3L3GA

Crystal structure of hla-b*4402 in complex with the r5a mutant of a self-peptide derived from dpa*0201
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title Constraints within major histocompatibility complex class I restricted peptides: presentation and consequences for T-cell recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 84
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3gA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l3gA01
3V0VA 4LLWA 4NUJA 4PJCB 3MNVB 4YHYB 1RZJH 1ORSA 3REVB 2ITCA 4GMSL 1PYWB 4JHAH 3LKOB 4PJXF 5DVLA 3VD7A 3NZ8B 5E99L 2H1PH 1GZPA 4QKXB 4E41E 2AV7B 1JNNH 1PLGH 3R1GH 4HS6B 1FORH 2R0LL 4CVZB 4DN4H 1HH9B 1NQBA 1IGYB 2QHRL 1TETH 4KVNH 3WHE1 2NXYC 5EDXA 1OLZA 3HE6B 2EKJA 2BFVH 3HMXH 4E41A 2FCBA 4U1NA 2VZ3A 3IXAB 2CR3A 2X42A 4R6UA 4YHLL 2Y06L 1G7IB 4RZCA 3GK8L 4YDIL 2VABA 3OG4B 1YEHH 1EH9A 1JFQH 4JFYB 4NNXB 2Q8BL 3R06A 1L6ZA 4LFHD 2DM2A 5C08A 2QTEA 4G6JH 3TBVA 3H9SB 1MH5B 2NTSP 2UUDH 2NMSA 2NY1D 1WTLA 4FXKB 2GYSA 5KVGH 1JYWA 3PGCB 1U36A 2WWKO 5C0FA 4ZXBC 3BHBB 3CMOL 4AQ1B 4RSVA 4NM8H 1NANI 4NOFA 5I1JH 4XVJH 1XGRB 1V5JA 3I6LD 1YEGL 4G42A 4XTRC 4Y1AE 4UTAH 4P48A 5F21B 4NRZB 3WNOA 3WBDA 3WS6A 1E4JA 5IGXL 4LEXH 4WI3A 5LWYL 2DQHH 1DUZB 3TT1L 5JDJA 3G04A 1D9KD 4PRAB 5IW1A 3C8KA 3B8YA 4HMEA 2XZAH 4H8WH 3ZHLA 3P30H 1E27A 1CTNA 5F1KC 2Y23A 4JE4B 1LEIA 1KIUA 3KPSA 5CCKL 2IGFH 1FYTB 5CP3H 4RWYH 1D9KB 2YA0A 4MHHG 4FN0A 1NCAH 1UENA 3Q5OA 2CGRL 2CRZA 4P5MA 2EIDA 1N3NA 4I0PC 5ALCH 1X5IA 3A67H 4GSDL 5IBTL 4TQEH 2OR9L 2YK1H 1IGTA 1K3ZA 3CH1B 4TVPH 3BEWA 3DUUB 3HCVB 2V7HB 3F6LA 1WZMA 5HHVH 3QWOA 3U36A 5D1QC 4Z95H 3OHXB 4JRYD 1UM6L 2OP4H 2Y5TA 5I1CH 1KPUB 1T22B 5I1DB 2B5IC 5B8CB 1IFHL 1VESA 4I48A 1EEYB 4HBQA 3CVHL 3EW3B 3O3UN 3HC0B 5MEOA 4AMKL 3I9GL 4APQD 2DN7A 3Q3GB 5F7DB 4HJ0D 3IXTB 4XNMA 5JORB 2BSRB 4JRYB 1UA6L 5C0DA 4NGHH 4OZGA 1QO3B 3IDNB 1QZ1A 2BCKA 3ARVA 3OXSA 3RX7A 1I1AC 5FA4B 3P4OA 4ZODA 1U8KB 2IEPA 3HZMB 4RA0C 1WITA 3I6LE 5FKAB 3AROA 5T3XH 2QSTA 5C0AA 5F1NB 4UDUA 5GJSL 3EYQC 5FHAH 3AU1B 3BZEA 1JHLH 4ZYKB 2EYSA 2PR4H 3CDFA 2DICA 5DR5L 1QHOA 5HGBB 4GW4A 1D5BA 4KJWC 1KFAL 5J6HB 5ICXB 3TA3A 6CGTA 2VAAB 3EO9L 2KQMA 5IG7B 4I5BA 4JM4H 1DANU 2BX5A 1NLBH 4YIQA 4TSBL 5GGTL 2XTLA 3GMRA 4PRHA 4WTXA 4KGLA 1A7PH 2OJZH 1ZLWK 2DIAA 1HHJB 3HPJB 4X9GA 1BVZA 5D7KD 1FL5A 3F62A 3QQ3B 5KSVB 4KTDH 3DYOA 2X4PA 4NDMA 5BJTB 5JZ7C 1NCDL 2IWGA 2ICWI 4I18C 3FT3B 2NXZD 3OAUL 1Q9WB 3SE3A 2D0FA 2V7NB 4OLXH 3FCTB 3BEVA 4WUUE 4N1CA 1DBJH 4JY4B 5F9AC 4RISH 3WIHH 2I25N 4ZD3L 3RVWC 2DQUL 4U1IA 5EBMA 1QFUL 1TQCB 3MLUH 4LCCC 1CXLA 4WUUA 3G5ZA 2NXZB 3MRKA 5CINL 4IOIB 1TJIH 3IU4L 4RMVA 1TIUA 4GS7B 1NCNA 3C6SA 3HZYA 4PREA 1CDUA 4I3SH 3GO1H 2E7LA 1HZHL 1QFWL 3SCMC 5FUOL 1A21A 3O3AA 3X13A 5B39A 1ZTXH 4XP1L 4PJGE 3TYFA 4J3UA 4M3JA 5GRVK 1A7RH 4OSUL 2DQDL 1SEQL 4G80B 1ITCA 4FFWC 4PJGA 4ZOEA 4HULB 3C60B 5J06A 2OJEB 4PJ5D 4NQCB 1C16B 1W72H 4JFFB 5C2BH 2X1QA 3RBGA 5D2NB 3VWJB 4Q2ZA 1A6AB 3NAAL 5D70H 2ED9A 1Y6MR 3WNLA 5E70A 4GLRH 3T8XB 2AV1A 1KV3A 5C09D 1BJ8A 1FGNH 3OKKB 2GITB 5BO1L 5BZDB 3CDYA 4I0CC 3GMLB 2HJLA 4IRSD 3RU8L 3DIFA 3L3JB 5DZOA 2ARWA 5HGHB 1A6UH 3O6LL 3VD9A 3D25B 1MI5B 1S7TA 4FMKA 2HTKD 1EAPB 1UZ8B 1FPTL 1E4KC 1YY9C 2VDLL 5C2UB 1PFCA 2NXYB 2CO7B 1CXKA 4J6RL 1Q1JL 5TPWH 4GAFB 3NA9H 1P84K 1CFVL 4IRSB 4G6ML 3VH8A 3VG0H 4P59H 3S88L 2XA3A 4LLQA 1ZT4B 1VEOA 2RJMA 3CPLA 1JNHA 3W0WE 4J1UB 5FA3B 2E9JA 1MFNA 5HI5D 3RZCC 4QLRA 2J88L 3UBXB 2X4OB 1BIHA 5JW5B 1C1EL 2R1XB 1I75A 4XMKH 4F7PB 3QJFA 3W0WA 1CLYL 4NT6B 1AO7E 3S4SG 4ZXBB 3X3GL 4JPWL 1FVCB 4JPVL 5GS0L 2W65B 1HDMB 3CXDH 3QUKA 5AD0B 3P0GB 2CUIA 3IYLW 3QSKB 2QQNL 3RY4A 1UACH 1EHLL 4DVRH 2HWZH 2XN9D 5F72S 1XGTA 5GPRA 4XNXH 3QNZA 35C8H 1Y0LA 3K4ZA 4FQ2H 4MNHB 5C0NC 4JHAL 1SMAA 3N50A 1U9KA 4ORGA 4LNVA 5D71H 1IGCH 2W0FA 4O5LL 2H1PL 4GLRI 3KPOB 1WBYA 2VZTA 1JNNL 3ARSA 2W9EH 1NGZA 1OARH 3R1GL 1FORL 4L4TD 4DN4L 1TETL 1DCLA 3TO2A 3LKSB 2Z93A 2BFVL 3BXNB 3HMXL 3FO2A 3PWUB 4UIKH 2CMRL 5CHNA 1SMOA 3OAYH 3LS5L 1YEJL 1KCGC 3S36X 1YEHL 3LB6C 1F6AB 3MFFB 1K4CA 5DLMH 5FV1L 1JFQL 4L4TB 1QRNB 5ELIA 2EYRA 3ARED 1EK3A 3EYFA 3P0VH 3ILPA 4JDVA 1JV5B 1ZHNB 1V7NH 3U30C 2X89D 1TPXC 4G6JL 2P7TA 1ZE3C 3DV6A 1NFKA 3NVQA 5KVGL 1KIPA 4LVNC 3ULUE 3VG9B 5F7EL 1KEML 2R23A 3L7FB 1H8SA 4NM8L 5GGQH 3BP7B 5D1QB 1ZEAH 3ZKND 4XVJL 5I1JL 1EBPA 1L7IH 5JDSA 4NSKA 4MAYD 1EEZB 1DLHA 2Y7QB 2FBJL 3TNMB 2B5IB 3QEUA 2VDKH 2DQHL 4KDTC 3AAZA 1LO5B 2XQYK 5DZNA 1CD9B 5FGCE 4YNYB 5F6HI 1XGUB 2JIXA 5DF0A 2XZAL 4H8WL 4ZNEA 4X7TA 3P30L 1LQSR 3JTTB 4NM4L 5EIIB 5IT2H 4KROC 5ADOH 1F45A 3N06B 1RZ8B 2IGFL 1WT5C 4M8QB 3D1MC 5SX5H 3S35H 1OWRM 4JO3H 1P6FA 4ACPA 2C4FU 4BQ9A 1JWMB 4OLZL 3HPLA 2XN9E 3BQUC 3R0MA 4PJ9A 2R2CA 4BFBD 5HY9B 5ALCL 3QDAA 4F7CB 3OXRA 3QDHA 3A67L 1ZT7A 4WHYG 3CSYB 4TQEL 4POUB 2P8MB 5ANMA 3QUMA 3EOTL 4CNIA 1MLBA 4LU5H 3S34H 4PJAB 4U6XB 3T04D 4G43A 5KSUB 3OKNA 3V5DB 4JPIB 4TVPL 1L9NA 4H5SA 4MCZA 1NAMA 4FXGA 1BVKA 3F58H 5HHVL 3V0AC 2BVUA 3HAEB 1VPOH 4LRIA 3DO7A 2P5EE 3BE1L 1A9EB 5CIPA 5JXEA 3U9UA 1LGVA 2OP4L 4JZJC 3AUVA 5I1CL 5E2TH 3SKMB 4NO3B 2CO6B 4X4ME 3MGTB 1MRDH 3FFCE 3HC4H 4OV6F 3TIDB 1D6VL 2WLYA 2P5EA 5DJXA 3F7VB 2R1WB 5GRUH 1QBBA 4NHUE 3TIEB 2GAZA 1AFVH 4ZTPH 5TH2B 4QHKJ 5DD6A 3P73B 4EBQL 3VXUB 4W6YB 4JHBA 1XZ0B 4NHUA 3GSWA 4Z7QE 3D18A 4KV5E 1IM9A 4PJIB 4P9HC 4QRSB 4D0BA 1U3HD 3LPWA 4LSTH 5SWZE 4X6EB 5LKNA 4YZFE 2PR4L 3SCMB 3MX0A 1Z9LA 2BSTA 4G7VL 3PP3K 3DGGB 1X5HA 4LPUA 5SWZA 4OGYH 1GRWA 4X9FA 5BS0D 2NZ9D 2PXYA 4FQCH 1NLBL 4JRXE 5J7CC 4LSRL 4XB8A 1YMMD 1A7PL 2OJZL 4PD4K 3CZJA 2JB6A 2YD4A 4NQED 2R0KH 4JKKA 1J05B 3BH9B 1MJJB 2WBJD 3DURB 3MRDB 5HHQA 2JK5A 2OL3A 3MUGA 5TDPA 5BS0B 1FN4B 4KXZH 5TQ2L 3OR7B 3VI4E 4JREB 1WWAX 5SV4A 3CX5K 4LP4A 4UIMA 1XF2B 4F9PC 4LBEA 1DE4B 2R29H 5HGDB 1F4AA 3R8BB 4J2XA 5HI4D 4BUHA 1F11A 3DVFA 5FXCH 2KPNA 3W39A 1U58A 2CR6A 3WIHL 4IDJH 3NFSL 5HGGS 3QFJE 1J18A 3ULVH 2JF1A 1G7HB 4NFCA 2Z31D 2D31A 3BIAX 5IIEB 4FQHA 1A2YA 3WE6A 4HPYH 3QFJA 4XVTH 4WTZG 4TUJB 1XFPA 4TTDC 3ZE1E 4I3SL 3OV6A 4YO0B 3WLBB 4F3FB 1S9WB 4LL9A 1ZTXL 3FB5B 1S7XB 5DUBB 3V6OE 4D9RE 5ACLA 2X4SB 1A7RL 3TJHC 1U93A 4LLDA 4LSQH 1VGEL 3M17A 1VFOA 4M61B 4PRNB 3SDCA 3EHBD 1ZKAA 1UH4A 1HILA 1MCWW 2NY0C 2HRLA 4U6HB 3V6OA 5FO7A 5CMAB 5CBAB 3FB7A 3ZT6A 1W72L 3ARDC 4AEHH 1MWAH 2X2YA 4U2YA 1D5XA 4WW2F 2ZSWB 3BW9A 4ZUVB 1ZK9A 3E0GA 2Y36H 3QIWD 4K8RL 4XP6L 2A6IB 3V6ZA 4MXQD 5C07A 1FGNL 4NPYB 3KLSA 1O5DT 4JFED 4ZQKA 1I9JL 4BKLB 4XWOC 3T4AA 3B83A 1YMME 3MO1B 4KI5D 4YFEA 4MD0B 3X11A 2ARJB 4XNUH 4KXZI 5D1XA 1NGYA 4KMQA 1N5YL 3QZWA 4XHJD 4LOUC 4NQEE 2KQNA 2ATKA 3C5ZD 3NFPA 3VFGH 3BZ4A 4AJ0A 1T3FB 1H3VA 3O6KL 1DSFL 2L7JA 1EX0A 2DQFB 5IEKB 3NA9L 5F9JA 1DANT 2OBGA 1UT9A 3GZKA 1MFCH 5EZJB 3MGOA 3VG0L 1B6DA 3E1F1 4Y4KD 2G75A 3C5ZB 3WFZA 1KIQB 1MAKA 3QDME 1WAAE 1QFHA 1GVIA 5D1ZC 1OD7A 2CKBA 2D4DA 1G7MB 3NN8A 4GKOA 5E1AA 1YN6B 4BQBA 2VAJA 4XMKL 4YQXH 3QDMA 5EU3B 4HEPG 1U8LA 4HGWB 1WAAA 3AS1A 1MIEH 4LHUD 5HJ3A 4LVNB 2YC1A 4HCRA 4GW5A 1RFDH 3ESVF 3EFFB 2JLLA 1G9MH 1PQZB 2XT1B 3MUY1 5GS1C 5IB2B 3BAEH 2DL2A 3FQRB 3CXDL 1I1FA 5ID0A 4U6YB 2EXWD 1EXUA 2A2QT 4M1CD 1AR1D 1T20B 4OD3H 4DVRL 2HWZL 3PHOB 3RGVD 3MUJA 2AJYL 4XCCH 1RVFH 3RL2A 4N0CA 4LHUB 4HT1H 2YD2A 3LRHA 1T03L 1ZHKA 5E6IA 5D71L 4V3EB 4F58H 2EEDA 4MZ2A 3O2DH 1JZ4A 4KROB 2W9EL 1W0YT 3JBG7 1LO3H 4EVNA 5CJBA 1OOAA 4HS3B 4NZTH 5ESVA 1GPOH 5FGBA 3DX8A 5GIRA 4CW1A 4OF5A 4D9LH 4Q7DA 3MNZB 4UIKL 4TUOB 2FWOB 4L1DA 4DAGL 3HZKB 4MQXC 4RFEB 4DGIH 3ARGA 4PRPE 1A4JB 5KVMC 1JVKA 3ME0A 1TZGH 2LE9A 4PBXA 3P0VL 4WHTB 4KI5E 3EUUA 3FOMB 3LAFA 1A5FH 4PRPA 2BY0A 3UPCA 3O45A 5HI3D 3MJGX 4NFBA 5DJ6A 3OPZH 3WS6C 1Q9OB 2BHZA 3VI3F 2IFFH 3GKWH 4K9EL 4Y4FD 2XTJD 3EKCA 5IMKA 2HN7B 5GGQL 4TPRH 4QXTA 1L7IL 4Y5VA 4JZJB 3RRQA 5HD8D 5FAAA 5HDOA 3PWJB 5GRYA 2BXYA 2VDKL 2GTZB 4HFWA 2UWEE 3BMVA 4QTHB 4KK8C 1MCFA 2ZNXA 3O2WH 2ILLA 3KXFE 3MJ8B 3WS3B 2GJ6A 3REWB 2BJMH 4CU8A 1M71A 2HT2D 2OTUA 3O3BB 2WZPD 5IT2L 3KXFA 5ADOL 4D0DB 1MLCB 1C8PA 4RAUA 3S35L 4O9HH 4JO3L 5D5ME 1TVDA 3KPLB 1FAKT 2VITB 3VFSA 4DGVL 3BZDA 4YGAB 2PYFB 5T1KA 3I3DA 4Z0XB 4X8JB 3UBXG 1FV1A 5D5MA 3VXMA 2FD6H 4KK6D 1HYRC 1TQBB 3VWKD 4IMLB 2JCCA 4QCIA 2NQCA 4LU5L 3S34L 2XKSA 1DUYA 3OKMA 5DSCB 4ODUA 1BBDH 2R56H 5KN5B 2AXFB 4WDIA 2LFGA 2BOCA 2I9TB 4UDTA 1CDGA 3E2HB 1VPOL 4JZOB 3KLAB 3VFTA 1E0OB 2GW5A 5E00B 3VWKB 4HUWB 2OZ4L 2DM3A 4RMQA 3GUTB 5DRWB 3QFDA 4WFGD 3HC4L 5DQJA 2Z0BA 5CP7B 2P24A 4EUPB 1INEH 1AQKH 1J0JA 2OK0L 1TJHH 5GRUL 4ELMF 2YUVA 4P5KA 1AFVL 1M7DB 4XBGA 3DI3B 1OW0A 3CUPB 4NRXB 2J7LA 4LAJH 1XF3A 5F44A 3DNKA 4LARH 5E24E 2VLRD 4LDOB 4HXBH 4QRPB 3QXTA 4FQLH 2ZUVA 2R9HC 4MLSA 3TA3C 3ZDZF 2XWTB 1DQML 4O02H 3HNSH 2FJFB 1PG7H 4N8VB 2D7PA 4J12A 1Q0YH 4MA1B 3T3PF 4R4BA 2VLRB 2R15A 1ACYL 4OLUH 1QHPA 4NQSB 4OGYL 4GRLA 2YPKA 1S5HB 4FQCL 4Z7UB 3DUSA 1A47A 4BH7A 1UVQA 3QHZL 4HMCA 1QACA 1T04B 4HG4J 3RIFF 3RWHB 5CEZH 1RZIB 1H15B 4LSVH 1S9VB 2R0KL 5HYQB 1R3LB 3MMEA 3SE3C 3TBYB 3EDEA 1F6FB 1A6WH 3VE0B 1HYSD 4Q9RH 5IFJB 2ZG2A 3QO1A 2FR4A 5EWIH 3BUYB 1BD2D 4XNQB 5IK3B 3O4LE 3H9HB 4YFLI 4YUEH 3T3ME 3MCKA 1XAUA 3DROA 4P5TD 1EV2E 4I13B 1XF5A 4KTEL 1YEEH 4K7PH 5E8DH 1U8JB 3U83A 2C4FT 1DDHA 5IMOB 3O4LA 1ZS8B 3L3HA 3T0DA 4ZFOL 3WJLA 4M93C 2IH1B 2VWEC 2VXSH 1AHWA 1JPSH 3TCLB 2GKIA 4WFHD 4LCUA 4WFGE 1X4XA 1D6EA 5F1SA 5A3ID 5F71A 1FNGA 5D1ZB 4O2EB 5BW7A 1CN4A 1UB5A 1DBKL 1J12A 2YHGA 1CR9L 1KB5B 1YEDB 3QEHA 2FX9H 3BVNB 1CF8H 2EH8H 3LKQB 5I0DA 3TVMA 1KELH 2V17L 3V0VB 4LLWB 5D7LD 4NUJB 4AEHL 1EGJH 1MWAL 1OTUD 4Z7VE 1ORSB 1P7HL 2ITCB 3JUYA 1MRFL 2GCYA 2X4UA 2GIYA 2AS5M 2N7BA 2PTVA 2AKRB 1GZPB 2ZUWA 5FB8A 4Z7VA 2Y1VA 4MVBD 4X0KA 1L7TH 4P2RE 5D7LB 2C9AA 1FFPA 3B9KA 2YRLA 4GKNA 1B88A 4U1NB 1Y18A 1FC2D 2C1PA 4XNUL 2F53A 3G6DH 5KSBF 1UQSB 3VFGL 3PQYA 3SKNA 4P2RA 4ETQA 3EOAA 4RZCB 3QWRD 1AD9B 1ZA3A 1T2JA 2J8OA 2CXGA 3RX5A 5IM7B 3R06B 1AC0A 3VXQA 3KLDA 2K3TA 3H7BA 5C08B 1FG9C 3TBVB 1FZOA 1RI8A 3UEZA 4NNYA 5FYJD 5I1IH 2OM5A 3G5XA 4LF3A 1HXMA 2IPTH 2Y9RT 4WENB 4X7SH 5I1AA 4LSPL 2DMBA 1A3RH 4G42B 3ROOA 1A0QH 4YQXL 3F6IA 4PJEF 1MIEL 4KRPC 2IH3A 1RFDL 3G04B 1N2RA 2EDKA 1G9ML 5IW1B 4DKFH 3C8KB 4NQXA 3FRPG 1MFBH 4OKDA 5LGHH 1MJ8H 4MB5A 2AP2A 3BI9X 4M03A 4P2CG 2HVKA 5IV2A 1RVFL 1LEIB 1OAUH 4HT1L 3FZUD 4P23A 3KPSB 3GNMH 5J56B 2GSIB 4WNQB 3OAZK 4X4ZA 4CU6A 2IBBA 4JKPH 4P5MB 3P2TA 2W07A 7FABH 3ARXA 1N3NB 2YPVH 3QUYD 1LO3L 5EO1B 5I75C 1GPOL 1R3JA 1XT5A 1UG9A 4D9LL 2V2TA 5HHOE 4LLAA 2IAND 1HNGA 1XGQB 5C0GA 3KYOA 3BEWB 4M7LT 2Z8WC 4AENA 1TZGL 2P44B 3BESR 3DMMD 3QWOB 3L6FA 3U36B 1A5FL 1JPFA 4MNGB 3ERYA 3QIUA 1BBJA 3OJ2C 4BQCA 2WV3A 4NKDA 2Y5TB 5IB1A 2IANB 3ULUC 3LH2H 2MNUA 1N59A 3IKKA 3OPZL 4I48B 3JV5A 5IHZA 1BQHG 3O11B 4XP9H 4TULL 5CAYB 2NNAA 2IFFL 4AG4L 3GKWL 4HWNA 2R39A 4TPRL 2UZXB 2H2PC 5HYJA 3DETC 4XNMB 5FYJE 3UTTD 4M6MH 4KV5F 5C0DB 4HX1B 1KLGA 2X40A 4OZGB 2BCKB 3IJYA 3OXSB 1RZ7H 4KHTH 1I85C 4YXHL 2EDQA 3P4OB 3O2WL 4G6AC 1CBVH 5FDYA 4YZFF 4S1SL 5IVXE 3IF1A 2YWYA 5C0AB 3DXAE 2OTWA 4UDUB 3J7HA 3BZEB 2FB4H 4XP5L 1DJSA 4O00A 5GGRA 4G6FD 3UTTB 2W91A 1YC7A 2WMPA 1D5BB 4GW4B 1T21A 1ZLUK 3Q0HA 5GXBB 1NFIA 3DXAA 4I5BB 4O9HL 3MV11 3CVHA 1BFVL 3QB7C 4YIQB 1G6VK 3ORJA 2MCG1 4PRHB 1QLEH 5D6DA 2YD1A 3LMJH 4G6FB 3SDAA 3FB6A 2FD6L 2D0HA 3KHOA 2ZCLH 1FL5B 1UH3A 4NBZB 2IQ9H 1MJ7H 4TUKH 1QSFA 5H37H 4ZUWA 1T5WA 5JXEC 4NDMB 2Z8VC 2A0LC 5EULV 1BMGA 1PDKA 1BBDL 2R56L 4J4PA 1T1WB 1JHKH 2H2SD 5IB3A 1IGFH 3RVTD 5GJTH 3KPNA 3BEVB 1EJ6A 1G7PA 5E2JA 2PW2A 5KJRL 1WIOA 4JM2D 1KXTB 1H5BC 1NC2A 4OZHF 3QEQE 1B2WL 1RJYA 1CDIA 2LTQC 3QR2A 3LKNA 1CFTA 4JANA 4HH9A 4WUUB 1AQKL 2NZIA 1X6NA 1TJHL 3MRKB 2XI9A 1NKRA 1TVHA 3ZE1F 3TN0A 1CLOH 4ZPTB 4S1DD 3C6SB 4JM2B 1PZ5A 4HXBL 4X5XA 4M93B 3IT8D 3O3AB 3X13B 2WWMC 4HBCL 3ZYOA 5B39B 4OLVL 4ETYA 3T0VA 2Y4SA 2PXYC 2GSGA 2UVEA 3HNSL 3U0WH 5FCSH 1Q0YL 2EXYD 3M8OH 2NR6D 4PJGB 5FM5M 3L3KA 3VA2C 4X83A 3P4LA 5JA9A 1TITA 1NFDE 1H3WM 4PB0H 4Q2ZB 1F4YH 2C1OA 3P4NA 5CWSB 3SPVA 3OKDA 4X6DE 2AV1B 4ZOAA 1OAKH 5CEZL 1DN0A 4LSVL 4XVSH 5JIIA 3RPKA 2R2BA 5J89A 4X6DA 2HJLB 3DIFB 2OCFD 4Q9RL 1NBZA 3DVNA 5EWIL 3GFUA 3S35X 1N4XH 4YUEL 1I8LA 1OGTA 5JHDE 1EAJA 4Z5RA 2DKMA 1SHMA 1YEEL 4K7PL 3MJ7A 2Z92A 2R2HA 3VH8B 3PV6B 4LLQB 5JHDA 1OQXA 4OCMC 3CPLB 2VXSL 4UNTA 4M62H 3ZYJA 5LXGH 1CLCA 1JPSL 3U6RB 2CUHA 2EE9A 2ADFH 3SDCC 1JN6B 2LU3A 9CGTA 5I0ZA 3QJFB 3V6OC 5GGVH 2W0KA 3G5YA 1DQQA 5IBUB 4JY6A 1WBXB 2Z35A 2FO4A 2X4TB 1JGUL 3MROA 3PHQA 5DVOA 3WXWH 3RGHA 3QUKB 5IFAH 3PWPE 3SGKA 2FX9L 1CF8L 2EH8L 1AC6A 2XZQH 1KELL 2Y5EA 1XGTB 2ZOLA 4OF7A 4Y19A 3QNZB 1Y0LB 1EGJL 3PWPA 5T33H 3JVGA 1JF1B 2IG2H 3IETA 4ORGB 1F4WL 4EUPG 1LE5B 2W0FB 4X80H 5D1XC 5L88H 5BVJA 1WBYB 1BVLA 3N1PC 1Y6NR 1QP1A 1RMFH 1NGZB 3UX9B 2ZJSH 5KAQF 1L7TL 3D0LB 1S78C 1IAMA 3TO2B 2P49B 1T5XA 5DDHA 3FO2B 4C4KO 5CHNB 3CX2A 4FS0A 3OQ3B 1OTTD 1KGCD 4KI5F 3MRQA 2B4CH 4P2OA 4MD4B 4N8VG 2EYRB 2YD3A 3T77A 3ARWA 5GZOC 4N0FA 5EOTB 1MEXH 1YQVH 4JDVB 4K23H 3TPUE 1NC4A 2D9QB 2AQ2A 3IJHA 4HGKC 3DV6B 4XGZA 1KIPB 2KZ1B 3STLA 3TPUA 4AL8H 1PX4A 2R23B 3QAZC 2JIXD 1XIWA 3HE7A 4V3DB 1E6OL 2VDRH 2NTFA 1VFAA 5I2IB 2K9UA 4X5WB 4MA7L 3HB3C 5J3HD 4FQJH 3W5NA 1A3RL 3F7RA 5JDSB 2HYMA 4NSKB 2UWEF 1ZHBA 1HOCA 1WWBX 1DLHB 4PY8I 3HMXA 4L8BA 2XPGA 1Z2KA 4U49A 4OCNC 4I9WD 4O58H 2AW2A 3AAZB 1ADQH 2DLIA 4C59B 4N0CC 5ISZE 3BO8A 5SWSD 1JIBA 4DKFL 2HKHL 4IOSD 5CD5D 2JIXB 2DI7A 1MFBL 4PJ9D 5LGHL 1ZWIA 2VRAA 3C8DA 5GSRA 4EQ2A 1U8PA 1URLA 1F5WA 2XZCH 4IRZL 4ZO6A 5ISZA 3MLSH 3GMNA 4YE4H 5FO8A 1OAUL 3GNML 5GHWH 1I7RA 4Q58C 4JVUA 3GM8A 3VXRE 2GI7A 3HPLB 4JKPL 2VMFA 4OKVA 4PJ9B 7FABL 4XWGH 2YPVL 3OXRB 2NY7H 1EFXA 3ARGC 1HHIB 3U2SA 3OMZA 2IQAA 3VXRA 4PJHB 5ANMB 3Q6FA 4OT1L 3QUMB 4CNIB 1MLBB 1S7UA 5ICYA 1JWSA 4IIQB 4J3TA 3OKNB 1MCIA 1V8HA 1JGVH 1NGPH 3MBXH 1MCWM 4H5SB 4MCZB 1NAMB 1BVKB 4MA8H 3TT3H 4TVSa 4Z9KB 1CGVA 1CXEA 5CIPB 3U9UB 1OPGH 4Y5VC 2W9LA 4CRPA 1BM3L 5CP3A 3LH2L 5AWNL 2R0WL 2EO1A 2F54E 4KAQH 3RUGB 1NJ9A 4M02A 2DI9A 3UTSD 2P5EB 3G08A 1ZLWH 2Q1EA 5DJXB 1CXIA 3QULA 5DHYA 4ZUUB 4PJ8A 4KZDL 2GAZB 3OGCA 1AR2A 4RDQG 5HHMA 5DD6B 1JNJA 4TVPE 2F54A 2EDRA 4M6ML 2J8HA 2UUDK 1ZANH 5DYOA 3MV7D 4M5YH 1QBMH 4KHTL 4NHUB 2EDLA 2ICWA 1CBVL 1LE9A 5BQ7A 4XXCA 3UTSB 1IM9B 3GJFK 4MSWA 5A2FA 5ITFA 2FO1A 2C3WA 5HVGB 2FB4L 4I9WE 3WNNA 4QWWD 2BSTB 3HNTH 4FP8H 3AFLA 3R8QA 4PBWD 4CMMA 4DTGH 5CLTA 3MRMA 2PXYB 3WFEH 1VSCA 1QLEL 4X6CA 1BIIA 2CPCA 3LMJL 4PLKD 1I4FA 1DEDA 5T3XE 5DQDH 5E8PA 2X7LA 2VQUA 5HHQB 2IQ9L 1MJ7L 3KWWB 1OD9A 2JK5B 3MUGB 2OL3B 2K1MA 3DX7A 5TDPB 4RGMC 4XVUD 2XYCA 4NJAH 2HRPH 4UIMB 1XF4A 3MLXH 5EOCJ 2OYPA 4LBEB 1CDBA 1IGFL 5HVFB 4H20H 5GJTL 4Q9QH 4S0SD 1F11B 2X4NA 2D7TH 2PYEA 3W39B 1YUHA 3IS1X 3FN0H 1OW0C 1MFEH 4NN7B 3TJEH 2GFBA 4HS8H 1N8ZA 2MQCA 4XPBH 1OGAD 4FQHB 2VSCA 5KS9B 1CLOL 3QFJB 4N5EA 5LCVH 3MTRA 4KUCD 3MLTA 3HRZA 3SJVA 2EKSA 1KCRH 1XGYH 3RFZC 3Q5TA 5I76A 2J8UF 5JOFA 4GRLC 1U93B 1FIGH 3OJVC 4LLDB 1V7ML 3M17B 3SDCB 3MV7E 2XWJA 5C07D 5EU6E 1S7WA 4P57A 3O8XA 2MFNA 5FO7B 4NQVA 4Y0GA 4U05A 3RWFA 3HUJE 3WIHA 3ZKMC 3FB7B 2ICES 4QXGH 5E8EA 4PB0L 3N85H 4Z8FH 1D5XB 2WUBL 1F4YL 3BW9B 3IFPA 4K2UH 3CSGA 5DJ8A 5EU6A 4BYHA 1X4ZA 3K4AA 5HVHC 4FQPA 1D5MA 1ZVYA 3HUJA 1T2QL 2IMMA 5C07B 1I7TB 4XVSL 4JFDD 4XCEA 5LGKA 4ZQKB 2JJTC 2V5SA 3NCMA 1K8DA 4P49A 3T0XA 4N0RA 4P0DA 5EPMB 3JSSA 3T4AB 4LLUA 2BVOB 4MDIB 5D1XB 1NGYB 3K80A 3O2VH 5TE4H 3VFRA 2ATKB 3NFPB 2EDEA 4PJFE 1FZKA 4LKXA 4QXWA 3WJLC 2XQBH 4JO1L 3OKEA 3IRPX 1H3PH 2V2XA 4I4WA 2BRQA 2GTWB 3MLRL 5F9JB 3CDCA 1GXEA 3QCTH 4C56E 1W72A 4D94A 3ARZA 4PJFA 3MGOB 2NW3A 3U7YH 3GSOA 1GGIH 4NBXB 3GSVB 3UDWA 2XZZA 5LXGL 1T6WA 5HDBE 4C56A 5BW7C 4DZ8B 2ZSVA 1KYOJ 3NN8B 2ADFL 5E1AB 5CJXA 5F7UA 4MMXC 3QDMB 5GZND 1U8LB 5IOPA 5GGVL 3TVMC 5HJ3B 2Y6SD 2YC1B 2WLZA 4GW5B 5L2KE 1TJGH 5F9WC 3BGFB 1NEUA 1FFQA 4IRJD 3D85D 5ID0B 3DLQR 1EXUB 4FFVD 4HFUL 1E4XH 5DMKA 5L2KA 2AJZB 1IGMH 4L9LA 3RL2B 5T33L 3QBTB 2IG2L 3IDJB 1ZHKB 1WJ3A 4KY1H 3RVXD 3NIFE 5E6IB 4EQ3A 2P48B 4X80L 1C7TA 1LHZA 1NMBH 4H1LB 2AJXH 3D85B 5L88L 2VXTL 3BKYH 2ZJSL 4EVNB 3MBEA 1PG7X 5ESVB 3STZA 3DX8B 5GIRB 4U0QB 3UPRA 1FVEA 1Q38A 4YAQA 3MV8E 2C7UA 4PP1D 5B39G 4JFDE 5ECJE 4JEGB 2X6MA 2NY2C 4NZRH 1T83C 2EZ0C 3MV8A 1YPZB 1YQVL 3SGDH 2M26A 3T1FA 1MCDA 3O45B 1HHKA 5CSZA 2AQ3A 5DJ6B 3B2UD 4MNQD 3EIFA 1FFOA 4JKMA 2YA1A 1HXYA 4CUCA 5IMKB 4I1NB 2VDRL 4QXTB 1NCCH 1H8NA 3K8MA 3MV9E 4FQJL 5EZOH 1A1MB 4M7ZB 4R96A 4I77H 2DMCA 4K7PX 5IVXF 1B0GA 4HFWB 4O58L 1ADQL 4MNQB 5I8KH 4FQXA 2GJ6B 4R4FH 2Q3ZA 2AJVH 1M71B 3WN5B 2X1OA 2A73A 1P5VA 3Q5YA 1NEZB 4NCC1 5C0BD 5T1KD 5K59E 5FGSA 2OTUB 1E4XI 5LQBH 1BPVA 3MLSL 1BZ7A 3VXMD 4YE4L 4WV1A 4QT5A 4CVXA 1YYLH 4MQSB 4X7CC 5GHWL 3DRQB 3VH8G 4OFYA 1I7UA 3FN9A 4JQXA 5HYIA 3AB0C 3WSQL 1JJUA 3GSNH 2O5YH 3VFSB 1A7QL 2FEEI 3HHRB 2AK4E 5T1KB 4XWGL 1CD1A 2NY7L 5D5MB 3VXMB 3VGAC 1YNTA 1A02N 2CQVA 4NC0B 2AK4A 3MRLB 2JCCB 4QCIB 1JPGA 5IBUG 4PJBA 4N5UA 3EFDH 1DUYB 2DLHA 3MLZH 4LMQI 4HLZH 3OKMB 1JGVL 4ODUB 1L0QA 4F8QA 4WDIB 1U41A 2BOCB 1U8MB 1DTUA 2APXA 1V3KA 3O9WA 4MA8L 4UDTB 3GIZH 4JG1H 4XMPH 5I8EA 3TT3L 3R4DA 3VFTB 1BF2A 3SGDI 1OPGL 3D39E 4RGMB 3VU2A 4NKMA 4TSAH 1MCBA 1TDQA 2FYYA 2A74A 3QFDB 5DQJB 4MJIA 1N6QH 1R3IH 2P24B 2BY1A 5LAXB 2GHWB 2I07A 1MCSA 1DQDL 3UYPA 4EN3A 3NPZB 3OJDA 4EDWH 1RJCA 1AD0B 1XF3B 5DK0A 4Q9BA 5C1MB 3KVQA 1ZANL 4NQDE 3V6BR 4JCLA 4M5YL 1QBML 4U6TA 4N0UE 4RGNE 1K6QH 4YDKH 1K2DA 1GH7A 5T5NG 4PJDA 3TGXA 1LILA 2EDDA 2VO5A 3E6HA 1CIDA 4N0UA 2DYPA 3NTCH 1FNSH 1NFDF 4DQOH 5D6DC 4LDLB 1ZHLB 5EUOE 1G7QA 3HNTL 4FP8L 3SDAC 3IFOB 2OZ4A 1Q94A 4GRLB 5JUEL 2YPKB 3DUSB 5KOVC 5C0BE 4BH7B 3WFEL 1P69B 1NLDL 1UVQB 2Z9TA 4HIHA 4U1JA 5EUOA 1LVEA 5C0JA 5ESAA 4J4PC 4KJPC 1UYWL 5J6GA 3MMEB 5DQDL 3VFWA 4PRDA 2G9HB 3V7AE 1M7XA 1OP5K 4AIZA 3HG1D 3PWLA 1Q9LA 1ZVHA 5GRVL 5HVHB 1J0IA 3QO1B 1I8MA 4NJAL 2J1KA 4F2MA 4GRWB 3MLXL 3HI1A 1NGXA 4Q9QL 3U1SH 43C9A 5C0CE 3DROB 1MAML 1DDHB 1CICD 1MFEL 4FFZH 2MPAH 3TJEL 3O4LB 3L3HB 3ARBD 3QH3A 4CDHA 1OT2A 5JW4R 4TTGA 3PGFH 3U4EA 2HTLD 3IDGB 5C0CA 2XICA 2G5BA 3V52H 3T08A 4HS8L 5DVMA 1AHWB 3HAEH 5LCVL 4LCUB 3MRBA 3BRFA 1D6EB 3ARBB 5FK9A 3B4NA 1XGYL 3FOLA 2FGWH 4UU9A 2IPUG 4MDJA 1FJ1A 3RNQA 3VXNB 3U82B 1ED3A 3NACH 1UB5B 2ERJC 2BXZA 1AKJD 1FIGL 2F8VA 1IGJA 1JCKA 1LP9B 3QEHB 3BH8B 2CRYA 1T89C 4B41A 3T0ED 4P46C 3TVMB 2EC8A 3ULVE 3ZTJG 3B9KD 3FT4A 5F9WB 3C6LD 4QXGL 3SDDD 3N85L 1KXVC 4ONGH 4RAVA 4GQ9H 1MREH 4G3YH 4K2UL 2AXGA 4ZFOA 3GGWA 2E6QA 3WL9A 1AKJB 5DMGD 3L3DA 1PKQA 4N68A 5FB8B 4GXUM 4Z7VB 4X0KB 1I8LC 2ZKHL 2D03L 4KKAD 1FFPB 3B9KB 4DKEH 1GGBH 2BOBA 4M48H 3EO1B 2HFGH 2BC4A 2DTSA 4JLRA 1Y18B 4XH2A 4FTVD 2F53B 5TE4L 3O2VL 4RA3A 3PQYB 3SKNB 2EDHA 2FHCA 4ETQB 3EOAB 2BVQA 2MHAA 3B9AA 4C58B 3OWEA 2I26N 2XQBL 4Y5XA 1H3PL 1FAIL 1OTSD 5K9OA 3VXQB 3QCTL 3WMSA 4HKZB 5D2LE 1MWAA 2XOTA 1FZOB 4KKBD 1IAKA 2NY4B 4NNYB 3U7YL 2E9WA 4KKLC 1GGIL 3GIVA 2NY2B 2BNRE 1WVZA 2DQGL 4LF3B 1RZKC 4JPKH 4OGXH 3E3QE 4PBVC 3KYMA 3VW3H 3SGKC 1U0QA 2VLME 2F58L 2BNRA 4P23D 3E3QA 2VE6A 3D48R 3VXTA 2HA1A 3KPQA 4KHXL 3JVGC 1E6JH 4NQXB 4OBSA 3GMPA 4ESKA 3UTQA 1YEIH 1VADA 2GJJA 3DOSA 2CLVA 5JQ6H 3EJYC 4ZFFA 2HVKB 4YBLB 2FH8A 4CKVX 4P23B 3FFDA 2E3VA 1NCUA 4HIIA 2RAMA 3VRLE 3UJIH 2XWBA 1NMBL 3BKYL 5GS0C 2IAMD 3B6SA 4E42A 1EZVX 3DJ9A 3U7AA 2V2WA 1R3HA 4P2OC 4DW2H 2NY6D 1R3JB 3QIUD 5IVZA 4ENEC 5BVPL 3ZE0F 2V2TB 1JZ7A 4J3XA 1RZJC 3KYOB 1ZLVH 2YR3A 1RUKH 4LRNL 4AENB 3VGAB 1R5WA 1Q72H 4ZSOE 4NZRL 4MJ5A 3ZL4H 1XIWC 3HE7C 3SE8L 3I84A 1BREA 5D7IE 5KVEH 3QIUB 1BBJB 2CLZA 4M1GH 4NKDB 2EE2A 4ZSOA 2X41A 1UJ3A 5IHZB 1KB9K 1OSPH 4OGAD 2H6PB 2NNAB 3O2DA 1R5VA 3OSKA 4YK4C 1HINL 1FDLH 5EZOL 4S0UC 3K1DA 5HYJB 2ESVE 1CU4H 2CIIA 5C70A 4R2GC 1CFQA 3IJYB 4PR5A 5EOCL 4H25A 5JPMB 3VDBA 5I8KL 3FONA 4L3EA 4X7EC 3QZWG 3DHMA 4XBEH 1PD6A 2ESVA 4R4FL 3IF1B 5BRZA 4WWID 3ULUL 2AJVL 2OTWB 4GKSA 4PJXA 3MREA 4KMTL 5C0RH 3KS0H 5GGRB 4JN2B 5LQBL 4D2NA 4ZS6C 5GSVB 5E9DD 1CFSA 1T21B 1YYLL 4NCC2 3CZFA 1NFIB 3DXAB 4HKXB 3IKCB 3CVHB 4LSUH 5IVNA 3GSNL 2O5YL 5L8KB 1J5OH 4PJHF 1YNLH 3HS0B 2QADC 5DHVH 2C3XA 2A6JA 4H8WC 3SDAB 3HI5H 3FB6B 2GY5A 2BMKA 3OKLA 3FHAA 5KTEL 4QRUA 1QSFB 3TBWA 5JIHA 1FQ9C 1T5WB 3FTGA 4RBPK 5IB5B 3EFDL 3MLZL 3H3KA 1ES0A 2YRPA 4X7FC 4WEBH 5IB3B 4XMPL 3GIZL 4JG1L 1DVFD 3TN0D 3QUML 4PJ8C 1N0XL 3B3IB 1G7PB 2AGJH 5INDA 2PW2B 2BVPA 1BWMA 1QSVA 2NYYD 2E6PA 5CLWA 3SGEI 3RVVC 3QUZD 3LKNB 4ZPVB 1Q9KA 1CFTB 4JANB 4HH9B 1R3IL 3GSXA 3G6JF 3G9AB 4FQIH 3K46A 4ODSH 5GQBA 2A9NH 4XXCC 4OI7A 1TVHB 6FABH 1I9RH 5D7SL 3TN0B 4EDWL 2QQQA 1KPRA 5FV2A 4K7PY 4F7EA 1I8KA 5GGSY 1PZ5B 3BPCA 4WTWA 1K6QL 4YDKL 1P1ZA 2FLBT 3GM0A 2FATH 4L9DA 3EDDA 1G0DA 5ILTH 1KEGH 5GRZA 1JK8A 2GSGB 2CDGA 1JNLH 3MZTA 5MHSD 4V1DE 2HH0H 3NTCL 1FNSL 1UZ6F 3FKUS 4LLVA 3ZYIA 4OZFB 3CFKA 1KUMA 3L3KB 4QHLA 3P4MA 4O2CB 1XR8A 2F5BH 1SYSA 3PABB 1FBIH 3F5WA 4JDTH 4JJ5B 4ZAKD 5DC0A 1AGEA 3P4NB 3SPVB 3OKDB 4S1RL 5E9DE 1LDSA 1IAIH 1JP5A 5FCUL 5E2UL 1KBGH 2PO6A 4LSSH 5I71C 3RKPA 5IEHA 5MEND 3MNWB 2DLTA 4ZUSA 4HIXH 4X6DB 4WWKD 4XPFL 4AQOA 1NBZB 3GSUA 3QXWA 3DVNB 4YFDB 1G7LA 3TP4A 5DS8A 1GAFL 4HK3J 1T0MB 2UYLA 2EDNA 5BOPA 1FH5L 1OGTB 1T0NA 4Z5RB 2VC2H 3FAWA 5SV3A 1VEMA 3BGMA 4L8SA 5MENB 5A1AA 3P11H 1G84A 3D2UA 4JFOA 4M00A 3ABZA 4AT6A 4FFZL 2MPAL 5BOZG 1TVBA 4N5EC 3MCLH 3MJ7B 2Z92B 2R2HB 4I0KA 3PGFL 1MCQA 5JHDB 5AG9A 3V52L 1OY3B 4LP5A 4RGOH 3LDBC 3ALWA 1CXFA 4X8XA 1T7VA 4XNYH 5ESQA 3P0YL 5EC2A 4Y4HD 4YPJA 3SE4A 3O8XC 4H26A 3UJTH 3G5YB 1DQQB 2FGWL 2VYRE 3QT2A 4JY6B 2NX5E 4KUCF 2Z35B 2FO4B 3NACL 3MROB 3PHQB 4MS8A 2YUXA 4HW6A 2NLJA 2BSSA 4NUGH 4JR9H 4N90E 2R2EA 2NX5A 3BPLC 1S3KH 5GGSA 4Y4HB 4M6OH 3KPTA 4U3HA 4Y19B 3NIFF 5DWUH 4B7IA 4ONGL 1VCAA 2V9QA 3RP1A 4WO4A 1MREL 4G3YL 1W0VA 3IETB 1FRGH 3WUZA 5I1GH 4KUZH 4GG6F 2B39A 5BVJB 1BVLB 1P4BH 1IAII 1UCTA 3QIBA 4YBQC 3VRJA 1GGBL 2HP4A 2VDOH 5HHPA 4M48L 1UGNA 2HFGL 1T5XB 3MSPA 5DDHB 4BQ8A 1CVRA 5I73C 3RWEB 3SKUD 5DT1H 3L9RA 4JB9H 3MRQB 4P2OB 3UDWC 5DJ2A 3NCCB 3T77B 4N0FB 3FO9A 1OCWH 5DJCA 3RZCA 3DX6A 5IFHH 4P4KD 3OAZH 1EGJA 5CJXC 3IJHB 2BNQE 2Q7YA 5D7JA 5I16A 1JZ3A 4XGZB 2L0DA 3CXHK 3T65A 3STLB 5L8JB 2HG5A 4JPKL 1XIWB 3HE7B 3U9PH 2NTFB 1VFAB 4GXVL 1JUFA 1XEDA 3VW3L 4QHUA 4HF5H 2BNQA 5FECA 1ZHBB 1HOCB 4HLJA 5DXWA 4J8RB 4P4KB 3N0PB 5DA4A 4L8BB 4L5FH 4XZUA 4Z7WE 5D6CA 2BZDA 4YHOH 3VXSD 4L9LC 2RQ8A 2CKBL 3BO8B 5K59F 3ARFD 4QRRD 4YK4B 5JQHC 2VLJA 3F8UB 4LCWD 2R69H 1KPVA 1T66C 1YEIL 3UPAA 4MMZC 1ZWIB 4EI5A 4HCRL 3SN6N 4R2GB 5C6TH 5ISZB 3U46A 3HRPA 2LU7A 5FO8B 1IC4H 1FZJA 3MBEC 2Q8AH 1I7RB 2AVGA 5DO2C 1FC1A 2EDXA 5MEQA 3UJIL 1I1RA 4ZFGH 2COQA 4OKVB 1AGDA 4JFPA 3MRIA 4V2CB 3W2DH 3EZ8A 4NYLA 4I3RL 1EFXB 3CDGA 2X1PA 1U8OA 4DW2L 3U2SB 1M05B 2IQAB 3VXRB 1WFUA 3ZDXE 5E0QA 4EIGB 3Q6FB 3PIQA 5F7FA 1YPZF 1S7UB 3RIAK 5ICYB 1JWSB 4K71B 3QI9D 4XI5D 5H2BB 1RUKL 5CGYC 1Q72L 4G9FE 4HIEA 4Q6IA 3ZL4L 2DQEH 5HHMD 5I6XC 5KVEL 4UV7H 1YY8B 1MHHA 3QXVA 2KDGA 2YZ8A 4M1GL 4N8PA 5JIPA 1NGQL 4G9FA 4FG6C 3LKPA 2QEJA 5FIEA 4G7YH 1OSPL 3EOBB 5KANG 2ZUXA 1OQOA 3G08B 4L29A 3I3EA 5DHYB 1Z9OA 4Y16D 4FQXC 4AIXA 3UC0H 3HR5A 3OGCB 3BKCH 5HHMB 4A6YH 4Q6YA 3MOBH 2F54B 2FBOJ 4KK5C 5DYOB 1IBGH 4XAWL 3PGDB 5GRXG 3RTQA 4WV1C 2ICWB 3KDMB 5L8LB 1LE9B 2ZUQB 4I2XE 5BQ7B 4XBEL 4GBXC 1KLFA 3BN9C 4MSWB 3H6JA 4JQXC 1CT8A 2BVEA 3AMKA 5EUOF 1OT1A 2ITDA 2R0ZH 3QQ9D 5C0RL 2ZOKA 1BJMA 2HT4C 5INCA 1ZMYA 4I2XA 1AXIB 3PDDA 1M6OA 3M45A 1XMWA 3FT2A 5FYJH 5HHNA 3QUXA 4CMMB 4V2BA 3LN4A 1U8QA 4LCWE 1B90A 1IT9H 5DQ9A 1EERB 4D3CL 3MRMB 3OX8A 4LSUL 3LQZA 3MLYH 4AYFA 3INUL 3V5HA 1J5OL 1B9ZA 4KJQC 5ACMA 1YNLL 4OD1H 4X6CB 1BIIB 1U6AH 1CGUA 3A6OA 4XMLH 1P2CA 2QSCH 5D72L 1EZVY 1JPST 1I4FB 1A64A 2E7HA 3CLEH 3L5WA 3O9WC 2PYED 5E8PB 2VR4A 5LGJA 2DDQH 2X7LB 5E5RB 4BK4A 4N9GA 3UTZA 3DX7B 4BSWA 1SY6L 5DJ0A 1KCUH 1XF4B 4L4VE 5I71B 4OF3A 4HK0B 2VDNL 4WEBL 3Q48A 3MACL 4ZO7A 3P40A 3GHEH 4GAJH 5CEXA 2X4NB 2PYEB 4YLQT 1J0KA 2AGJL 3S37H 3ET9F 2F8OA 4EN3C 4L4VA 4PRIE 3L5XH 3ZKXC 3MCG1 3HI6H 3SJVD 3QNXB 2GFBB 2PUQT 3RDTD 1ONQA 3RKDC 4X9HA 5KG9A 4NO0D 3UO1H 25C8H 4FQIL 4POYA 4ODSL 1N8ZB 3QRGH 3KG5A 2A9NL 4HZAA 1QUNA 3LIZL 4LNRB 1I9RL 4NZUL 1QA9A 1BWWA 1A6VH 3LS4L 2B0SH 4RGNC 3MLTB 3HRZB 3SJVB 5TQ0H 5MP6H 1VGKA 2EKSB 3ALPA 2HJKB 4QOKE 5F1IA 4P2QD 2I24N 5I76B 2FATL 4PLJD 3LDBB 4S10A 5ILTL 5CZXD 4BFIA 5JOFB 3KLHD 2VN7A 5K9QI 4WUKH 1JNLL 1TTFA 3TFKA 1LMKA 3ULVF 4OUUB 1MHCA 3WO3B 2XWJB 1MUJA 2RGSA 2WQRA 4QOKA 1OWWA 2RR3A 4P57B 3O8XB 5KSAA 4XB7A 4NQVB 3RWFB 2AI0H 5E8EB 2F5BL 4LEOA 1NDGB 4GT7A 1EVTC 5GGVY 1FBIL 3C09C 4JDTL 4JQIH 5D9SA 2ZUUA 2EICA 5D4QA 1D5MB 2D7QA 3OGOE 3HUJB 1IAIL 2ZG3A 2GK2A 3DV4A 1KBGL 4LSSL 2XKNA 4UQ3A 4XCEB 2ZNWA 2VDQH 4X4YA 3W11D 2PW1A 4HIXL 3W5MA 1CGYA 3EJZC 1DEEB 5L0QC 5EIQA 3UZEA 2VLKE 3MA7A 1CGTA 4NZDA 3VFRB 3MXWH 1FZKB 3DUHA 4K8RD 4LKXB 4YEFA 3OF6A 2O26U 4EJ1C 4ODTH 2VC2L 3OKEB 5CILH 3SE9H 5D2LF 2VLKA 2HLFD 2GUOA 1G9NH 5E8OA 1W72B 4TRPH 3MCLL 3CVIH 2NW3B 2H32B 3B9DA 2ICWJ 2P43B 4HMDA 3GSOB 3LQMA 5F70A 1QPXA 2F5AH 4YXLH 2P5WA 4KK9D 2A6DB 3QDGA 5IHLB 4C56B 3MYZA 3ARRA 5EH1A 4P3WA 2ZSVB 3NCEB 4Y2DD 3B2VH 4XNYL 4WHDA 1RUQH 2GK0A 3NBNA 1LQVA 3VFUA 3ZLQC 3S36L 2PKDA 5ABDE 3UJTL 4CJ1A 3LQAH 1IC7L 4RAHA 1IGIH 4IHOA 3VRIA 4AEIH 1QYGH 2YBRB 2PNDA 1VEPA 3IRZA 4NUGL 2WW8A 3S9DB 4Y2DB 3ULVC 3ILQC 3V5KA 5DMKB 4P2QE 1S3KL 1F4HA 4M5ZL 2JTDA 3NIGE 4RIRA 3BKJH 5DWUL 3DTXA 3FMGH 1FRGL 2B1AH 4Z6AT 4KUZL 2O93L 3O6FD 5AZ2L 3H42H 3QP3A 4W4NA 4Y89A 1HEZA 4JAMA 4HDIA 4PTTA 2DQCH 1OL0A 4Y5XC 2VDOL 3DRTB 3STZB 3Q6GL 3WFHA 1FVEB 1NANH 4YAQB 2C7UB 3WLWD 5B21A 3BIKB 4X98A 3GMOA 4JDZA 2YPLE 5DT1L 4S0TD 15C8L 1K5NA 3MV01 4JB9L 5D7IF 3P77A 3T2OA 2CDEA 5FM5O 1UEMA 3BDYL 3MV8B 1OCWL 5EBWA 2YPLA 1NSNL 2I60H 4ONOA 5C0IB 4B7LA 4PGEA 4JJHA 4KKCC 1HHKB 5DMJB 3HZVA 2J5LC 2DIBA 3E3QC 1VA9A 2DI8A 2P8LA 1HXYB 2WY3A 5I6XB 4JGJA 3U9PL 4CN1A 3HE6D 4HF5L 5GS1A 5I1HL 4R96B 4N8CH 4NN5B 3D0VA 1QQDA 4L5FL 1B0GB 4YHOL 4PV8A 1T4KA 4R4ND 1JE6A 4FQXB 2XV6B 3BJ91 2SEBB 3TYGL 2DWEA 2R69L 4PGBB 2A73B 2QLVB 3H9SD 4WW2A 3BP5A 1GGUA 3MRHA 2YSSA 1BZ7B 1FNEA 2VL5A 4WV1B 2E8YA 4QT5B 2Q8AL 4CVXB 4ZUTA 1U92A 4UBDC 1N64H 2HLAA 3PP4H 3RBSA 2OQJA 4GG8A 1ETZA 5I30H 4U1KA 1G9MC 5IKCA 1OSZB 2NCMA 2A83A 1B6UA 2YD7A 3BYTA 4OF6A 1YNTB 3TO4A 1J8HE 1PEZA 1I8IA 1W2KT 2AK4B 3D3VE 5EA0H 1ADQA 1X5GA 3GJFH 5TE6H 1JPGB 4PJBB 1HWHB 2Q86A 5IHUH 1P7QA 3C2AH 3HTLX 2X44D 1UJ3C 3A6BL 2NY5H 3O9WB 3D3VA 4EIZC 1NBYA 2RFXA 2DQEL 1FYTD 4KDWA 5F88B 3KPMA 3KPRE 1HQRA 2J3SA 1LK2A 4UV7L 2VH5H 3DVGA 4Y1AA 4PP2A 1NBQA 1FP5A 1RY7B 2FYYB 2A74B 1INQA 4G7YL 4PJCE 4AEFA 4MJIB 2G2RA 3KPRA 3OL2A 1U8HA 4C57C 1IILE 4ISVB 2UY7A 4FZ8H 4YFLF 1PGRB 3UC0L 5C3LD 3BKCL 4BJLA 3OJDB 4A6YL 1IEHA 3MOBL 3UCRA 5DK0B 2W0LA 3WO4C 3CLFL 1J86A 3MNVA 3QDJD 3LKOA 4M9OA 4M6NH 1K2DB 4PJDB 2VISA 4XXDB 3E6HB 2B1HH 3QHTC 1HH9A 2R0ZL 4N0UB 2DYPB 4U4BA 2X09A 3VGFA 1OVZA 4HD9A 5JXAH 3B5HA 3CK0H 3QDJB 2K7QA 5FYJL 1Q94B 4EOWH 2P42B 1K8IA 2E7BA 2UV3A 1G7IA 3QA3A 5F6HJ 2EIBA 3H9SE 4QXUH 4HIHB 4OD1L 1U6AL 3MRJA 3NCYP 4ORZC 4JFYA 1CGXA 4XMLL 5C0JB 5DHXB 2ORBH 5H8DA 5J6GB 2DIJA 5DRNA 3VFWB 4PRDB 4AIZB 3C09B 1Q9LB 3STBA 5JW3L 1YDPA 1J1PH 4EXPX 3PGCA 5DVNA 1I8MB 2APVA 5E2VH 1KT2A 5I74C 3VI3E 1KCUL 2FEDC 3EYUH 4LKCA 5DMIL 1NGXB 4MB3A 4D8PA 4WEMB 3CFIC 4OFDA 3GHEL 43C9B 5DD1H 2CK0H 1A7OH 1RIUH 1U2CA 4BSJA 4HH8A 2BP3A 3S37L 3RX8A 5L0QB 3F7YA 1YC8A 3L5XL 1MCOH 3NOIA 4NP4H 3LOWA 1FO0H 3U4EB 4DUVA 1MFAL 1PX3A 1FFRA 5C0CB 3PL6D 2G5BB 3UO1L 5MERB 25C8L 1SVZA 4HZLA 3QRGL 2OR8A 4IJ3B 4MXWL 5HPOA 2NY3C 4DWHA 4FNLH 1HNFA 2J12B 3MRBB 3RVUD 3RY5A 5EORH 5FK9B 3FOLB 1D9KA 3SDXF 4UU9B 2Q76B 3PL6B 4MDJB 2YMXL 1FJ1B 1F2XK 3RNQB 1ED3B 2APTA 1MNUH 4B0MM 4XRCA 1WQVT 2YD8A 4WUKL 4DVBB 5KZCB 1IGJB 1HHHB 4GW1A 5HBBA 2PO6C 3CH1A 1NGWA 2UVFA 2AI0L 2D2OA 4QHMA 1CGSL 4ZFOB 4MYWB 2AXGB 3GGWB 3WL9B 4JQIL 2M8XA 4HJJH 4WU7A 4XP4H 4K55A 3L3DB 1PKQB 3RJDA 2VDQL 5A40E 1QR1B 4Y5YA 2VDMH 2BOBB 4L8SC 1RV6X 4JRYE 4JLRB 2J4WH 4ELME 5BV7H 3C60D 3SEPA 2MHAB 1LDPH 3RIAF 4NQCD 5CILL 4JFFD 2DKUA 2YZ1A 4DK6A 2BSRA 1FSKC 4JRYA 3VWJD 3DSFL 5K9OB 1G9NL 4LPYA 4WI7A 3WNKA 3VXPA 4TRPL 5FA4A 3T2NH 3CVIL 4ELMA 4YHNB 1MWAB 1IAKB 3HZMA 1DVFC 3SE4C 3ZDZE 4DZBA 5E95B 1FZMB 4ZTOL 5FKAA 3GIVB 3FQXA 1A8JH 3GMMB 3MODH 4APQA 4R3SA 4KKNA 3UMTA 4HXAH 2WAHA 2PCPA 4IDLA 4RX4D 3KYMB 4MS8C 3B2VL 2IPKA 5HGBA 3T3PE 1NAKL 1RUQL 4Z7WF 2ZPKL 5IMMB 4RMUA 1MI5D 3O6MH 2BNRB 3WEXA 3LQAL 4PGZA 2FHFA 2VE6B 1IGIL 4FRWA 3UP1A 4AEIL 2XFXA 2VN4A 2NXYD 4YXKH 4WO4C 5JR1H 3EJJX 5GS2H 5IBLC 3GMPB 3UTQB 1TCMA 1VADB 4OCXH 3V7MA 1RHFA 3WNMA 2CLVB 3S97C 2HJFB 1RZKL 4YHPA 43CAA 3DGCR 4UUJB 3P9MA 3BKJL 3FFDB 1YZZA 5D7KE 3QIBC 4HIIB 4MX7A 5EU7E 4L3CA 5BZWA 2B1AL 2XWBB 3DHJA 1HIMH 3H42L 3ZT5A 3ZDXF 3ARUA 4HUUA 2V2WB 4ZXBD 3DI2B 1R3HB 5H94A 2EEAA 2QQKH 5FYLD 3CSPA 5IVZB 4X6BA 2R1YA 1LEKB 3BFOA 4XTRD 2W60A 3S7GA 4PJ7F 5D7JC 4R8WH 3UAJC 4FFEX 2IC2A 4DGYH 3RA7H 1R5WB 4G8FB 1A6PA 4FA8A 4MJ5B 3T0WA 1R3KA 3TNNB 1IM3A 4HIJA 3F12A 2CLZB 4ZDHB 1F4XL 1IQWL 1FLTX 1AO7A 4NQCE 4ZSOB 4JFFE 3H3BC 1F3DH 4U3XA 2VDPH 1KC5H 5BRZD 1R5VB 2FZ3B 5TFSH 5J1AB 4HV8B 1TFHA 4LMQE 1RZJL 5C6PB 1V3JA 1C16A 3FQTA 4EI5C 2CIIB 1A6AA 1UFUA 4I0PD 1X9QA 1DQLH 4PR5B 4PJ5E 2BRRH 2XRAH 4H25B 4E0RA 1PLGL 3FONB 1QRND 4L3EB 5FKPB 2YD9A 1R6VA 1JZ6A 4KVNL 5BRZB 3GI8H 1L8JA 4GKSB 3B5GA 4PJXB 3OB0K 3MREB 3QPQC 1AY1H 4PJ5A 4EZMA 5C09E 5BZDA 3FQWA 1BQUA 2BHUA 4ZMAT 1CFSB 2V6HA 4I0PB 1S9YA 3CZFB 2IBGA 1A7BA 1N64L 5D1QD 5KSBE 5C09A 5F96H 3PP4L 5FFLA 1A7NH 3I85A 2VXQH 4YGVA 5I30L 4GO6B 3KYKH 2FLRT 1WBZB 5JMRA 3TZVC 4JFZH 1KXQE 4PGDA 5KSBA 1CQKA 3EGSA 2BMKB 3OKLB 4Q6IC 1CG9A 3TBWB 5EA0L 1EHNA 2VL4A 3HLAA 5TE6L 5BMFH 3FTGB 3P9WB 4JQVA 3T0AA 4H1LH 5IHUL 3C2AL 4UTAL 1ZT1A 1ES0B 2X70A 5JW4N 2NY5L 1I1AD 5FYLE 4LEXL 2FH6A 5I8OH 4UZGA 4NN6C 4Y8AA 4PJEE 2VH5L 5INDB 2BVPB 3EYQD 3Q1SH 2EDJA 3VCLA 1JRHH 2AJUH 1Q9KB 5ID1A 3GSNA 4KJWD 1ZSDB 3GSXB 4FFYH 5AD0A 3RTQC 4NC2B 1KB9J 4PJEA 1I85A 1I1AB 3H9YA 3QXDA 2DWDA 1OP5H 3HFMH 4RWYL 1KPRB 1NCAL 4OLYH 1RUAH 5FEBA 1KJ3H 4F7EB 5EO0A 4OZIF 1HE7A 5IQ9A 1D5IH 1C5CH 3KJ4C 4WU5B 3VFOA 1P1ZB 4M6NL 4ODWA 4BFGA 3QUXC 2NY3B 1U8IA 5C0EA 2B1HL 1JK8B 5T3ZD 2CDGB 2YK1L 2XN9A 1KLUA 3AS3A 5JZ7D 2IBZX 1GCFA 4YDLC 4LLVB 3BX7C 3ARFC 1OAQH 3CFKB 2VZVA 5JXAL 3BXNA 4L4TE 1QRNE 1JI1A 3CK0L 4N9OB 4QHLB 4P4RA 1WFNA 3P4MB 3N9GH 1XR8B 3M1BA 1SYSB 3F5WB 3BWAA 2W1NA 5GRJH 4QXUL 3MFFA 4Z95L 3RVWD 4QY8A 3KNBA 3VXUD 1I3GH 2ORBL 4I18B 4CADA 1AQDA 4WFFD 1FFNA 4NBYB 4P2YA 4ZUSB 4Q74A 5A2IH 3GSUB 5AAWA 2F19H 5I1EH 4X4MA 1H5BA 3ETBF 3FFCA 3RL1B 4W70A 5DS8B 3P9LA 3SCMD 4NGHL 1BFOA 3AREA 5IP4A 3KJ6H 1T0NB 4LCCB 5DD1L 2CK0L 1QFWM 2CK2A 3BGMB 4G8GD 2X89A 4L8SB 4OV5A 1RIUL 3JWDH 3D2UB 4JFOB 5DUPH 4OQTH 1MCOL 4NP4L 2Z91B 3O81A 5T3XL 1TVBB 2JELH 4IBLT 3D87B 2DRUA 4IOFC 1FO0L 4Y88A 2DF3A 2BERA 1FNLA 5FHAL 1JRHI 1EEUA 1JHLL 3ARPA 4F7TA 3K2UH 1A1OA 3QWQB 4M3KB 2FJGB 1CD8A 4M9PA 4MAYA 4FNLL 4G8GB 4JM4L 3TFKC 4UI2A 5ESQB 4E9LA 1G0YR 4JCMA 5EORL 3VFNA 5JHLH 5KSAC 2ZCHH 1Q8MA 3SDYH 1MNUL 2JE8A 4JRXA 5I8CB 4LQFH 2V5RA 3LEVH 4PJAE 2NLJB 2HT3C 3NIGF 2BSSB 4F7CA 3QNYA 3EO0A 4KTDL 2UY6A 2R2EB 2P8MA 1F90H 1RZGB 1WK0A 1YY9D 3S5LA 4TSCH 4PJAA 3MRNA 5T3ZE 3LRGA 1IC5H 4OLXL 3TPKA 4WO4B 3NCJH 1W0VB 3GHBH 4XP4L 1DBJL 4RISL 3HAEA 1WGOA 1KCLA 1LO4H 3RWIB 4PGCA 4M6AA 2E7CA 3MLUL 3LRSA 3QIBB 2VDML 5HHPB 3RZCD 4OZHE 3WUWA 3MGTA 3SQOH 4BZYA 4U2ZA 5FUZH 2XNAA 3W9DA 2J4WL 2Z8SA 1TJIL 2WWKT 5IMLA 2R1WA 1EO7A 1NDMB 5BV7L 3L9RB 1WCBB 3IVKA 1LDPL 4OZHA 4Y7MA 5HYFA 3GO1L 3MRGA 1RK0B 4PJIE 5DJ2B 4JO2H 3FO9B 3OKOA 5DJCB 4S1QH 3RZCB 4G8IA 1TZHB 3DX6B 3T2NL 4CMHC 1ZGLA 1NCBH 3IGAB 5E94A 2YN3A 2Q7YB 4QRSA 1L9MA 5I16B 3WHXA 3T65B 3MODL 4HQQH 3VGDA 2HG5B 4MCYA 4NKOA 1XR9A 3I3BA 1WF5A 4HXAL 3H0TA 5C0ND 5C2BL 1JUFB 3FJTA 4QHUB 5HDLA 2BNQB 5D70L 5FECB 1ACZA 1BQHB 3C5SB 3O6ML 1FE8H 4OM0H 2RCSH 4MJ6A 3CFDA 3CJJA 5FYKD 4XZUB 3S37X 4PG9A 3DYPA 5L7XH 1U3HA 1D5ZA 2XG5A 4YXKL 5BS0E 2MKWA 1RIVH 2VLJB 3V7AG 5HPMA 4CN6A 1KPVB 5DFTA 3ZE2E 3LKRA 1A6UL 3ZSSA 3DURA 3LB6D 5BS0A 3OR7A 4R7NB 5CBEB 4U1HA 1YMMA 1XF2A 5MEQB 5AAMA 5TPWL 5E5UB 4NQEA 4NO5A 1AGDB 4JFPB 3V9FA 2WBJA 4P59L 3CDGB 4F33B 5EU4A 1U8OB 4FABH 2QQKL 4PYHA 3PIQB 2AJSH 2X9YA 4POZC 3U4AA 4OTXH 3U30B 1TPXB 4M1DH 5IIEA 1T1YB 4R8WL 1SQ2N 4DGYL 1A6ZA 2XXMB 2W0PA 3RA7L 3KAAA 4Q6IB 3GSQA 4YO0A 1MVUA 3GRWH 4PJCF 5ICZA 5HHXH 3NPSC 1G9EA 3LKPB 4KROD 3UTPD 1UACL 1CK0H 2Z31A 4L29B 4PRNA 4XNXL 4OI8A 3LY6A 35C8L 1OAXH 3HR5B 4O51A 4FQ2L 3NGBC 2VNCA 5IJKA 2B4CC 2HMIC 5GISH 5DFVC 5LVEA 5CBAA 2YXFA 3BQUD 4LHQB 5DJDB 1IGCL 4RBPH 4WW2C 4GMSH 2ICCA 2W9DH 1DQLL 4JVWA 2BRRL 2XRAL 1DFBH 4YC2C 3SKOA 4MWFA 1OARL 5E99H 5B4MC 1A6TB 1S8DB 5ETUA 1S7VB 3GI8L 2FIKA 3O4OC 5TDNA 2ITDB 1FHGA 1AY1L 3LVEA 5FYKE 2ZOKB 5INCB 3BQUB 4LQ1A 4I2XB 1QSZA 1BLNA 3KJ4B 3UTOA 3FT2B 4JFEE 5IHBA 1T1ZA 3QUXB 5HHNB 2X9XA 1U8QB 5DLML 5DQ9B 3TO4C 1AI1H 4YHLH 3OX8B 3QIWA 2YWZA 4OAWA 3LQZB 4OBRA 4IM8A 1A7NL 2FJHB 4YDIH 2VXQL 4WI8A 2FRGP 5F96L 3V5HB 4MXQA 3IDMB 4YDLB 1LD9A 1V7NL 3CMGA 1QSED 3KYKL 4JFEA 2H9GB 2DQFA 2Q8BH 4XC3H 3DWTA 4JFZL 1CCZA 3MQIA 3L5WB 4KGJA 5T1DH 2D9CA 4N9GB 5EIVA 3UTZB 4MLIA 5BMFL 1ORQA 3C5ZA 1ZEAL 1KIQA 4GRMA 4WFED 1J87A 1RHHA 5DI8A 3CMOH 5DJ0B 1BQLH 1QSEB 1MCHA 3J8F7 4WEUD 3GB7B 5CEXB 2PTTB 3IFNH 2EDWA 4OI9A 4L4VB 5IGXH 4Y4KA 5LWYH 3TT1H 3EFFA 4YHYC 1ONQB 1ZLVK 5IB2A 5KG9B 2UWEA 4FFYL 1R5IB 4J3SA 5AZEH 5DHVA 1T20A 4RQQA 1JGLH 2ENSA 3RWJA 1QA9B 5K9JH 4LHUA 4BZ1H 5CCKH 1KJ3L 3BD5A 2MCPH 2FX8H 5F1IB 1U8NA 1SY6A 1HKLH 3MOAH 5TGBA 1MQKH 4HUMB 4MAUH 4BFIB 1ZAGA 4DEPC 1X5ZA 3RGVA 4QOKB 5IBTH 1GL4B 1K4DA 32C2B 3VD4A 5KSAB 5K9KA 3DVIA 1HHGA 4KWUA 5EN2B 1GZQA 1SBBA 1CDJA 1JFMA 3N9GL 1JGDB 4LEOB 4HWUA 1UWEH 3F58L 1IMHC 2B2XH 3LEYH 3EBAA 5D9SB 3GSRB 4ODXA 5I1LA 4K3EH 5FYJU 1OM3H 3FRUB 4WHTA 1I3GL 3DV4B 4UQ3B 2XKNB 5E2TL 3FOMA 4QRPD 2VQ1A 7CGTA 1MRDL 4U0RC 4X4YB 1X6LA 4X9IA 5A16B 5FOBA 2PW1B 4Z0BH 4O2FA 1IFHH 4ZTPL 3CVHH 2NY1C 2F19L 3MA7B 5I1EL 4TTDD 5C9JB 3I75B 2CRMA 1ZXQA 3I9GH 3HNVH 3QDGD 3KJ6L 3L7EA 2A6KA 3K8KA 3NA4A 1WFTA 2XTJE 2VLKB 3O3EA 4DK3A 1R0AH 2GUOB 2DBLH 4WFEE 3TJHD 1RZFH 3ULSA 4OQTL 2QSVA 4ELKA 5E8OB 2JELL 2AEWA 4QTHA 4LSTL 2NY0D 2QKIA 4Y4FA 3REWA 2P5WB 1D9KC 3K2UL 3IAQA 3QDGB 3ARDD 4FQQA 3ARYA 2GJZB 5DJZA 5DR5H 3HR6A 4CMHB 2GK0B 3VFUB 1UADC 4AY0A 5JHLL 1SJHA 2W92A 5JO5B 2APFA 2O61A 2NY0B 1WIPA 1P9MC 2FDBP 2ZCHL 4IHOB 5GGTH 3VRIB 4TNWK 1H9VA 1C12A 3ARDB 4XWOD 1KOAA 3JV0A 3LEVL 2IBZY 1EFQA 3V5KB 1W8NA 3FO0H 1K9TA 4LOUD 5JIKA 3JTCA 4DUXA 1F90L 1TNNA 4IMLA 3H9ZA 1U3ZA 4RIRB 2R29L 1I1YA 2DS4A 4Y5YC 1IC5L 2JJTA 3DTXB 3NCJL 1WWWX 2IALA 3GHBL 3JTSA 4GH7B 1AXSB 2Z8RA 2QR0A 3U48A 2WANA 1LO4L 4IDJL 3UYOD 2CH8A 3I6GB 1HEZB 4JAMB 4OZFH 3ZKSD 4PTTB 5E00A 8CGTA 4RCAA 5D1ZD 3ROLA 3ULVL 4A2MA 3WFHB 3IJSB 5F3HA 3SQOL 5FUZL 3L3IA 1I3RA 4HPYL 4PFEA 4X98B 5CINH 4QRPE 4JDZB 1L0XA 4XVTL 1M7DA 3RNKA 1K5NB 2ICEA 1T1XA 1UM5H 3P77B 5HGAA 3IU4H 4APQC 5F8QC 5I1KH 4JO2L 4HJ0C 4S1QL 5EBWB 1MY7A 2YPLB 5FDWB 4LSQL 1NCBL 1G0XA 3IS0X 1B4JH 1ZGLP 1AXTH 2VLRE 2J8UE 2YOCA 2R8SH 2EIZB 1SVCP 3HZVB 3ESUF 2YD5A 3PWVA 4HQQL 1G7JA 5EB9A 2P8LB 4OSUH 1CTOA 2LABA 4F7MA 5EOQH 4E41D 5GS1B 1PEWA 2VLRA 2J8UA 3SBWA 1FE8L 3NPSB 2RCSL 4OM0L 3D0VB 2Y36L 4BH8A 2DAVA 1DP0A 3OBAA 1CI5A 4PV8B 4PV9A 1T4KB 3MRFA 2DWEB 1GIGH 1ND0A 5HYQA 1DZBA 3FN3A 5C08D 3TV3H 4E41B 4WW2B 1G6RH 4MQXD 4F57H 3BP5B 1UXWA 3MRHB 2YSSB 3RU8H 1FNEB 3B9VA 2VL5B 4YC2B 1X5XA 5EU7C 2VABB 2X10A 4ZUTB 1U92B 4M7JH 2HLAB 2ZUSA 1FPTH 4GG8B 1ETZB 4JGMA 5CGTA 2VDLH 4HGMA 2NXZC 1MFCL 1BD2E 3N1MC 2A83B 2WIIA 1Q1JH 1YN7A 1U8JA 1A22B 5IMOA 4Y2OA 5GGUA 4OFKA 4FABL 4WI2A 4GS7C 3TO4B 5C0FB 3MC0A 1I8IB 4JY5H 4Y1AD 1BD2A 1T83A 1P4LA 2AJSL 2XACC 1U91A 1WFOA 3BP4A 2P4AB 2Q86B 1P7QB 2NW2A 4M1DL 4P5TA 4Z18A 2BDNH 4KK8D 1S7RA 3D3VB 3C2SA 3KPSD 2RFXB 3BDXA 4XCNA 2Q6WA 4KRMB 2EO9A 3KPMB 1HQRB 1CLYH 1LK2B 4OF0A 1B3JA 1QFWI 3DVGB 1A3QA 4Y1AB 3BAEL 4WFHE 1J1XH 5ITBH 5CSBA 4OD3L 1CK0L 4JPVH 3BPOC 5DRZA 1E27B 1PY9A 1JWUA 3KPRB 2VZ1A 4XCCL 3OJMB 2QQNH 1OAXL 5F7HA 2FHBA 4UT7H 5GISL 4C54A 1ROWA 1MCEA 1A14H 4FQ1H 4RNRA 2ED8A 1N6UA 8FABA 4F58L 2W9DL 1J0YA 3O2DL 5D7LE 1DFBL 4O5LH 1MCJA 2AKRA 1H3TA 2MQ3A 4L8DA 1UWXK 2VISB 2VXUH 3V8CA 4NZTL 2FSEA 1IGTB 2ADJA 5D7LA 4WW1A 1A9BA 1RK1A 4PY8J 3G5VA 4IRSC 4LVOC 4DGIL 2CMRH 3B9EA 1K8IB 1AI1L 1UQSA 3ES6A 4R97C 1QEWA 3LS5H 5HDQH 5C08E 5HHOA 1YEJH 3QA3B 4DEPB 5JNYA 1AD9A 1WV7T 2HTKC 5A2JH 4MVBA 3MRJB 4JQVC 1II4E 4XC3L 5IM7A 3VXOA 1D3CA 4A6YA 4WGWB 1XCQA 5DRNB 5T1DL 5LBSH 4GXUN 1IC1A 1TCRA 1YDPB 5MEOB 1U95A 5EFIA 5C0AD 2DQJH 1KT2B 3QWRA 4H88H 5F7EH 1KEMH 1UKQA 1BQLL 1BZ9A 2D4FA 4LKCB 2P47B 5CZKA 5I19H 5HI5C 1T7YA 4OZ4A 2N56A 4U0RB 4D8PB 2R9HD 3TA3D 2FNBA 3PNWA 4MHHI 2FBJH 1TNMA 3IFNL 3F7YB 1KJ2H 2NY1B 2B20A 2BJML 1FNHA 4PRHD 5TDOA 4LPVA 5D96C 5M94B 2BVTA 2EYSB 3KPSE 5JOEA 5AZEL 4HZLB 1C5BH 1MVFA 5IVXA 1JGLL 4KC3B 3TA3B 4NM4H 1MSPA 5K9JL 5CKGA 1Z0NA 2X05A 5IROC 4BZ1L 1MFDH 2MCPL 3GMRB 2GSIA 4WNQA 2FX8L 1C5DA 2E5EA 1BJ1H 2OXGA 4PJAF 3CGTA 4OLZH 3MOAL 1HKLL 4IS6A 1MQKL 4MAUL 3ALXA 1TLKA 1X44A 4XRCB 3EDFA 4LPWA 4GW1B 5EO1A 3JV6A 2X4PB 2ZG1A 3L3GA 4DKAA 1NGWB 3V2AR 4HC1H 4WUUD 3EOTH 2WNGA 1XGQA 1UWEL 3O0RH 2AXHA 4MNGE 4QHMB 3MXVH 2VR5A 5EG6C 2B2XL 3LEYL 1YNKH 5KBNC 3D5OF 2IANE 4K3EL 1OM3L 3VG9C 3LSOA 3AY4A 4WU7B 3QUYA 3E8UH 4RRPA 5DK3A 4L3AA 4ZO8A 3BE1H 2EDYA 4MNGA 4U1IB 5EBMB 3AREC 1VDGA 5FHBH 5JPNA 4Y5YB 4Z0BL 1INEL 2IANA 1P6AB 1KCKA 3G5ZB 3K7UA 4DUWA 3O11A 4U33A 1D6VH 4OZGE 3QEQA 1OB1A 4PJIF 3FAXA 3EDJA 1YJDH 2CXKA 3HNVL 3HZYB 4PREB 3DMMA 4LARL 4HAGA 2E27H 2V9TA 5J13C 3ZKNC 4Z7OE 4EBQH 4FQLL 4ODVH 1R0AL 4HX1A 1FG2A 3LD8C 2DBLL 4MAYC 2YUZA 4UOW0 5C0AE 1FGVH 4G5ZH 1RZFL 3TYFB 4YDVA 5DK2A 3VXPB 1I7ZA 3B43A 1V3LA 4O02L 4ELMB 3UTTE 4QGYA 1PG7L 4DZBB 4JFXA 1DLFH 5T5FH 1IZJA 3FQXB 3W81A 1UKTA 2J6EH 4APQB 4R3SB 2MQ0A 1X5JA 4UT9H 4WVRA 4OLUL 2PCPB 3UTTA 1F97A 2I5YH 2IPKB 3C8HA 4PRHE 4G7VH 4WI6A 4C55A 5IESH 4L1HA 1T89A 3WEXB 4TNVK 4P46A 5E1HB 2QHLA 4BUGA 1NFDA 2ADIA 3WXVH 4LSRH 2XFXB 3D9AH 3SY0A 3BDBA 3ZE2F 4BSVA 4P99A 1A6WL 4ZO9A 2AQ1A 3FO0L 2ENYA 5IWLA 5FF6A 4YHPB 43CAB 3FQNA 1S7TB 4BA8A 4JO4H 4PIRF 4UAOC 3P9MB 5TQ2H 4ODHH 4MX7B 5JW4Q 4L3CB 1T1WA 5BZWB 5E8DL 1KNOA 3W0WD 4HWZA 4HUUB 5AG8A 5H94B 1JNHB 4UILH 3NFSH 3W9EA 4X6BB 2AJ3A 2R1YB 5H37G 3CU1A 3T09A 1LNUA 2W60B 1AO7D 4W4OA 5JA8B 2RIKA 4P9MH 2E7LE 1MRCH 2VWEE 4KRPD 1HH6A 1UM5L 1JHTA 4U7SA 3W0WB 3WKMH 4ZPTA 2WK2A 5AYUH 4Z77A 5I1KL 5JMOC 1OHQA 4JM2A 3RY6A 1R3KB 1IM3B 4HIJB 3F12B 4LHJB 2YN5A 1B4JL 3JWOH 1AXTL 1AO7B 2R8SL 1VGEH 4KRPB 1U3HC 1GGCH 2M2DA 5EOQL 4UOW1 1UM4H 1KCVH 3FQTB 4FZEH 4GJTB 4BFEA 2H32H 3BPOB 3IU3A 5E6ZA 5IB4A 1BEYH 5CWSA 2NZ9C 3S3JA 4E0RB 1SBSH 3QO0A 4JREC 4K8RH 4XP6H 3C08H 3VFPA 1GIGL 2Z93B 4OQ1A 1QLRA 3TV3L 1G6RL 4PJ5B 5GRWA 4F57L 1I9JH 3FQWB 3G6DL 2WBJC 3PJSA 1KG0A 5E56A 4K94H 1S9YB 5F7NC 1F8TH 1N5YH 5I75B 1K4CB 4M7JL 4S2SA 5C09B 3EYFB 2C3VA 3ILPB 4YGVB 2JJSA 3O6KH 1A4KA 1DSFH 1H3GA 1GOHA 1P84J 3ULUD 5HI4C 3TWCH 2P7TB 1MCLA 4PGDB 4LVOB 5KSBB 5I1IL 1AIFA 3K3QA 3EGSB 2ZUYA 3PV6A 4R97B 5BXFA 1CG9B 4JY5L 2IPTL 4WIQA 3HLAB 2X5PA 4X7SL 2H2PD 3DETD 4QNPF 4EI6A 5CJ8A 1OLLA 1A0QL 1ZT1B 2X70B 1MCRA 3U6RA 3EYVA 1GC1C 2BDNL 4G6AD 2Z31C 3QEUB 1RIHH 1JN6A 5FGRA 3L5HA 4L4JA 2VKXA 1QVOA 5HSFA 1NCTA 5IJKC 1S5IH 1WBXA 5JTWA 1J1XL 12E8H 5ALBH 5ITBL 3D6GA 3VCLB 2X4TA 1MJ8L 4X7TB 4JKLA 5F7LB 5ID1B 3GSNB 4WHYH 5FGCB 4PJEB 3MOQA 1M1SA 3QXDB 2DWDB 3EHBC 2AJYH 4UT7L 2F74A 4S11A 1A14L 4FQ1L 2VSDA 1CYGA 3WIFA 5D96B 5EO0B 5IQ9B 1JF1A 4MA3A 1T03H 3GJFA 3RIFK 1N5AA 3VFOB 4ODWB 1LE5A 2WBWB 3ARTA 1U8IB 1ZT7B 2VXUL 5C0EB 3QIWC 4U1MA 5JXED 4TNWF 2XN9B 1KLUB 3UXFA 2A0LD 4MXQC 5AUMA 3CFCH 3H3PH 3D0LA 2DL9A 1Z3GH 5E6YA 4G43B 3ZE0E 2QSQA 4P4RB 3BJLA 2P5ED 2YEZA 4MD5A 1P4IH 4DAGH 1LO0H 4KI5C 3M1BB 1KN2H 4FXGB 4PP8C 4NRYA 5HDQL 3BWAB 4XHJC 3DO7B 3C5ZC 3FFCD 4HSQA 4MD4A 1CDYA 4QY8B 1WLHA 5L2JA 4QRQA 1KN4H 3KNBB 2GEEA 2MJWA 4LVHC 1KGCE 5EOTA 3AGVA 4CADB 1AQDB 5LBSL 1FFNB 4XP9L 4XX1E 1IM9D 3V4VH 3ZTNH 4Y4KC 2DQJL 4H88L 1FIEA 2H45A 4K9EH 1H5BB 4WHCA 3FFCB 5I2IA 1T6VN 3ECBA 3P9LB 5I19L 1BFOB 3AREB 1JTOA 2LTQB 4X5WA 2WWMD 4PG2A 1RZ7L 5SWZD 3GSWB 3I02A 4OV5B 3D18B 1LWRA 3NCYS 1BP3B 2PXYD 2QV2A 4ZNEE 2VR9A 1OP3K 1KJ2L 4D0BB 2YUWA 3V0WH 1UB6A 3CSBA 4F7TB 1A1OB 5J13B 2Q20A 1C5BL 4JRXD 5SWSE 3LD8B 4MAYB 2EXWC 5SWZB 4M1CC 1AR1C 3CFEA 3GDBA 1F3RB 3FO1A 3MLVH 3RGVC 1QR4A 1MFDL 2OSLA 3VFNB 4ALAH 5SWSA 2JB6B 1HCVA 4DGVH 4PJHE 5ANME 4JRXB 1YYMH 2ZCLL 4TUKL 1HHIA 3QNYB 3EO0B 1L6XA 4RMWA 1GSMA 5L6YH 5CJOH 4PJHA 4PUBH 4HC1L 3S5LB 1FO0A 1JHKL 2H3NA 3O0RL 4NQUA 3MRNB 4IIQA 1HQ4A 3MXVL 1YNKL 4MXVE 3VGGA 3QFJD 2CLRA 1U58B 3E8UL 2D7OA 3RUGE 2LAAA 4UAOB 4CN4A 4PGCB 5FHBL 3ZSTA 3LRSB 2LQRA 2OZ4H 5EU5A 3WUWB 3PWNA 3RUGA 3VGHA 2D31B