3L3GA

Crystal structure of hla-b*4402 in complex with the r5a mutant of a self-peptide derived from dpa*0201
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-44 alpha chain
publication title Constraints within major histocompatibility complex class I restricted peptides: presentation and consequences for T-cell recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3l3gA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3l3gA01
5C0JA 5I75C 1SY6A 2KZWA 2FJHA 1FBIL 1R24A 3BZDA 2V2TA 5EZIH 2EH8H 4Y5XC 3MLZH 3N1FC 2BVYA 3MNWB 3VWJB 4U7KA 3SOBH 1MHCA 2CMRL 4XP6H 2AXJA 1E4KC 1S9KC 1TETL 3FCTA 3VXRE 2VITA 1NGWB 1IKFL 3FO1A 3GJEA 1TMCA 5FB8B 3QIWA 3ZMRA 3MRNA 2WSKA 4NQSB 4G9FD 2VLJD 5HGAA 3K4AA 3NOIA 2HRLA 5B39A 2UZXB 5CIPH 1JZ3A 4C4KO 3Q6GH 3BAEL 1IGYB 5A3ID 3BUTA 2BVPB 4R7DA 5E9DD 4MA1B 4N0CA 4XWOC 2X05A 4UQ2A 4YBQD 5JHLH 3MLYL 1U3YA 5IWLC 4NPYB 1XR9B 5IMMB 4J3UA 1GGTA 1FAIL 1GHFL 5CJ8A 4YQXH 4WO4D 2DQEH 3QO0B 5EO0A 3EHBD 4O9HH 1RUPH 5FA4B 1TZGH 3FONB 1SJEA 4P46B 4WWKA 4YDIH 5I8EB 4TVPE 5CMAB 4JM2D 1NFIA 3GMOA 4L9LC 3RNKA 2DMKA 2R69L 4JG0H 4JHAL 1J86A 5FO7B 4PY7B 4MZ2A 2GK2A 1ORQA 2O5ZL 1NANH 3QHFH 3EO1B 1ZA6A 3Q5TA 4DW2H 3KHQA 3QUMB 4ODHL 3MUY1 1RMFH 2LFGA 5B3NA 4D0CB 5JOEA 2D03L 4CMMB 3PJSB 3A6CH 3HMXA 3DX9B 4MLIA 15C8L 4ZG1A 1ZSDA 3NA9L 3PWVA 5F1IB 3RL1B 3RKDD 4JZJB 1DSFL 2CD0A 1U8PA 3V4VL 2F53E 3VFGL 2GAZB 5E2VH 2GJZA 4FQHB 5C0AB 5CEZE 3RZCB 4WU5A 5D2LE 2P46B 2A83A 2RFXA 4G6ML 4CADB 3KPOA 2C26A 3BKCL 3P4OA 3GSWB 3HAEB 2O5XL 1K8DA 5C7XH 5DK2B 5DQJB 3OAUL 5J1SC 2FX8L 1D6EB 1ZHBB 3TPUA 4WEMB 3VMOA 3K1KC 3RY4A 1I1CA 1HILA 5BO1L 3QEQB 4XNXH 3CX5K 2BERA 3OKLA 1XR8A 3QUZA 2EKSA 1G7PA 5HHVL 4LSPL 4PG9B 3MREB 2F19L 2NY1B 2IH3B 3S96A 2YRLA 5HYIA 5IMKB 5LGHL 2KKQA 2X4QA 5CGYC 4OZFB 3QJHA 3LEXB 4OM1L 2VL4A 3DBXA 4N8CH 3R1GH 3UJJH 4X5LA 2HJKB 1A21A 4NIKB 4S1SL 2A6IA 1F02I 4KDTC 4JGUA 4QRTB 2W60B 1NC2D 4U6YA 1INQA 1ZS8A 4NO3B 1KULA 3IDYC 5DT1L 1GOHA 4PJFA 3JTSA 4FA8A 1YEEL 3RWJB 4DZ8B 1XIWC 3TJHC 1NAMA 2QKIB 3GMRB 5BW7A 4OCRH 3FN0L 1SYSB 3FQXA 3SO3C 1T3FB 2VAAB 3QDJB 3SDXB 4H8WC 2IADB 1MI5B 3BQUB 3RX8A 1AQDB 2AJZA 5E1AB 2ADGA 1FSKB 1E4XL 4OD3L 5I15L 5SWQA 5FIEA 3ARQA 4LAQH 3RVVD 1W72A 1DVFB 2B4CH 2HAZA 1JGLL 1I4FA 3KG5A 4LLAA 5HY9A 5E6ZA 1GIGL 2UYLA 3VXOB 4DJMA 5D70H 5B3JF 1F97A 4JHBA 3SDAA 4B7LA 4CUCA 2X7LB 4X7TA 1P84K 4IBLT 5IF0B 1MRCH 1A6UH 4L8CB 1JZ7A 5DGRA 3GKWL 1OVZA 2OI9B 5EBLB 4U1JB 4WDIB 4KMTL 3D5OF 4TN9A 2VLLA 2DJ4A 3U7WL 2JELL 1CE1L 5FYLH 1C7TA 4XBEL 3P2TA 1AR1C 4DCQB 3HMWL 4XCYB 4G42B 4YHYC 1QFWH 4RFOL 1B0GA 2X40A 5D7IB 3EJYD 4Q6YA 1Y6KR 1AP2A 4IIQB 3TA3A 3WEXA 2X4SB 5C9JA 4GW1A 5ISZE 3VXRA 1N26A 4WTZG 2ZKHH 2EXYD 4PY8I 2PW2B 4PJ7E 5IVXA 3P3YA 2VQ1B 1QSFA 3ILPA 1NCCL 1LQVA 3S37X 2OR8A 4J23A 4P3WA 3LPFA 1YEDB 1FL3A 3ZT7A 5FO8B 1GH7A 3P77B 3UAJD 1KBGL 1MVFA 4M5YL 1E4WH 2VXSL 3Q1SL 1PX3A 1ZGLM 5EBWB 3SGEI 2VYRE 5F6HJ 3IU4L 2DWDA 5L2JA 2AAVA 1RJYB 4HC1L 2L7JA 4I9WE 5T5FL 4OZIB 2WQRA 4XXCC 1MCWM 5ITBL 1U3HD 5DJ6A 1D3CA 4HUNB 2HVJA 1F3DH 4Y5VB 1PG7H 1RIHL 1NCWL 1IFHL 3MV11 5I16A 4Q6IA 3UJIH 3DUSB 4I0PC 1U91A 4TNWF 4L8BB 2FX9L 4OLWL 2Z31C 1HKFA 1GAFL 4LHQB 2HFEB 4CVZB 3VXMD 2ADIB 3PNWA 5C2BL 2XTJC 4DVRH 1LO4L 4RQQB 1MELA 4LU5H 2DQCH 2E3VA 3FO9B 3NFNA 3AY4C 4NBYB 1WF5A 2YKLH 3WHXA 1A3QA 1MIEL 3B2UD 3O2DA 5DJDB 3GK8L 1X6LA 3MODL 4R90H 5CD5C 3QI9B 5FGSA 3V6OC 4JRYE 2AV1A 3V6FA 4LCCC 2PR4H 4BELD 5GGSB 3DLQR 4OZ4A 1B0RB 5E7FA 5H35B 1FSKC 3IGAB 3QNXA 3VGEA 5IKCB 1D5XB 1CDGA 3I9GL 2QR0A 2FEDD 4PREA 4PYHA 2EYSB 3S5LA 3V52L 3VFUA 4IMKC 2AJUH 5HVHB 1WISA 1FH5L 3QXTA 4NM4L 4X6CE 4UB0H 5DD6B 3ULVF 5DMYA 1HHGB 2KL6A 1QRNE 5L0QC 3JWDH 5HYSG 3I6KA 4OIIH 1JNHB 1IGCH 3QA3A 1JF1B 5DR5L 1NCBH 4EZMA 1RUML 5C0DB 5CIPA 2XNAB 5BCAA 3O0RL 5DO2D 3LV3A 1LEKA 2C1OB 4HPYL 4NCC1 4ALAL 2ZJSL 1TTUA 4O02H 4TUJB 2DTML 3VWKD 5JDJA 4MAUH 2XV6B 2BCKB 5TQ0L 5IOPB 1BBJB 5F1NB 4C57C 4I13B 3MRBA 3KPRD 1ZHLB 3FB6A 3D2UA 4MCYA 4JQIL 4NHUA 3ARGC 4U3XA 4LVOB 1EJOH 4LSVH 2NW2A 1LO3H 5MEND 2V5SA 3FT2B 4PJ5B 1PKOA 1N2RA 5F6IC 4BYHA 3HHRB 4GG8A 1MF2H 2X9WA 3GGWB 3RPKA 5GS0H 3KPPB 3H9HB 5B21A 3FOMA 5DC9B 3QRFM 3T3MF 4ZFGL 1KJ2H 3DRQB 3KXFB 2LVCA 5ICYA 5TDPA 5E08L 1CFSA 4XP5L 5E70A 4L8DA 5IK3B 1ZLWK 1I9IH 1PQZA 1MHPH 5L9DH 2YMXH 3S36L 2C7UA 4QRPD 4YNYB 3MUGA 4PJ9D 5F71A 4R7NA 3TCLB 1LO5B 3WN5B 2F58L 1ZVSA 3LIZH 4ONGL 2NR6D 5TDOA 1SBSH 4I3SH 5CGTA 1A6TA 4G6KH 1JK8B 3HC0B 4U6TA 1YJDH 4XWGL 5C0EA 5C71A 4C55A 1JUFB 4HGWB 3GJFH 3PXJA 2DJSA 1HYRC 1R3LB 4WI7A 2MQ0A 4U1GC 3TV3L 3E3QA 1GGIL 3U46B 1JN6B 2VR9A 2VLRA 3P30H 1PZUB 3QDGE 2YD7A 2Y72A 4K3GA 2OJEA 4NGHH 3G5XA 2XZQL 1G7QB 5EU6E 1IEHA 3L3DA 4K8RC 1I7ZB 1HXYB 4MDIA 3BFOA 1QP1A 5I1CL 4HGMA 4OGXH 4UDTB 1TDQA 2HH0L 2W9EH 5IW6B 1KB5L 5I71C 5D72H 1UKSA 1KJ3H 4JANB 1TJGL 4XNYH 5HVHC 5IMOB 1JGDB 3VFTB 1I8IB 4P5MB 1FC2D 3MCG1 4F8QA 4FOMA 1QBMH 1JFMA 1I1AD 3T4YA 5H37H 3QULA 5DRXA 4XRCB 6FABH 2WY3A 1KF9B 1OD7A 2HWZH 3D9AL 2Y6SC 2FIKB 3CLEL 4UOW0 1UH2A 2IPKA 3T4AB 2A74B 4FQLH 4NQDA 4CNIB 4WW1B 2VIRA 1X9QA 5FUZL 1AXTL 1T04B 3GSVA 3FT3B 3CFDA 3SKMA 4XT1C 3SE9H 4MS8C 4Z7QF 1T1XA 3CVHA 3ZL4L 1J12A 3ARXA 2VDPH 5HHMB 4NQCE 1G9ML 4OUUA 5EN2A 2YA1A 1YC8A 1ZK9A 3R0NA 2H26B 2EIZB 4Y1AD 4KVNL 5CP3A 1RZ8A 2XWTB 4S0UC 1RUAL 3MACL 4LQFL 1RZFH 1ZT4B 3WFDH 3EYOB 3RVUD 1J7VR 4PGEB 3HZMB 4OT1L 5MEOB 3QZWA 3IXAA 5F97E 3SEPA 3U1SH 4NSKB 2Z92A 1J88A 1N3NB 1HZHL 4KROD 4KJYB 4ODSH 5JPNB 4N1EA 4NZJA 1U0QA 1XF3A 3UTSB 4XMPH 5IEKA 2QEJA 5DZLA 1UZ8A 3ARDD 2XI9A 5D96C 4HEME 1FORL 1A7QH 5LG1A 4I2XB 4QNPE 3NCBB 1D9KB 1PEZA 4X9BA 4JO2L 3BMWA 1I3UA 5E00A 4FQ1L 5E95B 1CFQA 1QLRB 3QQ9D 4JFYA 4XAKE 1CQKA 3B9KA 5AG9A 5IHZB 4NUJB 3RBGA 1CZ8L 1BJ8A 5IV2B 3A6BH 4DTGH 4NC2B 4U1NA 5CBAB 4J3TA 1S9VB 1CD0A 5JNYA 4Z7OF 5F7HA 3CU1A 4OZFH 4XP9H 1S9YA 3O9WC 4U1IB 2HMIC 3NABL 5IBTL 4H1LG 4GXVH 5KVFL 4LLMA 1ODAA 4HUXA 1Y18B 5BOZG 4J1UB 1LK3L 4PGBB 2GJ6B 3C5JA 1JPSH 1MPAL 3FB7A 1BFOA 1FYTA 1HHJA 4LP5A 1EEUA 4ONFH 2PCPA 1IGMH 5IMLA 1NUNB 2J5LB 2KDGA 3EDFA 3LS4L 4ZPTA 3VE0B 4BFIA 3T0AA 3T0XA 3CDGA 3SBWA 1S3KL 1NKRA 4KC3B 1Z0NA 2J8UF 2X4UA 1XCTA 3BDBA 4UNTA 4HQQH 1U8HA 3CFEA 3MUHL 2Q8AH 4GG6A 3VDCA 1E6OL 1MIMH 1U41A 1ED3B 3RWGA 2SEBA 1R5WA 3NAAL 1MEXH 3CC5A 8CGTA 1OSZB 3DX6B 5ICZB 2WWMD 3BP6A 1AR2A 2IBBA 3N50A 4N0CD 4OGAD 5EU3B 4WCYL 5C0AE 2Z93A 3OHXB 4YC2C 5KN5A 1U93A 1UA6L 4EQ2A 5ESAB 5I0DA 1X5GA 3K8LA 1KCSH 1P5UA 5ADOH 1QSVA 3EYVB 2XQYK 3WFCL 4URTB 5GGQL 4PJIF 3TBSA 4WWKD 1UWEH 3LQZB 4XB8A 3CXDL 5C8JB 2Y9RT 4RMRA 2D7OA 1UC6A 5DJAA 5IB3A 4K3EH 4OD2B 3UO1H 4HZLB 4MDJB 5DHVH 5C6PB 3DPBA 3O6ML 2E27H 5GJTL 1A7NH 5D2NA 1KLFA 1N0LA 4TVSa 2ICWB 1CDYA 4ZSOE 2G60L 2BRRL 5IM7B 3KDMA 4HKZA 1KPRB 5ACMA 1MFNA 3NIFE 1FVDA 4KTDH 4P5TC 4L3EE 1F6LL 1RFDL 2XTJE 2E9IA 4O5LH 4XX1G 3O6FA 4XMKH 3IKKA 4YHZL 5LGJB 3CX5J 3RPIA 3QEHA 1NEZA 1QO3B 3ZKMD 3V6OE 4ODXB 1GZPB 1KTLB 3QDJE 5EFIB 2HRPL 2AERT 1MFEL 5FYKE 1XAUA 2IF7A 2ENSA 4ISVA 3BGAA 1OP9A 1KJ2A 3RP1A 2BNQB 4YK4C 3FB5B 1OAUH 4CVUA 1DEEB 4YFLI 5DYOA 2CIIB 2ZUSA 4JDZB 5JW4R 2BP3A 2PNDA 1KIQB 3OKNA 4PP2A 3QHZL 4JN2B 3QUZD 3B8YA 3B5TA 1A6VH 3WHE1 4DN3H 5GISL 2CKBB 1P4BL 2F8XC 1J8HE 4D9LL 5HYEA 3GJFA 4NYLB 2BOCB 3B6SA 3HE6B 1BWWA 4O4YH 2J88H 3LCYA 1ZVHA 2ARWA 4LRNL 1HSAB 4LCUB 3MNWA 3SKNB 3VWJA 2XWJB 5J1AB 3CCHB 4IRZH 3JTTB 5E6IA 2Y1VA 1T7WA 1EIBA 1A1OB 3JV4B 3X3FH 1NGWA 1B3JA 5DZNA 4LPYA 4NQSA 1NLDH 4MJ5B 3U0WL 4DFHA 3QUYD 4UIKL 3MMEB 3NTCH 4ENED 3IFLL 2R2BB 4HMDA 4G8FB 3TVMB 4ZFOB 2G9HB 4KVCL 3NCJL 3UBXI 3RGHA 4NPYA 5EU5B 1XR9A 5IMMA 4ZOCA 3RZWA 3QO0A 4JN1H 3GMNB 3MBXH 1JYNA 3EOTL 4X6DF 3HPLB 1QBAA 5FA4A 4KK9C 3FONA 4P46A 2YPVL 4HEPG 3GNML 4QCIB 4XCFH 3I3BA 5CMAA 3M8OH 2VDRL 3ULUF 4QRRB 2EDQA 4BQBA 4QRSB 1A3RH 2DICA 5AZ2L 1TJIH 3QUKB 4PJAA 2J2ZA 1UM4L 2VXTH 3QUMA 3VGFA 3OBAA 1S7UB 3TA3D 3ZZ1A 3L3GB 4MB5A 4D0CA 5I1JH 2OYPA 1FG2B 5J6GA 4ODVL 4CMMA 3PJSA 1YECH 1HYSC 2CDFB 4B0MM 5ADPL 4JZJA 1QSFD 3CFKB 5I1KL 2A77L 2GAZA 4MAYA 3QCTH 4LMQE 3UJTL 5J9PB 4XGZB 2HLAB 4FQHA 2FBJL 4OTXL 5C0AA 2F5AH 3QH3B 1MUJB 3RVTD 3RZCA 1FZKB 2XN9E 4JDVB 1EO5A 5I1HH 1K3ZA 4CADA 3RVWD 3GSWA 3HAEA 3MRPB 4HV8B 2ILLA 4HD9A 2EH7L 5DK2A 3N1MC 5DQJA 2FHFA 1D6EA 1ZHBA 5C6TH 3S4SB 4PJBE 2Y5EA 4HXBH 2VDLL 4H5SB 2CXGA 3G6DL 3QEQA 5KW9H 1Y6NR 4P57B 3I50L 4PG9A 3ARYA 3PWPE 3LDBB 2ZSWA 4HF5L 5IMKA 3UTTD 4JKPL 4OZFA 5I18L 3LEXA 5F9AC 3SCMA 3BZFB 2NZ9C 2XPGB 2HJKA 2VWEC 4C83B 1IAOB 1DL7H 4QRTA 1Z6JT 3KLAB 2W60A 4HK3J 1CWVA 5J13C 4NO3A 2ADFL 3IETB 4LAJH 5FF6B 3RWJA 4DZ8A 4JQVC 3WIHA 1MCKA 1FJ1A 3BO8B 1KOAA 1UM5L 4IEFB 2QKIA 3GMRA 4YWGL 1IBGH 3TIEB 1SYSA 5EG6C 4HULB 1AHWB 2CRYA 3DOSA 1JI1A 1OT1A 1V7ML 3SDXA 1MFAH 1MI5A 3BQUA 4NKOA 5IVZA 4R97C 3VFOA 3CPLA 1E28B 2IAMC 5TJWK 5E1AA 5I73C 1EEQA 3LKOB 1WGOA 5D93C 4QHUB 3KS0H 3H9YA 1AGBA 5EZIL 4X7SL 4M8QA 3O11B 4UV4L 3MLZL 4R4BA 4PJ8C 2BY1A 3VXUB 1I8LC 4NO0D 3VXOA 1QHOA 1CYGA 2B8OT 1BVLB 2BFVL 4G8IB 4GXUN 1S7RA 4HWBH 4JLRA 4H25A 2X7LA 1Q8MA 4LEOA 5IF0A 1ACYH 4XP6L 4L8CA 1OP3K 4CN1A 1IGJB 2XXCB 4LSTH 2OI9A 5C1MB 3W39B 4U1JA 2Q76A 3HR6A 5LVEA 1CXKA 3BOVA 3D0VB 3IDXL 1AY1H 2J8UB 4HUVA 4HIIB 4HJJH 5C0RH 3TBYB 3GMPB 3D2UD 1HH6B 3HI5H 5CS7A 2X2YA 3PHSA 3Q6GL 4XCYA 4JKMA 5CHNA 4DCQA 4G42A 1G84A 1GOGA 5D7IA 4IIQA 5TF1H 4IDJL 2X4SA 5DHVA 2YWZA 1F3DJ 1A8JH 2PW2A 4YQXL 4NRYB 4B41A 1FRGH 3KJ6H 4K7PH 3V5KA 3OX8A 1G7HB 4X4MA 5DQDH 4O9HL 5DDHB 3IT8D 3PV7A 2Q86B 4PJIB 5FO8A 1YEDA 2R2CA 5IUSA 3P77A 2VLKD 3WS6C 5JHDE 1N6UA 5EBWA 1IL1B 5C0BE 1YEGL 1WFOA 4ONHB 1RJYA 4OF8A 2DIAA 5HI3C 3X14B 4WJ5B 1JTOA 1QTYT 4OZIA 2LU4A 4L9DA 5EC2B 2H2PD 4Y5VA 3V4PL 1RMFL 3KWWA 5GGUA 3EIFA 1F90L 2P5WB 2K7PA 1KYOJ 5AUMA 3F58H 4ERSH 2MJWA 3PL6B 3DUSA 4L8BA 5DD1L 4PLKC 2EE6A 5GGVY 4UIMA 1UXWA 4OSUH 1N4XH 4MVBC 3FO2B 4K23H 4FFVD 2HFEA 5IQ7H 2X10A 2ADIA 12E8H 2DL9A 5HI4D 4RQQA 1RZJL 3FO9A 5TFSL 5E2WL 3SGKC 4FQ2H 5IP4A 2P1YA 4Y5YC 4HK0A 1KCUH 3BP7B 5MEQB 4J3SA 4KQ3H 5DJDA 2CDGB 1D5ZB 1WT5A 4Z0BH 4QRUB 5D6DC 1CDJA 3NMEA 5DHXB 2H45A 4Q7DA 5GGSA 5C7XL 2RAMA 1B0RA 1P6AB 5H35A 1PSKH 2ZG2A 3AMKA 3IGAA 1UCBL 5IKCA 5HHXL 3TO4A 2F74B 4ZMAT 5MHSD 3T1WA 1QR4A 4YH6A 2EYSA 2XQBL 3UX9B 5C07B 1IKNA 4RGNC 3RGVA 4ZDHB 2AXFB 2ZUWA 5KS9F 5KVEL 4S10A 1M71B 5E8DL 2DQTH 3B5HA 4WW2C 1AFVL 1JNHA 4N8CL 4AL8L 1GRWA 1JF1A 4OCWL 3BN9D 4NQDD 5FYJH 1W8NA 5C0DA 3ZSTA 2YEZB 4M93C 1WAAF 2XNAA 5DD5H 3OPZL 4AH2B 4M4PA 2OTUB 3G5VB 3N1QC 2BJMH 2Q1EA 4ZS7L 3FZUD 4KRNA 5GGRA 2UVFA 2AK4E 5IBUB 4TUJA 4OCRL 1MJ7H 5BS0D 1MCIA 2BCKA 5DMIH 5ENWA 3F7VB 5IOPA 1BBJA 5F1NA 3RDTD 3V4UL 4LKCB 5FGBC 2APFA 1I1FB 1FFOB 3FN9A 3BT2H 2B4CL 3I6LE 3BP5B 1BF2A 3MJ9H 5FYLD 4LASH 4P23C 5EWIL 1ETZB 1O7SA 5JW3H 5JTWA 1G0DA 4TVPH 5GRWA 3FT2A 4PJ5A 2E9JA 4TNVK 2ESVA 4DKDC 3EGSB 3PGFL 3MV01 3GGWA 1FP5A 4M7JL 3SJVE 3FMGH 3KPPA 3H9HA 4X6DB 3MJ7B 4G6FD 3DRQA 3KXFA 5FDYA 2BY3A 4TSCH 5I66A 5EBGA 3VGGA 1YEJH 2A0LC 1HHKB 5IK3A 5KSAB 3WFBL 1U92A 5DS8B 3M1BB 1KENH 1X5KA 3B9KD 4KTEH 5K9JH 3TCLA 3SKJH 3CZFB 3V6BR 3BUYB 1MJ8L 1JK8A 2EECA 5F93C 3HC0A 4FQXB 2EYRB 3LQAL 4YDKH 1BWMA 4HGWA 1F6FB 4HT1H 4O58H 3SE4C 1R3LA 1S7XB 4YDJB 3NVQA 3P9MB 4ZS6C 1JN6A 3OAZH 4F57L 4PRAB 4XNMB 1UQSB 3HC4H 1G7QA 5SX5K 1I7ZA 1EO7A 1HXYA 3ARSA 4GXUM 2OP4L 4MNQB 2EDNA 5F21B 5IW6A 4XAWL 1QPXA 3MCKB 3ULVE 5ESQB 2UZYB 1QVOB 4JANA 3H0TB 1NLBL 2NY7H 4P2QB 3O45B 4PJXE 3NPZB 4F7TB 4HIEA 5IMOA 1TNNA 5AYUH 1JGDA 1X5JA 3K3QA 1I8IA 2AV7B 5DA0B 3PWJB 3ULSB 3VFTA 2XA8H 4PRBA 3C60A 2DTSA 1CF8H 1ORSB 4WHTA 4QOKE 4XRCA 3EYQD 4YE4H 5JOFA 4DVRL 3TM6A 3ZLQC 4LU5L 1WV7T 3EJZC 2FIKA 5DJ8A 3IXTB 2YKLL 3I2CH 3PV6A 3WCYA 3T4AA 2A74A 5SWSB 3LKNB 3HFMH 4CGTA 3UYRL 4CNIA 4WW1A 2XIDA 1D5IH 2BNQE 2ED9A 5GS2H 1Y6MR 1T04A 2GT9B 4ONOA 3RTQB 4U33A 3FT3A 3IFOA 4RMSA 3MZTA 1M1SA 1NGYB 3DXAB 3NPSC 4CU6A 5HHMA 1NL0H 4HWBA 1VDGA 4S1QL 3MLTB 4R2GC 1X5IA 2X1WL 4L4JA 3T0EC 3NZHL 3OV6A 2ZNWA 2H26A 2AI0H 2EIZA 2YA2A 5HHOD 5ALBH 3RU8H 1ZTXL 2XWTA 4UB0L 5T5NF 3VXPB 3QO1B 4HXAH 5D1ZB 3X11A 1ZT4A 4PGEA 1X5YA 1IGCL 3CFIC 3LN9A 3HZMA 4HKBB 1NCBL 2NX5E 4NSKA 3L5HA 3VFNB 2UWEE 5JPNA 1UJTA 4GS7B 4N0YH 3K46A 5E6YA 5B8CB 3UTSA 1EVUA 3RAJH 1CLYL 3MBEB 4O02L 5GS3A 4PJCF 1H3WM 3DJ9A 4I2XA 5GS0D 4A6YH 1D9KA 1EO8L 1S9XB 2F15A 1QLRA 1YNLH 4WEBH 1I7RB 2NXZC 2R2EA 4NUJA 5EIIB 5EUOE 5IV2A 1NKOA 5CBAA 4HPOL 4RFNC 4PJDF 4EUPG 4C59B 2HVKB 1JGUH 4LIQL 4ORGB 4BSWA 4EI5B 3P0YH 3DVIA 2VLME 4JJ5B 4Z0XA 2CIKB 4U1IA 5I2IA 2XXMB 4L8SC 4WUUD 1OARL 4M5ZL 1MWAB 1IC7L 1Y18A 4YUEH 2ICEB 1KACB 4J1UA 3BWUC 4PGBA 3ALPA 3MLPA 4QRRE 2HT2C 4CMHC 2GJ6A 1J9CT 3AREC 4NNXA 1Z9OA 3EOYG 5L9DL 1I9IL 1KSRA 1MHPL 4L5FH 3VWJD 2OR9H 3K0WA 1JBJA 2DQDH 4JO4H 1H0DB 5E6ID 1FAKT 2ZP0T 4JM2F 1UXSB 4KK8D 5DRNA 4LCIL 4MXVF 3WLBA 2Y07H 1LE5B 4FQJL 3VE0A 5IBLC 4I3SL 1WQVT 4Z78B 3I84A 4KKAC 3GDBA 1LO2L 3WO4B 2DDQL 3QG7L 4DVBA 3MA9H 1JYXA 3TT3L 1WWWX 1GC1H 5DWUL 2VN4A 2CLZB 3RL2A 1OSZA 3DX6A 4N9GB 5EU3A 1BIIB 3OHXA 4XVUD 4DAGH 5ESAA 5E2TL 1AXSB 1WZKA 4G8GE 4WUKL 4HMCA 3EYVA 1ZEAH 2VDQL 4JFEB 4OGXL 2P45B 3O4OB 4BQ8A 5ACLA 3LQZA 4X5WB 5T3ZL 1RZGB 4V1DD 2Q6WB 5C8JA 5DSCA 4L4TD 3OGOE 1G1YA 4WY7L 4EVNB 5FKAB 2BNUB 3HG1B 4OD2A 4YBLB 3REWB 3ARTA 4HZLA 2EIDA 4MDJA 4GFTB 3BEWB 1KXTB 4O51B 2QSVA 3CNKA 5KS9B 5D5MB 4PB9H 2ICWA 2HWZL 3MYJB 1OSPH 5IM7A 3TFKC 1OAYH 2IMMA 5TQ2H 4J12A 1NBVL 3MRFB 4MAYD 1J1XL 3FAXA 3WKML 5I1AB 5C09D 3MJ9A 3VI4E 5LGJA 3P11H 3BSZL 3OG4B 3RZCD 5IJVB 3WUZA 1QO3A 1GZPA 4XHQA 3S35H 4RDQF 4Z7OE 4X98B 1IT9L 5C2UB 5GGSY 2VH5H 4KDWA 2FO4B 1Q0YH 3UTPE 4X7DC 3FB5A 3WFDL 1CD8A 4RFEB 4RGNE 1DEEA 3GSNL 3Q2CA 5DC0A 2OZ4A 5ANMA 2CIIA 3EJJX 4JDZA 1TCMA 4RZCA 1KIQA 3U1SL 1M7XA 3QEQD 4JFHD 3QUXB 3RWDA 4XMPL 2CKBA 1MCLA 3HCVB 4PJEF 4U0RB 1M7IB 3JV0A 4OZHE 3SCMD 1FPTH 4M03A 3FL7A 3T1FB 1CQYA 4NYLA 2J8UE 2BOCA 3HE6A 3CFBB 1HSAA 4YAQB 1TNMA 4LCUA 3SKNA 5GGRY 2V17H 5J1AA 3WO4C 3JTTA 3QNZB 4WWID 2PXYC 3WYRA 2DYPD 1YEIH 3GMQB 1MQ8A 3HNTL 5F8RC 1IQWH 1MQKL 4F3FB 3SE8L 4XP9L 1MI5D 4G9DB 3KR3H 2AW2A 3T8XB 4EI6B 4MJ5A 2FGZA 4AEHH 3RIAF 1OD9A 2PF6A 4GXVL 4GH7B 2MPAH 1TTFA 3MRJB 4NN6B 4G8FA 4JRXE 1BVZA 3O4OC 2G9HA 1ZLVH 3BXNA 1L0XA 3OG6B 1QHPA 5EU5A 2HJLA 4JPVH 3D69B 5EOQL 1KCVH 1MREL 1T21B 3PDOB 3D48R 3GMNA 4Y8DC 1H15B 1AGFB 3HPLA 3OTTA 3PG2A 2N4IA 4AEIL 4CKVX 1FYHB 4QCIA 3SY0B 1TENA 3ARFB 2C5DC 5I1IL 3MCLL 4KQ4L 4QRSA 5DGQA 2Q8AL 3TYGL 3BIAX 3QUKA 5FHBL 1IMHC 1T1WB 1OAXL 3GIVB 1Q9KB 5E7BA 1A0QL 3KYKH 4W4NA 3AFLA 4FFYH 5JXEA 1FNHA 2AJ3B 4CU8A 4M1CD 1S7UA 1T5XB 3L3GA 5IVNA 4KUZH 1EHXA 2NYYD 3DIFA 1KCSL 3OXRB 5I9QC 3D1MC 1CN4A 2KPNA 5F1SA 1XGYL 5DMKA 1JZ6A 1BP3B 3CFKA 3V8CA 4HS8H 3QQ4B 4U49A 2P5EE 4IOFC 4HW6A 5KJRL 2YD9A 2P42B 4Z7VF 2XKUA 4KHTH 5J9PA 2FLBT 3DUUB 4XGZA 1WC7B 2HLAA 3QH3A 4K3EL 1CICC 2FATH 1FZKA 3GM0A 4JDVA 4RMTA 1UGNA 5C07E 1YMMB 2GUOB 4LQ1A 3O2VH 3D18B 4MWFB 2JTDA 3MRPA 4HV8A 3P73B 1AGEB 1RZJC 1A14H 5DD0H 4OGYH 3V5DA 1L0YA 1BFSA 1F6AB 2RIKA 1VADB 3BN3B 3HA0A 5AG8A 3S4SA 4KTDL 4P2RA 3UTZA 5SWZE 1I7TB 4M6NH 4XMKL 1K9TA 4P57A 4AQ1B 4NN5C 2FB4L 4XCCH 4I48B 2R2HB 3D85B 2NMSA 4LBEB 2EXWD 2DIBA 1UEYA 3K2MC 4PJCB 1C5CH 2XPGA 4N5EA 5F9JB 4H8WH 3T2OA 4C83A 4JHWH 1IAOA 1F2XK 1W0YT 3KLAA 4UT7L 1B9ZA 2KH2B 5I30H 3IETA 5FF6A 1F58L 2ERJB 4R0LB 3QPQC 3BO8A 3FTGB 3TO4D 4AQOA 5L88H 2I24N 1QFPA 4PJDB 2HYMA 1NMAH 1AHWA 1FG9C 3MX0A 3RGVD 4HCRA 2HKFH 1C1EL 1A6VL 4DN3L 2PTVA 2YXMA 1E28A 4PJGA 1LO0L 1FDLH 1KXQE 3LKOA 3CFCH 4HUUA 2OL3B 3JVGA 3W5MA 2VOTA 5I1DB 1VKXB 4MNHA 4K3JL 4RGMB 4M7KH 4XVTH 3BVNB 3FO0H 5D1XC 3MRIA 4FABL 3O11A 5JR1H 4UILH 4O4YL 3VXUA 4G8IA 1BVLA 4Y16D 4ODTL 1QEWB 3WDHA 3ZYOA 1J1OH 4IRZL 4WFED 5J0BA 2B39A 3QXWA 1RJLB 5E24E 4JM2B 1RZ7H 4NQEE 3E8UL 5CZKA 3UC0L 4K7PY 4KMQA 1MLCA 5KSBB 4UNUA 5J1TC 3LB6C 3LEVL 3D3VA 4OV6F 4ETQB 3D0VA 5EU4B 5ID0A 1A4JB 4HIIA 3O3DB 3TBYA 3MLWL 1NJ9B 5TH2B 2R0WH 3KYAA 3K80A 4BZ1L 1CLZL 4NN7B 1J0KA 2R56H 2CR3A 1N6QH 4XHJC 2XTLA 4EDXB 2MFNA 1VPOL 4MXWH 5JQ6L 4PJ5D 4RGOL 2ESVD 1A6WL 1U6AH 4MA8L 2IFFH 4NRYA 4JN1L 1JPTH 5B39G 4P4RA 4UU9B 1T2XA 5DDHA 5I1LB 3MXVH 4H20H 4P2QE 1R5IB 2Q86A 3KXFD 4PJIA 4BUGA 3QFJE 5L7XL 4ZNEE 2R29H 4OLUH 1LDPH 2ZCLH 2CK0L 1EPFA 3LQAC 4YX2H 1RI8A 2E8ZA 4Y2OA 1A3RL 1IL1A 1TJIL 1NAKL 3X14A 2WW8A 4WJ5A 4CN6A 1C12B 2WP3T 1U2CA 4GRMB 5EC2A 1KELL 2P5WA 4BFEA 4HWUA 4I1NB 1XGRB 3IDGB 2QQNH 2C4FT 1Q72L 2ZUTA 4JY5H 5SWSE 3ARUA 5HGDB 3ZYZA 1UADC 3QCTL 2XYCA 4NNPL 4UBDD 2DLEA 4ZFZB 1F4YH 3FO2A 3CD4A 3NZ8B 1SY6L 5FYKH 1NSNL 3DXAE 2R0LH 4IS6B 1NC4A 2CUMA 1L7IH 5MEQA 3BP7A 3IFPB 5I1HL 2R23B 4HDIB 2CDGA 3KGRA 1D5ZA 1KIRB 5BRZB 4CL7A 7FABL 1JWMB 4QRUA 4F33B 5JUEH 2FJFB 4RAUB 4X6FB 1X5FA 4LSSL 4R96B 2UUDK 3L3IB 5F7NC 4AEEA 2A6DB 3DRTB 2F74A 2R9HD 4HXBL 4PP1D 4QGYA 1RZKC 3C60D 4IHOB 4K7PX 3AAZB 3EO9L 5FCUL 4ZDHA 2AXFA 4IOIB 4RA3A 3F7QA 4WO4C 4NOFA 1M71A 3EHBC 4PJEB 5CZVH 1CVSC 1NGZB 4FFZL 3IDMB 3VFMB 4DK3A 4R6UA 3ILQC 1DL7L 2A9MH 4AH2A 2OTUA 3G5VA 2FLRT 1EMTL 4Z7UF 3G04A 5HHMD 4FFEX 5ALCH 3ALXA 4QTIH 3BH9B 4LKCA 4D9RD 1OTSD 2G75B 4RRPA 1EJ6A 4FFWD 1I1FA 1FFOA 1BX2B 1KJVB 2YUWA 3BP5A 2AQ2A 3QG6B 5EOCL 1ETZA 3BISA 2BNRE 2WUBH 3HI6H 1CCZA 4I18C 1WIOA 2BHUA 3EGSA 5D7SL 3IJSB 1DLFL 3LS5H 3PDGA 1X5XA 4NUGH 4X6DA 1PKQB 3MJ7A 2Y23A 1WFUA 4OQTA 1ND0B 3SDDD 5IESH 4P9HL 1D9KD 4XNUH 1HHKA 5CJQH 4Y2DC 5DS8A 3M1BA 4YPJA 4APQD 4NP4H 3CZFA 2IPUG 3BUYA 2IQAB 2YD8A 4JFQB 3ZE2F 4O00A 1IC1A 4PTUA 3O6KL 4UDUB 2O61B 2R4RH 2EYRA 2V7NB 1CE6B 1QPPA 4K8RH 4QF1B 3C6SA 3KJ6L 3HZKB 3VXMB 5I8KH 4MJIB 1S7XA 5HDLA 2ORBH 1DEDA 2LTQC 4N8VB 3C08L 2GJ6D 2VDML 4Z7VB 2NY2B 4Q58C 2WK2A 4PRAA 1X7QB 1UQSA 3E1F1 1G7IB 2DKSA 1XIWA 4LCYB 4LLWA 3L7EB 3RWCB 1HSBA 4MNQA 5CKGA 1OAZL 3OKDB 4MHHI 1YYLH 3VFWB 4OKVB 3MCKA 5ESQA 1QVOA 3H0TA 3MROB 4F7TA 3HR5B 3O45A 4XPGH 1IC5L 3MYZA 3IF1A 4M1GL 2JF1A 2AV7A 5IHUL 4GLRH 5KOMC 4OI9A 5L6YH 1MJUH 2FHCA 3QXAB 4HKJB 4GKNB 1ORSA 3ZHKA 3P9LA 1R0AH 1Z9MA 4FQ2L 3GHEH 3IXTA 1KCUL 2D0GA 1W72L 3STLB 5GRUL 2VL5A 4C56E 4KQ3L 3HRPA 5AWNL 1WWCA 3DO7B 3VRLF 1NMCB 2EC9U 2VQTA 3NFPB 5GSRB 2GT9A 3QDHA 2ATPB 3RTQA 3X3GL 3B2VH 3H9SA 5FYJD 2FL5B 2BVUA 1PSKL 1OP5K 4QWWD 3DVFA 1OAKL 5KG9B 3MLTA 4UINL 2QLVB 4RWYL 5DLMH 4EQ3A 1YUHB 2EXYC 3S88L 2CJUH 4KKBD 4BQ6A 4FG6D 4UNVA 3VXPA 3MLRH 4AIXA 3QO1A 4PUBH 2DQTL 2W1NA 1RULH 5JIKA 3VGAC 4W4OC 3THMH 5MENB 1D6VH 1MCPH 2A2QT 4HKBA 4KV5F 5ICXA 1KEGH 3S5LG 3N1PC 4DKEL 2ZCKL 3QIUC 1BAFH 3EFFB 3ZE1F 4U4BA 5B8CA 1Q1JL 1WZLA 3RHWK 1UG9A 1U3HC 3QBTB 1SM3L 5A2JH 3DHMA 5DMIL 1NFKA 2YRPA 4PJFF 1X5LA 4QRPB 4YDLC 3LD8B 4PJ9B 4E0RB 5EUKB 1P7HL 2CMRH 5IW1A 1FCCA 3F62A 1S9XA 3ZDZE 1ZHNB 1TETH 3BPNB 3BT2L 3ZKXB 5EIIA 3HPJB 5GS1B 4NKIL 4I0PA 2HVKA 4WV1C 4ORGA 2QADD 5J6HB 3QDMB 4TVPL 3BAEH 3C8KB 4GRWH 4JJ5A 2CIKA 4UMGA 2CUIA 4KJPD 2NY0D 3AY4A 4ZAKC 2ICEA 1XGQB 5LWYH 1YY9D 3RKPA 3DGGB 1FAIH 1GHFH 4D0DB 1JMXA 3RRQA 3O3EB 1OY3B 5IQ9B 5K33A 2F54B 1P4IL 3O2DL 1KENL 5L8LB 3C2AL 4KTEL 4NNYA 1I9RH 5K9JL 1UXSA 5D7JB 3DSFH 4ZUTB 4M7ZB 1LE5A 3AS1A 4PRHA 2H6PA 1X6NA 4Z78A 3M17B 2R69H 4YXKL 4GT7A 4JHAH 3O8XD 4IMKA 5CSZB 4KU1A 2CO6B 2O5ZH 4YDKL 5CEZL 3U9PL 4MXQC 4WNQB 1N5YL 3NH7H 3GI8H 1DBBH 4LF3A 1RQ5A 4EDWL 4ODHH 3QP3A 2BHZA 2X89A 5CJXC 3ES6B 2CLZA 2D03H 4N9GA 1BIIA 2IWGA 3NA9H 2NNAB 2V2WB 1LP9A 5IIEB 1DSFH 4IRSC 3REVB 3ZYJA 3VWKC 1AXSA 3V4VH 3VFGH 2YPKB 1I3VA 2GSGB 4CJ0A 2QSTA 5IR1B 1VACB 1GYAA 1JHTB 4JFEA 3VD5A 2P4AB 3LH2L 1RK0B 3RVXD 4X5WA 3ALWA 1K4DB 2NY7L 2Q6WA 4G6MH 5CJOH 5FECA 4NWTL 1KC5L 4EVNA 5FKAA 2BNUA 3BKCH 3HG1A 5GS2D 4KXZH 1WCQA 3REWA 2PO6C 3ARGA 1U8NB 2O5XH 1M6OA 3MLSL 4KAQL 4O51A 5JXED 3UDWC 3OAUH 2PYEB 5KS9A 3E2HB 5D5MA 2FX8H 2EEAA 3MYJA 3VI3F 5HSFA 2VZ3A 4J4PA 4PJCE 5K93A 4H0HB 3BD3A 5HHVH 2XG4A 1A3LL 2EYTB 1G6RL 2AEPH 2HN7B 5LGHH 3CDYA 1WAAA 5I1AA 3Q3GB 4OM1H 2UVEA 1TPXB 3UTQB 4Z7UB 2BVOA 4S1SH 4G9FE 3BPNC 2NR6C 5IJVA 2VLJE 4PJDE 2E7LC 3VD9A 1U8JB 2BSRB 2I9LB 5DT1H 4Z7WB 4NZRL 4JQXC 3MRGA 1DE4B 4OZGA 5E4EC 5E9DE 3RU8L 4B5EA 5J8OA 1I85A 3KNBB 4HXAL 4OBSA 2R1YA 3HNVL 4W6WB 3X13B 4JPWL 4I4WA 4RFEA 5HPOA 5T33H 1H3VA 1V3JA 4P2RD 5C0JB 4ZTOH 1E4XH 1QZ1A 4OD3H 4LLUB 4QHMB 2J12B 4FXGB 2NZIA 2X4OB 3QUXA 1R24B 5C08E 2OSLB 1JGLH 4X7FC 4MXVE 1M7IA 5M94B 1OM3H 4XC1H 5JIPA 2N56A 3T1FA 4NZUL 3QXUA 3QZWG 3UEZA 1H3UA 4Y4FB 2WBJC 4A6YL 1QBLL 4Z8FL 5B38B 3PP4L 4IRJD 4YAQA 3GKWH 4U31A 4OI7A 3FCTB 1UWXH 1YNLL 1I1AC 3QNZA 3FO1B 3GJEB 4RMVA 4KMTH 3PIQA 3GMQA 2ZCHL 3KLSA 1F4WL 1T66D 2W07A 1JE6A 3CAFA 1Q9LB 5HGAB 5IVOA 3BPOC 4XBEH 5IB4B 3HMWH 2NTFB 2VZOA 2JB6A 2RB8A 2WIMA 4P3DB 3T8XA 4EI6A 1J0ZA 2D31A 4PRPB 3R8BB 1FIGL 1ADQA 4YUEL 2DBJA 2DM7A 3MRJA 5BXFA 3LKQB 5HYJB 2VSCA 2VXQL 2ZWLT 2APBA 1UYWH 3TGXA 1NCCH 2OR9L 3D69A 4PRIE 3EDEA 4JO4L 4WWKB 1T21A 5D1QD 3PDOA 4JRYD 4F7MB 1XF2A 3GSQB 1KBGH 1H15A 4M5YH 3Q1SH 2VXSH 4MHHG 4AG4L 1WLHA 4M6OH 3SY0A 4PFEA 3ARFA 3IU4H 3KPSB 3D3VD 3CVHL 1P53A 4HC1H 4ZXBD 5CCKL 1YPZE 4KROC 3GIVA 1Q9KA 1NCWH 4NJAL 1IFHH 3T3PF 4J3WA 1T5XA 3ARDC 4DAGL 4BFGA 1CDIA 1QNZL 4OLWH 1U8PB 4CDGC 1GAFH 5DQ9A 1V3LA 1IAKB 3MRKB 5FFLA 2ZG3A 5C2BH 4OV5A 1LO4H 1J0HA 2NY6D 4WU5B 3QQ9C 4NM8H 3OR6B 1MIEH 1WC7A 2GFBB 3GK8H 3MODH 3KPOB 3OKKA 3H7LA 5J11C 1MLBA 4YGAB 5EDXA 1UWGL 1YMMA 2YZ1A 5E5MB 3D18A 3JZ7A 2E5EA 4HS6B 4MWFA 2MCPL 3P73A 1AGEA 3MLXL 1BOYA 2P5WD 4PJEE 5INDA 3I9GH 3PGDB 5DFTA 1BZ9A 3V52H 1HILB 1VADA 4QY8B 1XR8B 1G7PB 1X5HA 2QHLA 4E41E 1I7TA 1FH5H 4NM4H 4J3XA 5FA3B 2V6HA 2D7PA 3QJHB 4NZDA 4X6EB 4HFUL 4Y19A 3P11L 4I48A 3D85A 4OUOA 4LBEA 1NC4D 2A6IB 1RUMH 3U0TA 4TTDD 1YMHB 4PJCA 3O0RH 3TIDB 3QIWC 5F9JA 3JTSB 4QRQA 2VO5A 4DGVH 4HPYH 4PR5B 4XPFL 4ALAH 2E6JA 5HXMA 1GGCL 2ZJSH 4R26L 3LOWA 2DTMH 3FQXB 3NIGE 2JK5B 3BIBX 5TQ0H 1UWXK 1TCRB 1NEZG 3GEWB 3FTGA 4N0CC 4OGAC 3BKML 2AJZB 4PJDA 4YHML 3HE7B 4JQIH 3QUYB 4PTTB 2AGJL 4JEGB 2NCMA 1JVKA 1T7XA 1T03H 4JVWA 4LMQI 1S7TB 1ZLUH 2UYLB 3QDGD 5I1DA 2V5TA 3BGFB 3NCYP 4H0GA 1VKXA 2MWCA 3BVNA 2I26N 3VA2C 3IKCB 1MFDH 3VCLA 1IEBA 3U30C 3DSNA 5EU6D 1QEWA 2V17L 1OTUC 3BJLA 3L3JA 1U3JA 5E08H 1YEIL 2MCG1 4XP5H 5KSBA 3Q5OA 1L8JA 1U42A 3S36H 2IGFH 2WWKT 4ETQA 2EEBA 5EU4A 3WO3B 1A4JA 4XB7A 1I1YB 3O3DA 4ONGH 2RCSL 1AP2B 1NJ9A 2JJSA 1NMBH 5TH2A 3WEXB 5DVLA 4H88L 4YHOL 3P4MB 1XT5A 4Z7VE 4JY6A 3LEYL 4GLRI 4UZGA 4P9HC 4EDXA 5T3XE 3D25B 4BM7A 3TV3H 4JPVL 1BOGB 4EN3B 1GGIH 1FL3B 2WLYA 1T1ZB 2O93L 2J6EH 4XBPB 3UMTA 4UU9A 4Y8AA 5I1LA 1PW3A 3EZJB 1R5IA 1WZMA 5K9OA 3MGTA 1FFQA 5F7EL 2ZUQB 2XZQH 3U7YL 4G5ZL 5I1CH 3DYPA 2HH0H 1KB5H 1H3TA 3C6LC 5GSVA 2M1KA 2Y06H 3QUZC 1C12A 1TJGH 3KYKL 1IAIM 4GRMA 1DBML 2CXKA 1WK0A 4ODUB 3IJHB 5HVGB 4KUZL 4LPTA 1XGRA 1U91B 1J10A 1L6XA 4U2ZA 4Y4HB 4ELKA 5HGDA 1JNNL 4U1SB 1HK6A 1HH9B 2I60L 5IEHB 4HS8L 3D9AH 3FQNA 3UTTB 4KHTL 3NZ8A 4OFPA 3TBTB 4XCNB 5BW7C 4IS6A 3IFPA 3KPRE 4LGPB 4FXKA 3K8KA 4HDIA 1AXTH 1XIWD 4MQ7B 3TJHD 3V6FB 1KPUB 3ZKSD 4CVWA 1MAJA 4I3GA 4TTGA 1KIRA 5BRZA 3O4LB 4MNQD 3GO1H 3ZL4H 5HD8D 1JWMA 1M05B 2APXA 5I19L 4F33A 5GRJL 2FJFA 1FVCB 4RAUA 4X6FA 5DD0L 2V9QA 4ENEC 3C5ZC 1QFOA 3ABZA 4R96A 3L3IA 2B5IB 2A6DA 2IH1B 4JJHA 3O6LL 4IHOA 3MACH 3AAZA 4LQFH 2HG5A 3SDAC 3EAKA 4IOIA 4K2UL 3WE6B 3HAEG 3JWNC 3O41B 2FRGP 3I6KB 3VJ6A 3QA3B 4LHUD 4OT1H 4LARL 1CD1A 1NGZA 3VXSA 5CIPB 3T65B 2VB5A 4NO0B 1HZHH 3IDMA 1ZLUK 3VFMA 2AK1H 4H8WL 2LU7A 4LPXA 2EDBA 1EVTC 2JE8A 3IJYA 3RTQD 1FORH 3OKEA 3H9SD 2E7LE 5DUPL 3OKMB 5T1MB 2AEIT 4OZFG 1AR1D 3TA3C 1BIHA 4JO2H 2EE9A 3FB6B 4FQ1H 4N0RA 2JIXB 4NHUB 4PRNB 3VRIA 3AS0A 1CZ8H 2OBGA 3WMSA 4YFEA 3MRQB 1BX2A 5C0CB 5EA0L 1SJXA 1KJVA 2DQGL 4M7KL 5ID1B 2AXGB 2GSIA 1IILE 3NABH 1ERNA 1AI1L 1RU9L 5KVFH 1I3GL 5DD3L 1WBYB 1LK3H 1XFPA 2DQUH 3RVWC 4JFDA 3IJSA 2VLKB 1PKQA 3MV9B 1DANU 1PQZB 5I17B 2C7UB 1J05B 1NFDE 1V3MA 4Q6IC 1MCJA 4WI6A 2ZSVB 5FGRA 3LS4H 1T0PB 2CGRL 1A6TB 5I6XC 1S3KH 4PB0L 4DFIA 4I0PD 5C0EB 4KXZI 1SVCP 2IQAA 3L95A 1F4AA 4MXWL 1U8MA 5TGBB 3GIZL 2O61A 2BSED 2V7NA 1CE6A 2IFFL 4QF1A 4WGVB 3NGBC 4WCYH 3HZKA 3VXMA 3ARBB 4MJIA 4KRPC 1UA6H 4H20L 1HCFX 4KMLB 2QBWA 3VA6A 3W0WE 5L2KB 5J12B 5FUCE 4Y1AE 3WFCH 3SQBA 1X7QA 3EDKA 1UZ6F 4ESKA 5GGQH 1OPGL 2BX5A 3QXDA 4DGIL 1KCGC 5HPMB 1A7PL 1G7IA 5FYKD 2IALB 3DYMA 1SEQL 1I9JL 4LCYA 3CXDH 4X80H 1KXVC 4TUKL 1I8KB 3OKDA 4PRHD 4OKVA 4DEPC 4Z6AT 3MROA 5CKAA 3RY6A 4R4FL 1UENA 2P24B 4PJAF 2QQNL 1B88A 1IVLA 2IAMA 1JZ8A 5GJTH 1CFVL 3WL9B 5DRXB 4G6JH 2FD6H 2X89D 4XXDB 4YIQB 4H1LH 2BRRH 1Q94B 4PPTA 3QXAA 2ID5A 4HKJA 1QG3A 4GKNA 1QSEE 3NCYS 4Z7UE 2IC2A 3HB3C 2Q8BL 1VERA 1U8OB 1CGUA 3I6GB 4NQDB 1RFDH 4XPTL 3FRPA 1CU4L 3SGEH 4YHZH 3CMGA 3DO7A 3TP4A 2FR4B 3SKMB 1MY7A 3NFPA 2JCCF 4U6HA 5GSRA 4D2NA 2ATPA 4OUUB 5EN2B 1F11B 3EW3B 5BS0B 2FL5A 1IM9B 3RDTB 5KG9A 4JPKL 4NRXB 3ARGD 4MJ4A 4XPBL 5KTEL 3QRGL 1YUHA 2YD1A 4R8WL 5F1OB 1D5BB 1SJHB 2HFTA 1ITCA 1IRAY 3QHZH 3H42H 5MENA 3BHBA 3MRRB 3BZEB 1QUNA 1PG7W 5GISH 1P4BH 3TEUA 1UZ8B 1RURH 1L0QA 2N1KA 3DI3B 4D9LH 4V3DB 2Z8WC 1R6VA 3QAZB 4G6FB 4LEXL 2FJGB 5KAQG 4LSRL 4GKZB 5ALCL 1H8OA 3DMMB 3ZE2E 4LRNH 3GBMH 4QTIL 5E00B 3CMOL 4QRPA 4DZBB 4PG2A 2W91A 5EUKA 3TH3T 1S7VB 1P5VA 1ZHNA 4U1NB 3E3QC 3MRMB 3MOAL 2P7TB 2CRIA 3Q48A 1GPOL 3DV6B 1HCVA 3DO3A 1S9YB 4OF7A 4OQ1A 5HI4C 2QJDA 3U0WH 5J6HA 3QDMA 4UIKH 1BLNB 3QUXD 3C8KA 3E6HB 3HNSL 3GI9L 3GRWL 2PETA 5TE6H 2PKDA 3SGKA 4Y5YA 4KVCH 3NCJH 1BM3H 1M7DA 3U48A 3UBXB 1HHJB 1NPUA 1XGQA 4QGTA 4I3RL 5DMJB 3DGGA 4XNUL 4GBXC 4OCSL 1FIEA 1OQOA 3EOTH 3O3EA 1FC1A 5IQ9A 4JM4H 2F54A 4BFIB 5ITFB 5I8OL 4F7PB 2NLJB 4PBXA 5CSBA 2YPVH 5D7JA 4ZUTA 4NP4L 4ZTPL 1RUKL 4WTWA 3A67L 3M17A 3F65A 5AZ2H 2YUZA 4ZUVA 3VG9B 4AYFA 5CSZA 2R4RL 1QRKA 1O0VA 3SO5A 3IRZA 1J0JA 4K8RL 3BN9C 5D7IF 4KZEL 3VRLE 4WNQA 2Y6SD 3BP6B 3P0GB 1MCEA 3PWPD 2ORBL 2UZIH 3ES6A 4K7FB 4ODVH 4OIAA 3BESR 3FZUC 1P9MA 2V2WA 5IIEA 3Q5YA 5ADPH 3REVA 2X9XA 5I1KH 2A77H 2YPKA 4MS8D 3TBSB 5HDQL 4U3CA 2XG5A 5J06A 3UJTH 1C16A 5IR1A 1XGUB 1RIVL 4OTXH 3ZDXF 2FBJH 4Z77A 5HI5C 1RK0A 3TPUE 2VXVL 2FGWH 3ARFD 1K4DA 1Z3GL 2AKRB 3MV7B 1EGJH 5KVDL 5HHOB 5FK9B 4ORZC 1KG0B 1MJUL 3ZE1E 5EC1B 2PYEA 4HKZB 3VGDA 1GCFA 3KJ4C 2XT1B 2EDHA 2H9GB 2VDLH 1UACH 3G6DH 4OFKA 1PVHA 3H3PL 4PJFE 3I50H 5CGMA 2HN7A 4HF5H 4JKPH 4D9QD 5I18H 3Q3GA 4A2MA 3B2VL 3B9KC 4GJTB 5LQBL 3AMLA 3Q0HA 3UTQA 2D7TH 5D8JL 4ISVB 5FYJU 3DV4B 1U8JA 1YMMD 2I9LA 5DLML 4Z7WA 1UH4A 1DE4A 1VFMA 3CFJB 5D71H 3TF7C 1UM5H 3LHPL 1MCNA 5B4MC 4Y89A 4Q0XL 1OGAA 2DD8L 2VISB 3DVGB 5T1DL 4F15B 1RULL 3X13A 3THML 1V7MH 1D6VL 1MCPL 3EOAA 2R0KL 1KEGL 5KAQF 2VXUL 1MRDL 4LLUA 4QHMA 4WUUB 1RAMA 1BAFL 4FXGA 2X4OA 3CH1B 2FYYB 4Y19D 1DP0A 2OSLA 3D85D 3GJFB 4X7SH 4AIZA 2GY5A 4UV4H 1VESA 3B6SB 4FXLA 3WXWH 3TYFB 3TN0B 2BVQB 3SBWC 2BFVH 3MJ8B 3I02A 5EOTB 3UZEA 4Y4FA 1BD2D 3ZDYF 2MKLC 2NY4C 2RBLA 3OJ2C 5B38A 1PD6A 5E6IB 4QXTA 5F9WC 3T08A 4UT6L 3KLDA 4NHCL 3PXHA 4JREC 3IDXH 5IVXE 2PTUA 3TZVB 3HTLX 2W9LA 1IARB 1QSFE 1Q9LA 5FM4A 3BYYA 2OM5A 4JZNB 5IB4A 2NY5L 2NTFA 4I77L 4P3DA 4PRPA 3RJQB 4O2CB 1JWUB 1U8KB 4IDJH 3PQYB 3RX7A 4FP8L 3LKQA 5HYJA 5LWYL 1CLOL 3TPKA 3ZKNC 4OLEA 5C6WH 1QFHA 1HNFA 2AS5M 4F7MA 1I9RL 5D2NC 3GSQA 3LN5B 2ICES 4V1DB 3DSFL 4L4TB 1J18A 5BV7C 3W81A 5HHNA 2X4PA 3VI3E 3T0EA 1YEGH 3KPSA 4PJAB 1AGDB 1P69B 1KCLA 3NH7L 3GI8L 1DBBL 3V4PH 3O6FC 1F90H 5J6GB 4PJHA 3O3UN 2Y36L 5DD1H 4HIJB 4MAYB 4ZNCD 1IAKA 3MRKA 5GS0C 5C09B 1VFOA 3H8NA 1RUQL 5FOJA 1RZJH 5TFSH 5E2WH 1RK1B 5F70A 2JCCB 4L4VA 3OB0H 4QHNB 3OR6A 3RWIB 2MHAB 5CJOL 2GFBA 1YNTB 3IFNL 1HDMA 2QHRH 4S1RL 1KFAL 5I76A 4BZ2H 1Q9OB 4UOJA 5E5MA 3RUGB 4HS6A 4S1DC 1UCBH 2YHGA 4OCNC 5HHXH 3PGDA 2XQBH 3AVEA 3BDYL 4QY8A 5SX4I 1U95B 5E8EA 3D39A 1N64H 3TC9A 5KVEH 3KPNB 3L3HA 3E6FB 1S5IL 2IANB 2ZSWB 2AEPL 2V2XB 5E8DH 5FA3A 3VWJC 4KWUA 3INUH 3SGJA 4X6EA 3SCMB 1AFVH 4UAOB 1TFHA 3AREA 4AL8H 4Q9QL 4OCWH 2QV2A 3B8SA 2DI9A 4OLXH 1YMHA 3OPZH 1U8QB 3TIDA 1R5VB 4NHUE 2HT3D 5BRZD 4ZS7H 4JVPA 1EUUA 1FJ1B 1EEZA 2DYPB 4PR5A 2DMBA 2JK5A 3QPXL 4MA1C 1TCRA 3V4UH 5DTFB 2LV4A 2VN7A 5T33L 4NKOB 1B4JL 5IVZB 2B1AL 3VFOB 4ZTOL 3CPLB 1HIMH 3HE7A 2YPLB 3QUYA 4PTTA 2FEEI 3WLWD 4DOHE 4CJ1A 1AGBB 4TSAH 4DN4L 4G6AC 3H3KA 3AGVA 4M8QB 2ZUXA 5EWIH 3VXSD 4R4BB 1S7TA 1B6DA 4HHAB 4P46C 3EYUL 1OM3L 1PYWB 4KFZC 4XC1L 3UYOD 3I75B 1S7RB 2YZ8A 4JLRB 3VXNB 4H25B 2W9DL 1TJHL 3PGFH 3IKCA 4NKMB 4LEOB 1CLCA 4M7JH 1A1MA 3CJJA 4TNVF 3RWHB 2VRAA 5TE4L 2PTTB 3S98A 1F5WA 2Q76B 2VDKL 3H9ZA 4HUVB 4FZ8L 4JR9L 3WFBH 4TSBL 3QIBB 3E3QE 4UOW1 5CHNB 5AZEL 2VLRE 2J8HA 4JZJC 4YZFF 1I1YA 1REIA 1AO7A 1MJ8H 1HYSD 5TE7L 1KTDA 3P4MA 1S7SB 5DHVB 1DZBA 4JDTH 25C8H 3LQAH 1UYWL 3RZCC 1JGEB 3ULVL 1FCGA 3V5KB 3D25A 1DJSA 3OX8B 4LNVA 1BOGA 4EN3A 4N0UB 4JFDD 5FCSH 2X1PA 1T1ZA 4XBPA 3DTXA 1ZLWH 4F57H 4NFBA 4M6OL 4KK6D 1VB9A 3OB0K 3G6AB 1F42A 5C0NC 3FQUB 4NQXB 2OP4H 1FNSL 4YXHL 5LCVL 4XAWH 4MB3A 3KWWB 5GGUB 4RBPH 1NLBH 5AUMB 1JRHI 1A6PA 2NY1C 1A5FL 2ITCB 4ODUA 4Q9RL 4NQDE 3IJHA 1SBBA 3T77B 4JFXB 4P4KB 5SV3A 5GQBA 1HEZB 2CDEB 4Y4HA 2NX5D 1UXWB 4UIMB 3DX7B 2CRZA 4S0TD 4U1SA 4MJID 1HH9A 5IEHA 4DUXA 3UTTA 2NZ9D 1A4KB 1FVEB 4HK0B 3SHSA 4NM8L 2NY2D 2IBZY 3TBTA 1N0XL 1U58B 2CKBL 4XCNA 4LPCA 3S36X 1MAML 3UYRH 1OQXA 2R15A 3F12B 3FFCA 4P2OB 2PXYA 2XRAL 4MQ7A 1KPUA 3G6JA 3BQUC 2QQQA 3O4LA 4JO3H 4HJ0C 1IAII 1K4CB 1M05A 2Q3AA 1A7RH 2AABL 1WZ1L 3TO4B 1FVCA 4X5XB 3RQ3A 3V79C 1DVFC 4S1QH 4U6VH 2IAMD 3QJFA 3NZHH 3RGVB 1RPQA 4XH2B 1KJMB 3MXWL 2IH1A 1QA9B 1ZTXH 4MD5B 5CILL 2EDXA 5GRXG 4K9EL 2CQVA 4ZUSB 2YD2A 3WE6A 3O41A 3F6IA 4PJ8D 2VMFA 3C8DA 5KOVC 3SE3C 1WITA 5F7YC 3RBSA 5IFHL 2OI9C 4I8DA 3T65A 4NO0A 2Q87A 3T2NL 4RAHA 4Y16B 3S97C 4TRPL 2DQFA 3S4SG 4ZFOL 1URLA 3BX7C 5GGRB 4DGVL 1CLYH 3OJVC 5K59F 1H9VA 2FNBA 3OKMA 4N1CA 1HNGA 5ENWB 5T1MA 2GHWB 1GJIA 4YLQT 2H32H 4IIQC 5I74B 1EO8H 2WAHA 4MCZA 2JIXA 3HUJA 4PRNA 2VR4A 5F7DB 3MRQA 1T03L 1N5AB 1FYTE 4HPOH 5C0CA 1BGXL 4LIQH 2R1XB 2PW1B 5HHQB 2EDKA 5ID1A 2AXGA 2ESVB 4G8GD 2XZCH 1MFDL 2HTLC 3PHQB 1OARH 4M5ZH 2NQCA 4MQSB 1TTGA 4KJQC 1IC7H 5KVMC 1PAMA 3PGCB 3WSQH 4K71B 4YGVB 1WBYA 1H3XA 4FTVA 1DBJL 1AD0A 5EH1A 5I66B 5F72S 3UYPA 2VLKA 4Y5VC 3MV9A 3P0VL 3UZVB 5HI3D 4GG6E 4FQIL 4LKXA 5I17A 2IGFL 1U92B 1J05A 2DAVA 4K07A 4F58L 5FGCB 3LPWA 2IBZX 4LCIH 4Y4KB 2ZSVA 3AB0B 4FQJH 1S8DB 1NMBL 5F7MC 5GGTL 1UT9A 2EC9T 2D3VA 5GRZA 4RBPK 1LO2H 2ZNXA 2DDQH 3QG7H 5JOPE 3QDMD 2MQ3A 4MVBD 5TGBA 1GGBL 3TT3H 1FLTX 5DWUH 3SDYL 5F96L 1WT5C 5EB9A 2UV3A 1T20B 3QI9C 1ZMYA 2FH8A 3ARBA 2J6EL 1RHFA 5E2TH 4PY8J 4WUKH 4KI5C 5MI0B 5L2KA 5D2NE 2VDQH 2F54D 5E99H 4GRLB 5HPMA 2Y4SA 4NBXB 1NGXB 2IALA 2Y06L 4DKFL 5T3ZH 1DBAH 4TYUA 5D7JD 3UTPD 4HIEB 1PZ5A 1I8KA 4WY7H 5F9OL 3F7PC 1MHHB 2DBLH 3ZO0A 4EUPH 1IZJA 1DDHB 2P24A 5M7QA 4PRBB 3C60B 4Q2ZB 3WL9A 4WHTB 1VENA 5JOFB 4WI5A 4XXDA 4YIQA 5D6CB 4GAGL 3C2SA 1Q94A 5DJ8B 3BIKB 3PV6B 5JQHC 3G08B 4OD1H 1NBQA 2YUVA 1U8OA 3I6GA 1NBVH 1J1XH 5IW3A 3WKMH 1K8IB 1FL5B 3AUVA 2FR4A 3IFOB 4P5KB 3GO1L 3BSZH 1HINL 1YYMH 2JJWA 1QSZA 1UJ3B 1F11A 4LVOC 5BS0A 1IM9A 4JG1H 1IT9H 3RDTA 4NRXA 1DQLL 3MRDA 4WUUE 1CT8B 1KT2B 3AM8A 3X11B 1QOKA 2PYED 2I9TA 1D5BA 1SJHA 1FO0L 2FX7L 3GSNH 1BQLL 4YFDB 4NFCA 1JTPA 1QD0A 4MNGB 1QLEL 2AK1L 3MRRA 3BZEA 3MA7B 2XICA 1ZKAA 4S11A 3DETD 3L9RB 2A0LD 3WN5C 1NGPL 2FJGA 1LK2A 1B0WA 5DJXB 3SDDB 4GKZA 4FMFA 1MHEB 4PLJC 5HDBE 3DMMA 1B2WL 2CK2A 3WV0A 2CO7B 4K55A 4DZBA 4UQ3A 4Y7MA 4APQB 4OM0H 5T3XH 2R2EB 1LVEA 4LVNB 1S7VA 4WIQA 1JGVH 4GUPB 1OGAD 1T83C 3MRMA 4O2EA 3HNTH 3QWQB 2JKXA 5FM5O 2P7TA 1MQKH 2XWBB 3SE8H 4BSWB 3DV6A 5IBUG 4HIXL 1KN4L 3L3OB 4MB4A 4PJGF 4Z0XB 2EKJA 5I2IB 1HN1A 5MP6H 4N9OB 4ZS6D 2EIEA 1BLNA 5TF0A 4PD4K 3E6HA 3S37H 4NO2B 4RRPG 2EDJA 2DQUL 3QCUL 4GMTL 3LN4B 4NNXB 1T0MB 3JUYA 3UBXA 3WUWB 2C3VB 4PJAE 4Y4FD 3WNNA 5EOQH 2NY5C 5A2IH 5HHPB 1MREH 3U7AA 1WCBB 5DRNB 5IB5B 1JPGA 3WLBB 2AJVL 2BDNL 2NXYB 4PP1C 5ITFA 4F7PA 2NLJA 2EE3A 4AEIH 5FM8A 1MJJB 4PLOB 5E1HB 2FEEL 3VDAA 1FNEB 5I1IH 3MCLH 5K9QI 1NCAH 4KQ4H 4DVBB 1PBYA 3S7GA 3TYGH 3ZSSA 5FHBH 1OAXH 1A0QH 5C09E 3RL2B 3ZKQD 4PRPD 3EJZD 4K3HA 4YR6A 2W0FA 5F7WC 4X4YB 4K7FA 3EDJA 5HYJD 3AXLB 1F8TL 3VD7A 2HTKC 1DLHB 1XGYH 3U4AA 3RIAK 5KJRH 3IS0X 3N85L 2HFGH 1XGUA 1LNUA 4X80L 4M43H 5H2BA 2GCYB 5DSCB 2OLDA 2GW5A 3QHTC 3T0ED 1UM6L 4UTAL 3KPSD 2X42A 4FQCL 2AKRA 3QEQE 2P8LB 3H6JA 3MV7A 4JFHE 5GJSH 1NCDL 3TBWB 4BKLA 5HHOA 2X4NB 4JCMA 4G6JL 2OMBA 4KKCC 2FD6L 5FK9A 1KEML 1KG0A 2Z8SA 1N59B 5EC1A 4FS0A 4IM8A 2X70B 4RNRA 2H9GA 2VZ1A 1P1ZA 1IGIL 4OAWA 1XF5B 5JMRA 2L4OA 2ZOLB 5DEZA 1D9KC 2FB4H 1MVUB 1TVHB 2KQNA 4L4VD 4XI5C 3SDXE 3LKRB 1JRHL 1MI5E 3WDIA 5JLZB 3V5HA 4UT7H 3DV4A 1S7QA 2NXZD 3ZT6A 4LVHB 2G5BB 1YQVL 3MOBL 3ULUL 1F58H 3CFJA 5ELIA 1TQBB 4M6ML 5ANMB 4RZCB 2VISA 2M26A 3DVGA 2DLFL 1G9NL 1ZOXA 2X6MA 3H42L 1C1EH 2QADB 3D39D 4GQ9H 4AZ8A 3RWDB 4DWHA 1LO0H 2F53B 3BRGC 4WUUA 2NY0B 4OFDA 3CGTA 2HT2D 1RURL 2J5LC 3CH1A 2FYYA 3HLAB 4P59L 3TWCL 4OCXH 3ARED 4K3JH 5F7LB 5JDSB 3ETBF 4FABH 3QFJD 1IAIL 5D2LB 3TYFA 3TN0A 2Z91B 2BVQA 3N1GC 5CJBA 3GBML 3MJ8A 2YA0A 4ODTH 1U36A 5EOTA 5ILTL 5D4QA 5JW4N 5IBLD 5DHYB 3CZJA 5D7IE 4KDVA 3E8UH 2G2RA 1P84J 3UC0H 3K4DA 5JPMB 1AJ7H 3G5YB 1H5BB 2DQJL 3LEVH 3SDCB 4Z5RB 4QXGL 1N6VA 3O8XB 2RHEA 3TZVA 4X4ME 3HE7D 3MLWH 1TQCB 4JZNA 1E0OB 1TIUA 4PGDB 3BMVA 4BZ1H 2AJSL 1CLZH 5DUBB 5TE6L 4O2CA 3LVEA 1JWUA 1U8KA 3BXNB 1BM3L 1VPOH 3PQYA 4P0DA 4Z9KB 2HJLB 5JQ6H 4RGOH 1A6WH 1OAQL 4MA8H 4FNLL 4OZIE 1FLRH 4QWWC 1OB1B 1OP3H 1JTTA 3K2UL 4HBQA 4JM4L 2YD5A 5L7XH 3FQTB 4F7CB 4W81A 1INDL 4YHIB 3LN5A 2AXHA 2OQJA 4V1DA 2CK0H 4L4TA 2DL2A 5BZDB 4FG6C 3ULVC 1O7VA 1XCQB 1NAKH 2CUHA 1YNKL 1AGDA 1IE5A 4OF3A 5I1GL 4HK3N 1EH9A 1AO7D 3TFKD 1KELH 1X4XA 4W4OA 2UZIL 3DIFB 2DOCA 2BVEA 1Q72H 1JNLL 1NEUA 5DMKB 2I07B 4N90E 4K3DL 4EN3D 4HIJA 4P99A 1JHLH 4NNPH 2Y7QB 4KI5E 1FFNB 5C09A 1SY6H 1GZQB 1NSNH 1IC4H 2NPLX 4X9GA 3RNQB 4WTXA 1RK1A 2FGWL 2JCCA 4QHNA 1WFTA 4OBRA 3RWIA 2MHAA 2ARJA 3BD4A 3NACL 1YNTA 1Q0XL 4HS3B 5BJTA 1EGJL 3FB8B 3TNNB 2ATKB 7FABH 3OB8A 4BJLA 1CGVA 1Q9OA 5CZXD 3KLHC 3V5DB 4LSSH 3RUGA 2CPCA 4A6YB 1JYWA 4P2CG 2DQHH 5ISZB 4KJPC 2GTZA 4F7EA 4P2RB 3UTZB 2DB8A 3U2SB 4MD0B 4Y4HD 1UACL 2A9NL 4OFYA 3EO9H 1UB6B 1U95A 5FCUH 3MV8A 3HE6C 4QYOB 4WFEE 2BNRD 3ZDYE 3KPNA 5J3HC 2EDTA 2IANA 3E6FA 2V2XA 2LU3A 2BXYA 1EFXD 4OJFH 4FFZH 2X1QA 3WNOA 3LKSB 4JE4B 1VEPA 4E42B 1MWAL 2D7TL 2HA1A 3FFCD 1BECA 2PXYD 4OB5L 4IRJB 2Z0BA 4K9EC 1U8QA 1CXIA 1R5VA 4DQOH 3O4LD 2W92A 5DC4B 4XNZB 4WFHD 1EMTH 4F37F 5D71L 2DYPA 4J8RA 2A6KB 3IVKA 2FSEB 5ABDE 3TVMC 4FRWA 2J8OA 4LLDA 4MXQA 4PJ5E 5DTFA 2ESVE 4KKLC 4PV8A 3U36B 2B7DT 3C09B 4PJGB 5INCB 4OI8A 2YPLA 1QFUL 4HUUB 5D9SA 5D7LD 43CAB 2WLZA 1T2QL 3KXFE 4X4ZA 2NY3B 4MNHB 2HLFC 3MRIB 5JW4Q 5EOCH 3WXWL 4HHAA 1PYWA 3I75A 3VXNA 4P9ML 4Z7NF 5D7SH 3FKUS 4NKMA 2E7MA 5D1QB 1OW0A 2AEWA 4JRYB 1DLFH 2OJZL 3RWHA 1XGPB 3PWNB 3U4BH 1PEWA 1MLCB 2PTTA 2JJUA 5DZOA 3CU7A 3D3VB 5IGXL 4P9HH 5K9QG 4ZXBB 5ID0B 2JIXD 3QIBA 3VFRB 2V9RA 4NJ9L 3R8QA 4X6CB 5FOBB 5GIRB 1RJCA 5C0CD 1QRNB 3OR7B 1S7SA 3O6KH 2X41A 3GB7B 4GKSB 4KTYA 5F1KC 4LPUA 4S0SD 2D7NA 1JGEA 4C56D 4U6XB 4QO1A 2PN5A 1WUNT 4P4RB 1CBVH 3MUJA 4LDOB 2NY6B 3C08H 4FTVD 4N0UA 2VDMH 4OKDA 1JFQH 1RZIB 2V5RA 1C7SA 3MV9D 1FL6B 3K4ZA 4MA7L 3G6AA 4KK5C 3FQUA 4NQXA 1PFCA 1OAZH 4AIOA 2Z4QB 1E27A 1UCTA 1CI5A 4D0BB 5DVKA 1IC5H 3LDBC 4M1GH 5I75B 2FH6A 4OLYL 3BZ4B 1NAMH 3SQOH 2ITCA 2V7HB 5IHUH 2VQUA 2EE2A 3T77A 4JFXA 4P4KA 3FOLB 1P7KA 1HEZA 2CDEA 2COQA 4N5EC 3DX7A 4Y5XB 3ARBD 2DM3A 1LP9F 5HHME 3KYOA 1XEDA 1NC4B 1A4KA 1FVEA 1T4KB 1W72H 5SX5H 2YN5A 3MNVB 1GVIA 4OFVA 5GRUH 5L2KD 5AWNH 1U58A 2DN7A 4D9RE 2GIYA 3IDUA 1YY8B 3O3BA 2QHRL 3F12A 1AHWC 4P2OA 4BZ2L 4JRWA 3CSYB 3X3GH 1X44A 3CUPB 1T89A 1XGTB 1DQDL 1K4CA 4ELMA 1OAKH 4X5XA 1WTGT 3JVGC 1S9WB 3BPLB 4R3SB 3RWEB 4UINH 5B3JE 4RWYH 3W11C 5EIQA 3S88H 1BQHB 3UTSE 2ED7A 1N64L 4XH2A 1KJMA 1GC1C 5D5MF 1QA9A 3WJLC 4MD5A 1DN0A 4LNRB 2P49B 4BH7B 1DUYA 3INUL 4ZUSA 3QDGB 5DI8A 2H2SC 4I2XE 3WXVL 3QSKB 5T5NG 5LBSL 5KANI 4DKEH 2ZCKH 4OLXL 1BF8A 1WIPA 5EU6B 4RISL 1G1CA 1D7FA 4Y16A 2WUCL 1Q1JH 4L9LB 2WINB 1PG7X 1A9BB 1WJ3A 1J0YA 4WHYH 3MUZ1 3RIFF 4X9HA 3G04B 5F88B 3ZHLA 4PDCE 3LB6D 4YPGB 1SM3H 4WU7A 1IM9D 1EFQA 1A7OL 5JW5B 4F9PA 1T1YA 3PHOA 1NCUA 5TPWL 4OZGF 1JI2A 5FEBA 1HIML 1CIDA 4GMSH 1QFWM 4XHJD 1DBKL 3GZKA 3R06A 4EBQL 2GJ6E 4TSAL 4HH9B 4NKIH 5F7DA 1NCTA 1N5AA 3IAGC 2R1XA 1YEKL 3UP1A 2PW1A 5HHQA 1LE9B 3PHQA 2WANA 5A2FA 3PGCA 4YGVA 1A1NA 4PD4J 1SEBA 1U2HA 4R4NC 4G43B 3DMMD 2XY2A 1J1PH 1WBXB 2F5BL 1EHLH 1IQDA 4NZTL 1P4IH 4JKKA 3O2DH 3PL6C 3PDDA 3C2AH 4FQQA 1MRFL 1EAJA 4Y4KA 5IFAH 1T7YA 1S8DA 4YXKH 4PTUB 3MQIA 4PJBF 3MFFB 4JDTL 5CEYB 25C8L 3NN8A 5CEZH 3U9PH 3CH8A 1N5YH 3C6SB 4EDWH 4OLZL 3L5XL 4TTDC 3NBNA 3GKZA 5FYJE 1T20A 2MOVA 5DVOA 4V2CB 3FAWA 4FHBD 4L3CB 3W5NA 3IDYB 4EEEA 3DI2B 1ROWA 2B2XL 3S3PA 1XIWB 4LLWB 3BPLC 1HSBB 4QT5B 1H8NA 3LH2H 2H8PB 3SO3B 4GRLA 3T0BA 1NGXA 1MFBL 4JO1L 1P7QA 1CGTA 3IF1B 5DJ0A 5DK3A 1MHHA 4NWTH 1KC5H 5CINL 3LZFL 1OTTC 3VFVB 5DMGD 3VG0H 1DDHA 4J2XA 2YK1L 2IPUK 3MLSH 1T5WB 5F6HI 4KAQH 4Q2ZA 4JFFA 5AEAA 3P9LB 2OTPA 5JORB 3RWFB 4LHUB 4PRDB 5D6CA 5C08D 5K59E 1ITBB 1MY5A 3ILQD 1I7UB 3BIKA 5DFVD 2VL5B 4KY1H 1MCHA 3G08A 4ZYKB 1FNAA 1EK3A 4YXLL 2OL3L 4UT9L 1A3LH 5C9KA 1G6RH 1MNUL 2DLGA 4X8JB 1RZKL 1K8IA 3DROB 5SV4A 1FL5A 1SVZA 1EEYB 2E8YA 3H9SB 4JO3L 4P5KA 3NCCB 2R0ZL 5ANME 1A7RL 4HAFA 5LXGH 3JWOC 4LRIA 1UJ3A 2E6QA 2MMXA 4U6VL 3B3IB 3MV7D 4LCWD 4YHYB 3ECBB 5FHAH 4NZRH 4JFOB 1IGFL 1CT8A 4RDQG 1KT2A 1WEJL 2FO1A 3T3ME 3HNVH 4W68A 4JPWH 4TPRL 2H3NA 2W59A 5ICXB 1ACZA 4F9LA 2Y5TB 3MRCA 4JCLA 3MLUL 4MNGA 1BZQK 5D7KE 2F8VA 2MTPA 1VHPA 3MA7A 3ULUC 3SGDI 4YEFA 1DFBL 2EEDA 3NCMA 5I1EL 4PRID 2YSSB 5KSAC 4POUB 3D0LB 4GRWF 3L9RA 5HJ3B 1G9NC 3SDDA 4NZUH 5DJXA 1F4XL 1MHEA 4Y2DD 1QBLH 3OZ9L 3EYFB 4AT6B 4Z8FH 3ET9F 3PP4H 3MLVL 5IW1B 3C6LA 4FQXC 1O5DT 3OAYH 4KHXL 4QTHB 5E8OA 4APQA 1RIUH 3X17A 4MQXD 4ZSOB 4GUPA 4I0PB 4ZO8A 2ZCHH 1F4WH 2Z31B 3FQWB 1FN4B 3U82B 2OMNA 2XWBA 2VZVA 3L3OA 4POZD 4L3EB 4M4RA 4W70A 2XTJB 2XZCL 4NT6A 1FIGH 1KIPB 5FXCH 3GSOB 4NO2A 3WSQL 3P40A 2VXQH 5HD8C 5BVPL 3LN4A 4JY4B 4F2MB 3TN0D 1T0MA 3WUWA 1PGRB 3HS0B 4HLZG 1TZIB 2C3VA 4LCCB 5HYFA 3T2PA 2HP4A 4TOYL 4OCYH 5HHPA 1KLGB 4NNYB 1WCBA 2ARJQ 5IB5A 2A1WL 4AG4H 5KSBF 4PRHB 2H6PB 3C5ZA 1MJJA 1R3JA 1KLUB 5T1KD 1FNEA 3CVHH 4LHJB 3TESA 3TZVD 2YD6A 5CCKH 4M7LL 3CK0L 4LF3B 5T3ZD 2P8PB 4RIRB 5L0QB 2DLIA 4E41D 4MJ2A 4NJAH 4Z7QE 5CP3H 1J8HB 3DARA 3X12A 3PQYD 5DRWB 2BY0A 1LP9B 5E2UL 4X4YA 3RTQC 3S9DB 1QNZH 3AXLA 4U7MA 1DLHA 1NUFA 3EBAA 4HX1A 2AJYH 4GKOA 5EZLB 5E99L 3HN3A 1DBAL 5GZND 3O3AB 4XC3L 3P4LA 4ZO7A 2GCYA 2VDNL 1NDGB 5FECB 1YEHH 4N8VG 4P2RE 5D1ZC 2HKHL 2WBWB 2DBLL 3ARGB 2P8LA 1UWGH 1M6OB 1KGCD 3WFHB 2OTWA 3TBWA 4H26B 2MCPH 2X4NA 3MLXH 5KBNC 2C3GA 35C8L 4GS7C 1N59A 3STZA 5B8CC 5F6IB 4OD1L 4DGYL 2DQIL 5H94B 3QIUD 3MBEC 5CSGA 2X70A 5IROC 5EO1A 5KANG 3TJEL 4LSUL 1XF5A 5JZ7C 3QT2A 4HUMB 3OMZA 1EDQA 1H3PH 2ZOLA 1MSPA 4G8EB 5DURD 5DVNA 3EYSL 4HFUH 3U0PB 1MVUA 1TVHA 4RSVA 1YYML 2BVOB 2AJXH 5J89A 3LKPB 1CDUA 2W65A 2KQMA 1UB5A 3LKRA 4JG1L 4U1HB 4XPHL 3MPCA 2J4WH 5IJKA 4PJGE 3MRGB 5C0FA 4OZGB 5JLZA 3FRPG 4XPFH 1GGCH 4EI5C 4R26H 2G5BA 2R1YB 3OAYK 1CFNA 4I4WB 3VH8B 3BKMH 1NCNA 4M48L 3VXUE 4U1GB 4YHMH 1OLZA 4OFYD 1RVFL 5T3XD 3U6RB 3MV8D 2AGJH 4ZAKD 2IAND 4XMLL 4XP4L 2F53A 4D8PA 1CL7I 4V2BA 2VABB 3HLAA 3U9UB 1EX0A 5JDSA 3F5WB 3B4NA 3D3VE 5GGVH 5D2LA 2XN9B 2D0HA 2Z91A 4WI8A 4G3YL 5I71B 1A22B 3BP4B 1AE6L 5DHYA 2ITDB 4OM0L 1CGSL 5T3XL 3PIQB 1JGVL 3OL2A 2G5RA 4PJXF 5JPMA 1ZGLP 3G5YA 1H5BA 2EDYA 4KJWC 4MXQD 1BEYL 3FJTA 3SDCA 3J8F7 1N7ML 1PY4A 4G7YH 4Z5RA 4DKAA 4YHLL 3O8XA 4KPHL 3R0MA 4U0QB 4PJBB 2JB6B 2GQHA 4AENB 2YPLD 2D31B 5JIHA 3RX5A 2RCSH 5MP6L 1FZMB 4PJIE 3PWPB 3S37L 4H88H 4YHOH 3TNMB 4PGDA 5BXFB 2IG2L 1QLFB 5DUBA 2C4FU 3LEYH 4IRSD 5A2LH 1CDBA 5BV7H 2XFXB 3ESUF 5F44A 3BKJL 2ZG1A 1OB1A 1XF2B 4YBLC 1JV5B 2P5WE 3FQTA 4F7CA 4RMQA 5GZOC 5F7EH 2JJTA 4YHIA 3F7YB 1KN2L 4EXKA 1G6RA 2XOTA 2PO6D 3U7YH 4G5ZH 1NCAL 5BZDA 4HFWB 2DLHA 2O5YL 4J4PC 3QIBD 1XCQA 2PYFA 4XCEA 2IQ9L 1JZ4A 1JZ2A 1BJ1J 3QQNA 2GTWB 1MOEA 1WWAX 4PGJA 1DBMH 1MCBA 2K7QA 3ARVA 2LAGB 5DQ9B 3ROLB 1JNNH 2I07A 2UWEF 5D96B 2DM2A 2I60H 4OV5B 2QSCH 1LD9B 1C5DA 2Y7QA 1F3RB 2HFGL 2VUOA 1FFNA 3BH8A 3EOBB 4M43L 1GZQA 2FBOJ 3S3JA 4HWZA 2CRMA 2BSTB 1HXMB 3OKKB 1I85C 3RNQA 1CTOA 1EHAA 1J5OL 1MLBB 1S78C 1JJUA 4HS3A 3FB8A 1YDPB 3TNNA 3V8OA 5IFJB 5GJSL 2ATKA 5I19H 2VUYA 2V5MA 5GRJH 4GSDL 2W0LA 3F6LA 5EUOF 5INDB 1FFPB 3QUXC 2VDOL 5C3LD 5CAYB 5E2JA 1BZ9B 4JFZH 3O9WB 4A6YA 3QEGH 3VRJB 5ISZA 4U0RC 3DURB 3FFDB 3W2DL 4P4KD 2Z9TA 1HKLL 4NWUL 3O6LH 4YO0B 4MD0A 3U2SA 3RI5F 4PJ7A 1UB6A 4PBWD 4QYOA 2V5YA 4K2UH 4K94L 2W38A 1KYOK 4Y19B 1MCRA 4LARH 5ESVB 2OXHA 3WKNA 3VXTA 3U0TB 4JHZA 4ZQKB 4NO5A 2WBJD 4GRWB 4TULL 4TQEH 4GBXA 4XPAH 1BZ7B 3LKSA 5JHDB 4E42A 1BD2B 5C0BB 4QRQB 4P2OD 4IRJA 3GBNH 5EOCJ 5DUPH 2Z35B 5LGKA 2UUDH 4NOBA 1CXFA 1GL4B 3MFGB 2A6KA 8FABB 2FSEA 3C87A 5FDWB 1FZJA 4NN6C 4M00A 1T7VA 3B9VA 3WJJA 4GQ9L