1YEDB 3BKMH 3T0WA 1DL7L 4M02A 3STZA 1J0ZA 2BXZA 3S88H 4NN7B 1C16A 1I3RA 2PW1B 2ZCHH 3LPWA 3HZVB 4ELMB 3T4AB 1B6DA 3ARGD 4EI6B 2Y06L 4B53A 1GOHA 2LAAA 3IJHA 5I2IA 2ZUUA 3VWJC 4OCWH 2OL3A 2DYPD 2F8XC 4L3EB 5HDBE 1GGYA 3ARFD 3QHTC 4JFEE 5I18L 5HTSA 2OM5A 1NCAL 3T04D 5IJKA 1UB5A 2RCSL 3MYJA 5CJOH 1ND0A 3EFDH 2JKXA 5HI4D 2C4XA 3TT1H 4BQ8A 1A14L 2YA2A 5DVNA 5EA0L 1LK3L 3QEGL 1YQVH 3HAEA 4NWUL 1P1ZA 1KGCE 2CD0A 5B8CC 3C9NB 5JR1H 3TO2A 4GBXA 2ADFH 3AXLB 3OKKB 2OR8A 1KENH 1XIWD 4ZO7A 3M45A 5CIPH 2R1XA 4YXHH 3INUH 4R8WL 3TH2T 4I0PC 1MLCB 2A9NL 4JO3H 1FRGH 1G9MH 1YEKH 4RBPH 4XWGH 2XYCA 5L0QB 1QEWA 2O61A 1GOFA 5C07B 4E9LA 2UUDK 3GHEH 4R97C 4ODSH 4LQFH 4PREB 4Z0XB 4G6FD 3CU7A 5L9DH 1TENA 5BVJB 5BV7B 4EUPA 5L2KB 4F7PA 1BJ1J 5MEPA 3FRUB 5DZNA 4X6DE 1DUYB 1LO0L 1C12B 1FE8L 3AVEA 4JG1H 3WHXA 5JNYA 3WS3B 2B2XH 3FQNB 3RZWA 1UWXH 3UJIL 3KGRA 3VG0L 3DXAA 1KPVB 4KI1A 4LLDA 1MI5B 3QXTA 3DPBA 4JFDA 4LLVB 5ISZD 4E42A 1JN6B 2OR9L 2KL6A 4PPTA 1WLHA 1BFVH 1TQCB 5T3ZH 1JYNA 4P2OA 5KOVC 4RAHA 3WDJA 1TJIL 3PABA 3F5WB 2WBJD 5TH2B 4HFWB 1Z5LA 3TFKC 3FQUA 3HNVH 5EC1A 2JELL 3K46A 4HUXA 4PRAB 4G5ZH 1GGIH 1UEYA 2VQUA 4OCXL 5TFSH 4DGYH 4PGBB 4PRIA 1T03L 4GKZA 3BGAA 3RGVA 1FL6B 1AHWC 3G6JE 2EH8L 2HFFB 4NQSB 5J13C 1FGNL 4RGND 4ZUSA 3VFVB 2XN9E 5CKAA 1FNGA 4U1HB 1E4XI 4I3SL 3GBNL 4I77H 1RJYB 4C56B 5J1TC 1UYWL 1XH3A 3ZE0F 1ROWA 3OAYH 1EERB 4LVHB 3G5VB 5IG7B 1ACYH 5GGQL 4GRMA 1YEEH 4WU7B 4S10A 3IDMA 4Z7UB 4YIQA 5JXAL 5T5NG 2H6PA 1U8LB 3D3VA 4L9LA 2CRMA 3WIHL 1PY4A 3WFCL 3KJ4B 1PYWA 3IDUA 2I9TA 4H8WL 1NMAH 3QA3A 4KY1H 4WTXA 4XVJH 3OAUL 5J57B 4HIHA 3VFUA 3KPSA 4G6KH 4RISL 4K3EH 3O4LE 3KPNA 1NJ9B 1QBBA 1VDGA 2W0FA 1DQQB 1XEDA 5EU6B 3U0TB 3ZDXF 1XF5B 1RJCA 4KHTH 5HYFA 5EH1A 3ALXA 2D3VA 1P84K 3KPMB 1URLA 1JNHB 4PGEA 1RZJL 2D03H 3TIEB 5DJ8A 3QDAA 1BD2B 3LEXB 2X89D 4OF0A 4P59H 4QXGL 5AWNH 3T2NL 2M26A 4ZS6C 1UM4H 2E6JA 1UVQA 3OR7B 3I84A 3ZE0E 1JV5B 2H3NB 2VOTA 4JFZH 3QO1A 5FO9B 2NY6C 3KNBB 1NANI 1G7QB 1KELH 4KVCH 5GRZA 1IMHC 2EZ0D 1MVUA 1Y6MR 2J88L 3ESUF 3OXRB 3TN0C 3QULA 1FZMA 1PKQE 2G2RB 1R3HA 3DSFH 4J8RB 5B21A 1AXSA 2HP4A 1BIIB 4R90H 4XAWL 3KPPB 2JLLA 3HE6D 2FHBA 3SY0B 1G6RL 2HVKA 5CP7B 4PGDA 1WITA 1BZQK 5CD5C 1P7QB 4XTRD 3TC9A 4LPWA 3M1BA 2GSIB 1DJSA 1R3JB 1D9KD 4Y8AA 5KS9E 3ZKND 1E28A 5HVFB 5CS7A 1L0YA 1M05B 5ECJE 5I6XB 3EIFA 2R69L 3MNVA 4EOWH 3CX5J 1XZ0A 3I6LD 4I4WA 2NYYC 1INEH 3QDJD 1EHLL 3QUMH 4P9ML 2X5PA 2ENSA 5BW7C 3QCVH 5CZXC 2QQNH 4I18A 4DGIL 4D9LL 2FL5A 5EOQH 1FYTB 2XV6B 1RMFL 4PJ8C 1FLTX 3N85L 1C16B 3ILQD 1I3RB 2DBJA 3I50L 4P46B 1DVFA 2AEIT 3FO1A 3IKCA 3CSGA 1OAYH 4M7LH 4KKCD 2XWBA 4OFKA 1H3UA 3QUXA 3FQWA 2R23A 5TQ0L 2W9DH 1Q9OB 1U92A 3UYRL 3VWJD 3MLVL 4HWNA 1NKOA 3U0WL 3RY5A 3OJVC 1EFXD 1MUJB 4GJTB 3SKUD 4YUEL 1HXYA 2I25N 3RUGF 1L6XA 4K2UH 4X9BA 3KWWB 1T04A 4ZTPL 1VFOA 3FHAA 1ND0B 2NLJB 2GAZB 2HFGL 2OTWA 3QHZL 5IVXE 1TTFA 4OZFB 2VQ1A 2VLJA 1BQHB 3VGGA 1U93B 4GO6B 3QFJA 1EUTA 1IAIL 4UDTA 1KJ2A 4HJJL 1DBAL 4ZS7L 3K1KC 3C8DA 4XP9H 3TZVB 1QBMH 3TO2B 2NXZD 5FYJD 3IAQA 3GK8L 2R1XB 3MLWL 3KPRD 5T1KA 1MJ8H 1EEUA 4DOHE 3K8MA 2WY3A 3HRZA 3BWUC 3B9EA 3FT3B 4I0PD 4TUOA 2GCYA 1KXTB 4WU5A 4EKXA 4OM0H 1PSKH 3K4AA 2C4FT 2UY6A 5GJSL 5ACZA 4Y1AA 3QH3B 4EEEA 3KYMA 4PBVC 3WJJC 3VXUB 5JHLL 5JW4R 4OM1L 2MSPA 4OSUH 5JNYB 3QEUA 5GSVB 3BP5A 1WTGT 5GRXG 4HK3N 1XGQB 5ELIA 1AFVH 1F4XL 4LLDB 2AK4D 3Q3GA 2W9EH 2HFTA 1R24A 3CMGA 4JFDB 4P5KA 3BRDA 3QCUH 2R2EA 3P11L 5SWSA 3ULSB 4TOYL 2B7DT 4MNQB 5DD3L 4BH8B 3NFNB 3BKML 4NIKB 4BH7B 2XZCL 4J3SA 4OAWA 3RWHB 4HUUA 3ZYJA 2ZZUT 2GTWB 1TLKA 1NC2D 4FP8H 3TFKD 3UTPE 3EJJX 4FQXA 5E7BA 5MEND 1YPZE 2VQTA 3RGVB 1XGYL 4O5LH 3ARXA 4EDXA 4PR5B 4S0TD 4HBCH 1CT8A 1JPFB 4LIQE 4PJ7E 3PGCB 4OCWL 3BISA 2I07B 3MRIA 5C0IA 2W60A 3ZSSA 5SWZB 2LU7A 1UB6A 3GJEA 2YXMA 3LSOA 1FFOA 4FQPA 3IAGC 3LCYA 2NY3C 4ZFOA 4ORGA 1B6UA 4PJGE 3MGTB 2BSTB 4Q2ZA 3TVMA 2FHFA 2CKBA 4ZFFB 5CJOL 4KJQC 3BPOC 2XFXB 1IC5H 4HT1H 1NQBA 3EFDL 4JFED 2AJXH 4AENB 3UBXA 3VXPB 2ARJA 1KF9B 1T2XA 2WW8A 1FIGL 4RA0C 4F80A 1EGJA 4F15B 1AIFA 4ZFZA 2CK2A 1ZA6A 5JR1L 1A6TB 2ADFL 3QWQB 1K8IA 1KENL 3F7PC 1G7JB 2GYSA 1L6ZA 3MV9B 5GRYA 2PXYA 1IGIL 1ADQH 4MCZA 2EDXA 4YXHL 3INUL 4QXTB 1CK0H 4MNGB 4PB0L 1CFSA 1K6QH 1PBYA 1YNKH 4JO3L 1KGCD 1YEKL 1FG9C 3KPNB 4JFXA 4MD0A 4XWGL 5C3LD 1HK6A 5BMFH 1BJ8A 4MD5A 1QLFB 1IGJB 3GHEL 4PV8A 1W8NA 5CLWA 3O0RH 2MJWA 4LQFL 4ODSL 2K9UA 2LU4A 1QVOA 1BOYA 3NPSB 4GH7B 3TESA 5L9DL 5EWIH 4FOMA 2NTFB 1A6WH 4Z7QE 4G3YH 3HG1B 2Q7YA 4YGVB 4WI9A 1N5AB 5CFHA 1YC7A 3VFWB 5ESVB 4JG1L 1MWAB 3CCHB 1ERNA 5EOCJ 1I85C 2B2XL 3JWOC 5CKGA 4MX7A 2L7UA 1A1NA 4ZS6D 4MNHA 5DQ9B 1NFDF 3N1MC 4HAFA 2GJ6B 4POYA 3GRWL 1K2DA 5JPNA 5B39G 2NY6D 3PWPE 2FIRT 4YH6A 1E6JH 2LQRA 2Y7QA 1BFVL 5T3ZL 3X3FH 3C09B 4CADB 1QOKA 3RJDA 3VRJB 3TN0D 1JZ2A 4W6YB 5EO0A 2Y4SA 4YBQC 1VB9A 4YHIB 2V5RA 3BPCB 3HNVL 5T1LB 4ZOBA 4G5ZL 1GGIL 2EYSA 1CL7I 5M95B 4IMLA 1T1ZA 4PD4K 2DLIA 5CAYB 4F58H 3OF6D 4UDUA 2VJXA 1T7YA 3M1BB 5IB5A 1E27B 3SDYL 1PQZA 2XTJC 5CD5D 3ULVC 4LP5A 5HGHB 3WE6B 4U05A 3S35X 1XGTA 2E7BA 1CDBA 1UC6A 5L8JB 2ILLA 1K5NA 1T7XA 1IC1A 4ODBD 4I77L 1S5IH 4WI4A 3QIBA 4WCYL 2NYYD 4JO4H 4S1QH 2XN9D 3JVGA 4ALAH 2YEZA 2FL5B 3BZEB 1ACYL 4PJFA 5IFHH 3TJHC 2JB6B 4CN1A 5CZXD 1UJ3A 1MHHB 1SJHA 3WFHB 3IXTA 4PJ8D 1H0DB 4RDQG 2JJUA 1S7TA 1MCHA 2Z31B 3HNTH 1B0RA 5IMMB 1LP9A 2YA1A 2X1XR 4FTVD 1JBJA 1NMAL 2EH7H 3QIWA 1SJVA 4XVJL 2FHCA 1FVCB 4NKDB 2R0LH 5D1ZA 4G6KL 1QRNE 1S7QA 4K3EL 3RWGA 3SJVB 2OMNA 4KHTL 2X10A 5IHUL 1A7NH 5D93B 1NBVH 2UZYB 2B5IC 4ETYA 1ZHBA 2V17H 1KIQA 2D03L 1CFTA 3DUSB 3HC3L 1U95A 1ZHLA 4MA1B 5IFAH 1T2QL 3EUUA 3H0TA 1C5BL 3O4LD 2OTWB 5BCAA 5HDLA 1CZ8H 4FFVC 3EOBA 3VJ6B 1IGCL 4F7EB 4HV8A 5HGDA 5AWNL 1NDGB 1Y18A 3QFJB 5C0DA 1IAKA 3FO2A 5FYLH 4JFZL 5JIPA 5IBUG 3IGAA 1EZVX 4IHOA 4JY5H 4KVCL 4W6XB 3RNKA 4POUB 4L8BA 4OGZA 3UJJH 5T1KB 4OZIB 2DQCL 2W0KA 3Q5OA 1RK0A 3TIDA 3LKRA 3SGKA 5EIQA 4TUOB 1X5ZA 3O4OB 1KN2H 1IQDB 4HWZB 1GC1H 4R90L 4LIQH 1WC7A 5CMAB 3VFSB 3T2QA 1ZS8A 1MSPA 1QKZH 5IOPB 3QUKB 1RUQL 6CGTA 1VEMA 4Y19A 1R6VA 1P7KA 1U2CA 3HNSH 5HGBA 3SDAB 3X11A 3Q3GB 5FKPA 4DKAA 3MUGB 3RBGA 1INEL 5SWSB 3QUML 2VUOA 2EDQA 2F53A 4JZJB 4L4TE 5EOQL 1X6LA 4LCUB 4QRTB 2Z92B 1P2CA 1MREH 1OAZH 1JPST 3LD8B 3LEVL 3BSZL 1MFBH 2X9YA 1S9VA 2BSSB 4XAKE 1NCCH 1OARH 2M1KA 1MAJA 4PJAF 3L3GB 2CGRH 5EBWB 4D2NA 3MLSH 4TVPE 4C83A 5E6IC 3LZFH 2W60B 2GW5A 2XKNA 4R7DB 2ZCKL 2EC8A 4RMUA 5HDQH 4X4ZA 5DRXA 3NCBB 3RI5K 4M6MH 2X44D 2NY3D 4K2UL 2OMBA 1FO0A 4LAQH 4HJ0C 5KTEL 3BWAA 3QNYB 4KJQD 1M7IB 3MRRB 2XG5A 3ZDZE 1MHEB 5LWYH 3BH9A 4N0UE 5DI8B 3P4MA 3AS2A 3QAZB 4MCZB 4GRWF 3FQRB 3U6RA 4ZNEE 1MJ8L 3DURB 2JK5B 3QJFA 4NQCA 5TJWK 3LV3A 2V2WB 1OAUH 1N3NA 2PTTA 4WHTB 5ID1B 4PJAE 4PV8B 4RMRA 5FYKL 1UCBL 3L3JB 1LEIA 3UYOD 5E2VH 2UYLB 3DVFA 4OM0L 5HHNA 4Q9BA 1U42A 2J8UF 2BX5A 1CD9B 4LSUH 3FT2A 5CBAA 5D5ME 5DHVA 4OSUL 5DMKA 5C0EB 2APFA 4IIQC 4Z7NF 1M6OA 4F37K 3EYOB 3SBWC 4UV4H 1RJLA 4J12A 4Q6IA 5E1AA 1A1NB 5KANI 4H8WC 2W9EL 3RNQB 2P5EB 3IS1X 5CJQH 1YEHH 2VZSA 3LQAH 5KVMC 3QCUL 3ARTA 3CZFB 3O8XA 3D25B 4YHZH 2LVEA 4PTUA 1G7LA 4WI6A 4PJDF 3T0AA 1WIUA 2ZCLH 3WJLA 4L1HA 2Y7QB 1MFAH 4LCYB 3JWDH 3OKEA 3GIVB 5IMLB 3DGCR 5I66B 4Y4KA 3QWRD 5FYKU 1RZJC 1W72A 4GRWE 3MSPA 4NNXB 1YMMD 4YBQD 3H3KA 3ZYOA 5KSBE 1CD1A 4HUVA 5HHMB 4S1SH 1WTLA 3WFBH 1FNHA 1P7HL 3LEYH 2UV3A 1OLLA 2GT9B 1A7RH 1HOCB 5JW5A 3ARDB 5DQDH 1T0MB 5FV2A 5GS1C 2XTJD 3BHBB 3ULVD 1CTNA 4HH9A 4LCWB 1J8HA 3RJQB 2AEPH 2VZVA 2MOVA 3QG7H 2OZ4L 5F7UA 4U1LB 1A4JA 3WO3B 4NOFA 4G9FB 5M94B 3ME0A 1IC5L 4HT1L 4EXKA 2AJXL 4X5LA 3FONA 4X6EB 5D72H 5I73C 3V6OE 4F9LC 5CEZE 5E5UB 4YO0A 3TJHD 2VAJA 3MJ9H 1WBYB 3TM6A 1JWUB 1HH6A 3GMRA 5T1MB 1S7TB 3DYMA 3PIQB 2ZOLB 1CFNB 1FH5H 2DB8A 5HYSB 2P7TA 4YAQA 3O6FA 4EQ3A 2HRPH 2HH0H 2IMMA 1RZFH 3PXHA 1CK0L 1B4JL 1K6QL 2K1MA 1ZT4A 4HULB 4F7TB 4K8RH 1DBJH 4NZJA 4Z78A 3V4VH 4D0CA 3IRZA 5BMFL 2D4FA 2P4AB 5IFJA 4H1LG 4NOBA 1ZLWH 5KANG 3TNMA 3FAWA 4JEGB 3T3ME 2R2CA 5IR1B 3GUTA 4RQQB 1A6WL 4G3YL 3VGAC 2FATH 3WHE0 4GUPA 4LVNB 3K80A 5F1KC 4HKJA 4HV8B 2I9LB 1Y18B 1F6AB 4FFVD 3DETC 3ZDYE 1QYGL 4HLJA 3FO2B 3E1F1 1JYWA 4KZDL 4NZUH 2YD7A 5AZ2H 3RFZC 2DYPA 4KDTA 2F54A 3GMLB 4LSSL 4JDZB 3C5ZC 2Y25A 3LMJL 2X4PB 5GIRA 3ARFA 5GS0C 1Q1JH 3ORJA 5JUEH 4O4YH 3FQTB 2GTZA 2IADB 4M7LT 3CDYA 4HWEH 3SO3B 1E6JL 4U6XA 4LASL 3X3FL 1JI2A 1JZ5A 3VXNA 1VADB 2APVA 5I8OH 3BEWA 2YUZA 3MTRA 4X6CA 3AREB 2W0PA 2N7AA 1WC7B 2AXFB 4TVPH 1U8NA 2CRIA 2YRZA 4QTHB 1A9EA 4YDKH 1HINL 4M43L 1JGVH 2PO6B 4F58L 5J6HA 3WNNA 1KTKE 4WUUE 1AP2B 3MV7B 1XIWA 2X4OB 1XR9A 5DK2A 2XWJA 4MAYB 5DJYA 1A6ZA 5J8OA 3MBXL 1CE6A 1QFWM 5KJRH 2BVTA 4ZXBC 3SE8H 3FFDA 1G7MA 3EJYC 2XTLA 4ZDHA 3TLRA 3FCTA 4HC1H 5JQ6H 3CFBB 1X5XA 4ZQKA 3ZMRA 4XGZB 4MQ7A 2JF1A 4JO4L 4S1QL 1N0XH 4XMKH 3QQ4B 3S36X 3KLSA 3CVHA 1YC8A 5F44A 3B4NA 3PP4H 1LO3L 4X7SL 4MWFA 1QD0A 1P2CB 3L1OH 3RWIA 3QXWA 3S5LA 1REIA 1NAMH 4B50A 2G5BA 3V6OC 2QHRH 2VMFA 3QHFH 5C86A 3WEXA 3E3QC 1VGKB 2PYEE 4NNYA 2EH7L 5ISZA 3SDCC 3UROR 1U8PB 5E6ID 4YK4B 5KVGL 4NDMA 5F9AC 1JZ8A 1A7NL 4Y16B 1NBVL 2WBJA 4GAJH 2KQMA 4PS4H 5IFAL 3B83A 3MCKA 1FO0B 3TBSB 4NQXB 4LARH 4ODXA 3T3PE 3B9DA 3S36H 3SGDI 2PN5A 2E7HA 1S9XA 3BWAB 3QT2A 3QCTL 3RPKA 2EYRB 4HJ0D 4QOKE 1FGVH 1CDIA 1IKNA 2CH8A 4UOW0 1HHKB 4JY5L 4QT5B 25C8H 4TVSa 3H9SE 3U6RB 3UJJL 2HLAA 4GRWH 4NKOB 4RMVA 5KVDH 2HVJA 4PP2B 1DP0A 4J1UA 2VZTA 4FQLH 1KPRA 2PTTB 1MJJB 5KZCB 5TE6H 1A7QH 1GC1L 1IAMA 4JPKH 4OZ4A 2BRRL 4BM7A 3MRCA 3LQMA 5I1KH 4K94L 2CIKA 5IQ7H 3TYFA 1FNEB 5IEKA 4WWKB 3DRQB 3FN0L 1QKZL 3IDXL 3VGEA 1T7ZA 4OGYH 5DMKB 2C3GA 4NM4H 1RFDH 3BYYA 3ZE2E 4JCLA 1RJLB 3HNSL 2R29H 5LXGH 3UZVB 3AY4A 3S6CA 1E4XH 1BJ1H 5EN2B 1GZQB 5A2KH 1H3XA 1F00I 4PTUB 5DHYA 3TNNA 4JRXE 3MJ6A 4CW1B 1DDHB 4X7FC 4MJ6B 1QR1A 5T1DH 1IAIM 5MERB 3I02B 4YDJB 5EUKB 3GJFK 1YEJH 1ZHNA 3OQ3B 5IKCB 1O7VA 5HGGS 1MREL 1OAZL 1LE5A 5FOJA 2X89A 4ZOCA 1MFBL 3OJDA 2ZG1A 4WW2A 3FB8B 1NCCL 2XZQH 1OARL 5KVFH 2OJEB 1WEJH 4Y2DB 1S8DB 4XXCC 1Y0LB 2AAVA 3MLSL 5A2JH 3LZFL 4LPUA 4P3CH 3O2DA 4LPXA 1CDYA 5DJAB 1CIDA 1IM9D 1SVZA 2AK1H 1J8HB 4GG6F 1GGCH 4XAKD 4P9HH 5A1AA 3EO1A 4XNZB 1CU4H 1CE1H 3KXFB 3ARBC 2HKFH 3QR2A 4M6ML 1BX2A 2WUCL 5HHOB 3NTCL 2E6QA 1HILA 4HD9A 4K3JH 5MEOA 2P24A 5DJ2B 2Z4QA 3HE6A 3AFLA 4XCYA 4JPWH 4O02H 5BVPH 1I1YB 4XCCL 2VKWA 4UTAH 5E0QA 3VGFA 3OSKA 4K55A 4YO0B 2WZPD 3VA2C 4NSKB 1MJUH 1VSCA 5LWYL 1HSBA 1D9KA 4FMFA 4AIZB 4DZBA 4KV5E 1NANH 4IOSD 2B8OT 1JGEB 1M7XA 1MHCA 2BHZA 3P30H 3QDJA 1D3CA 1II4E 2Y9RT 4W4NA 4BKLA 1X5HA 1ZA3B 3C8KA 5E2VL 3CX2A 3T77A 4A6YH 1KB5H 3K3QA 4ELMF 4AT6A 5GS3A 1N6VA 5BJTB 4QHUB 2YPKA 2O5XH 5C8JB 5ABDE 5HYJE 4LSUL 5CILL 4DUXA 3UPRB 4ZFGH 1TQBC 1KCKA 3IXAB 4OBRA 3I75B 3CFCL 2R2BA 4Z7VF 4UV4L 4G42B 3T0VA 1KIPA 5LVEA 2ERJB 4E0RB 3DETD 3VWJA 2CPCA 2F54B 3HMWH 5J1AB 3LQAL 2IBZX 5I15H 1EFXA 3C5ZD 2GTZB 5BOZG 4YHZL 3GGWB 3EGSB 5DD6A 5GS0D 2ZCLL 3VFGH 2LTQB 1IEAA 2QLVB 1MFAL 1BFOB 3JWDL 2AERT 4H26A 4GLRI 1A6AA 2WWKT 1PG7W 1N5YL 4YPJA 1OP5H 1EJOH 3X12A 3ZE1E 1U8NB 2XPGA 4UT9H 2FGZA 1A9EB 7CGTA 4S1SL 4HX1B 1RQ5A 1T5WA 4XP6H 1GSMA 4RGMB 1JWSA 3WFBL 4CDHA 1ZK9A 3WS6C 1F2XK 3LEYL 1J1XH 2W0LA 4PP8C 5DJYB 5B8CA 5C70A 1A6ZB 5DQDL 2Q3ZA 3KPRA 4GMSH 2KZ1B 3RZCD 5H35A 2BOCB 1EK3A 2AEPL 3BZFA 3QG7L 4NKIL 5F7NC 4GRLD 3FO0H 4Z7WB 1P6AB 4ZXBD 4BSJA 1DN2A 5ADOH 3LIZH 3VH8B 3EJYD 5D1QA 4AEIH 3W9DA 2V9TA 3DIFA 5D72L 3S3SA 1NC4B 5LGJB 1FZJB 3UBXI 4LVOC 3OHXB 1L0XA 4DCQA 1KBGH 2G5BB 5F1OB 2BK8A 3C8HA 3FT4A 1OB1B 2AK4A 5I75B 4NNYB 4R7NB 2HRPL 2HH0L 2UZIH 4JAMB 1RZFL 5FIEA 1N2RB 3TWCH 2FYYB 1F4HA 5D7IB 4I9WE 4M8QB 4K8RL 1DBJL 3SDCD 4JY6B 4WTWA 5E7FA 5ETUB 5GGUA 1UWGH 3VMNA 2R1WA 1AKJD 1D5XA 1FPTH 1TZGH 1FG2B 5CJ8A 1XGUB 5DS8B 3NABH 4TNWK 4GXUM 1MCBA 1OSZB 1NC2A 1AXIB 1Z3GL 4WIQA 1U8HA 3MO1B 2W91A 3TFKA 5LBSH 2FATL 4MJ2A 5MENA 4LGSB 3P4NA 1I7ZA 4R4FH 3IDYC 4JDVA 4OGAC 5CGYC 1AHWA 5AZ2L 1JZ3A 3MROA 1H5BB 3BD5A 4NKMA 4JFYB 5EBMA 4LFHG 2HT3C 5JUEL 5F3HA 2GFBA 2HT2D 2Y5EA 1B0WA 4O4YL 4ONFH 1I9IH 3ET9F 4KTDH 3L5WB 4HWEL 2BVOA 3CXDH 5DD0L 1OF2B 1SY6L 1M7DB 1D5MB 2P8PB 4QRRE 4ODUB 5I8OL 4JLRA 1ZT7A 1DANT 2ATPB 4JFEA 2A6IB 3H3PH 2DD8H 4Z8FH 1MAKA 3DYPA 4GSDH 3MRCB 3MR9B 5AAMA 2WLYA 4X80L 1D5BB 2XXMB 4K7PY 5ITFA 2GSGB 2YUWA 4YDKL 5IEKB 4PJ5E 2B20A 2ITDB 4FQCH 3CLFH 3U82B 1K4CB 2W59A 5D2LB 3L3KA 5C0AB 4CNIA 1TVDA 3HI6H 3SKMB 4PG9B 1O7SA 4QRUA 2VE6B 1MCDA 4POZC 5KJRL 3SE8L 1IZJA 5LJYH 3K2UH 3THMH 1S7VA 4WUUD 5E9DB 5ACMA 4U1KB 3QB7C 43C9B 4HC1L 4NFCA 5EB9A 3OX8A 3G04B 1N0XL 5CHNB 4XMKL 4WEBL 3WDHA 3CUPA 4KI5F 2FR4B 5IVOA 4HWBA 3G6AB 3PP4L 5H8DA 1ZVSA 1DQTA 1K4DA 3VXMB 1MRDH 2P8MB 4UAOC 3U7YH 1FFRA 3WFEH 4B7IA 1NAML 5DC9B 1BLNB 3HA0A 4U0QB 4WW2B 1S3KL 4HGMA 3QHFL 2J3SA 3I2CL 1ZMYA 3B5GA 3GIZH 3RRQA 4TSAH 3HI5H 1MJ7L 2DLFL 2E7CA 5DDHA 4YHYC 2NY0C 3MFFA 1WWWX 4LLAA 3OKMA 1AGBA 1CDHA 2ZOKB 3TN0A 1PEZA 3MRHA 3SDXA 3ARBD 4FN0A 2V2XA 3KLAB 3HE6B 1I8IA 4XCNB 4XCYB 3S36L 3IETB 4V1DE 4DJMA 1KB9J 4AIXA 2Y6SC 3CDCA 5CIPB 5I1IH 4JZOA 3MRFA 4G8GE 1FGVL 4K9EH 3GNMH 2Z8SA 3MRJB 1D9KB 3G9VA 5CJ5A 3B9KB 25C8L 4WO4C 2COQA 3IKKA 1A6UH 2MNUA 3KPQB 3G6JA 4FQIH 3BZDA 2A6KB 3PDDA 1E4JA 5E8NB 4UV7L 5KVDL 3WMSA 4QRPE 1WAAE 2AS5M 1FQ9C 4M8VA 4BKLB 1OGTB 1K8DB 2XN9A 4KKAC 4OLYH 5TE6L 2FJHB 1MCEA 5MHSE 5H2BA 4RX4D 5BW7A 3H9SD 4YBLC 4R3SA 4LCIH 5I1KL 1ZLSL 4AT6B 1VEPA 5IQ7L 3LN5B 3QNZA 5HY9A 4PJ8A 3GSRA 3HC0A 5F96L 4MA8H 2JJTC 4OGYL 3O3EA 4OD3H 4NM4L 1RFDL 4LGPB 4N9GB 4FTVA 2R29L 5LXGL 2FBOJ 4PP1C 5ICXB 3ZTNL 5HD8D 4PJHE 2ATKA 3HZYB 2XWTB 5E95B 4I48B 4OF7A 5C0JB 1AH1A 3BESR 5HVGB 3NIFF 2YUXA 4AZ8A 4PJIE 2EDTA 1NKRA 5EOCH 3LKQA 4NGHH 4WRLA 1A3LL 3C5SA 5DGRA 5HPMB 5F88B 5CJBA 3PWJA 4NKQB 5EZOH 3I6GA 2E5EA 3O4LA 2EDEA 1S7WA 3T65A 3MXWL 1YEJL 5E94B 35C8H 4PRNA 5EOTA 2AXGA 2XPGB 4AYFA 4JRXD 3QWOB 3LHPL 2V7HA 4NN5B 2XZQL 3CSYA 5KVFL 1WEJL 4ZUWB 3F7YB 2NXZB 4I3RH 4R96A 4MHHG 2DI7A 2EE3A 2ADIB 3PDOB 2XACC 4RRPA 3Q6FB 4P3CL 3NN8B 5JOPE 1VACB 5EU7E 5SV4A 3TV3H 2IQ9H 3KPRB 4NZDA 3AB0B 4U1GC 1CU4L 1CE1L 3RBSA 3EYSH 1J0JA 1XT5A 1HYSC 5D1QB 1A21A 4K3JL 2HFEB 1TQBB 2YN3A 5JXEC 3D39D 4JPWL 4O02L 5BVPL 3VW3H 1DN0B 1PKQA 3QPXH 4UTAL 5CGTA 1CD0A 1WICA 4RFNC 5HHXH 5E4EC 2A6DA 4EXPX 3SKOA 2NCMA 1MJUL 3B8SA 3WJJA 3JTCA 4D0DA 4M61B 1JFQL 1M4KA 3DROA 1JMZA 5D7JC 3KAAA 3QDMB 3P30L 3OTTA 2VXVH 4RMQA 4NO3A 4PJEE 5EBLB 2WBKA 1RPQA 5KG9A 1UCTA 3L7EA 4O58L 4A6YL 1KB5L 1JPGB 3MJ8A 2H45A 2JB5H 3T0EE 2VXSH 4NQDB 3HR5B 2DQEH 2DL9A 4OKDA 4YR6A 4ZFGL 2X70B 2WUBL 1RHHB 2EDYA 3DO7B 2B1AL 4XH2A 2YD3A 4LNRA 4I0KA 3MROB 4M6NH 3VFOB 4OGAD 1NCNA 4WW1B 3FTGA 5CGYD 2ZWLT 4UU9A 1DQJA 3CXHK 5I15L 1PJ9A 4XZUA 2HT3D 3ELAT 4MSWB 2DQUH 3CNKA 5DTFA 1S78C 2OLDA 3RQ3A 4LVOB 1QP1A 3E6HB 4D9QE 3BKYH 4PFEA 2IAMC 2XZAH 3VG9B 1ZT7B 5I8EA 1WK0A 1VKXA 2ESVE 1IAOB 4UT9L 1AGDA 1A9BB 1LEKA 3Q5YA 4N1HB 5F93C 1SYSB 3KLHC 43CAA 1UM5H 4N1CA 3V0AC 2M8XA 1J1XL 4F8QA 4M9PA 5IW3A 3QUMB 1ZLWK 1HHIB 4GMSL 1FFNA 4GW1A 4PRIE 2Z0BA 4V2CB 4RNRA 3FO0L 3ARRA 1S7VB 4L9DA 5EU7C 1GOGA 1YN6A 2P8LB 5GS2H 3DJ9A 4QTIL 3FHQA 4O00A 1MQKL 5ADOL 3LIZL 4N8VG 1I1AB 2FIKB 1EO5A 3IDYB 3ULUE 1HI6A 4AEIL 1BAFH 1MCSA 4CMMA 3W5MA 1KFAL 3IJSB 4FQQB 4L8SC 5GZNC 2DAVA 1RURH 1VPOH 1GC1C 1QA9A 4KHXH 4IJ3C 1C7SA 3MRLA