3GSRA

Crystal structure of the binary complex between hla-a2 and hcmv nlv-m5v peptide variant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsrA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3gsrA01
3EOYG 1UWEH 2XPGA 3ZKQD 4PJDB 2YHGA 4GRLB 3O45A 2D03L 3N0PB 3TLRA 4HKXA 4ZQKB 4X9GA 4Y19D 1VADA 4PRHE 4XNMA 1IAOB 4NO2B 4PJ9B 4U1MA 4JFYB 3F7VB 5IESH 5EO1A 4P2OB 1RU9H 3I6GA 2N7AA 1JYNA 4MZ3A 3DXAE 2JELH 3KPQA 2X2YA 4XP5H 3WYRA 4DFHA 5FM8A 4QOKE 2W60B 1FSKB 1G1YA 5GPRA 5H94A 2CK0H 1NCWH 5LG1A 3RNKB 4PD4K 3DSFL 4M9PA 3Q0HA 5JW4R 3GM8A 2C3XA 4PJ5D 4HH9A 1CFTA 4FNLH 1FG9C 1Y0LB 4OF7A 5CZVH 5CZKA 5AAWA 5DJXA 1PBYA 4DKDC 3VFWB 5A3IC 2NX5A 2E27H 3OTTA 1D7FA 4KKLC 4KUCD 3VXTA 4EBQL 3X3FL 3RWCB 3CFIC 1SQ2N 1DN0A 1NLDL 1XF5B 4LIQL 5EO9A 5HVFB 4KKAD 4LCIL 4BA8A 5J6HB 5A43C 3WJJC 3U4BL 3G5VA 1INEH 4PLJD 4JLRA 3C5JB 3V6ZA 4P46D 2BY3A 4NO3A 3TN0A 5EPMB 4HXBH 4HUNB 1ZT1B 4M3JA 5BV7L 5DQDH 1MCPL 2HJLB 4KK5D 1N3NA 1DBAL 1V7NH 4YHYC 4XP4H 2OJZH 4IRJD 1OGTB 4I8DA 1CZ8H 5K9QG 5DI8B 4H20H 3INUL 3WO4C 4ZTPH 1QFUL 3MNWB 4R0LC 2DWDB 2VISA 3BZ4A 3K0WA 3O3AB 4JO1L 5FA3A 1W8NA 4DUVA 1QBML 5E2TH 1CGWA 1U8LB 2YOCA 3VXPB 5JHDD 1P6AB 4YIQA 3M1BB 4TYUA 1ZT4A 1OW0A 3LKRB 3MLUH 4J4PA 4LPXA 3WO4B 4NO0B 4XAKE 4R0LB 4S2SA 3F65A 5BV7C 1W0VA 1R5IA 2GUOB 1YEKL 1T04A 3MV8E 5FGSA 4L3AA 4GRWB 4HLZG 1RZJC 2A74B 5D5MF 3W11C 3V7MA 4F8QA 3QIBD 4HV8B 1QLRA 2CJUL 4TUOA 5FGBA 3B5HA 2GHWB 3DYPA 4JKPH 3VXUD 2VDRL 3K4DA 1AQKL 2VDOL 2ESVE 5DJCB 1REIA 4K3EH 3T0XA 4U7KA 4AEHL 1BJMA 3TIDA 4ODXA 3BEVB 2RBLA 5I76A 4JB9H 2VITB 3MRNB 3U9UA 1SM3H 5KSVB 3MA9H 1FE8H 1XR9A 3GUTA 2OS7A 2JCCA 4NQCD 3LS4H 5BVJB 1LP9A 1A6ZB 1OARL 4LKXA 3X14A 4X4XB 3SKJL 1DZBA 3BQUD 3S3SA 1U8PA 2XQYG 3O6KH 5IHZA 4L8DB 4HWEH 1GGIH 3HS0A 2Y7QB 3BKYL 1R6VA 4WENB 3DUUB 2RR3A 5LAXB 2O93L 4HAGA 5KVEH 5M94B 4I5BB 2BNQB 1NBYB 5MERA 1G6RL 1D6EB 2H32B 3W39B 4YWGL 5JW3L 4U2ZA 5SX4I 2HFEB 3JWOL 1KCUL 2XQBL 3MGOB 5I66B 1UM5L 2XNAB 5F9AC 4JN1H 3UX9B 4XCNB 4KXZH 2DB8A 1RULL 5ICZA 1X4YA 2EYSB 4I3SL 1N0XH 1UJTA 4NKOA 2L0DA 3IFOB 3ISWA 5JLZB 1ZHNA 2GQHA 1Q9KB 2BOBB 4YC2C 1ZV5A 4PTTB 4KQ3H 5JO5B 2X05A 1UT9A 1FRGH 3CUPB 4NFCA 4P9ML 3HMXH 3JTSA 4BFBD 4WTZA 4WI4A 1OAXH 5A2FA 1BWMA 4KRNA 2V17L 4HPYL 3JWOC 1FQ9C 1BQLL 4YC2B 3BSZH 1X5YA 4MVBA 4IEFB 4OGZA 4MB3A 3PWLA 4NZRH 1NC4B 3ILQD 2F58L 3EYUH 4NM4H 1CFTB 5DUPL 1G6RB 4V3EB 1NAKL 3TA3A 3WFEH 1XIWC 1TZIA 1T66D 5D70L 2NX5B 1P84K 4NRZB 4Z7UE 5EOCJ 4GKSB 5EA0H 3MC0A 4IM8A 3HR6A 2AJYH 2IANB 4Z7OF 3AMLA 4HIJA 1NBVL 4HH8A 3SE4C 1MFBH 3NFSH 1HKLL 4NUJB 1A6UH 1VPOH 3WFCH 1XIWB 4ZS6D 2WW8A 5F1NB 4RGOL 4GBXA 1S7TA 4XNXL 4XNQA 2YPVH 4N1EA 1OPGL 3TBYA 1DUYA 1U92B 3IDUA 4Y1AE 4EXKA 4RQQB 1TJGH 1CXEA 4FN0A 2ITDA 1JTOA 4KH2A 3WD5H 3PDOA 3E6HB 5ICYA 5C0DA 4ZUWB 1ZHBB 4LSPL 3OJ2C 1DLHB 5A2KH 5JOPE 3OF6A 1GGBL 2OMBA 3AM8C 3D39A 5D7LB 5HD8C 1RZIB 3EYVB 5HGAB 3NPSB 3TT3H 4OLWL 3N1PC 5EU6E 1QA9B 4DFIA 1JMZA 4KJPD 4KKNA 2I07A 5HYIA 5T1DH 1BHGA 2VDKH 1YN7B 4WI8A 4WFEE 4XPFH 3AS0A 1HZHH 5D2NC 1SEQH 2XICA 1XH3B 3RDTC 5JPNB 2MKLC 4OIIL 4EUPG 4MS8A 2AV1A 4NGHH 4P57A 4IIQA 4BSWB 4PJ7A 4LU5H 1KCRL 2KKQA 3I50H 3IAQA 4LKCA 4JFEE 1SJXA 4K23L 4HZLA 5CBEB 5D2NB 4DK6A 3RDTB 4HIXH 3G5XA 2YUZA 3S35X 1DE4B 5HPMA 3UTSA 15C8H 2J8UE 1OAZL 5KANG 1X5XA 2UUDK 3IDIA 4MDIB 4L8BB 5EU4B 3L3GB 3T4YB 1VFBA 3DI2B 5E5RB 3IU4L 1GAFH 1UKQA 1XGTB 2DJSA 1WZ1L 1OAYL 2GK0A 2JCCB 1JV5A 3O9WD 2X9YA 1E6JH 4O51A 1MFDL 2V2XA 4KKLD 3HLAA 4LKXB 5IWLA 4KWUA 1MPAL 3OBAA 1NCTA 1UQSB 4PRBB 1OAUL 1CGXA 3NFPB 1A6VL 1F00I 3HAEG 1G7PB 3TZVA 3TF7A 1UM6L 5MEOB 4QHMB 3FO9B 5D7SL 2O5XL 2HJFA 4X6DA 4TPRL 4UOW1 4UQ3A 3BUYB 5KN5A 1R24A 2AK4B 4G3YL 2ZPKH 4OCWH 3RPIB 3QFDB 5I17B 3PWPA 3UO1L 1LO5A 5GGSB 3KWWA 3MBXL 3FO1B 2QSVA 3ARUA 1S7VB 5KS9A 5K9KB 5ID1A 2GAZA 5FKPB 3VXQA 3TWCL 4TOYH 5AZ2H 4K9EC 3H9SB 4J1UA 4NO0D 4Y7MA 3C60C 1ND0B 1EJ6A 3HMXA 1IE5A 2IC2A 5JUEL 1KIQA 1IAKA 1CS6A 2VLJA 3PV7A 4HUVB 4XPTL 3BH8B 2JKXA 3I84A 5C8JB 2HT3C 4HJ0C 2A6KA 2X1PA 5DLMH 3AS3A 2UYLB 2GTWB 3TA3B 1D5XA 1XEDA 2NY4C 3MRKA 4R3SA 4X6BA 2X4NA 1K6QL 3O6MH 3GHBL 3TPKA 5ESQB 2ZJSH 1AHWC 4AH2B 1D5IL 3D69B 3KYKL 3UJJH 3QG7H 2NY4B 1D9KC 5INDB 1YJDL 4H5SA 4Y88A 3RBGA 3LSOA 5DD1L 3UJTH 3BVNA 4DGYL 3CVIH 4LDEB 1AHWB 2EH8H 3L6FA 4K94L 4CW1A 3HB3C 4JRYB 1QFPA 1QLFB 1D9KB 5DVMA 1CL7L 3QZWA 4JY6A 1CN4A 3ARXA 1K2DB 1KACB 2DQGL 5E7FA 2BNQD 4DKFH 5CLTA 4M02A 1KGCD 3SDCB 5DMKB 4JRXB 3GSUA 1JRHL 4QRSA 2MJWA 4V1DA 2UWEB 3GSQA 1Z0MA 5DK3A 4S1QH 1U3HC 1YJDC 2IBZY 2VJXA 1CE1H 1X5KA 4ZOEA 2I07B 1RSFA 4G9DB 3W2DL 1UEYA 4NQEA 4JN2A 4NKDB 4LVEA 4R97C 1EFQA 2GFBA 4FS0A 3ES6B 3QIWC 4K94C 1TJHH 2QQNH 5T5FL 2BMKB 1U3HB 5DVNA 3P4MB 1MUJB 1XZ0B 3EZJB 1JHLL 4NC1E 4P57B 2NMSA 3V52L 4EI5A 1IFHH 4DWHA 4R97B 4UMGA 4YNYA 3TYGH 3QIWB 4CN6A 4F7TB 4MAUH 4EXPX 1OCWH 1RVFL 2EDQA 5DUMH 5TQ2H 3AVEA 1NDGA 1CD0A 2WUBH 1QKZH 3D3VB 2DJUA 3N9GL 1U0QA 4YUEH 4LEOA 3ROLA 5KTEL 4HGMA 2CRYA 3EO1A 4C83B 2J6EL 3I75B 4LCUA 3MRQA 1RUML 2IAND 3RA7L 2CKBA 3FFDB 5E08H 3C08L 1W2KT 4PRIE 3HZVB 5FYKU 2HWZH 1XIWD 5IT2H 2O61A 4NNXA 4LRIC 3KXFE 1ZA3A 3OJDB 4L9LA 1ZLVH 2MCPH 5C1MB 5FYKE 5J9PB 3B43A 4GUPB 1CVRA 1D5ZA 5L7XL 1FZJB 2OLDA 2X4UA 3EAKA 4X4YB 3P4NB 3LN9A 3GSRB 3NAAL 3BIKB 3T09A 4FQHB 3UMTA 4R7DB 2HN7B 5IQ9B 5L2KA 2DL2A 4JE4B 5JW4Q 4D3CH 5DWUL 4F80A 3U4EB 1NH6A 3FMGL 3OKNA 1EHLH 3EOAB 3QXAA 4KROC 4W4OC 4GQ9L 4ZOCA 5E5UB 5IG7A 1TTGA 2NY7L 4NC0B 1JWSB 3QUKA 1OP3H 5TDNA 1NGYB 2QADC 1TQCC 1A6AB 3TO2B 3P0VH 4KROB 1MHCB 3IJHB 1FO0H 3QIUC 4ZG1A 2EO9A 1K8DA 3B5TA 1NDMA 4KY1L 3ZT5A 2QADB 2V7HB 4DTGL 1TQCB 1KJ3H 4PGEB 3FT2B 3SDXE 1JZ8A 4NHCL 4MCYA 2I26N 8FABB 2WIIB 3QIUB 4JFQA 1SY6H 3WIFB 5C70A 3RDTD 3QYCA 3H6JA 5HGDB 3ZTNL 5E2UH 3VGGA 4UBDC 5HHOB 1P4IH 5JXEA 3P11L 2B20A 2J7LA 4TULH 1HWHB 3S6CA 3U2SB 5D1ZA 2X1QA 3CIQA 2J12B 4QF1B 4P2QE 1M7XA 3C5ZC 4C54A 4CMHC 3NPZB 1MY7A 4UTAH 4H5SB 3UBXI 1F4YH 1GGYA 3PXJA 1JIBA 2DI8A 1NMCC 3ALXA 5TQ0L 3C5ZB 4P3CH 1BIIA 3O41B 3BJLA 5IW6A 3BT2H 4XGZB 2X4PA 4F9PC 3S88L 1CDBA 1NC2B 2EXYC 5D93C 4ZOBA 3VCLB 3RGHA 3HC0B 3L7EA 2OL3L 3ROOB 1UWXH 1OF2B 1EXUB 4LAQL 1J0IA 5H2BB 1CGSL 1G7HB 3SQOH 4GG6B 4GAFB 3NCJH 5D93B 4PJ5A 5DMJB 2R56L 1YEJL 4X9HA 4NNYA 3X12B 2R4SL 1EAPA 1CD8A 3ULVL 2ZWLT 4MXWH 4IMKA 4QNPE 4XRCB 3H9SD 5D6CA 5E2VL 2HFFB 3DX8B 4HWBL 4ISVA 1W72A 2A9ML 4DN4L 2ZUVA 3SDAA 3GO1H 1JNNH 4JZOA 4G8EB 5K59E 3Q2CA 2J4WL 5GS0L 1CU4H 3UTTE 1GIGL 4P46A 3C60D 4WUUB 3GSOA 1VEOA 4HIHB 3O0RL 1BVKB 3MRHB 3HCVB 2OL3B 1AO7A 3W9EB 2AEQH 2AV7A 4K7FA 1RZ7H 5I18H 5KSBB 1QEWB 5CP7B 2YPKA 4OD2A 3ULVC 2HT3D 2SEBB 2XKNB 5F1IA 2KQMA 4HJ0D 3MRFB 2CKBB 4FMKA 4MQTB 2DWEA 3G08A 3C2AL 3V0WL 5LGJB 2NY4D 4LSDA 3ZYJA 4Q0XH 1CBVH 3VGFA 2YD9A 3LQMA 3Q1SH 4M1DH 4ZUVB 5IR1A 1L9MA 5KS9F 4M1GL 2NLJB 4AT6A 4JZNB 3QI9C 1P9MC 2VDNH 1YPZF 4QRUA 5JHDA 4Q9QL 4NOFA 5DEGA 2CGRH 2DIAA 1D9KD 5EZJB 3A6BH 3MACL 3RVUD 4YDKL 5KVMC 2CLZB 4R26H 3FN0H 4LSSH 3QI9B 4AM0A 4QRRE 4HK0A 1C12A 3ULUL 3IFPA 4JRXD 3S9DB 3SO3C 2P5EA 1PKOA 4KZEH 3HB3D 3GB7A 3Q6GH 1MJ7L 5IMKB 3D25B 4KPHL 3VXUA 3SHSA 2P8MA 4HIIA 4PUBL 1J05B 2H3NA 2YKLL 4OBRA 1ZGLB 1J10A 3SO3B 1FO0A 1I9JL 5J6GB 2E9IA 4PJ8A 3REVB 2GITB 4MD0B 5BZDB 3DXAD 4PB0H 5KSUB 4KDWA 1U3HD 4PREB 2EIZB 1EV2E 3LEYH 2D03H 2YWYA 4S0UC 1KIPA 3QFJA 1CR9H 4PJIB 1JJUA 3TESA 4LSQL 5DSCB 4MA7L 1SY6A 3ULUC 3HRZA 4PRNB 4Z7VB 3STBA 5D9SB 4U1HB 3GSVB 4L29B 3D3VD 1UCTA 2MPAH 3TFKC 3MLZL 3A0OA 4D0CA 5ELIA 4LAJH 3C5SB 5MI0C 4HWUA 4CADB 4TVSa 4O02L 1FZMA 3G9AB 3HUJF 4N5EC 5EFIB 4WHTB 1GPOL 1UXSA 1T1WA 4ZPVA 2YPLA 3CFKB 1PVHA 3L7FB 1JZ7A 5MI0B 4JVPA 2X4SA 5FECA 1AI1L 4D8PA 1LO3H 4EBQH 5IMOA 1GC1C 5C0CB 3U0PB 12E8L 4LCCB 3LIZL 1BJ1J 4HJGA 1NLDH 1VGKB 2OZ4L 4XPHH 3VMOA 2FCBA 2JK5A 1CK0L 3O81A 4LCIH 3U4BH 5ILTL 4OF8A 2FD6L 1R3KA 2Z93A 1JN6B 5IV2A 1G7JB 4Z95H 4PYGA 4KDTA 4I18C 3GJEB 4X8JA 4RFEB 1XGYL 3PDDA 4FXGA 4OKVA 3WS3A 3GK8L 3OKEB 5BV7H 3RZCA 5I2IA 5D2LE 3DJ9A 4JDTL 2FECL 4FG6D 4QHNB 5FGCE 2FIKA 4KROD 1YYML 1CD1B 5F7HA 4I18B 4FFZL 5DQJA 1A3RH 1JNHB 5T1KD 2BXYA 3TBWA 1ZTXL 3INUH 2PW2B 1W72B 1P1ZA 1QFUH 3B2VH 2QADD 4M6NL 4JPVL 5E6IA 2IPKA 4PGCB 1QBMH 1L9NA 3QIUD 3RUGB 5KG9A 3BRDA 5H8DA 1NCNA 3EFDL 1XMWA 1AFVH 3B6SA 4M7ZC 4PJEF 3EOTL 4M7JH 4TUJB 2EKJA 5HDBF 5D7IB 2NY5H 4OZ4B 4WEMB 5D1XC 3O4OC 1YEGH 3GMOA 1WZKA 1DVFC 1FFOA 2YPKB 2NY2C 1PG7L 2F5BL 4MA1C 1IILE 4UBDD 1T1ZA 2HKHL 4S1DC 3UPRA 5K9OB 4AENB 1L6ZA 2VDRH 4P5TA 2HVKA 1H3UA 2ADJA 2VDOH 3JWNC 3O4OB 3P9WB 5D1XB 3RIFF 4F7MA 3E3QA 1P7QD 3TPUE 1OB1A 2NY2B 5CUSL 1U8OA 1FAKT 3C5ZD 2FEDC 4IDLA 2Q7YB 3G6JB 4AEHH 4I0PA 4MA1B 2FGWL 1H0DA 1J12A 3CFJA 2XT1B 4H88L 4P5MA 4WIQA 5DEGB 1ZHKA 3ZE2E 1NGWB 3RKPA 3O6FC 1T20B 2G5BA 3QCUH 4HS8H 5IVZB 5CJBA 5BRZB 3A6OA 5C07B 4Y5YC 1OARH 1QO3B 3SKJH 4N8VB 3H42L 4HZAA 1DQQB 3O6FB 3BKYH 5DFWH 3ARFC 4UOW0 3H3PL 4L1DA 5GGRY 5HHMD 2DF3A 4JM2C 1ZHLB 2ZNWA 4NRXA 1OQOA 4Y5YB 5IW1B 3AC0A 4MJ5B 2ZOKB 1FL6B 5IHUL 5IBLD 4YHIB 2R1YA 1NPUA 3MR9B 3PQYD 3RX7A 5SWZB 3JWOH 4U6YA 2XQBH 3ARFB 3OXRA 5FYKL 2Z8VC 2W91A 3OMZA 2Z35B 4JM2B 1FGVL 3D18A 4LHUD 4P4RA 5F7EL 3G6AB 5ADPH 2HRLA 4HUXA 4JFPB 5DK0A 3CZJA 4I3SH 4DKEL 3FQUB 3V4UL 3O9WA 4LSTL 3P3YA 2QKIB 4M8QA 1XF2B 4WUUD 1BZ7B 4MXQA 1EO8L 4PRDB 5E9DD 1T03H 4ZUUB 2EDNA 1EMTH 4OZHB 4P9MH 2GIYA 1F3JA 1MI5D 2OK0H 2Y36L 3IDMA 4XAWL 3IKCB 3EZ8A 4PJHF 3IDNA 1T5XB 1FIEA 3STZB 1DBBH 2A6JB 3BP4A 5CMAB 5SX5K 5DUPH 4X9IA 4LLMA 1ZE3C 5ESAA 5IB1A 1NAKH 3N1GC 5DURD 3MYZA 3ULVD 5D70H 2DQHH 1OSZA 5CAYB 2LQRA 2J8OA 1E27B 3RIFK 3B9EA 1NBVH 5HI5C 5HVHC 2CDEA 1UZ8A 1K8IA 1KPUA 4TRPL 4RGOH 3I6KB 3BWAA 3QI9D 3PP3K 4WI9A 4XNXH 5GS0D 2Z93B 3BP6A 1F02I 4Z78A 3VE0B 1OPGH 3VJ6B 5HVHB 5F8QC 5C2UB 3IDYC 3ARWA 3VFTA 5SWQB 2GJJA 3N1FC 4D0DA 3EKCA 5DZNA 1A9BB 4OFYA 2CIKB 5E70A 1UKSA 3L3IB 5FM5O 1OGAE 1MCCA 1EGJL 3UJIL 3QZWG 5DFVC 1GGBH 1OLLA 1RFDL 4BH7B 3IDYB 3AY4C 4W6YB 3SDDB 1TZGH 1SVCP 3DARA 4ZYKB 4OLWH 4K3GA 1ZSDB 4WHDA 3IJSA 3IDGB 4F7EB 1A7NL 2WWMC 5JHLH 3L3OA 3G6DL 5I73C 3DX6B 5KG9B 3ULSA 2PUQT 1EVUA 4NM8L 5CFHA 1AXSA 3GMMA 2R0ZL 3QUXC 2VLRA 5C0IA 5FV2A 1II4E 3NTCL 4H0IA 1IC5L 1K85A 4CN1A 1OP9A 3ULUD 2VMFA 1KCRH 2IWGA 1DEDA 3CMGA 4M48H 3MV01 4OKDA 3GGWA 2BK8A 3QUXB 3L3KA 2CMRL 1CE6A 4GSDL 4CJ1A 3BP5B 2EICA 3PGDA 2D9QB 1YYLH 3D9AH 4JQVA 3H9ZA 4UT7L 2OR7A 5CEZH 5C0RL 2N1KA 3RI5K 5JXAL 4KTEL 2A6IA 4XVJL 5C0CD 3EJJX 3IU4H 5DVOA 3MA7B 1KCLA 3BOVA 1YY9C 4DAGL 5E1AA 3PWNA 3LKQB 2C4FU 4G8GA 1MFDH 1V3KA 3RKDD 1MPAH 3KPNB 4R2GC 1P5UA 5T1MA 3DRTB 2Y9RT 3ARDB 2YSSA 1OAUH 1QSZA 2EYRA 2IMMA 3S5LB 4WV1C 5JZ7C 5CZXD 1BVLA 1MIMH 1LVEA 4WTXA 2O5XH 4YFEA 2Y25A 3WE6B 4R2GB 4TPRH 2VLMD 4U1IA 1CTOA 3HC3H 4G3YH 4PJAF 4Y4HD 3MV11 5EN2A 2QQQA 3L5WA 5FM5M 4MB4A 1MELA 3JTCA 3MBXH 5DXWA 1KCSL 1T1YB 1UB5A 1Q9OB 4HKJA 3P73A 1MH5A 5DUBB 1FJ1B 2BRRL 1VFAB 1A1OA 1ZGLM 3RWJB 1JWMA 4UUJB 5T5NG 5JNYA 5F7FA 5JW5A 2A6DA 2DQJL 3ZYZA 3OB0H 4FFWC 1F3JB 1HYRC 4M5YH 4P2RB 3G5YA 5J3HC 3P4OA 2H6PB 3IDMB 4Z76A 2FSEA 4XZUB 4L3ED 4JANB 5IMLB 1HXMB 2XWTA 5D5ME 4JREB 5FHAH 3QEQB 3BP4B 3W0WB 1WBYA 3MRCA 3O8XA 5D1XD 1DVFD 1WV7T 4NZJA 5C7XL 2ZUSA 4HJJH 1K6QH 2NY2D 1ZGLP 4GT7A 1UZ6F 3T0AA 1HHHA 3GI9H 4YO0A 5B38A 4S1DD 3LKPB 3ZYOA 3RWDB 4JFFE 2V9TA 2JB6A 2UV3A 2WIMA 1P7KA 2E6PA 4R8WL 4LCYA 1YJDH 5BRZD 1I9IL 5C07D 5DD1H 1KSRA 3VI4E 1EHXA 2FEDD 2AXFB 4PS4L 5GGVY 2MQCA 3MV7E 2P48B 1AGDB 1BLNB 1HIML 1K3IA 3T0EC 1AGEB 4F37F 5E8EB 1RZKL 3O6FD 3VFRA 4OTXH 2AW2A 3QDJD 1CL7H 5EU3A 1XT5A 2DQGH 1R3JB 4DCQA 3FRPG 1HQ4A 4WEUD 3CXDL 2Z31C 1QBAA 3RY6A 1NCDL 1EJOL 2RB8A 1JRHH 4FQXC 4GXUM 3T0EB 3PDGA 4JFDA 4LQFL 3ARFD 5DJ2A 3UBXA 1DSFH 1FIGL 2DIJA 4DZ8B 2H26B 1MNUL 4JM2D 2BJMH 3EYOB 4PJDF 1YN6A 3OAYH 3IU3A 3QO0B 5LWYL 2Z31B 5HI3C 2CO7B 4KMTH 2E3VA 3DV6A 3W2DH 4PRPB 3SJVA 1L0YA 5EH1A 4FQXB 4C57C 1FCCA 1CGTA 3RWIA 1RZKC 2VLRB 1NEUA 2VZOA 4XCCL 1JHLH 1HHJA 3CH1A 4OZFH 2I5YL 4KRPC 2FEEI 1K5NA 3RU8L 1VFMA 4YH6A 4I9WD 2HTKD 5MENA 4M7LT 1MLCB 4EDXA 3UAJC 1HILB 2DLFL 2P5WB 4D0BB 1RVFH 3BIAX 1PEWA 1UWXK 2FDBP 3N9GH 4HFWB 4KRPB 4NDMB 1C1EH 1JVKA 3T2NL 3DV4B 2DTSA 4G9FA 5KTEH 1FORH 1I1YB 3CC5A 5FYKD 4O2CB 3HFML 3KDMB 2VAAB 2LAGB 2Y5TA 4HDIA 5F6HI 5I75C 1QSEE 2R0KL 4Z7OE 1YEHL 3C08H 4PFEA 2ZG2A 4U4BA 4XB7A 4OCYH 4PJCE 1BFOA 4L4VD 3OKDA 1L0QA 1QRNE 5HI5D 5I75B 1AGFB 4ORGB 4X98A 1X7QA 4UINH 3OG6B 4WNQB 4OM0H 4CBPA 4OUUB 3NAAH 4OZIA 2CLRB 3VFNA 4XNYL 1T2JA 4KGJA 5F6IC 4F37K 2DMKA 1NGZA 1U8IA 5DWUH 4YR6A 5HDOA 3DIFB 5TH2B 4LLWA 3FMGH 1UM4H 3FT3B 1H15B 4U1IB 1KXVC 1KJVB 5CD3A 2C3GA 5F9JB 1H5BA 1JUFA 4N8VG 4PGZA 3I3DA 5F6IB 1EPFA 2QQKL 3QDMB 1CGYA 4Q2ZB 1BPVA 5DFVD 1MCKA 1IGJA 2X4TB 4N1HB 5MEPB 5HGBA 5DK2A 4PGBB 2XWJB 1WJ3A 4MWFB 5JR1H 4KY1H 3BPOC 4YE4L 1UACL 3WMSA 3LRSB 25C8L 3NCEB 5F3HA 4DTGH 2WWMD 2VLKA 5H35A 1ZVSA 5TPWL 4IHOA 2BFVL 5BO1L 3RQ3A 1Z5LA 4CMMA 2PYEA 4Y4FB 3KGRA 1MCHA 5E4EC 2X9WA 3QUXD 2EO1A 4R4ND 2Y07L 3ZTNH 2CK2A 3KNBB 3BPOB 3PABA 1QBLH 1WBYB 2R4RH 3O8XB 3A6CL 2IQAB 3P11H 5TE7L 4PRHA 3FQTB 4YAQB 1A3LH 3SGEH 3P9MB 1MAML 5E4EB 1AXTH 2FHFA 3NCMA 5HVWA 1DQMH 3V2AR 3OAZK 2DQTL 3WFDL 5H37G 4QRQB 3DROA 3DXAA 2CRMA 2BHZA 1OAKH 1RIVL 4OF3A 4QOKA 1C7SA 4UT6L 4YGVA 1H3XA 3S98A 4QTIH 5E8NA 4NN7B 3ZHDA 3F7YA 4L8SC 5C09B 2D7OA 4X0KB 2P4AB 4BZ2L 5EZLA 3ZE1E 1YY9D 3AGVA 4M7LH 1KJ2A 1MVUB 3S88H 5DS8A 1YUHB 3BH9A 3WS6A 4GMSL 4XNUL 2AKRB 5TDOB 2GSGA 1CDYA 5KVFL 1VHPA 2EECA 4L8SB 3KPRB 4R2GD 2XA8L 4UNTA 3FQNB 4OLXH 4PB9L 4RCAA 2BVQA 5JDSB 1KNOB 2BNUB 5JZ7D 5DD5L 1EEQA 4AIOA 4MD4B 2HKFL 3HG1E 2R56H 3U9PH 3ZTJH 3SJVB 4TVPL 2NY6D 3CPLA 3CAFA 3MNVB 43C9A 4AK1A 1LEIB 3ULVH 1IQWL 2C3VB 4FZEL 3D6GA 2A73B 4MJIE 1NUFA 2YD6A 4OSUL 2A9MH 4DN4H 2BVOB 5DZLA 3UDWA 1CF8H 2IH3A 1RHFA 4P2RD 3SE3A 1RPQA 5TE4L 5I16A 1I8LA 5F88B 2E7BA 5GS0H 1GIGH 5CGTA 3QEQD 3W0WD 1OD9A 5EWIL 3GMPB 4FFWD 5K93A 3QXWA 5J3HD 1FFNB 5I1DA 1KN4L 4M9OA 3V6FA 4ERSL 3CC5B 4LK4A 2NXYC 5GGQH 5T1KA 3C2AH 3V0WH 5GRWA 3Q6FB 4X9FA 4APQC 1I1FA 3T65B 3P30H 3MV8A 5MHSE 4QRRD 5DD3L 1G6VK 3AU1B 5IBTL 2NXYB 5GGTL 1FDLL 3AB0C 4Q9QH 1TJIL 1PSKL 1M05A 5DQ9A 4YPGB 4X7FC 5D7KE 2BCKB 2GJ6E 4PJFB 2PW1A 5BXFB 4OV5A 2QQLL 3FB6A 5IKCA 3REWB 3DO7A 2R2HA 3LHPH 1A6WL 3AB0B 3BD3A 3ULUH 3T0ED 4HIEA 1H5BB 3ARSA 3IETB 3WBDA 5J12C 1JYVA 1YECH 3CK0L 1RI8A 3TCLB 4C56E 4PUBH 4PRPD 2EZ0C 2VXSL 4FQXD 1OSPH 2CUHA 3I85A 3TNNB 3DMMC 2R1WA 3QUZC 1I1AC 5FYLL 5J12B 1F4XL 3RGVA 4RX4D 4CRPA 1BF8A 3GHEL 5DMIL 1LK3L 4IHOB 3VXRB 2VH5L 2PYEB 3DMMB 2V2WA 4A2MA 4MB5A 2ICCA 1I1AB 3QUZB 1H3PL 3TCXA 5C0AD 4EN3B 4ZTOH 4CNIB 3PABB 3E6FB 5D8JL 4NKMA 1I8IB 2V7NB 1F5WA 1WWAX 1QSFE 5HHMA 4Z0XA 3MLZH 1DUZA 1QD0A 3EJZC 4UTBL 5HVGB 1XCTA 5E4IA 5C0GB 1WITA 1MCEA 1J0HA 5BZWB 2OR9L 3PP4L 3UAJD 3MSPA 5KVGL 5GRZA 1KELL 3RNQA 4RAHA 3PQYA 4O02H 3DROB 1OWWA 4JQIL 1BD2B 4RWYL 3BO8B 1AY1L 4QOKB 1GPOH 1D5MB 4IBLT 1E4XL 2JIXA 4Y5VC 1CFSB 3EFFB 1TCRB 1IGML 3V6OE 3RWHB 2WUCL 4I2XB 5I74C 4X6FB 3BAEH 3B8YA 3LIZH 4UIMA 3LH2L 2GJZA 1KJ2B 3WJLC 3DGGA 2WANA 5HPOA 3MRGA 3MFFA 4Y5VB 5E9DA 3I9GL 3WUWB 4WU5A 1SYSA 4LARH 5ILTH 2V6HA 4ZDHA 2YZ8A 1MI5A 1NMBL 2FD6H 5EC1A 1LILA 3H9HA 1MWAL 2OP4L 4Z7UA 5I74B 3SKNB 3BKCL 1E4WL 2PCPA 4YHNA 5SV4A 2BVQB 4IOSD 1XGYH 4Y2DA 1VACA 1IKFL 1B9ZA 4HUWA 1T2QH 3GK8H 1A1NA 1MHPL 3DETC 4JDTH 3PJSA 1BX2B 1BOGB 3RY5A 1YYMH 2B1HL 1FH5H 1FP5A 3MRDA 4Z7WE 4ZFOL 4FFZH 1OTTD 3OPZL 1JNLL 4ELMB 1IEAA 2EDYA 3KPSE 3OKLA 4M6NH 2OJEA 4JPVH 3T3MF 2QL1A 5CCKL 3ARYA 2DQUL 5C6TL 5I16B 1AKJB 1WAAE 1J8HB 2WBJA 1LDPL 1TMCA 3EFDH 1C08A 3U79A 2Q20A 4CVXA 5F7DA 2JJUA 5EU6A 1KB5B 4DQOH 4AQOA 1PQZB 4UILL 4N0FA 4ONHB 1JCKA 3GSWA 3H7BA 4XCFH 1PG7H 4KZDL 1BVZA 1KTLB 2BVEA 3D39E 1SYVB 5FYJL 1EO7A 1RAMA 2Z91B 3MV8B 4ZFOB 4X7TB 1FNAA 2BNRB 3MLVH 4JFEA 3CDGA 3QNZB 5C09D 1C16B 4H88H 1J5OL 2DMBA 4GKNA 1T83C 2ESVB 4ZFGH 2J8UA 2B1AL 1QNZL 1KFAH 3F7PC 5HDQL 4XMKH 3LQAH 3TYFA 1VGEH 3GMQA 4X5WA 4FZ8L 1T4KB 5TE6L 5C9JA 4K7PH 5ENWA 5FO9A 1NMAL 2VR4A 1KTDB 5IHUH 2ZCKL 4D9RD 3UTSE 1R0AH 1LD9B 5C3TA 3BFOA 2ARWA 5IVNA 5FYKH 4DW2L 2C7UB 4E41E 1FGVH 3U46B 3CFDA 5CKAA 3K46A 1CXKA 5F7EH 3TJHC 1ZLSL 5I1CL 1NBQA 3I02A 2CR6A 4LSTH 4CU6A 2Z8RA 5DHVB 5FV1L 1OWRM 2VDPL 2W0FB 1RZ8B 5HBBA 2F54B 2I9LB 4KJYB 5AYUL 2AJUL 1EO8H 2KZWA 4HC1L 4RIRB 1A22B 2V5YA 4Z7QF 2DI9A 4QT5B 2P24A 1E6OL 2HT2D 4XAWH 4M62L 5IMMA 5DA0B 3RNQB 1TTFA 1A21A 5DHYA 1EHNA 3CFCH 1AC0A 1YC7A 1PKQA 3B8SA 2O5ZL 4NQVA 1DANT 4XP1H 1V05A 5J57B 4U1JA 4Y4HA 3GDBA 4TVPD 3QXDA 4G7VL 1HSBA 4AL8L 3RIAF 1H3WM 3IFLH 3QQNA 2X70B 4LPWA 5J89A 5DC0A 1F3DJ 1WCBA 3V5HA 1YPZE 1OAQL 1NJ9A 4ELKA 4YXKL 4GOSA 4U6TA 3JWDH 4APQD 3T1FB 5IB4B 5DF0A 3MJ8B 4QHKJ 3LS5H 1A7PL 1OGAD 3SPVA 3VRLE 1K4DA 5DJ8A 5HHPA 4L3EA 2PCPB 1TZHA 4LCWE 5AUMA 4OF0A 1I4FA 1IZKA 4FXKB 3S37X 3UJIH 1EGJH 1DVFA 4MNGE 5I15L 4N0UB 5JW4M 3MRJB 5TDPA 5GRJL 1SJHB 1VENA 4LASL 4Y1AB 5JORB 2E9WA 4YHPA 1DQDL 3VFGH 1TETL 4WFFD 3S97C 3UBXG 4BYHA 4RFOH 5C0BB 4NQSB 1QHPA 1AD9B 3S96A 3F12B 3QUZD 1I1AD 2X4OA 5I6XC 4XI5C 2R0ZH 3D87B 1JF1B 2AQ1A 3MCKA 5JTWA 3DBXA 3NTCH 3F62A 1S9YB 3QUMH 1IC5H 1ULVA 3O3EA 3LEXB 2D7QA 1RUPL 5D6DC 3QDJA 4P4KB 4O2EB 5DEFB 3JSSA 3S4SA 3D85B 4B7IA 3EO9L 3B9KC 4GSDH 2VQ1B 3PIQA 1BD2D 5DMGC 1EZVX 1XGUB 3AMKA 4PLNC 4KI5C 3EJZD 3HUJE 4G43A 3PV6B 3FQXB 5EU7E 2XWBA 2D0GA 2QR0A 2Q8AL 5C0RH 3VWKA 1HI6B 1BBDL 3AXLB 5JXAH 5FYLD 3B9KB 2OSLB 3VRJB 2D7PA 4OQTL 5BS0E 1S7RB 5I8OH 1ZLWK 1IGCL 4XVJH 2R39A 3RIAK 3KPLA 1JE6A 4BQ9A 4IS6A 4BUGA 4YDJB 3VXNA 2FRGP 2QBWA 4HUUA 3FOLB 4OZGB 3GEWB 4UIKL 1KLUB 3LV3A 3OGCB 5EUOE 4EIGB 1S7XB 4PRIA 1KLGB 1JL8A 4GMTH 4GG6F 2HT4C 2FGZA 2XV6B 1IEBA 4J12A 3V4PL 5EIVA 1T7WA 4O2FB 5DJDA 2P49B 3MUGA 4XC1H 4MNQE 3L9RB 2DLHA 1ZA6B 4RAUA 3SGDH 1GGCH 2FO1A 1KBGH 4ZFZB 2F8OA 3DVNB 3T4AA 2V9RA 3OXSB 1DFBH 4L4VA 4X5XB 2F74A 5I1AA 1FVCB 5EBLB 4MA3B 4JKWA 1JF6A 3VGEA 2ITCB 1KT2A 1IGIL 5B8CA 5D7JA 2DQJH 4NHUE 3EDJA 3N1MC 1IRAY 3RVTC 3QDGE 4PJEE 3GBMH 5IB2A 3LD8B 5HDBE 3NFNB 4BZ1H 5IEKA 2B4CC 4N9GA 4GKZB 4NSKB 4Z7UF 1CGVA 1MHEB 1MCWM 3O4LE 3S3JA 2YC1A 1KJMB 4EDWL 4ZAKC 5JMOC 4JDVB 1HSAA 5AD0A 3U1SH 4UU9A 5HYJE 2DI7A 5FKAB 5KOVC 5C7XH 4ZSOE 3SDXA 2BNRD 3ULVF 2X41A 3K74B 4CU7A 3QEGH 4YGAB 3SCMC 4CVZB 2IEPA 2RCSL 4ZAKB 3QWRD 1ES0B 4K3JL 5EO0B 2IAMC 4R8WH 5M7QA 4Y16B 3WCYA 2GW5A 3QWOB 3RWFB 4UQ2A 4PS4H 2EDWA 4QY8A 3SCMB 1IAMA 4KI1A 1HIMH 5I8KL 4P2QA 2IAMB 1RJLA 1F11B 2YA2A 3MZGB 3V0VA 3R1GL 3BZFA 3FQWA 3GMNB 3ARBC 1EGJA 1T0MA 3DLQR 4UDTA 3M07A 2ATPB 3MUY1 3CXDH 5FO8A 1CICA 3RWEA 1WFTA 1WBXB 3WUWG 3BXNB 5CBAB 1X44A 5T5NF 1BEYL 1JGDB 1F13A 4M61B 4R96B 4EOWL 3GMRB 3GSNL 5HI4C 5FYJD 1FIGH 3L5IA 3JVGC 1M71B 2FEEL 5F89A 3G04A 3MREB 5LWYH 4Y4KA 2K7PA 1Q8MA 4KKCC 1PX3A 2YUVA 3LN4B 3MYJB 4Y19E 4IOFC 4XPGL 3KPTA 5CJ5A 2F54D 4WDIA 3QUMA 3TJHD 1H3GA 3T77B 5B3JE 3MFGB 2I5YH 4H1LB 3TGXA 1L7TL 3SDYL 1LHZA 2CPCA 2J8UF 3GRWL 3S36X 3L1OH 3ULUF 3OR7B 4YEEA 3VH8A 4QRPD 1S7QB 2G9HB 1HCFX 1QSED 4PJHE 2WK2A 1FFRA 3BIBX 4Z9KB 1HHGA 1NCAH 1LEKA 4NQDD 3T2NH 4JR9L 1DBKL 4PJ9C 4DN3H 3DRQA 3GSNB 3VFVA 1IQDB 4LHJB 5GGUA 3HFMH 1RIUL 1X5ZA 1JGEA 1A4KA 1I3UA 4GKOA 3QPXL 3UTTA 4OUOA 3S37L 1YEHH 3FRUB 3HNTL 2KDGA 4YHKL 3VRIB 4TSAL 3X3GL 1A2YA 3F5WB 1U95A 1YEDB 3NCFB 4NO5A 2R2BB 2OTUA 1GL4B 4F57H 4Q6YA 4QXUH 1EBPA 2EYTB 2MHAA 4MCZB 4BH8A 2BXZA 3BP7A 5ALBL 1NAML 4WO4C 4ODSH 4PV8B 1IJ9A 3DUHA 4YQXL 1EAJA 4NWUH 3K7UA 4OGYL 1HOCA 3KXFB 1YY8B 3FO2A 2WQRA 4AMKL 5ICXA 1G7IB 3VMNA 2I9TA 4F2MB 3NZ8A 4LLQA 4RGNC 1AP2A 4WO4B 1KYOJ 1R3LA 2QQKH 3NCCB 5C0EA 1FPTH 2R0LL 2F8XC 1VERA 2EDFA 4HKZA 5C0BD 4DUXA 3GJFH 5ANMA 1RZGB 5KSAC 4DK3A 4QRRA 3TT1L 1HE7A 4RGNB 4U6XA 2DKMA 3WDHA 1GVIA 4WJ5B 3CVHL 1T22B 1PX4A 5B8CB 3WKML 4YE4H 1UACH 2X9XA 4HGWB 1U8KA 25C8H 3RTQC 3U0WL 3ORJA 4UB0H 5DD6B 5KSAB 2RAMA 5BO1H 2BFVH 3F7RA 3V5DA 5L2JA 4MSWA 4XI5D 3D85D 2VIRB 1NAMB 2IH1B 3RWGB 2Y07H 3MRMA 2ICWJ 4U6HA 1N6QL 4HPOL 3RTQB 4J3VA 4JVUA 5IVXE 3SDXB 1W8OA 4NCDA 2PO6A 3VXUE 3B9KD 1ED3B 4H0GA 1ZXQA 3TIEB 3WFDH 2DQTH 5DMGD 1B3JA 5ID0B 3ARVA 4KI5D 1N2RA 3HI5L 3D48R 2P8LB 1KXTB 4OJFH 4RX4A 2DAVA 2ARJA 4HKBA 4B0MM 2Q6WA 1BIHA 4UQ2B 1FC1A 4LVHC 3MZTA 3VFPB 2LABA 1XF4A 1LE5A 3WL9A 5ABDE 2XY1A 3PWVA 4NQCE 2VABB 1M7IB 5C0AA 1TVBB 3V0VB 3SKOA 5I8EA 5KVDL 3HI6H 5C08D 4LVHB 4GMSH 5T3XL 1KC5L 3O11A 5KVFH 5FUCE 3FZUC 2ZNXA 2CDGA 1S7WA 2XA8H 4FABL 2FZ3B 3VD7A 4PB9H 2ADGB 3LQZB 5ERWB 2OI9A 4FQCL 2NNAB 1KXQE 3MLPA 1X5GA 4PJAE 4R7NB 5E1HB 1P4LA 5DD5H 4PJBB 3WIIL 2BSSB 1OP5H 4JM2F 5F7NC 4GFTB 3EHBC 4WY7H 5F3BB 3EO0A 5FO7A 1JBJA 2PYFA 3O6LL 3QB7C 4XXDB 3VFUB 1KEML 3M8OH 2BX5A 4OM1L 4WFGD 5F70A 2DM3A 1FYTB 4FZEH 3BGFC 4H26B 5EBGA 3MLXL 2NCMA 3NZHH 1N5YH 1EFXD 1YNLH 3OJMB 2D9CA 4OSUH 4PJGB 1GZPB 4HS6B 4V3DB 1AC6A 2FH6A 4L5FL 1I8MB 1ACZA 3M17A 4OZHF 1LO4L 1GZQA 2FH8A 5HYEA 5TE4H 5JQHC 4MJ6A 3BGFB 3FAXA 3QISA 5C9KA 1X4ZA 3TO4C 5D1QA 1I1RA 4F9LA 5DRXB 3RVTD 3FCTA 4YX2L 2GCYA 2FJHA 3MROA 4ERSH 1F58L 4HS3A 1AGBB 1AQDB 1N64H 1FN4A 3CFBA 1ORQA 3TO4B 3RVXC 1FVDB 2HFTA 3TBTB 4ZAKD 2BOCB 2G75B 2R0WL 2AXJA 4U0RC 3LDBC 1D3CA 3E8UL 5GJSH 4OLZL 4YXLL 2ICWA 5DD3H 1U8JB 4JO4L 4X4ME 5E8PA 5GGTH 4PGJA 2AXGB 3SCMD 1FDLH 2MHAB 3EYSL 3DVIA 3WNMA 1PSKH 4XMLL 4U0RB 1TVHA 3LDBB 4NQXB 4K8RL 1I9RL 1C5BH 1A1MA 4PTUB 1CT8A 1JGUL 4U33A 3TPUA 1F90L 5DR5L 4Z8FL 1JPFA 2VLLB 1LWRA 1NGPL 2VWEE 4YHMH 1T80A 3LKNA 3EDDA 3OX8A 4P9HL 4PG2A 5CHNB 3ARBD 2ZCHL 3S36L 1SMAA 3CK0H 3GJFA 4PJDE 2VXSH 2DLTA 2EXWC 5HI4D 1H3TA 2I60L 4LEXL 1KB9J 4K8RC 5GIRB 4QCIA 3SBWC 3QRFM 5E94A 3VD4A 3R06B 1JPST 1BZ9A 3L3HA 4WW2C 2DMCA 3GHEH 4XXCA 5DMIH 4KKCD 2X7LB 2VH5H 2ORBL 4HEPG 4U3HA 5J1AB 4IOFD 4RA3A 1H3PH 4Z0BH 1IM9B 2YD7A 4P9HC 3QNXA 1PY4A 4QYOA 2FO4A 5D8JH 3QQ3A 1UFUA 4MNHA 2AJXL 3FQRA 4LSVL 5CGMA 4FQ1L 3QO1B 4X99A 1G7MB 1NEZA 4HLJA 2LU3A 4WWKC 2OR9H 2ADFH 3MRLA 3B9VA 4JHZA 5KVGH 4GAGL 1KELH 3MBEC 4QGTA 1L7IL 3JV6A 3PUCA 1FL3B 4JQIH 2Q87A 1RZFL 4RWYH 4Z5RB 3GMLA 4OT1L 1MJ8L 2ARJB 4HKBB 1MFEH 1I8KA 1E4XH 5D4QA 1BQHA 4WWKB 2ZG1A 3U83A 1EEYA 1FNSL 1IGMH 3MBEB 2YMXL 1U3JA 1U8MA 2WUCH 2AJSL 3T0VA 2P8PA 4JFXB 3AREA 3HE7C 1UA6L 4XH2B 3LH2H 5CJXA 5DJ0B 4YHOL 5ACZA 1HH6A 2XZAL 3I9GH 1ZEAL 3O11B 2R2CA 2FJGB 4TTDC 1S9WB 5FOBA 1NMBH 1MWAH 2OP4H 3HE7B 3BKCH 4WO4D 2Y23A 4QNPF 2APFA 4K2UH 2BRQA 3QRGH 2R2EA 3MRBA 2YR3A 1S9XB 1VB9A 2WZPD 1MHPH 3DTXA 2H2PD 1CFNA 1Y18B 2B1HH 4RGND 1JI2A 5ESVB 1RHHB 2CIIA 4DZBB 4IOIA 5ISZB 3TEUA 3OPZH 4XCEA 1FFPA 3PHOA 4LGRB 2A0LD 1CLYL 3H0TA 4M93C 5LKNA 1YMMB 2EDOA 2IPTL 4LIQE 5D2LB 5CCKH 3QCVH 5FCSH 5EB9A 5KSAD 2DQUH 1PZ5B 4G42A 1OGAA 3IFNL 5FDWB 5FGCB 3PWJA 1FVEA 5F9DC 5C6TH 3X11B 5I1LA 3P9LA 1SEBA 5E5MA 4EQ3A 3HKFA 4RMSA 1YC8A 3C6LC 2GT9A 4M93B 4NPYA 3KHQA 5GS1C 3RTQD 3BI9X 1N8ZA 4PJXB 3TV3L 1F2QA 3ARGA 1FZOA 4UILH 4RISH 4OF5A 5LCVL 2F15A 3BPLC 3H3BC 1NFDB 4MJ4A 1NKOA 5D72L 4H1LG 3C6LB 4HHAB 3BPCB 5GS1B 3D0LA 4RDQF 1U93A 5EU5A 4LLDB 3EOBA 5CIPH 2W9LA 3C8KA 5C0JB 3PHQA 3BPLB 5FAAA 1R3HB 3FO0L 1JPSH 4HCRL 2Z0BA 4YHZL 1NGXA 1IBGL 1A7OL 1UB6B 3PNWB 2CXKA 2M1KA 3HC4L 5TGBA 5GGRB 4NRYB 5LVEA 2B1AH 1QNZH 1R3IL 3JTTA 3VFOB 2UUDH 3FB7A 1FLRL 4LSRH 4GAYA 3GIVA 2BNQE 4ZD3L 2XZCL 1KGCE 4FZ8H 5TE6H 3IXTB 3GSXA 5IFJA 4PIRF 5IEHB 5DRZB 3FZUD 5EBWB 3WUZA 5E03A 2ZCKH 3HI1B 3HZKB 1U2CA 2EEBA 4GLRH 2G2RA 4XTRC 4DW2H 1FYTD 1I7UA 1MQKH 4I3RL 3MRPB 3U7YH 1C5DB 2Q3ZA 3MO1B 2EC8A 3EHBD 3BISA 3N50A 1N5AB 2H9GA 4KC3B 1GRWA 1NFIB 1O7SA 3QQ4B 5D71L 1UXWA 4A6YB 4JZJC 2Z4QA 5FA4B 4FQQB 1CDJA 4J8RB 2FYYB 4E5XB 4DEPC 4HC1H 5T3XD 2MSPA 4XPAL 4X99B 32C2A 3QG6A 1EX0A 4UV4L 3QCTH 4XWGL 1QBBA 3MLRH 4U1NA 4JZJB 2PN5A 1UCBL 3MRLB 2FWOA 5IJKC 2AEPL 3RVWC 1KPRA 4KXZI 2FJFA 4DEPB 3QA3B 3TO4D 1JNJA 4KHTL 3O2WL 3FFCB 1JMXA 1MCJA 4OLUH 4D9LL 5E2WL 2PXYA 3C6SA 3E2HC 5FK9A 2IANE 4AL8H 1R5VB 2DQEL 4MDJB 1T5WA 1AIFA 5HY9A 4LVNC 4FQLH 2VZSA 3UXFA 4ZFFA 3RVXD 2DD8L 4I3GA 3T2OA 5D5MA 3DWTA 3UTPD 3E2HB 4YXKH 5SV3A 3L3DA 3Q3GB 4P49A 1A7PH 1NGQL 4P3DB 3LN5A 3ZKMD 1MWAA 3ZYIA 4YDVA 1M1SA 3WIHL 2X4QB 4LBEA 4QRTB 4KUZL 2OTWA 2XY2A 5DJYA 4CVUA 3GNML 3BESR 4JFFA 4AZ8A 5D7LE 4YZFF 3VXSB 5J11C 2ID5A 4PY8J 1YNTB 5DZOA 2Q86B 1A4JA 2GSIA 4TNVF 5I15H 1LO2L 2CIIB 3PL6A 1MFCL 3IF1A 1S8DA 4UNVA 3MV7A 3EYFA 4LASH 4W4NA 2GI7A 3JBG7 1DQDH 1T3FB 1TETH 3MOBH 4ZUSB 5J11B 3QWRA 5IB5B 2VAJA 1QFHA 2XKSA 5E8OA 3SO5A 1NBZB 3BMVA 4K8RD 1MIEL 1IM9D 2HP4A 1ETZA 2QHRH 3KLAB 2FATL 2GTZB 5ITBH 1T83A 5D2NE 5E8DL 5LXGH 3D2UB 3HPJB 1T6VN 1A6PA 3NOIA 4XBPB 3WXWL 3BKML 1K4CB 4OCRL 5BS0D 1RUQH 3EO9H 5GS2D 4BFIB 1ZWIA 4RFNB 2VL4A 4MGXA 3WHE1 1MCLA 1RIHH 1EERB 1ZAGA 1MJJB 5CIPA 3STLA 3CFEA 4IRSA 3C8KB 4LQ1A 4XBGA 5CEXA 2D31B 4WWKD 2VUOA 2Q8AH 4XHQA 1T1XB 1BBDH 3GIZL 3FTGB 2R9HC 3RHWF 5CD5C 4OCXH 1IGCH 5I1EL 5HYFA 5HTSA 3MLYL 3DSNA 4FXLA 4P48A 5EBMA 3RL2B 2FL5A 4JY4B 3MXVL 4OB5L 5HJ3B 3C9NA 1B0RA 3JTTB 2ZSVB 3MOQA 4UIKH 2X4RA 1UH3A 2H2SD 5INCA 5T3ZE 4QRPA 5DTFA 4M4RA 3OKOB 1QSEA 3V4VL 7FABH 5CINL 1KYOK 4KGLA 5TFSH 3LPFA 3VXOB 3P77B 3KPMA 3X13B 4EUPB 1S9VB 3BRGC 4TTDD 5EZOL 4PJCA 4NQDA 4PRAA 3V4PH 1INQB 2Y06L 2RFXA 1QRNA 2Z92A 5E6YA 5GJTL 5ISZD 2BVPB 4PGDB 4AJ0A 4TNVK 1MCQA 5GGVL 3ILPB 4TUKL 2Q1EA 1YMMD 1JWUA 2OX5A 3MX0A 4DVBA 3BHBB 3QDGD 2H9GB 3VFMA 3H9SE 5IFAH 3T0WA 2E7LC 1WFUA 3AS2A 4HC1A 3O4LD 3ZL4L 1U8QA 4IJ3C 3RBSA 1I3RB 1B6UA 1IGIH 5GSVA 1XGPB 3FT4B 5B39A 1R5WB 4HBCH 4OBSA 2P1YA 5GRUH 5EIIA 4RAVA 4NNPH 4L3CB 5I8CA 3IVKA 1S7UA 2H8PB 2Y1VA 3C6LD 4FMFA 3VGHA 4X6EA 3BN3B 1ZVHA 4OAWA 4WW1A 3QH3B 5HHVH 5K33A 3V7AG 4EDWH 2K9UA 3WLBA 1RV6X 1BBJB 1X6NA 2Z8WC 4MXVE 2XN9B 1UC6A 1OM3L 5IHLB 4N8CL 4EZMA 1IGFL 1HHIA 2X44D 4OGXH 1IL1B 1I7ZB 5L8KB 3GJFK 1WGOA 4F33A 3SGJC 3VWJC 2ADIA 3DUSB 3RHWK 1BWWA 2DKUA 3MV9B 3D0VA 4PP1C 3G5ZA 3LN5B 3QNYA 1LNUB 5IF0A 4GRLC 1QR1A 2B7DT 4GXVL 3EDFA 5IM7B 1XGQB 3F6IA 2V2TA 4GO6B 4KJQC 1DQJA 5GS3A 2BC4A 4JRXE 1BMGA 1DDHB 4P2OC 3NABH 2UWEE 1KIRB 1ZS8A 4GAJL 3BZDA 4QGYA 1Z6JT 2F53B 3UTQB 2RJMA 1BEYH 1FSKC 4UT9L 4FP8L 1KTKE 3FB8B 1I3VA 2IQ9L 2VE6A 1PYWB 1MRFL 2MMXA 3UTZA 1MHHA 1QVOB 4JDZA 2X1WL 1F8TH 3SGKC 1B2WH 1QFWM 4H0HB 4QHUB 1TCMA 1AD0A 3OKMB 2BDNL 4XCYA 4JFOB 3LPWA 4XTRD 3CX5J 1U8HB 3FONB 5I1HH 2OQJB 5IIEA 1KEGL 4R4BA 5EUKB 2IFFL 3DVGA 1U8NA 4FTVD 1I3GL 4PY7A 5CKGA 5C08A 4PG9A 3HG1A 4L4TB 1W0WB 4LRNH 3D3VE 4Z7QE 1QQDB 4S1RH 1HQRA 2MCG1 1I7TB 3WLWC 1S3KH 1K3ZA 1DJSA 1RD6A 1X4XA 1NUGA 4IRSB 4PR5B 4HUMB 3SY0A 4MJIA 4JPIB 4JR9H 4F7CB 1DBKH 1RURL 3KYOB 2J5LC 4K3DL 4PV9B 5ETUB 3H8NA 3O2DL 3RVWD 3MRRB 3WN5A 1OP5K 3QAZB 2M26A 1RK0A 5KW9H 3HNTH 4F7PA 2QJDA 2J5LB 4YHKH 1VEPA 4TSAH 4ZXBA 2VC2L 1VKXB 5HGHA 3KS0J 2X4RB 1ZT7A 3PGFH 1SBSH 5BOZG 3AAZA 5HYSA 5IJVB 1JHTA 3IS1X 1I7RB 3ZKND 5ALBH 4N0CA 2X5PA 1CFQB 5IOPB 3VXMB 4CGTA 4R9HA 1RZJL 5FGRA 4YQXH 5SWSD 3T2QA 1HINH 4OGYH 3ARTA 4AMKH 3FB5A 1XR8A 4LFHG 4PBXA 2FIRT 4WUKH 5CSZB 4XPBL 4ZUTA 1JFQH 1MCSA 1KB9K 1KG0B 1WBZA 3NCYS 2GJ6A 4H8WH 5HHQA 3BKJL 2R0LH 3W9DA 4DVRL 1FNHA 1X5HA 1WT5C 4X6CB 5GRVL 2CD0A 3OR6A 2FLBT 3VFSA 3CVHH 3EGSA 3U0WH 3F58H 2QSCL 3EJYD 1ORSA 2J88L 4C56A 4QLRA 4UDUA 4HQQL 1RY7B 5HHOE 1IKNA 3S34H 2W0KA 3BRFA 1N6QH 4HPOH 5GSRA 2FBJL 1I9EA 1T89A 4XP9L 4BKLA 4WI5A 1TNMA 1CD9B 1CXHA 4TSBH 2EIBA 3B3IB 2HLFC 3VI4F 5JOFA 2DQIL 1LE9A 3MJ7B 5DRNB 1FAIH 4E0RB 2DYPA 3HI5H 4MQ7A 4GW5A 4OCSL 3KPOA 2ZG3A 1QSFA 2D7TL 2VL5A 1Z9MA 2NY3C 2R9HD 4CUCA 2YA1A 1BOYA 5CD5D 5IQ7L 4MQXC 2ICEA 3T1WA 3DECA 2EC9U 1Q94B 2XACC 3TBVA 4MAYD 5EOCH 4ZS7H 5GRXG 1F4WL 3MLTB 1A14H 2XPGB 3OL2A 5KVDH 2NY3B 4JPWH 3O45B 3TVMD 5T3XH 1KC5H 2HG5A 4HKXB 4GG6E 3RAJH 5HHME 1VADB 4XNMB 3V6OA 4U1MB 2VQUA 4PDCE 5EO1B 4F15C 3I6GB 3PQYE 3WIIH 4Z77A 1IGYA 3KPQB 1JYWA 1WFOA 3O6LH 1T21A 2EEAA 3BDYL 5H94B 1KEMH 1OLZA 4F15B 1BM3L 2AJZA 1SJEA 4DOHB 4HX1A 1JFMA 2MTPA 4P23A 3MRIA 2WY3A 3CMOL 3JV0A 4L5FH 4WUUE 1KCVL 2IALA 1LO4H 4HH9B 5E9DE 2ENYA 4WHYH 3ZT6A 4Z7WA 2JB5H 5DJXB 1MI5E 4H25A 3VXTB 5JIPA 3KPSA 2V9QA 2VSDA 3VD3A 1T0NA 3IXAA 4YX2H 1U36A 2E6JA 5EOTA 3TN0C 1DN0B 4PJCF 5EO9B 4QHLA 4DUWA 2QSTA 1IC4L 1LQSR 1WAAA 2XZZA 3G5VB 4JLRB 3U6RA 4KAQL 3ULVE 2WBKA 3V6ZB 1CG9A 4EI6A 4NO3B 4NOBA 3TN0B 3MV9D 9CGTA 3MMEA 3NN8A 3E8UH 4OLZH 4N0YH 1BAFL 4P5KA 3NPSC 1Z3GL 3EYSH 3PWUA 5DJ6A 1FC2D 3CH8A 3VWJD 3QUYD 1N3NB 4ZPTA 5MEQA 1YA5A 4U1SA 3L95A 4G8IA 4CJ0A 5J1SC 3MNZA 2CUMA 4GRLD 1OW0C 4J4PC 1JGUH 2F53D 1F90H 2VISB 4XVSL 1MCDA 3BZ4B 1OL0A 2A1WH 5C6PB 3MLSH 5FA3B 1BGXH 3THML 4PJ9D 2PKDA 4NZTL 3FOMA 5GZOC 3QEHA 2ZUQC 4JJ5A 4P59L 4YIQB 1VEMA 1AE6L 4P2OD 2MNUA 1ZT4B 3MUJA 1V5JA 1A6TA 4S2SB 5FGBC 4YJZL 4HWZA 5ADOL 1W0VB 1R5IB 1RUKL 4AEFA 1T04B 4PJIE 2HMIC 3K80A 2I60H 2ZUQB 1TFHA 3CVHA 2AJ3A 4LEXH 3VFSB 2EIDA 2IADA 5T3ZL 3MCLL 4U31A 1QLRB 4TUOB 2CR3A 5HHNA 3BZEA 2P42B 4OV6F 2VZVA 1AGCA 4I0CC 5I30H 3ULUE 2C9AA 1U58A 2HTLC 3N06B 4CDGC 4MD5A 3B5GA 3C8HA 1KPVA 2AJXH 4E41A 2VOTA 4FQJH 4LSVH 3TIDB 4ODXB 5IESL 5I76B 2P43B 5B21A 5CJ8A 4GW1A 3HE6A 1QFWH 3U9UB 3L3JA 2PTUA 1XR9B 3GUTB 1U91A 2L4OA 1DR9A 1LP9B 5A3ID 5FB8A 1WC7A 3X14B 1RZFH 3ZE1F 1U8PB 4OT1H 5IHZB 3KPOB 1MJ8H 3LRGA 2BSTA 1KENL 3HS0B 4KI5F 1SJVA 1A5FH 3C8DA 5C0CE 4KTYA 3DURA 1RJZA 4K9EL 4UV7L 2YMXH 3WHXA 3BE1H 2AJSH 1PD6A 4HT1L 1EO5A 4L8CA 3VI3F 5MERB 1S5HA 1H3VA 2XTJC 1BQSA 5SX5H 3OKKA 1T7YA 4UZGA 2KQNA 4N1CA 1ZEAH 5AYQA 2EDJA 3MQIA 2R8SL 1B88A 5ICZB 1N0LA 4NKOB 1XCQA 4LP4A 2XTJB 1Z9SA 1WIUA 2XZQH 1YPZA 1INEL 1YMHA 1ZHNB 5C2BL 1EEUA 5FFLA 4JEGB 2VLME 1PKQE 1IGYB 1YNKL 2R1XA 1X6LA 4I48A 4MVBC 3PP3H 1T21B 3NIFF 3CCHA 3JTSB 2NZIA 2P7TA 5DQDL 3TA3C 4LCWA 1CLYH 5CEYA 3RUGE 4P23B 1V7NL 2IPTH 1NKRA 3QHFL 4XP4L 3R8QA 1CIUA 1X3DA 3PWLB 1Q1JL 1CZ8L 3IFNH 1P6FA 4H20L 2OXHA 4MNGA 3U0TA 4Z7NF 1X5AA 5ECJE 2AABL 3EYQC 5D7IE 3W11D 1TZIB 4GBXC 3I6LD 3IGAA 4LGPB 4A2LA 4L3EE 4HIJB 3WHE0 4S0TD 3TV3H 1M7DA 2Q3AA 3C87A 5E0QA 4GBXB 1S7TB 4XNQB 4F3FA 3QEUA 4RMQA 4Q6IA 3SDCC 3TBYB 1DUYB 3G6JE 1QACA 2ITDB 2HLFD 5HDLA 4WI7A 3FO0H 4HCRH 3MOAL 3PDOB 5ICYB 5C0DB 1IBGH 5BQ7A 1A7OH 5BRZE 1NCCL 3B9AA 1HH9A 5C07E 4YBQC 3P0GB 3D39B 2NW3A 4RZCA 2FHCA 4N68A 5DO2C 1QYGL 2NY3D 3E0GA 3HUJA 3MNZB 3QQ9C 5T1LA 4Y8AA 3IJYA 4MQXD 4TSCL 4JB9L 2X10A 1R3IH 3B4NA 4GRMA 1SM3L 3QDJE 4MS8C 4LDOB 1WQVT 2D0FA 1FLRH 1HWGB 3BW9A 5BS0A 3LS4L 4R4FL 4PYHA 1CDHA 3MGTA 3BN9C 1E28A 1I85C 1JK8A 5SWZE 4KKBC 4WCYL 3WFHA 4HWEL 2HRPH 2AV1B 2B2XL 4IIQB 5CILL 4PJ7B 2IFGA 2FNBA 2WWKO 2W65A 4LKCB 3OB8A 4HZLB 5DMYA 5EUOA 1LDSA 1AJ7L 1URLA 1YEEH 3OKYA 3G5XB 4Q9RL 3PHSA 4OI7A 1NC4D 3LKSA 5HPMB 4NT6A 4ZNCD 3UTSB 3MUZ1 4OZHE 2NPLX 4MNQA 4M7KH 5HGGS 4GG8A 1EEZA 1FL5A 4I9WE 2NX5D 1QPXA 4NC2B 3IDIB 3I2CL 1QPPA 4WU7A 1VFBB 2W0PA 3L3JB 4XMPL 4UV4H 1Q9LA 3ZO0A 4XWGH 1M6OA 3QSKB 1IZJA 1UCBH 1IAIL 1MFNA 2GK0B 1JV5B 2F9BT 5B39G 2AEPH 4QXTA 3TZVC 4CKVX 3HMXL 1P69B 4O51B 3W82A 2V2XB 3TF7C 1MRCL 3HLAB 4KHTH 3O2WH 1OAXL 1G9ML 2BSTB 5E2WH 2JJSA 3RX8A 3DX7A 1UWGH 3TN0D 2DQEH 2D2OA 3ELAT 3TJEH 4NHUA 3BSZL 3HR5A 3QDGA 4PJEA 4NZRL 5DJZA 4PP2A 3EYUL 3TZVB 4BSVA 4G7YL 43CAA 4L8CB 1HDMA 1KN2L 4WFHD 2MQ3A 3VW3H 2GK2A 2OR8A 4L4VE 1B90A 2HJFB 4X6DB 3O4LA 1MFAL 2WM0A 2I24N 4UQ3B 3TNMA 3HZYA 5D7LD 5KN5B 5EA0L 1R24B 2ZUTA 2AJYL 4K7PY 1NGQH 1F4AA 5HYJA 3PWPB 3RP1A 2YD8A 3BWUC 1MEXH 1LO5B 4ZSOA 5TF1H 1PY9A 3KWWB 3WXVL 5C0FA 3BEWA 4K55A 4KUZH 1UEMA 5KS9B 4IMLA 3GNMH 2DQFA 4LNRA 1YPZB 4Z7WF 1D6VL 1G9MC 5HD8D 5E56A 5ID1B 2GAZB 2YPVL 3VXQB 1A7RL 3QJHA 3S35L 4J4PD 4J1UB 1J9CT 5LQBH 4NQUA 4RNRA 5DVKA 1UVQA 3UZQA 3ECBA 1J1OH 2CLVA 1Z0NA 2BSRA 1KIQB 2ZOLA 1WAAF 3CX5K 3SE9L 1IAKB 1JGLL 1HNFA 2VLJB 4PLKC 3RJDA 2ED9A 3CSYA 4OLEA 1HXYA 4E9LA 4HW6A 4ACPA 3R8BB 2A6KB 4JQXA 3TT3L 1RJYA 2HMID 3K4ZA 1D5XB 1EHAA 3ZKXC 3MRKB 2ZUXA 4R3SB 3IGAB 4X6BB 2FATH 1CDGA 2X4NB 1KUMA 1HHKA 4KJWC 5E8DH 1CLOH 5KJRH 2CO6B 1F6AA 1SEQL 1ITBB 2KL6A 4EUPH 2VXVL 1LEGA 3BKMH 3ZKXB 4OCRH 2NYYC 3LSOB 2HTLD 2HVJA 4Y19A 3T0DA 4LU5L 5F9OL 3I50L 3BVNB 2K7QA 4G59A 4ODWA 5EC2A 1L0XA 3TBSA 3ZDZF 3L6FB 4CW1B 4HIXL 5A2LH 3O3UN 4NP4H 2WP3O 3QZWB 4JY6B 1EZVY 3OSKA 5GRYA 5T3ZD 1FG2A 15C8L 5L88L 1U6AH 4PJHA 3GSUB 3TH2T 4QRSB 4V1DB 3MXVH 4TNWF 3GSQB 3KYNA 2AK4D 4FTVA 4GS7C 1X5FA 3CGTA 1MCIA 2CKBL 4JVWA 5FCUL 2L7UA 4F8TA 1PZUB 4TQEL 1MJUL 2XTJD 3GBNL 4NQEB 1E6JL 4JN2B 4QTHA 4EI5C 3V4VH 2GFBB 4GS7B 5CINH 2FR4A 4BQ6A 1Z9LA 3U7WH 5EZOH 1HYSC 1EA9C 2JTDA 1PGRB 3HAEH 4R6UA 2Y06H 2EH7L 4EI5B 4OD1H 5GJTH 4YNYB 2C1OA 4I4WA 4RRPA 5GGVH 4ENEC 1J7VR 2DM2A 4XWOC 2NW2A 2A83A 4MVBD 3OAUL 1NDGB 4WGVB 1F3RB 4OCWL 4PJGF 1V8HA 3LKSB 3N1QC 4LLYA 4LEOB 3TA3D 3ROLB 3SEPA 3EO1B 3ZL4H 1SHMA 4P2RE 1DEEA 4LCUB 3MRQB 4L9LC 1DANU 4LLVA 1D5BA 3KR3L 1Q9LB 4TOYL 4HWNA 2MWCA 5IROA 3QEQE 5SWSA 5C0NC 4IRJA 5E00A 4E42A 3W0WE 1CTNA 4YFDB 3EYQD 2O61B 5JPMA 1ACYH 4NNXB 4GBXD 2DLIA 3BGMA 1ZA3B 4L9LB 1XGRA 5CWSA 5A1AA 3QULA 3MJGX 1D5ZB 3T04D 1Y6KR 2X4UB 2AP2A 3G9VA 3HR5B 4JRYD 1OM3H 1MREH 5DLML 2AGJL 4N8CH 3KPPA 3VRLF 5FDYA 1HDMB 5L2KB 4KV5F 2ATKA 5ANME 3OF6D 2NTFA 3OKNB 3SDCD 3TNMB 3QXAB 5DDHA 3QIBA 5IG7B 3LKOA 5KAQF 4QXWA 5IVXA 1RK1A 3QUKB 3UJJL 2N56A 5TDNB 4TNWK 4YBQD 4IMLB 3OAZH 2AI0L 5DO2D 4JG1L 3W81A 3QQ9D 1N59A 3CVIL 3RPKA 1BJ1H 3J8F7 3T0EE 1EK3A 4OFVA 2EH8L 4MYWB 1K8DB 5A40E 1LK2A 1NDMB 4MS8D 4FOMA 5DJAA 4NJ9L 5DRWA 2CLVB 3L5HA 5JXEC 5F1OB 4UT9H 5FOJA 2YN3A 4MCYB 2IQ9H 4NQCA 4PRPE 4JFQB 4DKFL 1MRFH 3OJVC 3D5OF 3QIWD 5D1ZC 2W0LA 3QHZL 2WWKT 1HXYB 4KKBD 5F7KC 2C1PA 3BQUA 5JIKA 1GC1L 4PBVC 4GH7B 4S1QL 5J56B 2BDNH 1H8SA 4BQCA 1XF3A 1CL7I 5D1ZB 4MAYA 1KEGH 1WWCA 3HZMA 2IFFH 5IB3A 4WTZG 4PJAA 1JTTA 3DSFH 5C0AE 4WW2F 1JRHI 2P5WE 2QQNL 1CI5A 3TVMA 4G6KL 4LCCC 4OLVL 2HVJB 5ITFA 1W72L 1IFHL 5CJOL 3HTLX 3TYGL 3UZVB 2X09A 1BIIB 5L8LB 3X3FH 3VGAC 4MAUL 5IW6B 4Y5XA 5LBSL 4AIZA 5GXBB 2X4PB 2EDTA 1J8KA 4LIQH 3O2DH 3TZVD 4YUEL 3NACL 5HYQA 1CGUA 3HPLA 2KH2B 3L7EB 1E4KA 4ODHL 1IM3A 1IGTA 3VGAB 4WWID 5EUOF 1P2CA 4GRWH 2VC2H 4IMKC 1QUNA 3KJ6L 3PWPD 2WINA 3NIGF 4PJ5B 1N4XL 2HWZL 1MCPH 2JJVA 4NNYB 3SDAC 1MAJA 4KKAC 1TQBC 1FNEA 1DBAH 2MCPL 1EAPB 1RZJH 4PLJC 5D6CB 3HAEA 3K3QA 4M5ZL 4P46C 4YZFE 4ISVB 3QDME 4X4MA 1OOAA 4OCLC 3SDAB 1UJ3A 1TQBB 4JO1H 1OVZA 4XPBH 2VLJD 4UAOC 2CXGA 4JZOB 4P46B 3VMPA 1WTLA 3GSOB 4ODUA 5HHOD 3CZFA 3IDJA 3WEXA 1YEKH 1AO7B 4PLKD 1WWBX 3KYMA 2CDFA 2K3TA 4UAOB 2AV7B 2FX7L 4K7FB 1NCUA 3JV5A 4MX7A 1N7ML 3QUYA 2WV3A 4OD2B 3P0VL 5F1IB 1FO0L 2DWEB 3G08B 2H32H 2CJUH 2QSCH 5IW3A 4PJDA 1VA9A 2BZDA 1HCVA 4HQQH 3QPQC 4RBPH 2W9DL 1AQKH 1MSPA 3BGMB 4ZQKA 1NFDF 1OD7A 4TTGA 5IR1B 3QULB 1IAOA 4NO2A 4PJ9A 4AT6B 4JFYA 4KJWD 5HXMA 3CDYA 1OQXA 5IVOA 4QRUB 5JHDB 3F7VA 4XP9H 2XA3A 3ZKSD 4P2OA 5J1TC 1MCRA 1FCGA 4KRMB 1EUTA 2VSCA 4HBQA 1NC2D 2W60A 2DQIH 4O4YL 4TULL 4AM0B 1F4HA 4HK0B 1C12B 1Q0YL 2WP3T 3IFPB 2P5EB 4V1DD 4OCSH 2B39A 2QSQA 3GB7B 2CRIA 1Y6NR 4PJ8C 5C09E 3LKOB 3SE8L 1MF2L 5IQ7H 2EXYD 3VXUB 2OMNA 4UTAL 4NQTA 5D96C 4JCMA 2P8MB 1FV1A 4HIIB 2H3NB 4NQED 1Y0LA 1FO0B 1G6RH 3SN6N 2H1PL 4YWGH 4P0DA 5JW3H 4PJ8B 3KPRE 1N59B 1PG7W 3SGEI 1J0ZA 3VFWA 3EUUA 4CDHA 1KCUH 2AQ3A 3PG2A 1UM5H 3RWCA 3BT2L 2R23A 3T8XA 5LGHL 1KIPB 5D96B 3QFJB 1RULH 1XF5A 3K1DA 4LPCA 4NQCB 5J6HA 4UNUA 3HRZB 1S9KC 4BZYA 4D9RE 3C5JA 1HYSD 5B3JF 2ICES 3E1F1 4B53A 2V5RA 1IAIM 5EPMA 1T7XA 3OV6A 1YDPA 4D0CB 1ZT1A 3BDYH 1RQ5A 3WJJA 5AG9A 4ENED 1JF5A 2HJLA 3FN9A 2V17H 4HPYH 3BDXA 1BQLH 1FZMB 5IBUB 3CMOH 3PGCA 1OGTA 1UXSB 2F58H 4RWHA 1J1XL 1T1WB 5DI8A 1MY5A 1BFVL 2X6MA 2YPLB 4ZPVB 4BK5A 4XX1G 3MNWA 2DWDA 3GO1L 4Z18A 2WBWB 2X4SB 3FN3A 3O3AA 5FECB 5C3LD 4D8PB 1JNNL 1U8LA 3VXPA 5C0ND 5IMOB 3IYLW 3M1BA 3QDAA 4KUCF 4N8PA 4KDTC 2XFXA 3O2DA 4HJGB 1HKLH 3LKRA 3VD9A 4NO0A 2EE2A 4R0LA 4TVPE 2JK5B 3ILQC 5L2KD 1IC4H 1PW3A 3AUVA 2GUOA 3RZCC 2AEQL 1R3KB 2FLRT 4M43L 5IV2B 2A74A 4X8JB 3SDDC 4WVRA 4HV8A 1BAFH 2HH0L 4FXGB 4OKVB 3WS3B 5F7LB 4PJFE 3RZCB 5I2IB 4Y89A 2R69L 4LSPH 2LV4A 3O3DA 2GY5A 5E6IC 3HNSL 5DJCA 2FIKB 4ZS6C 4YDIL 5I71C 4M1DL 1L6XA 5DQJB 3ZE0F 1M4KA 1GOFA 3BEVA 3TBWB 4OI9A 2CGRL 2VITA 3MRNA 1P1ZB 4XVSH 5KSVA 5E6IB 2IPKB 4P99A 3THMH 5I71B 4NZTH 3FN0L 1TLKA 4LSSL 5J0BA 2GYSA 1T2XA 4P59H 4QWWC 5BVJA 1AE6H 1A6ZA 4CL7A 1J0KA 4X4XA 1P4BL 4L8DA 2X40A 3KAAA 3B6SB 2Y7QA 4OIIH 5JXED 2QEJA 3DUUA 4WFFE 4MHHI 4P5TC 5IUSA 4I5BA 3GMOB 3E3QC 1FFOB 2BNQA 1NBYA 4K23H 1DCLA 1D6EA 3IRPX 2H32A 5T3ZH 3W39A 5L6YL 4RGMC 3ARPA 4I0PC 2HFEA 4PB0L 1T1ZB 3UPRB 2NXZC 3MGOA 5I66A 3LEYL 3TFKD 2XNAA 2AJVL 7CGTA 4P5TB 4N90E 2HVKB 4G80A 5IVXF 2ADJB 4F7MB 5I1GL 4XCNA 1CR9L 4RMUA 2EYSA 4N9OB 1OAZH 1OB1B 3WFZA 1U8OB 2HAZA 4RGMB 4I0PB 3IFOA 1J87A 1BREA 1H0DB 3CFJB 4N5ED 4P5MB 2NXZB 5JLZA 1Q9KA 1ZHKB 2BOBA 3BDBA 2XIDA 3ARDC 4PTTA 2G5BB 1BD2E 2XQYK 5JO5A 1WZ1H 4EEEA 1OAYH 5GQBA 2MPAL 3CUPA 1PDKA 5F7YC 1A7BA 5FYLE 1A7QL 2X42A 1KENH 4I2XE 1CFVL 3VD5A 3WNLA 1A6VH 4K9EH 4UV7H 1A47A 4Q74A 1NC4A 4NRXB 1FV1B 4HGKC 4HT1H 1G6RA 1UM6H 4U0QB 5JQ6L 5D7SH 3O9WC 2R1YB 1QFOA 4NRZA 4U6YB 1LO3L 4GKSA 3OXRB 5GHWL 2IANA 1QR4A 2R23B 4MMXC 3T8XB 3D18B 4P4RB 4MXQC 2R8SH 4NUJA 3UO1H 4HUXB 5DK0B 2DRUA 4XPHL 3SDAD 1XIWA 3O9WB 5F1NA 5C2BH 5BCAA 4M8QB 2F5AL 2HFGL 3TWCH 1YNKH 4Z95L 3SE4A 5FUZL 1U92A 4JREC 2YUXA 4ELME 4RQQA 5F96L 1YDPB 1AO7D 3E6HA 5JUEH 4ZUWA 1ZHBA 2AERT 1DLHA 2E8ZA 4XPTH 3IDNB 4HG4J 3QHFH 5D7LA 1J8HE 1RZIA 1A3RL 3PGCB 4M8VA 1Q1JH 3EYVA 1DLFL 5HGAA 4LLMB 5ESAB 5IB1B 3B2VL 1QA9A 2AABH 1JPTL 1ZANL 3ZMRA 1I75A 1OSZB 4YHYB 5CJQL 1YN7A 2FECI 3AM8A 3GHBH 5AZEL 2CDEB 1UZ8B 2XFXB 1K8IB 3QPQD 1KPUB 1D5IH 1XH3A 3KYKH 1AFVL 5JPNA 1ADQL 4M7JL 3TH3T 1VSCA 3BWAB 4U1LA 2NY5L 4BSWA 3BP6B 1YEGL 1A9EA 4DGYH 2BNRE 3HRPA 2E8YA 4Z78B 2P5ED 5CBEA 5D2NA 2Q76A 3VFTB 4CU8A 2DL9A 4K94H 3RDTA 4D0DB 5BV7B 5C92A 3MOAH 3V0AC 5CGYC 3O3DB 1DE4A 1NCCH 2E7CA 2EC9T 4PJ8D 1TDQA 5SWZD 4MDIA 4G6JL 1QYGH 4L8BA 5EU4A 3L3GA 3T4YA 4TSCH 2EDHA 5CS7A 3ERYA 3QFJD 5A16A 1XGTA 2NY5C 3IJSB 3QCUL 4HS8L 2IBGA 1ZLWH 1LMKA 5FYJU 5J8OA 3L3OB 4R4FH 5EZIL 3ULSB 5I19L 1AXSB 3GMMB 5T5FH 4WCYH 1UQSA 1J0JA 4W70A 5FYJE 5C0IB 1HKFA 5IHBA 4PRBA 1OT2A 3OQ3B 3NFPA 2B2XH 5CILH 1G7PA 2VDML 4JM4L 3V52H 4JQVC 4RSVA 5MEOA 4QHMA 3FO9A 4HFUL 1HN1A 4PBWD 3GGWB 1GOGA 1J86A 1AJ7H 3L3KB 4RRPG 1OY3B 4POYA 1CE6B 3BUYA 2F54E 2AK4A 4Q9RH 2R15A 3PGDB 3RPIA 3QFDA 4G80B 5I17A 2YPLD 1H8NA 5ADPL 4RMVA 5GGSA 3FO1A 2BY1A 2BHUA 1S7VA 2J6EH 3P0YL 3I2CH 1EIBA 1RUMH 5K9KA 2A6IB 5CSBA 4QRPE 3EBAA 3RA7H 4J2XA 4XMPH 2RHEA 5FKPA 5L9DL 3H9SA 4QHKI 2VUYA 1IAIH 1T03L 1ND0A 5E1AB 3PWNB 1EMTL 2LAAA 4S0SD 4G8GB 4NQDE 2J2ZA 5C86A 1MRCH 2J8HA 1WZMA 2OK0L 1G9MH 5T1MB 2H45A 1CXIA 4HUVA 3BH8A 5L7XH 2YSSB 5F1KC 3CNKA 5C8JA 1DBBL 2EYRB 3C60A 1G7QA 2APVA 4BFEA 3RZCD 3RJQB 4G7YH 2UYLA 1BVLB 2GTWA 1KN2H 4EQ2A 1MFAH 2DQHL 4EIZC 3SDDD 4GQ9H 4FFYL 1QRKA 5EN2B 5ESQA 2NY7H 3L5WB 4AH2A 3WXVH 3D69A 5E6ID 3U36A 2CUIA 1YZZA 2FX9L 4HUKB 1UB5B 5INDA 4HKJB 3P73B 1MH5B 3J7HA 1D6VH 1F42A 1A1OB 1XFPA 1B4RA 1CDCA 3FL7A 1JWMB 4N0UE 1A7RH 5JNYB 3S35H 4Y4FC 5MP6L 2RIKA 1AHWA 4NKQB 5JW5B 2A6DB 4JRYA 1QLFA 1D9KA 5DT1L 4Y8DC 3O8XC 3G5YB 3P4OB 4QWWD 1K2DA 4NHCH 4X6CF 5C0BE 1JGLH 3SE9H 2FSEB 4Z76B 2XWTB 4KVCL 3SDCA 4GRWF 4JRXA 2FB4L 5DMKA 1TZGL 3MJ9L 4ZO6A 2UWEA 3ZHKA 4P5TD 3MRCB 4LPUA 3S8WA 5K9JL 2B0SL 3DHMA 4G9DA 5JHLL 1CQYA 3RX5A 4NKDA 4I0PD 4NN7C 4X83A 1HHHB 2D0HA 4YO0B 5B38B 1HNGA 2NXZD 3ES6A 3GKZA 2BMKA 1U3HA 2JB6B 5C6WH 1P7KB 5IBUG 1MCOL 2VXVH 1MUJA 1XZ0A 3P4MA 4LCYB 5JIIA 3L5JA 4U1LB 5F9OH 1A9EB 2BVTA 1I85A 5TQ0H 3RY6C 1OHQA 3QIWA 4M48L 2Q76B 4F7TA 1G7LA 3ARDD 3VFRB 4KI5E 5EU3B 3D3VA 2JJWA 1YYLL 3D9AL 4DCQB 4POUB 1HQ4B 4YXHL 4LSUL 2NZ9C 5CEZL 5L88H 2OL3H 2YA0A 3VI3E 4C83A 4OZGE 4D9QD 1U2HA 2VXUL 3I75A 4JFDB 5DJ2B 4LAQH 3UBXB 1CGSH 4F58L 3T0BA 1WISA 5A16B 1YN6B 2CKBH 3FFDA 3IU3B 3L5XL 5FCUH 5A2IH 4BELD 3HZVA 35C8L 4TQEH 5C08E 1MJUH 1YEJH 3DV6B 2VZ1A 3GBNH 3OJDA 2R4SH 4ODTL 3RWIB 1DBML 1Q9WA 5J9PA 2O5YL 4FRWA 4U7SA 4GUPA 1MCBA 4MXQD 4OZFA 1HHJB 3CH1B 4ZOAA 1FZJA 5E2VH 4HWBH 4X4YA 3P4NA 3GSRA 2EH7H 4HAFA 3BIKA 1K5NB 4LRIA 4FQHA 3DPBA 4JHBA 4R7DA 2HN7A 1MIML 5IQ9A 5MENB 3NIFE 2ENSA 4JFZL 3U4EA 4EDXB 3VDCA 2J4WH 2UZXB 3EOAA 3HC3L 3OAUH 3ZSSA 4WFGE 4J3UA 3KHOA 1KV3A 3O0RH 2PR4L 1EH9A 1JWSA 4G9FB 3WFBL 4ZO8A 2J6EA 4Z7NE 1NGYA 4FFVC 1NFKA 1A6AA 2Y5TB 4HDIB 3TO2A 4W4OA 1MHCA 1QOKA 3IJHA 3KR3H 4XB8A 1ODAA 2ARJQ 3SGDI 1BFOB 3C09C 4KK6C 3OKDB 2V7HA 2YD4A 3NVQA 4M5YL 4PGEA 2Y5EA 3FT2A 4M1GH 8FABA 2WIIA 3QIUA 4X98B 3T3PE 1X7QB 3WIFA 2GY7B 5FHAL 5HGDA 3C60B 1H5BC 3ZZ1A 1G7QB 4OFYD 3VFNB 3C09B 4OZIB 3MACH 2AGJH 3BD5A 4YDKH 3JZ7A 5HHOA 1NGZB 1U8IB 5CSGA 4YR6B 3UZEA 3D1MC 5DEZA 4LLWB 3IT8D 4KK9C 3U2SA 3KJ4C 4HJJL 2A9NL 5GRVK 4NJAL 5CD3B 1GJIA 1TTUA 2AS5M 3GI9L 4QF1A 1BFTA 1JUFB 1MJ7H 1PFCA 5CGYD 1GH7A 4KPHH 3U36B 5ACLA 3QP3A 2Z31D 4HK3J 3UPAA 2AI0H 3KJ4B 3RVUC 2YD2A 2YKLH 1I9JH 4FA8A 1P7QA