3CPLA

Crystal structure of h-2db in complex with a variant m6a of the np366 peptide from influenza a virus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete modification of TCR specificity and repertoire selection does not perturb a CD8+ T cell immunodominance hierarchy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 65
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cplA01
3OAUH 2ICEA 5E8NA 2ZUQC 3SKUD 4P5KA 5D5MB 2O5YL 1DBMH 3QULB 3ARBA 4DKFL 5CJBA 4HPYH 1AGBA 1CFSB 1AGFA 4AT6A 3KXFE 3QUKB 4J8RA 4QHNA 4OBSA 3PL6A 4B53A 5IB4A 1T1YA 3FONA 4UUJA 2FEEI 3CMOH 4P46B 3U2SB 4HKJB 3QZWB 3T4YA 3G08A 4XC1H 1BBJB 3FFCB 3L7EA 4PJXA 2FX7L 4KI1A 1PDKA 5C0EB 4IMKC 4FQJL 1WIPA 1IEAA 1UM4H 1INQA 1RUQH 4LKXA 1RUQL 1IM9D 3L3OB 3RVWC 1UM4L 3EO1A 4WWKB 3GSVB 3OGCB 1L4IA 5EOTA 4GKSB 4HKBB 2FX7H 4RX4D 4Z7QF 3T08A 5KS9E 5IW1A 4XC1L 1MVUA 3JUYA 1ODAA 1ZVSB 1TQCB 2VKXA 3CMOL 3P4MA 5TDOB 3CC5A 4WU5B 3K7UA 3QNXA 5GGSB 4I3SH 1UT9A 5GS3A 4EUPH 2CRYA 1E4XI 1VENA 3HRZB 5HHQA 4XB8A 4HPYL 5D96C 3B9KD 3NGBC 1DBML 3V2AR 5F7HA 5MENA 1AE6H 1BQHA 3OAZH 5E94B 3BX7C 4G5ZL 3ZT5A 3VFUB 4Q9RL 1KFAL 2X4UB 5JOFB 4KHTH 4OZFH 5LXGH 2JJSA 3RWFA 3EBAA 3VWJA 5FHBH 5F3BB 1AXSB 1DQJB 3K3QA 3P9LA 4NM4L 5DTFA 1CVRA 5ALBH 3QUYD 5GRUL 1MIEH 4GMSH 4PBWD 4TSCH 3OG4B 5D1XC 5ECJE 1FHGA 3WHE1 1RIHL 4RFOL 3U0TA 1IGJA 2DI7A 2VOTA 2C3WA 4JFQA 4PRPB 1NJ9B 3KPPB 4KRMB 4L4VB 2FX9L 1EAJA 2W9EH 1R3HB 3JWDH 5CZXC 3P77B 5GZNC 4R3SA 3EJZD 3O45B 4JM4H 3U4AA 3EYSL 5C0GB 2GITA 3V4UL 2P24A 2V5TA 4PJFE 4LP4A 2Z35B 5D5MA 3HFMH 5T5FH 2NNAB 1YN6B 1ZT4A 1L6ZA 1PW3A 3WFHA 1Q9KB 1AGFB 4HCRH 4YDLB 3VWKD 2IG2L 3WEXA 4TTDC 4KK6C 4P2OC 3TBSA 1QRNB 4U1MB 5ITFA 1FG9C 3AGVA 3L9RA 1MCOL 3O4OC 4PGDB 4DK6A 5CEZD 1ZEAH 5D7IF 4ZUSA 4OB5L 5A2LH 4IS6A 5ENWB 5TE6L 4HK3N 5HHNB 1QR1B 1BQUA 2R29H 3KYNB 3U6RB 1BJMA 1EJOL 5TF1H 5ACLA 4LKXB 4L3AA 5C9JA 2UV3A 3LS5H 4RZCB 2VLKA 3L3OA 3GKWL 4PJ7E 4N8CH 3LN4A 5GISH 4NKMA 4R7DA 3G6JB 3PL6D 1H8SA 3O3UN 5LBSL 5FYLL 1X5HA 2GJ6A 3ME0A 1AGEB 3BP6B 3RWEB 1UB6B 3FO0H 5T3ZH 3UZEA 3PWVB 2EH7H 2FWOA 4LCUA 3MROB 5JDSB 1A6PA 4WIQA 4KUZH 1EPFA 2V5SA 4F7PB 4HBCH 1UH4A 5GGVH 1E4JA 1CICA 3EYVB 2J88L 1CDHA 4ODWB 4RCAA 2A6IB 3LN5A 4X6DE 3U7YH 1JRHI 3MACL 5FA3A 1DQDH 1FBIL 2VDLL 1I9IH 4WFGE 2WINA 1CE6A 2D7MA 2XWJA 3IXAB 2R0LH 5F8QC 4RQQA 1LNUB 2WBJB 2B0SH 4LDOB 4WW2F 4HHAB 5I1EL 2VC2L 3QO1B 2NXZD 3VRIA 3H3PL 1KV3A 2HMIC 4I18C 1U8IA 1KC5H 4JRXE 3BZEB 4YDKH 3EOAB 4CBPA 4XXCA 3F12A 5CWSB 1IAKB 3HE7B 3AXLA 4JRYE 4P4KB 5JHLH 3DX6B 3ARFB 4XAWL 4J2XA 2PYFA 4MMXC 1QG3A 1UXWB 4AL8H 2JIXD 4JZJA 1S78C 5DRZB 2J5LC 5DD5L 4G9FA 1MCSA 3DSNA 4YUEL 4MCZB 5I74B 2FEDC 4PPTA 2QL1A 1I8KB 1CGVA 3TBVB 1MCKA 2DQCL 2R2EB 3I75A 3HI6H 3X12B 3UPRA 1A6AA 3OJDA 2Y6SC 4N0UA 4GRMA 3C60A 5EBMA 4PJ5D 2JJTC 1P53A 1GGUA 2PW2A 5DJAA 4HT1L 2HTLD 4WHDA 3F7VA 4JFOA 2H45A 4JM2D 5E6IA 4K2UL 2WW8A 3V4VH 1KLGB 4FTVD 5F96L 1YEJL 4S1RH 4L4VE 1IGML 3VFPB 3L95B 3E3QE 4K7FA 5HI5C 4DUXA 3GSXB 3SQOL 3QDMB 4RZCA 1P7QD 4S1QL 1JPSL 4WFFE 5CSZB 4H88H 4NKDA 4Z7WB 5JW4N 1PLGH 1GVIA 4JGJA 1NC2D 4HIJA 3I02A 2IWGA 1IRAY 3GSQA 2WY3A 4ZFFB 2YD2A 1NCTA 3QAZC 4YR6A 4Y4FD 2AJ3A 3LQZA 4PJIA 1OCWL 3SGJC 4AEFA 4B0MM 4OD1L 2VQUA 2H32B 1IQDA 1NDMA 1T83C 4C57C 2M1KA 2EIEA 4R7NB 4LDEB 1PEWA 4S1SH 3S97C 1VESA 2FIKB 1CFNB 4LCWD 4QHUA 4S11A 5D7LB 4XXCC 2P46B 3WD5H 5J11C 1AJ7L 1ACYL 4MJ6B 1FO0B 5C07A 2LU7A 2GSGB 3ORJA 2ORBH 4LHJB 3BQUA 1L7IL 1EFXD 1KPUA 1NCNA 3P11H 3AAZA 3RGVC 2CGRH 1I85C 2EH8H 4ELMB 1Z9SA 5I19L 4HS6B 1Q9LA 3U9PL 1HI6B 3KNBB 3KG5A 4PJAE 1MHHB 3S7GA 5C08D 5GSRA 3BZEA 5MEQB 2AK1H 5GZOD 5DHXB 4GRLD 5I8CB 2NX5A 2IAMC 1JI2A 5F9WB 3TVMA 1G9NH 4APQC 4JRXA 1N0XL 1GAFL 3QCUH 3X13A 2MHAB 1MJ7L 1S9XB 1EHLH 5JQ6L 1CE1H 4P3DA 5DWUH 4OFIA 5DD1H 3PDOB 4LCYA 5CILH 2QSQA 1RFDH 2HH0L 2VZ3A 4ODHH 4LEOB 4U3CA 4Y5YA 3SDDB 1BIHA 3ROOA 2EKJA 4KFZC 4D2NA 4Z7VF 3UYRL 1S9WB 4L9LB 4ZO7A 1QLEL 3HR6A 3OKKA 5HHPA 5DHYB 4P2QD 4HFUH 1MCEA 1CG9A 5C0IA 1Q0YL 4J6RH 2P44B 1KPVA 2F58L 3ESVF 4XCEA 4FNLL 4JPVL 3S5LB 2CO6B 5ALCL 3GSXA 3K2UH 5KS9A 2YPLB 5SWZE 1NL0H 1YY8A 3R0NA 1JNNL 3WNPA 5GGRY 1EAPA 4M7JL 3NIDE 4XWOC 1J1XL 5JO5A 4XBEL 3DX9B 2K7PA 3RVTC 3UYPA 5HD8C 4KAQL 5FDWA 4OZGA 2ZCLL 4QOKA 4PY7B 5D1QD 5KSBF 1I1FA 2GTWA 4UV4H 4PRNB 2VXUH 4M61B 5I1HL 1JVKA 5K93A 5F6HI 2MQ0A 2OSLA 1G9EA 2NY4B 4LNRA 15C8L 1KB9K 2H8PA 4POYA 2B1HL 3KPOB 3WFEH 1NCAL 4EJ1C 4NHUA 1BD2E 3CFKB 3MRKA 5T1KD 4RGNC 3L7FB 3BDYL 5T33H 4G9DA 3TO4D 2LE9A 3CK0H 4H1LG 2XWTA 5D8JH 4HBQA 1JV5B 4N5UA 1FIGH 3CFEA 4N0YH 4LDLB 2VN4A 1JYWA 3KPNB 1MJ8H 4EBQH 3QDME 1JF5A 2DBLH 1SJEA 5I8OH 2VLLB 4ODTH 2CKBB 4WTZG 5DD0L 1U58A 5E2VL 1QBAA 3H42H 4OZFG 1XIWA 1AGBB 4DN3H 3PP3K 3BHBB 3MNWA 4MA7L 1N3NB 4U1NA 1RULL 3FHQA 5EC2A 5I73C 5JW3H 3FZUC 1T1YB 5IMMA 1BLNB 2P47B 4YGVB 1VACB 1MRFH 1CXFA 3AM8C 1S9YA 3SO3C 1ZA6B 1YNLL 4NGHH 4FFYH 1A9EA 1NGYB 4BYHA 4G8EA 1JZ5A 4RWHA 5C07D 4WFGD 1YQVH 1T7XA 4HV8B 1YEHL 3T77A 5F70A 3U4EA 4OUUA 1CXLA 4FQXD 2AK4E 2DQJL 1D5IL 3VRLE 3TCLA 1OTSD 4XBGB 2D0FA 4LEOA 3MV11 3FB7A 3N9GH 5EOQL 4ZDHB 5ID0B 2LU4A 2DAVA 5GPRA 1ZHKA 1CLZL 2YOCA 1NDGA 4U1JB 1RZIB 3G6AA 1NCBL 3MRNA 4PTTA 2IGFH 1V8HA 1ZGLM 2C1OA 3TJEL 3ZE1F 1S5IH 3WS3B 3RTQA 3DUUB 4WNQB 2X70A 3HMXL 3SKMB 4XI5C 3W9EA 3QQ3A 3O41B 4PY8I 1TVBA 1MCIA 3ZTJH 5I1KL 5C0IB 5JXEA 3MJ9H 4TRPH 1H0DB 3D85B 3EJYC 1ZLUK 4ISVA 1YJDC 1V7MH 4MAUL 3MRJB 3BXNA 1KTKE 3VFUA 5JNYB 5ETUB 1W72L 3LKQA 1EFXB 1Q9OA 3MRRA 3FO9A 2G60H 3GJFK 5FKPB 3Q1SL 4NHCL 3MGOB 5FGCE 3AREB 5TE4L 1TQBC 2BVTA 2PCPB 3GUTB 4U1IB 1T1ZA 3P9LB 1CFTA 4P5MA 4O02H 2AJYH 2FR4B 2GTWB 4JN2B 3PWUB 5IFAL 3OZ9L 3BGMB 4N90E 4WCYL 2O61A 2AXFB 4XPAH 3TV3H 5DT1L 4NN5B 1PX3A 2R56H 4LU5L 1KCGC 1GHFH 5IUSA 1DBJL 3KPOA 5C3TA 2CSPA 2D0GA 3DV6A 3ZYOA 1IM3A 1HCFX 1OAXL 4OCLC 3V79C 1A1MB 1IGIH 4L4JA 3CH8A 4X6CE 1BFVL 3T2NH 3SDCD 1JV5A 4NHUE 3MJGX 4AY0A 4ORZC 5D2NB 3UBXB 4NBXB 3MFGB 2HWZL 4OLVH 5CGYD 4Z7VB 4H25A 4JKPL 4PRHB 4RNRA 3DECA 3QQ4B 1TJGL 1C5DB 3D2UA 1MCHA 4MXQA 3L3JA 1W2KT 3WFHB 1BM3H 3MNWB 3KLSA 4PJFB 1E6JH 4QRRD 4OKVA 4JY4A 3IDMB 2XA3A 5SWQA 4D0BA 3CFDB 8FABA 1IGTA 3HMWL 1A3QA 1UEMA 4MA8H 1O0VA 1VGEH 1UCBH 3TZVC 4ZS7L 3HE6A 4NPYA 4Y16A 3QHFH 4G43B 2VZTA 5IHZB 4M7LT 4KVNH 5C09A 5DK0B 4XWOD 4Q9BA 2HJKA 3FQXA 3ULUH 4OUUB 3PQYE 4JCMA 5IJVA 2X2YA 2EIDA 1FYTE 2ARJB 1CFQA 1T7VA 5FA4B 1HZHL 2MNUA 5EULV 2J4WH 3MSPA 5ESQB 5BMFH 1NC4A 4JFXB 4ZSOA 2GCYB 4J3VA 1FVEB 1CFSA 3F62A 2GK0A 1WTLA 3LQAL 1HHHB 4OFPA 3OKMB 3DUUA 1YEFH 3SKOB 2ZOKB 2E6JA 4MD4B 4OFYA 1UCTA 3O2WL 3JXAA 1R0AH 2YUWA 1AXIB 4M6NL 1WLHA 3I85A 4KMLB 5C0BB 2FZ3A 2XN9B 1LGVA 4C58B 1UZ8B 1EFXA 1C5CH 5IG7B 4EXPX 4ONGL 3LZFL 3VGGA 1N2RA 1RMFH 1CE6B 2XWJB 1ONQB 2AK4B 3LIZH 1N64H 1TZGL 3FZUD 3HZYB 4POUB 2NY5L 4WEUD 4X6DB 1KTDA 4XP5L 4KMQA 5T1KA 1HHIA 2BY0A 3LV3B 4L3CB 1TXKA 3BRGC 1F6AA 3O9WA 3O6FD 5HHQB 1Y0LA 1OTTD 4MD0A 3D87B 3PXHA 5CWSA 1S78D 5FYKE 4YDLC 5CHNB 3LS4H 4F3FB 5T1MB 2J8UF 4JZJB 5EORH 5IMLA 4ZUUB 5E9DE 1EXUB 1EO7A 1QA9B 2VLRD 1P4IL 4RDQG 2R8SH 4JRYB 3MRLB 3W0WB 4AEHL 1SY6A 3K4AA 5DQ9B 3RVXD 1MUJB 3ARBD 3QUMB 2IMNA 5IEKA 5E70A 2Z8VC 3L5HA 1HWGB 3EGSB 5TQ0L 1ZT7A 3ZDZE 5H37H 1JTOA 5HTSA 3QDGD 1S7TB 1JE6A 3CH1B 5LVEA 3LSOA 3VFGL 4NOBA 5C0AD 4D0CA 3MV8B 4GKZA 1JRHH 3BEVA 3RAJL 3RI5F 3GIZL 1FE8L 3ZKND 5CGTA 5JXEC 5KOMC 2W0FA 4KY1L 5CLWA 2W60B 2IF7A 4XXDA 5FO7B 3PUCA 3T4AB 4KK6D 1IAOA 3S4SG 1FNLA 4ZPTB 3MRPA 1FIEA 4J3SA 2P5ED 5D2NE 1FYTA 4QRRA 2GCYA 3NN8B 4MHHG 5I1JH 4CW1B 1U3YA 4ZPVB 4ZNEA 2N56A 3RWJA 4NDMB 3RWCB 5KG9A 2C1PA 5DD3H 3SHSA 1ZKAA 1CBVH 1G7JA 4HD9A 4KV5E 2QLVB 3IXTA 4F57H 2QQKH 1WWBX 2BFVH 3QI9A 4U6VL 2CH8A 1W0WB 4HIEB 4JFDD 3ZTNL 1HSAB 1RSFA 3IFNH 4E0RA 1T5XA 1JMZA 2GJ6E 1J9CT 5C92A 5HHOE 3MOQA 4JFFE 2DBJA 3RGVD 5IESL 1A6UH 5AYUH 3UZQA 3O4LD 1OQXA 4X5WB 1X44A 5KVFL 3G5VB 3WFCL 2VLJA 4PTUA 5F1NB 1HHIB 4KJYB 1EK3A 3ZDZF 3QHTC 1OT2A 5T5NG 5SV4A 2MSPA 1I1RA 4A6YH 4MJIE 2KPNA 2ED8A 1J1PL 5KJRH 3O6LH 2JJTA 3NCJH 4K3EL 3PQYA 4I18A 1UQSB 4UDTA 1U8NB 1MY5A 2B5IC 5JXAL 4NJAL 1AFVL 2R2BB 3VE0B 4RIRA 3QNXB 4HX1A 1BJ1J 3GMMB 1MY7A 2ADGA 5IWLC 4JRYA 4HXBL 3VJ6A 2YSSB 1MI5A 1CCZA 4XPGL 1VFMA 4PJGF 5LAXA 2VMFA 5IMKA 4KKNA 3MBEC 4DWHA 4MA1B 2CLVB 5L2KA 4LASH 3V6FB 4DGVH 1HQRB 2VIRA 1MNUL 4IRSD 1NPUA 2KZ1B 3MRFB 4MD5A 4WEMB 2I07A 5D7KD 1MCCA 3D9AH 4FXGA 2DQUL 4LSSL 1MHEA 1WFTA 4RFEA 2A6JB 1MCWM 3GSNB 1JUFA 4HIHB 1FH5L 4Y1AA 4YXKL 3FO2B 5KS9B 4XNMA 5L9DL 1LO3L 3K81A 3B5GA 3RWHB 3ZZ1A 2R1WB 2I60L 1Q9WB 4LFHD 1YMMD 2XKNB 1I1CA 2XTJD 4UBDC 4L4VA 5KZCD 2Y5EA 3FFDB 4NNXA 1ORSB 3B3IA 4YHKL 4Y5XB 1CDBA 4JM2C 5SWZB 2XPGA 2VXSH 1DBKL 3NFNA 2HLAA 3C60B 4HC1H 5EU4A 3H9YA 2X41A 4AENA 5E2UL 4PREB 4WHYG 5BS0B 4OLEA 1CLOH 3LMJL 3MRDA 5IBTH 1AD0A 3WXVH 2HVJA 2F54D 1N26A 1U8MB 3NTCH 4YDJB 5GRVL 5F44A 4MXQD 2R9HC 1N0LA 1EZVY 4HUXA 4QGTA 3WEXB 2NTFB 4ODBD 3ZTJG 1RZGB 3HI5L 3MUGB 1I7TA 3BKML 5SWSD 4LLWB 1RJYB 2W91A 1UZ6E 1SJEB 1MFCH 3DURA 5GRVK 4KGJA 3GMOA 1VEOA 3FN0H 3U83A 2HRPH 1U58B 5TQ2H 1KSRA 2ZCHH 4LBEA 3LKOB 4ORGB 1RI8A 4PRPE 3LRSB 2QADD 4H20L 5DRXA 3LDBC 1J0JA 1K4CA 3ZKNC 5DD6A 5T1LB 1KXVC 3BP5A 2YR3A 5ICXB 3HNVH 3UTTD 4R0LA 1HK6A 4FZEH 4NUGH 4NO0A 2ZSWA 3QSKB 3QHZL 3KXFA 5E99H 1QQDA 4BKLA 4HF5H 2ADGB 2MKWA 5C0BD 3WL9A 5IHBA 2GJ6B 4BFIA 4CUCA 2IPKB 4KI5F 3TA3A 2WWKO 4PRPD 1F90L 1YMHA 4J3TA 2UWEF 2BY2A 3G6AB 4P3WA 1GGIH 3V52H 3V0AC 2NY3C 3DVGB 1AP2A 5DJ2A 3WS3A 4PRIB 4OAWB 3MRFA 1UXSA 2VB5A 3KPRD 3BAEL 4RISH 1D6VH 4HKJA 2M2DA 3O6ML 3H7LA 4K07A 1U42A 4Y19D 5E6ID 3VD9A 3U7AA 2EXYD 4DCQA 3IXAA 1AKJA 2QTEA 5L8LB 4UU9A 3GMPB 3HNSL 3M1BB 4TPRL 43CAA 1F42A 5DQDH 2NY4C 4YDVA 3BGFC 1XCQB 1IGYB 4L8DB 4TUJB 4X8JB 2X4NA 1Q9WA 3QRGL 2V7HB 2XFXA 5E4EC 3SDDA 1UWXH 2NXYC 1E4KC 4MDIB 3MCLL 4P4KA 1S7RB 1FPTL 1TJHH 4AQOA 1NGPL 4YWGH 3GSUB 5HDBF 1QO3B 3OAYH 4M7KH 5HGDA 5F9JB 4X80H 3O2VH 5EZLB 5JIIA 4L5FL 3DRQA 5DHVA 4KKAD 3LAFA 1EBAA 4XCEB 1D9KD 4JDVA 2ZP0T 3U30B 1CQYA 5DJ6A 4IMLA 5FM5M 1P4BL 1B2WL 4K3JL 4LCCC 1X5FA 1DE4A 3MOBL 3KS0J 1TTGA 5JOFA 3BJ91 5HDOA 5JUEL 4XNZB 2OQJB 1HQ4B 1NGXA 4KKCC 1FNSH 2H9GB 1DLFH 4PY7A 3VXPB 2BMKA 5BJTA 4ZOAA 1U3HA 5DC9B 3DYPA 4JO1L 1NGZB 3KJ4C 3Q5YA 1B0WA 5DRWB 5F7UA 3ARDB 4X6BB 3HC4H 1XGPB 3X17A 2R23A 4B50A 1IGJB 1BIIB 2UUDK 4EKXA 1J0ZA 2V2TA 1V7NH 3RDTA 5D1ZB 4YHZH 2Z92B 5TE7L 4LHUA 4G9DB 3ALXA 4JRXD 5GS1A 2DLFL 1LHZA 1WAAE 1T7WA 4NKIH 3L3HA 3GHBL 4YBQC 1NANI 2GITB 4NKOA 1DANU 1R3JA 2A6DB 1MFNA 2X7LB 4KDTA 5AAMA 2Z31C 4Q6IA 4KZDH 4MMZC 3D0LA 3S96B 5HJ3A 1MWAH 2ZKHL 3AB0B 2AS5M 5JMRA 3ZO0A 3V5DA 5FKAA 1W72A 1I8IB 1K5NB 5EZIL 3PP3H 4FRWA 4ZAKB 5D7LA 3C5JB 1O7VA 2HJFB 1LDSA 4B7LA 4OFDA 2DLIA 2JKXA 4LVOB 1QR1A 2GIYA 5F7DB 1WFNA 4LRIC 5KAQG 1IBGL 3TBWA 3D3VB 4WO4A 4ZOEA 4NC1C 1IC5H 3REWA 3MFFA 1T5WA 2D31A 1N5AA 4NN5C 4GG6F 2MTPA 3IDIB 5GRWA 5HGBA 4I5BA 1IVLA 2IANB 3S98A 1WZ1L 1TITA 3N50A 1AH1A 5KVEH 1A6WH 1TTUA 1OAUH 2ATKA 4LVHC 4PTTB 5KTEH 3ZHLA 4GQ9H 3VXME 1A3RL 1QO3A 3KLAA 3R1GL 4K3HA 3D85D 5AZ2H 3WFDH 4L3CA 2AV1A 3SBWC 2E7HA 5I16A 3I50H 3S37H 4WI6A 3C6SA 4GRLA 3BD4A 3GZKA 2D7NA 4LLVA 1A2YB 5KN5B 1KB5B 3LPFA 2EECA 3B2UC 2EC8A 2DQIL 1GOHA 5I76B 3HRPA 2H6PB 3QDAA 1RIUH 1UKSA 1JTTA 3MRBA 1DUZA 2XG5A 2VAJA 3K74B 4H8WC 2VL5A 1IQWL 5L2KD 5D71L 4MNGA 3TZVB 5IW6B 1UENA 2IBZY 4PDCE 4NQVB 4CN1A 2CJUH 4LQFH 3QUMA 5IEKB 4PJAB 3SN6N 5CSGA 5E9DB 1I3UA 3LHPH 3JV5A 2BSTB 4G8GA 1DFBH 3MNVA 1M7IA 4FQIH 4HUVA 3TESA 4LCCA 1RY7B 2YD6A 1IAKA 4XVTH 4HZLA 4RAVB 4N9GB 4HXAH 1ND0A 1K4DB 3WLWD 4TOYH 5CBEA 3KPLB 5ADOL 3U36A 1YEGL 2P5WA 5CJOH 3O9WC 4L3EE 1TVDA 2W65A 3WE6A 1KJ2L 3NH7H 4JEGB 4QY8B 4NNYB 5E8PB 2WP3T 4PG9A 4YQXL 4QXGH 3CFKA 1A6AB 5HY9B 4NIKB 2V6HA 2Z8SA 3S34L 5J1AB 3RVVD 1MJUL 4DTGH 1H3PH 2DQTH 1QLRA 3KR3L 3HNTH 4X6DF 3JWOH 3O45A 2ICCA 3HZKB 3WJJA 1NMAL 4F37F 5SWQB 1LO2L 2NCMA 3IXTB 4UTBL 3C6LC 5I9QB 1BD2D 2QQNL 3KYKL 4PRDB 1BJ8A 4HMCA 2YPLE 4ZUTA 4ONOA 1UA6L 3O3AA 4TN9A 3HE7D 4QRSA 5LGJB 4PJ9B 4U33A 1FDLL 5IVXF 1RZFH 2HVKA 5ESQA 5I2IB 4YEEA 3QEQA 3T0EC 5F7EH 4IRJC 3VXRD 2VLKE 1A9EB 1FCCA 2L7UA 4N0UE 1T22B 1RUKL 1WT5C 3HG1A 4ENED 4JFFB 2IBZX 2NY2D 5C6TL 1QBLL 3MYJB 1IEBB 4WW1A 1MREL 1A21A 2WM0A 1SMOA 5DEGA 4C4KO 4OLWH 5BO1L 4LCWB 2D0HA 4U6XB 3SDCA 2R2BA 3TWCH 5DA4A 1IAII 3VFSA 3OKDA 4NZUL 5KVDH 4MNHB 4X6EB 3F58L 3B83A 3GMQA 3IU3B 3RVWD 1JN6A 1KTDB 3DMMD 3VWJC 1R3KB 3O3DB 5JW5B 3GBMH 5I74C 3GBNL 2BSSB 2HG5A 2YMXH 5KW9L 5F7YC 1HILB 1CFVL 4Z7UA 4KDVA 4DN4H 2YN3A 3VXMB 5FA3B 2LAGB 4MJIA 2BHYA 4LQ1A 1HH6A 2DI9A 5DJCB 3DI2B 2ZG3A 1WBXA 1EVUA 3MJ8B 2O5ZH 3HB3D 4ZUUA 1FNFA 3FMGH 4OQ1A 3GI9H 4EQ3A 4H8WL 4JN2A 2DRUA 1T2XA 2OJZL 1DBAH 4LLAA 3EFDH 1J8HD 1CXEA 1FFQA 1P7KB 1PJ9A 4Y5VC 2APXA 3IS1X 1C7SA 1ORQA 5D7LD 1JL8A 1KJ2A 1JPTH 2CDFB 2F19H 2KUTA 3VXNA 1BOGB 3B8SA 4GW4A 5CLTA 4KK8C 4YFLF 1JIBA 3UROR 5E2TH 5C6PB 2CDEB 3THMH 5IQ7L 4DOHE 2Q8BH 4OZ4A 5DJDB 4PJ5E 1JZ4A 2IJ0C 1N6QH 1T66C 3QIBC 4LVEA 5BRZA 2B2XL 1A5FH 1U3HD 1OSPH 4QRSB 1HYRC 5I1AA 4NC2B 4DAGH 4P57A 1UWGL 4JN1H 4NRZA 4KTDH 4WU5A 4D0BB 5K33A 3GFUA 8FABB 1OAYL 3LQMA 2VDRL 3DURB 1NFIA 5CAYB 4K7PY 4APQA 4WFFD 1TLKA 3MNZA 4IJ3B 1JGVH 1L0QA 2Y06H 4I48B 4Q7DA 4X4ZA 4NZDA 4NDMA 5E6YA 5DRXB 3CXHJ 4E5XB 3BSZL 3VWKC 5FYJU 3QI9B 4OCNC 5CZVH 5GS2H 2X4OA 4GG6A 4Z7VE 1FVEA 5A2KH 3FT3B 3L5XL 5SX4H 2A9MH 2BVOB 4GXUM 5DK2B 2OL3H 1GGCL 4E41E 1B0GA 3QUZA 4YR6B 2PXYC 5I1CL 1LO0H 3B2VL 3D3VD 2VXTH 2VZOA 2NY3D 5T1DH 3DVNA 4NQCA 4Z77A 2XXCB 2YRLA 3AU1B 1S7VA 4UT6H 1UZ8A 3S36X 3RZWA 4XCYB 5HI4C 1WJ3A 5CJQH 3QXDA 2VLKB 1YYLH 5KSAC 4PJXF 2MMXA 1RZJH 3C08L 5E6IC 1JGUL 3O2DH 3NIDF 4UT7H 3PQYB 2OR9H 1AHWA 2RQ8A 1MHCA 4L8CB 4O5LL 2AJUL 4YHOL 1CXKA 3U4EB 3UBXG 1IAIM 3JVGC 4NBZB 4QNPE 2NXYD 2X4NB 4Y4HA 2AEPL 3DMMA 4O4YL 1EO8L 2X4SB 5K9JH 4JY5L 3TPUB 1KTRL 4OQTL 4RAHA 2YN5A 1CXHA 4KI5D 4GUPA 3MROA 5JDSA 2CDFA 3VXNB 1IC4L 2W9DL 3ISWA 3K8KA 3L9RB 4HLZH 4X83A 4OIIL 4OJFL 2EDHA 3GK8H 5F9JA 5C0BE 3MCG1 4R26H 3SCMA 4RFNB 4KKBC 4LCYB 1BAFH 3E6FB 1MWAA 1KTLB 2HMID 1N59A 5D70L 2FSEA 3MOAL 1CR9H 1P1ZB 5ETUA 3BVNB 2OCFD 1E28B 4YXLH 4XHQA 2K3TA 3PHQA 1TETH 1Q8MA 1OM3H 4OUOA 4PGBA 3VWJD 5IB5B 4JRWA 4R2GD 1NCWH 2JIXB 1IT9L 43C9B 4S0UC 5I1DA 5DJZB 3X3FL 1UXWA 2BVUA 4YX2H 5EBWA 2V2WB 4CU8A 5EU7E 4FQCH 2G9HA 4LSPL 3DXAD 4CVXA 4NJ9L 4CDHA 3C5ZC 4XMKL 1L7TL 1D3CA 5L7XL 2NMSA 4D3CL 1X5AA 4TUKH 1RK1A 2YD5A 4PGZA 2DIJA 3ECBA 3GM0A 2VDKH 3BE1L 4P23A 2WINB 3CLEH 3WIFB 4JO3H 1FO0L 1GGBL 3HZMA 2A6DA 1T1WA 4M5YH 4EIZC 2WAHA 5F3HB 1LE9B 1WFUA 3QO1A 3MXWL 1BVZA 3EYQD 4P5TA 4BSJA 2FBJL 3AU1A 1E4KA 3ERYA 1A0QH 4Z5RB 1CN4A 3PNWA 3MV8E 2DLEA 4OKVB 3BISA 4OCRL 1FCGA 4ODSH 4OCSL 2CK0H 3C5JA 1NC2B 1MCPH 3FRUA 1OAZH 5A3IC 1Y6MR 4G7YH 3ARTA 1X6NA 3OXSA 4NZRH 3TN0C 1LO5A 3RVUC 2BNQD 4NZTL 4PGCA 1CLYH 4ZFFA 4PTUB 5F1NA 2IQ9L 1FN4A 1DL7H 2FIRT 2X4SA 3UZVB 1WK0A 5DUPH 1QEWB 1NCDH 5EU6E 1BLNA 1FAIL 4JQXC 2DOCA 5EBMB 4X6CF 1G7LA 3CZJA 1G7MB 5EO1A 3QUZC 5EH1A 1AHWC 3LKNB 3RFZC 5DC0A 4K94L 3AREC 2IANE 2J3SA 5FAAA 3V4PH 3HHRB 1KLGA 3MREB 3GSOB 3LKSA 5H94B 5BXFA 4JPWH 4NNPH 2A77H 3DOSA 2YS4A 2YSSA 4FQXB 1GH7A 2FZ3B 1UM5L 2XN9A 4AJ0A 5BV7L 1AXTH 1EX0A 1Q1JH 4UU9B 1P1ZA 2PXYD 2VO5A 3KJ6H 3F7YA 1OAKH 4KWUA 4KHXH 1IGYA 4KPHH 4I9WE 5FYJE 1CL7H 2KDGA 2X44D 5D1ZC 4G42B 4GOSA 5A43C 1VKXB 3C2SA 1MLBA 1BF2A 3O3EB 1YQ2A 3TH2T 4RFEB 2A6JA 3CLFL 5KSAD 4PJXB 2GY7B 5DZNA 2HT4D 3WDHA 1KCSH 1QSFA 3LEYH 5EZLA 5JNYA 3CXDL 4PLKC 4BQ8A 2OZ4A 1J5OH 3MMEA 4KZEH 1FZKB 2Q7NA 3WLWC 3UTTA 1CGSH 2OK0H 4IMLB 3P0VL 1MVUB 2X4RB 2YHGA 5JOPD 4JB9L 5CBEB 3DETD 3Q6GL 5IBLD 4JR9H 2ED7A 1W0YT 3QPXL 3VI3F 5I71B 3H8NA 1GOFA 1SVCP 2XY1A 4WHTA 3A6BL 4OI8A 2FH6A 3FQWB 2P8PB 1U3HB 3OMZA 1MUJA 3KNBA 3U1SH 4NQXA 1EZVX 3ARDA 1BQHB 2IQAB 1XR8B 4WUUD 3BD3A 5D6DA 4GAJH 4Z5RA 5DEZA 5HD8D 1JPFA 5D1QC 4BSWB 4HUXB 4FABH 3TIDB 2ICES 1HEZA 1EAPB 4AG4H 2DLGA 4P23C 3PGFL 3W39A 1BOYA 5HDLA 4FTVB 2UYLA 5LKNA 4X9GA 3V6OE 2VWEC 1GZQB 2WWKT 3BMVA 3IU4H 1UYWH 4XXDB 3RKDD 5KS9F 3DHMA 3VI4E 4UNVA 1KENH 4OGYH 3QG6B 5INCB 3JTTA 3UTSB 1R5VA 3TJHC 2FO4B 2V7NA 3V5DB 1K2DB 2XZZA 5HHPB 2J8UE 3W0WD 1I8IA 2F53D 1I3RA 4PV8A 3OB8A 1EMTL 4ZAKA 3DYMA 5DR5H 3TNNA 4FQQA 5FHAH 2BNQA 3QEGL 4N8VA 5J6GB 4FP8H 4Z7WF 2OP4H 1MFBL 3OBAA 3GM8A 2APBA 5F21B 2A83B 2E7MA 3QEHA 2P7TB 2GJZB 4D8PB 2CQVA 2XWBB 1YMHB 3MFFB 1F4WH 3IB4A 1QFWL 4R0LC 3K4ZA 1U3JA 2ZOKA 3VI3E 3V7AE 3BQUD 1PFCA 3DMMC 3ARVA 3IKCB 2QR0B 3N1QC 4DW2L 5ID1A 5IR1B 2WUBH 1A7NH 4U49A 4A6YA 3MRHA 3IETB 1R3KA 3O3DA 3O6KH 2W92A 4H0HB 1U8PA 3MODL 3MTRA 4URTB 3FQUB 2F54B 4ELKA 1MFDL 5K59F 1KT2A 3B2UD 3KYAA 4YDIH 3RX7A 1G6RH 3V0WL 4L8DA 4TUJA 4LPTA 5I16B 2YUZA 2PXYA 3L7FA 1QHOA 4NC1E 4UQ3A 4S0TD 1KCVH 2A9NL 4GRLB 3ZMRA 5DVLA 3TFKA 1J1OH 1REIA 1F8TL 5GS0H 2R1XB 4Z0XB 2AEQL 1A4KA 1F58L 4RMWA 5DUML 1G0XA 1J0IA 4CVZA 1IARB 1M71A 5FUZH 3GNMH 5EU6A 5B8CB 1PG7L 2DWDA 5DDHA 5E9DD 1TIUA 4XCCL 3RKPA 5J12B 2AXJA 1N7MH 2BERA 3SDDD 2IEPA 3IDXH 3QISA 1H0DA 2VDML 1F4YL 1WBYA 5D7LE 3WFBL 3WUWG 3R06B 3RY6C 4F7PA 3MRQA 5DMJB 1HQRA 3DVIA 3SEPA 1JWUB 4OGXL 1U8HA 1U8KB 4P2OD 3CDCA 4OZ4B 3MLTA 3DO7A 5HI3D 4PGEB 3UDWC 3CSPA 3PF2A 4UIKH 1CDJA 4Y2DC 4DKEL 4X6BA 1RZ8B 5IB2B 1JPGA 4QRPD 2AXFA 2R23B 3GKZA 4PJ5B 1NKOA 3DLQR 2EDYA 5INCA 4G8FB 1G9MH 3DV6B 2V7NB 3LB6D 1NFIB 1ORSA 3B3IB 1MAML 4ZXBD 3UTOA 2YBRB 4ZQKB 5SWZA 4XRCA 1OARL 2C4XA 4PP1C 5D93B 5GS1B 3BP7B 4P59H 1H15B 3G5XB 1LEKA 4P9ML 5FO7A 5CEZL 4HKZA 3HE7C 3QIUC 2Y5TB 3W5MA 1U91A 1NBVH 3EHBD 3QNYA 4PRHA 3QPQD 1YYMH 1A7PL 1SEQH 2BDNL 5SX5K 4FXKB 1BZ7B 1S7XA 1C1EL 1YZZA 3GEWB 4GXVH 5IHUL 1SBSH 4FTVE 3FT3A 5TGBB 1HSBA 3ZE0E 5IGXH 2VJXA 3CZFB 3IJSB 4LSVH 5MEND 1VFOA 2CUHA 5DYOA 1IGTB 4KGLA 5A2JH 4EEEA 2B1AH 4PIRF 4LBEB 2EDRA 4HIEA 5DLMH 1P7HL 3HUJA 4C59B 1PG7W 4UV7H 1KCUL 3X11A 3OJMB 1BBDL 2X4UA 1A4KB 2C9AA 3UBXA 1EVTC 2ATKB 4YK4C 3T8XA 4H25B 5IBUG 5KVGL 3FT2B 1IKFH 3GSQB 2EDLA 1AXSA 1IGCL 4Y88A 3ARDD 3VGDA 1OP5H 4R90L 2UZIH 4KI5C 5C70A 3FOLB 1I9EA 3IU3A 2W0KA 3FCTA 1GCFA 2IH3A 4WV1A 1HHKB 3LEVL 4K3DH 2HG5B 2H6PA 5CKAA 5IG7A 4QHUB 4K71B 3VE0A 4OCYH 1OP9A 3D3VE 3EO9L 4ALAH 5IFJB 4IBLT 5C2UB 5F9OH 2I5YL 4I0PA 2JK5A 4OLXL 2GSGA 5GRXG 3BW9B 4G6ML 3ZDXE 2XQBH 2VLMD 2BX5A 1X5LA 4K7PX 3GMNB 1E28A 3QB7C 2JTDA 2X1XR 1JPGB 1SJHB 3EIFA 4XP1L 4XWGH 3TO4B 1MF2L 2VIRB 5FIEA 4DUWA 2GK0B 2E7LE 3RHWK 5DVKA 4AIZB 4M00A 1C16A 2BVYA 4HZLB 2PYEB 3MBXH 3T1WA 4LAQH 5J3HC 1UEYA 5T1MA 1K4DA 1TFHA 1G7QA 3U36B 1DQTA 1WBZB 3BO8A 3AS3A 4LP5A 3DRQB 3ARBB 2ADFL 1JNHA 3KPSE 1QFUH 1KBGL 4MA3A 5A16A 4X9BA 4OBRA 2IH1B 2CDGB 3C5ZA 1MSPA 3WUWB 1WWCA 5F6IC 2XPGB 3ZKQD 2ZJSL 4PS4L 1S7SB 1S7TA 4Y1AE 1BBJA 3L7EB 1H3GA 3S4SB 5F3HA 3W9DB 2DMCA 4ZTPH 2HT3C 4L9LC 1GZPA 1KB5H 3A6CH 3MGTA 4IDJL 4MQSB 1NGQL 4OCXH 5FGCB 5HI3C 3MCKA 4WU7A 5J57B 3O0RH 4Q9QH 2FLBT 5GGTH 4LK4A 1XGYL 1RZGA 2Z92A 1CICB 2XY2A 4L3EB 2HVKB 4FN0A 3MLYH 2IAMA 4HWBL 2X89A 3OXSB 1S7QB 4M5ZL 3FO1A 4JO2L 1FZOB 3J7HA 4JPIA 5E95B 5HGAB 5I17B 1OAQL 2FJFA 5EO9B 5F89B 3PWJB 2QADB 4XP6L 1LNUA 4J4PC 5H37G 1IEBA 5T1LA 3JSSA 4N8PA 4NHUB 3QIUD 3UMTA 1P7QB 2XA8H 1HSAA 4G6JH 3N1FC 2Z9TA 4K8RD 1FORH 1PEZA 2FX8L 4JQIL 2WIIA 2W1NA 2COQA 2DL9A 5FO8B 3IDGA 3VD7A 2GT9A 5FYJH 3EYUL 4M48H 5CMAB 3QCTL 3HPLA 5EUKA 4X5WA 1HKLH 4N1CA 2HFEA 3ULSB 3BHBA 4PJGA 2A2QT 2IAND 1FFOA 3UPRB 2YKLL 5FCUH 4I3GA 3CVIL 3EJJX 2HT4C 1RUAL 3DV4B 1A7OH 2DIBA 4ZTOL 1D5ZA 1U2CA 1UQSA 2F8VA 2NY0D 4XNZC 3QH3A 4LLYA 3KLAB 1WAAF 4P9HH 5IBUB 1XCTB 1X5YA 2NY7H 5EU5B 3C8DA 1AO7D 4M62H 5BZWA 3SO3B 4UT9L 2MPAL 4X5LA 4LCWE 2DWEA 3DXAE 3EDJA 1X3DA 4HUMB 1GGYA 3KYMB 4LAJH 1GC1C 25C8L 2X4RA 3TYGL 2Q8AL 4IRSB 5IMKB 2C3HA 3MRBB 1UM6H 4GW4B 5LQBH 2XNAB 2MFNA 3H0TB 5I1IH 4NFDA 1FSKC 4IRZL 4KK5D 4X4MA 5AUMA 5I75C 1D5BB 3KPQB 4Z78A 2NR6C 3PHSA 1URLA 3ILQD 3NFPA 2VAAA 2KQNA 4UOW1 3W2DL 2AJ3B 5EU3B 1NEZG 1JGLL 4UINL 4XVSL 3PABA 3PV6A 4UBDD 3QDGB 4P2YA 5E03A 5ESAA 4HS8L 3WXWL 3S36H 5F1IA 1JPFB 4TTGA 1S9KC 3SGKA 3UO1H 2H41A 3OR6A 3C60D 3Q2CA 2UYLB 5CGMA 2DQDH 3KPSB 1RUML 3MLPA 4Y5XA 1HINH 1WZLA 3CFCL 3G5YB 1FO0A 3EOYG 5C08A 4ZAKC 3NFNB 2GY5A 2EKSA 4OM0H 3RDTC 5BOPA 4S1DD 1TQBB 2AJXL 2DQGH 4MNGE 3BZ4B 4RMRA 4ONFH 4FQXC 4MXQC 5ACMA 4ZFOA 3TP4A 1T03H 4W68A 1P7QA 3WN5C 2L0DA 1MPAL 4LSTL 1D5XA 4JG1L 2ICWJ 4L8BA 4DOHB 4CL7A 4JG0L 1QLRB 3SKJL 1FC2D 4M1GL 4ERSL 4FHBD 2MCPL 2AJVH 2RR3A 4FFZL 5IVZA 1CZ8H 5TPWL 1RJYA 1YEEL 4ZUTB 4O2CA 3S96A 2P7TA 3C9NB 2Z4QB 4U1HB 1MFAL 5GIRB 1BFTA 3RU8L 3BQUC 4U0RB 1IL1A 3QUZD 4CN6A 2UWEA 1Y6NR 2UZXB 1WAAA 1FC1A 4JY4B 3ARFA 2AV7A 3I9GL 4X99A 5F1OB 2ZUWA 5DHYA 1XIWC 1TENA 1ZMYA 1MHCB 4L8CA 1U8PB 3EUUA 4KKLC 4KMTH 5IMOA 3TA3C 3HG1B 5KBNC 3HCVB 1AD0B 2Q87A 5E5MA 3T0XA 3M17A 4DKDC 4NWTL 5D1ZD 3BEWA 3ULVD 2X05A 4TVPH 2VLJE 4Z0XA 2F54E 1HWHB 1BGXL 5DURD 1WQVT 3P73B 5D1QB 1S3KH 3SGEH 1XF3B 2NLJB 1WEJL 4BH7B 12E8H 4GAFB 4TSBL 1ZLSH 3SCMB 2NZ9C 3IAPA 3ESUF 3JVGA 3GMQB 5BVPH 1CD1A 4AM0B 1QBML 1WBYB 2APTA 3QDJA 3RL2A 4PJAF 5HHOB 3BOVA 5A2FA 4OLYH 1FYHB 3MRQB 2Y4SA 5JZ7D 3ETBF 2F5BL 4LRNL 4DGYL 1ES0A 2A1WL 3UBXI 4PB9L 2RFXB 1D7FA 1IC1A 4PRBB 2BRQA 4KJQC 4P2QA 3LQZB 1IGFH 2HLFC 1TTFA 1IEHA 4Z95H 1BX2A 3AVEA 4W4OA 2YUVA 4GKNB 4ZXBC 4K9EL 1JNJA 2E7BA 5D2LA 1RHHB 1KJ2B 1U6AL 1UXSB 2VXQH 4XX1E 5HYSB 4RMSA 3EZJB 4KKCD 4I4WB 1S9YB 3K8LA 1A6ZB 1DSFH 3MO1B 1NCCL 5ILTL 3X3GH 3KPLA 1EGJA 4PLNC 5C07B 3INUH 4WEBL 1T89C 3WIFA 4XPFH 4JKLA 3RKDC 2QJDA 4BQ6A 5T3XH 3W39B 5EB9A 3MLRH 1U91B 2HKHL 5DJYB 3AAZB 5GSVB 3GI8H 3PP4L 1VB9A 4Q2ZA 5DMGC 3UJJH 1KN2L 2J12B 1JHLH 5J1AA 4JHAL 1FFPB 4PJIF 4RMVA 1AI1L 5JHDB 3S8WA 2C1OB 4KRPB 4Q6YA 1I3GH 4NO2B 3DTXB 4ZUWA 4LPYA 4J4PA 4X99B 3S5LG 4PJ8D 3MLZH 4N5EC 5IFHL 4QGYA 5IOPB 4MVBC 4OCWL 2PKDA 2W0FB 3WIHH 3L3HB 4Y5YB 5I30H 3G5ZB 5EOCL 2MOVA 4IMKA 4IOFD 1RJZB 1QKZL 2X4TB 1AQKH 1F4XH 3MRRB 2J5LB 1YECH 3V8CA 4D8PA 2PO6D 3ZKXC 5T3ZE 1N6VA 3QUXD 3EOTH 3ZSTA 1UWEL 3L1OL 3W81A 1U8OA 3UTQA 3VFVB 4I2XA 4M1DL 4LIQL 4PR5B 4HJ0C 1OF2A 4RSVA 2CO7B 1FJ1B 1U92A 2VDPL 2FHCA 4O51B 2AABH 3MA7A 1WIUA 5D1ZA 4E0RB 1Z3GL 1VFAB 2EE6A 1ZHNA 3GJEB 2WMPA 3QDJE 2R0KH 4QRTA 1B88A 3VFWB 1BWMA 3SGJA 5C0AB 3PWNB 1I1FB 2XRAH 3NFSH 2G2RB 3U7WH 1T83A 4MXWH 1F6FB 3G6DH 1OB1A 4PRNA 2XI9A 4AZ8A 4QHMB 3SBWA 1QSEB 3T2OA 5JXED 2VLJB 3VXTA 1DVFD 1KEML 2RCSL 1T2QH 3MV9B 2BK8A 4KJYA 3S3SA 3HLAA 1NSNL 3TPUA 1K8DB 3PWPD 1H3UA 3QIBB 4OV5B 2IBGA 4AIZA 4XNUL 3VRJA 1BEYL 1P84J 3R06A 3QR2A 1FGVH 2NW3A 1GRWA 3MLXL 1DUZB 1TMCB 1NGWB 4F33A 5C0JA 4Y16B 2JB5L 1ZLWK 5JOPE 2C3GA 3EJZC 4WO4B 2MKLC 4ODVL 2FLRT 1KG0A 4PRIE 1RVFL 5EC2B 4DVRL 3D5OF 2ZSVB 4JLRB 2NZ9D 7FABH 3BVNA 3WUWA 1CD8A 1DQML 2P8MA 3FHAA 4PP1D 4LLDA 4PJXE 5IB5A 3GSWA 3FRPA 3W9DA 2KH2B 1TJIL 4FXGB 3ARZA 1AY1L 2WNGA 2AVGA 2HFFA 1INEH 1T04B 4YHYC 32C2B 4GSDH 4BH8B 1ND0B 2X1PA 1X5IA 3L5WB 3SKNA 4KTEL 4Y1AB 4PP2B 2HA1A 1ZXQA 2I9LB 5FM4A 4MJ5B 4ZG1A 4UMGA 4L3ED 1NMBH 3QNYB 3ZHDA 5SWSB 4R4FH 3RTQD 1SY6H 2FH8A 2YPVH 5D7IE 4Q0XL 2D7QA 1UH2A 3UJIL 1RK1B 4APQB 2X70B 3F7RA 1CIDA 2Y9RT 4FFWD 1XH3A 4J4PD 1ONQA 2AK4A 5CJXC 5BCAA 1Y6KR 4YHML 4WUKL 5HHXH 4BK5A 4XCNA 4FQQB 2F53E 1KNOB 5I15H 4JQVA 3LV3A 4D9RD 5JHDE 1YEDB 1UKQA 4JPKH 2GJZA 5KANI 3GRWA 4NYLA 1J05A 3C09B 3WSQL 4EUPA 3MBED 3PHOB 3MA9H 5CHNA 1LK3L 4WY7H 3GGWB 4WUUE 3TVMC 4LLWA 4UB0H 3TT3L 2VDOH 3FT2A 1U0QA 2DM2A 4NNYA 3BZDA 4U1KA 5CEYB 3FQUA 3MUY1 1KEGH 2Q6WA 4LLUA 3GDBA 5CCKL 5DMIL 4XPHL 2J8UB 4MVBD 5TFSH 5CD5D 2GK2A 3BKYH 3SOBL 3VXUA 1I7ZB 1IFHH 4XMLL 3WIIL 2R0WH 3LDBB 5LCVL 3IRPX 1OP3K 1LDPH 4RAUB 3VH8A 1PKQA 2DJSA 2X4PA 2YWZA 4OD3H 1R3LA 4X7SL 4XNYL 3F7PC 1K3ZA 2PO6C 4X4XB 1RZKL 1ULVA 2BNRE 2B4CL 3QCVL 5F6HJ 3DX8A 5HHOD 1KG0B 1R24A 2J6EL 1IAOB 1JHKH 5GRJL 3BIKA 1WVZA 4K23H 2YEZA 2IPTH 4JREC 1R5IA 4PRIA 4MJ2A 1HIML 1A3LH 3B5TA 4CW1A 1DEEB 2APWA 1A22B 3B5HA 1N5YL 4JFPB 2X9WA 5CIPH 1C16B 3OJVC 1YEIH 6FABH 2E8YA 4BH8A 2QHRL 3D25A 4UNUA 4HJJH 4XPTL 1SYSB 4IHOA 3ALWA 5IT2H 2QADC 5I73B 3DHJA 4D9LL 5JR1H 1HYSD 5GJTL 1G0YR 3NCYS 4LCWA 4IOIB 3TT1L 3PDGA 5CEXA 2X4QA 2DDQH 5BV7C 4TULL 4MDIA 4RMQA 3RWDB 3QDGE 3MLWL 1EHNA 5IK3B 2Y07H 4M7LL 2HT3D 4ZFGH 1EGJH 3D69B 2ADIB 4M02A 3LEXB 2H32H 4KUCD 4AYFA 1ACZA 1J11A 3GO1H 3VFTB 3H9SE 2VLRB 3GRWH 3BWAA 1UJ3B 3BKJH 1G1CA 1U9KA 4LPXA 1MI5D 4FQLL 3VG0L 4YHLL 4N0CD 3QNZB 4R7DB 3ARUA 3GGWA 2QSVA 4PRHD 3NZHH 5CKGA 3H9SD 1QYGH 4OM1L 3RX5A 5H8DA 2D9QB 4ZNEE 3VWKA 5MEOB 1IILE 5E0QA 3C5SA 3V8OA 3MV8D 1YNKL 5LAXB 2EYSA 3BZFB 3NCYP 4F3FA 1GSMA 4GH7B 3ARWA 1HDMA 1VPOL 1TNNA 1Y18B 2F53B 2P8LA 5E2WL 4XVJH 1EXUA 1VADA 1PKQB 3LCYA 3KLHD 5IVNA 4WGVB 3DO3A 1CXIA 4GT7A 3HCVA 1JZ7A 4GW1A 4F9LC 1OY3B 3RRQA 1AR1C 2LTQB 4YHIA 2WLYA 1NLDL 1X5JA 3LKPA 3QFJE 1UWXK 1CF8L 5I1AB 3V6OA 3VRIB 2LFGA 2BOCB 3FCTB 7CGTA 3HG1E 5K9OA 3REVA 1F4HA 2Z31B 2VSCA 4PJGB 5EO1B 3UXFA 5GHWH 1ZS8A 3N06B 5L0QC 2NXZB 3Q6FA 3BEVB 4XBPB 3T3MF 3SE8H 4JFPA 5CJXA 3PGDA 1VEPA 1I9RH 2NY1C 3BKCL 4I0PB 3IJHA 5DF0A 1MHPL 4E5XA 1YJDH 3MV9D 4J1UB 5F7DA 4FMFA 4MQXC 3TVMD 35C8H 1RURH 1KT2B 1ZAGA 1UVQA 4OSUH 4JVUA 4RGOH 3P30H 3IDIA 3U0WH 1S8DB 2CXKA 3K4DA 4BFGA 4UQ2B 1VA9A 1ADQA 2R1XA 4N0UB 4NQDB 2BVOA 1A14L 4IRSA 3OV6A 5AZEL 1QFWI 3RVTD 5DSCB 3WDIA 1LMKA 1H3WM 3T4YB 5JORA 4M7ZC 3ZHKA 5AWNH 4NZJA 3BO8B 4Y4FA 2AV1B 4GKNA 2CRZA 4LEXL 1F4AA 4GG8B 3IGAA 5EU3A 4ZD3L 3ARGC 2Y23A 3MLVH 2D7TL 3LKRA 3KS0H 2OI9C 5I76A 5IEHB 2OTUB 3OKNA 4G7VL 4YHNB 1Q0XL 5HHVL 3RIAF 1CGTA 3HE6C 3TZVA 4BKLB 5GGSA 2J6EA 3KPSA 4Y4HB 3C5ZD 1DBBL 3SDYH 2AJSL 1GZPB 2GFBA 4PJAA 3NABH 4DZBA 3IFLH 3B6SB 4ZO8A 3K1KC 2H32A 4YLQT 5MENB 3BZ4A 3IJYA 4WFHD 4PJ5A 3MV7B 2EC9T 1JF1B 3MJ6A 1AP2B 1MH5B 2VITA 1HYSC 3PXJA 4IIQB 3B9DA 1D5XB 4X6CA 4D9QD 4N9GA 3ECBB 3V6BR 4OF8A 4U2YA 1KTLA 1FZOA 4JPIB 2BXZA 3BPNC 1MEXH 4YE4H 2QEJA 1JTPA 4JZNB 2Y36L 4JZJC 4QT5A 2D03L 2OTPA 4P2RD 5TDPB 3RPIB 3EYFB 3LD8B 5IHLB 2V7HA 2XFXB 1DUYA 5A40E 5I6XC 3GMRB 3QUMH 4GAYA 3UC0H 3CDGB 2I07B 3TH4T 3WJLA 1XIWD 4HPOH 4UIMA 1I3RB 5EBLA 5EN2A 1XF4B 3BJLA 3GSUA 3S35H 4X6FA 3SE9H 2D7OA 4R3SB 4CDGC 4HUNB 1QUNA 3TF7C 3P9MB 2R0ZH 1KCRL 3P4OB 1E4XH 3O8XB 1NEZA 2VXVL 2Y72A 2XZCL 5GZND 4OZHE 2XKNA 4JDVB 4YNYA 5DGQA 3V6OC 3VXSA 5I9QC 1ZT4B 2NYYD 1PKQE 4QRTB 3S6CA 4U7KA 1E4XL 5ICYB 5L88L 4HULB 3UYOD 2FB4H 2Q1EA 3ARED 4U6TA 4MVBA 3SE9L 3IKCA 4JDTH 3S35L 2AI0L 2YK1H 4PJHE 1X7QB 4KRNA 3P73A 5D1QA 4KQ3H 4J3UA 3N85L 2QSTA 4XH2B 3KHQA 3OAZK 3UC0L 5BJTB 5C0AE 1KPVB 3KWWA 2VISA 1XEDA 1K8DA 2EEDA 4YC2B 3RUGA 2D03H 4YDJA 1YY9C 2Y36H 4N0CA 4HFWA 2CMRH 1QSEE 3GIVA 4YE4L 1IMHC 2XZAL 3IFOB 5CUSL 4NQSA 1B4JH 2R1YA 1FNGA 5BQ7B 1P4LB 2CIKA 2G5RA 3WNMA 5FDWB 4HG4J 3QDHA 1S5HB 6CGTA 1A7QL 3MLSH 1MLBB 3L3KB 3C6LD 3I6GA 4NKOB 1ZHBA 3VXRE 2WQRA 5C0CA 4H26B 1MCWW 4NQDE 3QIUB 2GJJA 4R97B 2AJSH 4NBYB 1G7MA 4QXTB 3FL7A 3F8UB 1JFQH 2VITB 1C12A 3N1PC 5HYSA 3MLTB 2EYTA 3CFEB 2YD8A 1Q0XH 1A6ZA 4NCC1 3T0ED 4PUBL 3KPNA 3TZVD 2I9TB 4G7VH 5JIHA 5B39A 4KQ4H 1PBYA 1WCBA 2D7TH 1ED3A 1J8HE 3MUZ1 3O3BB 4ZD3H 4C56D 4BSVB 4WHTB 1WUNT 4LEXH 2FATL 5DJ2B 4NQXB 2JLLA 3WKML 5IMMB 4F7MB 1NAKH 4Y19A 1S7SA 5D2LF 5IIEA 1U41A 4QHLB 5EBLB 5EN2B 1H15A 1LEKB 1CDGA 3G5XA 5AZEH 4BZ1H 4OI9A 4RX4A 1NCUA 1A14H 5CP3H 1KNOA 2X9YA 3MRCB 5I0ZA 3P9MA 4GBXD 4W4NA 3KLDA 2XOTA 3MMEB 3HE6D 1JHTB 1MRDH 3T2QA 4KJPC 3FQRA 1RURL 1YDPB 35C8L 4Y0GA 4HWBA 2YD3A 5BOZG 3P0YL 1RJZA 1YJDL 3LH2H 1MHPH 1TZHB 1U8LA 3MJ9A 2IAMB 1FZJB 3BT2H 3S3PA 5MP6L 4MNGB 1IZKA 4HJ0D 3PGCB 5I8EB 1FFRA 5GHWL 1TVBB 5DFTA 4O00A 2V17L 3ES6A 5IMOB 1XT5A 5CD5C 5J89A 3DVFA 2OJEB 1KN4H 1MQKH 5D7JA 4OFYD 3VFPA 3M17B 2F5AH 4XPBL 1KJ3L 4D0DA 1INDH 3EKCA 4FQ1H 1GIGL 1OTTC 2BVPB 2EDDA 3CVHB 5DQJB 1I8LA 3GJEA 1FNGB 2HN7A 2WIIB 1RZ7H 1RZKC 4MS8C 4KK8D 2BMKB 1DVFC 4NP4L 1QFPA 4HQQH 5CJ8A 1ITCA 1NAML 3KDMA 4OT1L 4V2BA 2OS7A 2QQLL 1JYNA 2EICA 1YNKH 3P0GB 3GSNL 3MV9A 2YEZB 3ARBC 2P42B 4WFED 2BNRB 1MCQA 3Q3GA 4LHUB 3FT4B 5EA0H 3VA2C 1OSZA 5K9QG 1A6VL 3FQNA 3O6FA 3RY6A 1KJVB 3NZHL 3V6ZB 4YHLH 3VG0H 1Q72H 1SBBA 4BZYA 3CSBA 5EU6B 4P5KB 1FNAA 3BKJL 4K94C 2FL5A 1KPUB 2HKFH 4P9HC 2AQ2A 2IC2A 1TNMA 2DWEB 4HEME 4X9IA 4XNXH 3GO1L 4CVUA 4DQOL 3SPVB 1W72B 4HGMA 4POZD 4RGNB 4YH6A 5GSRB 3SY0A 3VGAC 4G6FB 3VXRB 2EDQA 4J3XA 2R15A 3E3QA 1A1OB 3WNNA 4M7LH 3TVMB 2Y07L 5GGRA 3MLWH 5AUMB 1ADQL 3IETA 4L8SC 3X13B 3L3GA 4TULH 5H2BB 3QIWC 3NPSC 2P5WD 3TT1H 3T65B 4ONHB 2PN5A 4HDIA 3OB0K 5F7KC 3S88L 3CX5K 2GYSA 3SKNB 2CLZB 5HGBB 1H5BB 4PP2A 3LB6C 3C87A 4DK3A 4DVBA 4XPTH 1WISA 4EIGB 1I1AB 2OBGA 4FFWC 5HI4D 4U1LA 3H9SB 2ZG2A 1JZ2A 43C9A 1N5YH 1A7RL 4NN6C 1A3LL 3NAAH 3O11A 3V9FA 4I3RH 2IPTL 3MGTB 2EKSB 1T6WA 1CK0H 4XCNB 1JHKL 2OJEA 2B7DT 4JO4H 1TZIA 3G9AB 5C2BL 1KB5A 4P5TC 1CU4H 1HDMB 1V3LA 5C07E 4AMKH 3ABZA 3QCVH 2B4CH 4GMTL 4QWWD 2IFGA 5HVWA 1U8KA 1BZ7A 1S7XB 2DQEL 3A0OA 3NACH 5C86A 3KVQA 1F00I 3BUYB 4GW1B 4WI3A 1FG2B 5DTFB 5LCVH 2DICA 3U30C 5IVZB 3WIIH 1IFHL 2E9JA 4QTIL 5E8DL 3SOBH 4YHIB 3BKYL 3GMLB 4HWEH 5TFSL 2YA0A 4XPHH 5CSBA 5DMIH 5CCKH 2H8PB 3JTSB 4XC3H 1KEGL 4XZUB 4FS0A 3OKLB 5ACZB 2KZWA 1N4XH 2BP3A 2R4RH 3CFBB 3FJTA 4UB0L 5FECA 3VXUB 5AYQA 1Z0MA 3BP7A 3ARDC 1L0YA 4WY7L 3EO0A 4PJGE 5EUOA 1LK3H 1OHQA 4F8TA 1E6OL 1YEKL 4UTAL 1FSKB 1UVQB 1CD9B 5D7IA 4FQPA 3UTSE 1YN6A 1Q38A 4JPKL 1T1XB 1CWVA 1ZWIB 1DEDA 1I8MB 5TGBA 1CD0A 2BOBA 5FUCC 5I15L 5ITBL 4QRQB 1QRNA 1RU9H 4U1MA 5HHXL 1JGDB 4WUKH 4Z7UF 2AP2A 4NM8H 4YXHH 3MXVL 4KROD 4LSRH 5ELIA 3PWPE 3UTZA 5IM7A 2Q76B 3UJIH 4Q0XH 4HV8A 2FD6L 3T77B 2Y1VA 4B41A 2ZCKH 4R4FL 4MS8D 3BW9A 2Z8WC 1YPZF 1SM3L 5E8NB 3MQIA 2X10A 1QFHA 1H5BA 1F3JA 4JHWH 2P45B 2X5PA 3DGCR 4GSDL 2R9HD 2VL4A 1INEL 5TJWK 1MI5E 1YC8A 1OTSC 1AY1H 1NUFA 5CEXB 3HG1D 5EPMB 1TJIH 3R8QA 3MV9E 1X6LA 1T89A 3QXWA 3QG7H 5CIPA 3ULUE 4U1SB 2YD4A 3DIFB 5DEFA 1G7QB 2ZG1A 1DQMH 3QDGA 4RGNE 5E8EB 4XT1C 7FABL 1AIFA 5DEGB 1JNHB 2FDBP 4R6UA 1MQ8A 2V2XA 5DJ8B 4G3YL 5CS7A 2VE6A 4L29A 2L7JA 1BZ9B 1LO4L 3DJ9A 5MENE 3BP4B 1QSZA 3NA9L 1CT8A 2VQ1B 3NIGE 1FGNH 1PY9A 4L4TE 2IPUK 4LKCB 1C5BH 3P4MB 5TDOA 2FR4A 1BEYH 2DKSA 4XNUH 3GMNA 3FQWA 3FB8B 2JELH 2DTMH 4YO0A 4U1GC 2VZ1A 1PYWA 1SEBA 1T2QL 2ZNXA 2RCSH 3AFLA 5CJ5A 2C3XA 3IDNA 3RA7L 4PRID 3CFBA 5D2LE 4CGTA 4MXWL 1LP9A 1MRCH 4KI5E 3I2CL 3RL1B 1RK0A 2ZUYA 4GRWF 1B3JA 1S7QA 4GRWH 5SWSE 1MWAB 1Z3GH 4M8VA 1I75A 2EXYC 5HGAA 5IB1B 2R2HB 1QP1A 2Q6WB 3OPZL 2B39A 4EI5B 5FFLA 2BOBB 2AV7B 3WV0A 4H5SB 3O4LA 4EOWL 4V1DE 5E4IA 4LIQH 5D7JD 4LLMA 3VH8G 3QJFA 1QNZL 4FQHB 5J13C 3QFDA 4NQCE 4PRPA 4OF3A 1UWEH 4BZ2L 2CDEA 2CLRA 2C5DC 5ERWA 5DJ0B 4E41D 1MHEB 1M6OA 5GS2D 3TNNB 4HIIA 4XP4L 3U48A 5D1XB 1I3VA 5C09B 2EDEA 2NY6D 2DD8L 5TH2B 2YD9A 1AQKL 3OWEA 5CMAA 5D4QA 4RWYH 1II4E 5I30L 3IS0X 4GFTB 4KKAC 1ZLVK 3QEHB 3IFOA 5A2IH 2XTJE 3RWHA 4F37K 1KPRB 4WUUB 1T0MA 1VFAA 3WIHL 2W38A 4Q58C 5ISZA 3NIGF 4NNXB 1R3IH 1UGNA 3CFJA 1KYOK 4HIJB 3MLZL 3MNZB 3C6LB 4G6KL 4R9HA 1I3GL 5TDNA 4OLZL 5F89A 3DGGA 4ESKA 3DIFA 4JHAH 2QKIA 4HS3A 1JHLL 1L9MA 4M6MH 3HLAB 2ID5A 4O58H 1KLFA 5GJSH 3GI8L 4PJCA 3F5WA 3IAQA 3OKOB 4LLQA 4LHQB 1GPOL 3O4OB 3VRJB 3PNWB 2HKHH 4FZ8H 1FFNB 4HKXB 5I18L 1MFEH 2PNDA 2X4QB 4LVNC 2EYTB 1J8KA 1KOAA 1FV1A 4XPFL 4NO0D 4EDWH 3INUL 5IROC 3SGEI 4WO4D 5C0DA 5I1GH 3QFJA 3D69A 3O3BA 1U6AH 1D5BA 3KPQA 4ODUB 3MJ7A 1EDQA 1FVCB 5B22A 1OW0C 4YIQA 1SEBB 2BCKB 5D7SL 1JWUA 1ZVSA 4QKXB 2O5XL 4U4BA 1Z5LB 1L8JA 4GW5A 4PB9H 1IM9A 3TBYA 4LRNH 4DGYH 4K9EC 1DN0B 3SDXA 3ULVL 3CUPA 3GB7B 2XG4A 5DQ9A 5FUOH 3RWGA 1VEMA 3TN0A 4LRIA 2PYEE 4LCIL 5BVPL 2H1PH 4FQ2H 5HGHA 1DUYB 1GC1L 4TSBH 1ZLSL 2YPLD 4L8BB 1IAIL 3BPCB 1DQQB 3O3EA 4MS8A 3D18A 1M6OB 1S3KL 1XF4A 1MELA 5FGBC 1TCRA 5DVOA 5C3LD 4X6FB 4HKZB 1JWMB 4TVPL 1I1AD 1CVSC 1GJIA 1I7UA 2ZPKL 4CADA 5KSVA 3QWRD 2BVQA 1AR2A 1ZLVH 1MCDA 1NLBH 2A38A 4MCYA 1Z9OA 3ROLA 3V0VA 2BOCA 3ARFC 3EFFA 4R97C 5JO5B 1HSBB 2CPCA 5AEAA 2OTWA 5LGHH 3LOWA 1ZS8B 5D6CA 4JFYA 1BZQK 4P49A 4KKLD 3OJDB 1UACL 4XBPA 2FEEL 3TA3D 4M61A 4O9HH 1UG9A 5C0GA 1WGOA 1CDCA 3TBTA 1FRGH 3Q5TA 4JFOB 4X9FA 4Y8DC 3HC3L 3HC3H 3KWWB 1F2QA 1ZHNB 1FRGL 3FQNB 4IJ3C 3RIFK 3VG9C 1CZ8L 4HKXA 5TPWH 4O9HL 4FFZH 1UZ6F 2AJVL 3VH8B 1HQ4A 1CL7I 3ZYZA 1UACH 4M1GH 5E7BA 4ERSH 4N1HB 5LGHL 1D6EA 3QFJB 4JG1H 4TUOB 1S5HA 5D7JC 4BH7A 1MPAH 2C3VB 3I02B 3T0WA 4POZC 1T6VN 1T03L 1NLBL 5C09D 3L3IA 2ZPKH 2DQGL 2AJXH 1B6UA 3NCEB 4D94A 3ZE2E 2OM5A 4F9LA 3LPGA 1EBPA 3RQ3A 2E5EA 5J06A 5GGTA 3CFCH 1HINL 4LL9A 3RVVC 1RUMH 4Z7UE 5D6DC 2DQDL 1IAIH 2ESVA 1DJSA 3AM8A 1CFNA 1CS6A 3T65A 1GC1H 2ZWLT 3K0WA 4FQ2L 3B9AA 1VGKA 3UO1L 4JY6B 1GXEA 2H1PL 2ICEB 1FP5A 1P5UA 5FGBA 1AGEA 1F3DJ 3MPCA 4HS8H 3B6SA 4LCIH 4ZDHA 3WXWH 5ID0A 4X4ME 4JJHA 5FUOL 4UINH 1JGLH 5HYIA 5ANMA 1XZ0B 3ULVH 5J6HB 3OAYK 3KPSD 4R96B 3VD3A 5HHME 3NA4A 4WI2A 3ZKSD 2MWCA 5E2JA 3C09C 4F7MA 4JM2F 2IBBA 2O5XH 1BF8A 1G7IB 1LE5A 5I8CA 4LF3A 5L2KE 3DRTA 1UM6L 3DXAB 5HYQB 5D7SH 3QXUA 3D85A 2Q8AH 3CDFA 3MRHB 25C8H 4AH2B 3QO0B 2MHAA 2NTSP 3VD4A 3S9DB 1F3RB 1GL4B 3LKQB 2EIZB 1YMME 3L5IA 3WBDA 1H8NA 1QVOA 2DLTA 5GSVA 2MPAH 4UT9H 2CUMA 5E00B 2NY7L 3EOAA 3ROOB 3FTGB 4N5ED 5I1GL 3B9KB 1AGCA 1W8NA 4P5MB 2BY3A 4GO6B 4EDWL 4ZTOH 4NO2A 1BQHG 5GRZA 3CVIH 1MFEL 5FCUL 5I18H 4FZ8L 2O61B 2RB8A 1GPOH 4QF1A 1BX2B 5HYFA 3HRZA 3O8XA 2MJWA 4X7EC 5GJSL 1H3TA 1LK2A 4O58L 3QQ9D 4M6ML 1RJLB 4PBVC 4CMMA 3MRMB 5C0NC 3X12A 1NMCB 3QCTH 4OD2A 3EYUH 4OLZH 2FEDD 5FYJL 3WO4C 4HK3J 4G6KH 3ZT7A 1J7VR 1LQVA 1R3IL 1FORL 2F8XC 3VXUE 3D2UB 2XA8L 3ARPA 2EEAA 1DANT 5IQ9A 5DURB 4RWYL 2VERN 3QDMA 1NAMA 5K9OB 4QO1A 4LCCB 2DD8H 4KROC 1I1AC 2BNRA 3Q3GB 2Q3AA 4XP4H 4JM2A 3MRKB 2WWMC 2HTKC 4FTVA 4JQVC 5BV7B 3P77A 1ZE3C 4HWBH 3MLYL 4BZ2H 1M05A 1QQDB 3WN5A 1BD2A 4NN6B 1QNZH 3WNOA 4PJDB 5GGTL 3WNKA 4EOWH 1MCRA 4UOW0 3OPZH 1F3JB 4OCXL 3PWPB 3QIBD 2FL5B 1S8DA 4Z18A 4PJHB 1R5VB 3STLB 3A6CL 1S7WB 2UVFA 2W0LA 4HAFA 1KB5L 1Q9KA 1V3MA 4JFHD 5JA8B 3JBG7 3STBA 4ZTPL 1N3NA 1L6XA 3I2CH 1MRCL 2Z91A 3VXRA 1B0RB 2A6KA 4PS4H 1CQKA 3QWRA 3TYFA 1ZA6A 4YPJA 5E8EA 5F88B 5LG1A 3RA7H 3DI3B 3VXQB 3QO0A 1KUMA 1G7HB 4PGJA 43CAB 1JFMA 1KBGH 2FHFA 3CXHK 2E9BA 2DTML 2JELL 1QVOB 1YA5A 4MXVE 1Q9LB 3OKEA 3LN4B 4NO3B 5IK3A 3QEUA 3PWNA 1C5BL 2EE3A 4NT6A 2NY4D 5B3JF 1FGNL 3EZ8A 3NCBB 3H0TA 4LLDB 1FZMB 3NA9H 2BNUB 4C56A 4MLSA 1LO4H 5D5MF 1HNFA 1IEAB 3UCRA 3SE4A 5DVMA 5I0DA 4G3YH 1JZ3A 1MF2H 1ZT1B 2YD1A 1JBJA 1YPZA 4DZBB 4Y4KD 4XP1H 4QYOB 3R8BB 3IDJA 2D3VA 4X5XA 4NQTA 2FWOB 1RJLA 4LCUB 4CMMB 2N1KA 2FJHA 1T0PB 4OLXH 5DO2D 2A6IA 1PVHA 3QG7L 1KIPB 3TEUA 4ALAL 4FFVC 4WTXA 1RK0B 3IYLW 1J8HB 4OCYL 2UZYB 1P2CA 4XTRC 3ALPA 3MR9B 1I4FA 3W5NA 4K3DL 3LEVH 3PJSB 4JHWL 1VFUA 2GHWB 3EOBA 4L1HA 4WWKC 1SM3H 5E94A 4JFHE 1YEDA 2ZCKL 4FQHA 4UZGA 3D0VA 2FD6H 2OMBA 4R90H 3RDTB 5I71C 1IGCH 2JCCB 4MAYD 5MERB 4LSRL 3AXLB 3MXVH 4YXHL 4WRLA 5KVGH 4NM8L 1HH6B 3OX8B 1OGTA 1JP5A 4V1DB 4Y7MA 1BBDH 2FBOJ 1RU9L 5ITBH 3NGBB 4O2CB 2I9LA 1VCAA 4HUWA 5IB2A 4Z7VA 4UV7L 3C9NA 2Y6SD 3NIFF 2OR7A 4X0KA 2JJUA 1KXTB 4JFQB 3TBVA 3REVB 4YGAB 5C09E 3L3JB 2R2EA 2CRIA 1A64A 4HJGB 1YEKH 4UTAH 4O2EB 2J8UA 1E6OH 1WC7B 4U0QB 3IFPB 3O6FB 4JGMA 1NBQA 3OTTA 1DVFA 4W6XB 5HI5D 3S4SA 3TYFB 2R4RL 1U95A 1N4XL 4JKMA 1SBSL 3HE6B 4NPYB 5IHUH 1C1EH 4KRLB 2BDNH 2YD7A 3G04B 4UNTA 1A7PH 3LPWA 5C8JB 1ZVHA 4XC3L 4ZFZB 4N5EA 1N5AB 2VN7A 4MB4A 1NBVL 3CFIC 3NZ8A 4HWEL 2YRPA 5E8DH 3IJSA 4QTIH 2JB6B 3IVKA 5C0DB 2PTTA 1OARH 1F13A 3L3DA 1NH6A 1Z9MA 3NACL 2V9RA 1MAMH 1A8JH 2DQEH 3HC0A 3X14B 3VD5A 4PJ7A 4JANB 2V5RA 5HVHC 5FYKU 5J0BA 3JUZA 4GMTH 2WWMD 2ESVD 1MAJA 4AMKL 1GYAA 1CU4L 3PWJA 4QYOA 3QDJB 5C2BH 4JO4L 4PJ9C 5IEHA 1WIOA 3HAEG 4OZHF 4DKEH 1CTNA 1CK0L 3WMSA 4NKMB 2YC1A 4UIKL 3HI1A 5BS0D 4HK0A 2GAZA 4I3RL 3VCLA 5FF6B 3NAAL 3RNKB 1A7RH 2ENYA 2VE6B 5DK2A 4X4XA 3SGDH 2VR5A 5A3ID 4PV9B 3JV6B 2SEBA 4CAGA 2GT9B 5GXBB 3VJ6B 3NIFE 1WCBB 1R24B 3HZYA 1F4YH 2E6QA 4G80B 4Y4KA 4MZ2A 4GRLC 5HXMA 3MV7A 4KRPD 1HHKA 3IDXL 3UDWA 2D4FA 4YO0B 3S88H 4APQD 3Q5OA 4XCYA 2ZNWA 2IADB 5JW4M 1PG7H 5C71A 1ADQH 4LHUG 2PCPA 4M4RA 3GUTA 5HYEA 2AEQH 1F8TH 4HG4K 4EXKA 4EDXB 4MGXA 1R5WB 1U8QB 2A9NH 1KCVL 4AIOA 4DQOH 2VKWA 4XNXL 1G6RL 5JPNB 3EFFB 3FQRB 3U0PA 3HAEH 2HKFL 1MFDH 3QIWA 3MODH 3O6KL 3RWDA 3OKLA 5ACZA 4P2CG 1Q72L 2PETA 1A7NL 1YUHB 1D9KA 1PX4A 3OGOE 5HSFA 2HLAB 5FV2A 4I0KA 1WF5A 2ADIA 1AR1D 5AD0B 5JW4Q 2P1YA 1A6VH 4PRDA 1QFWH 5EA0L 1ZSDA 3VFTA 1F4WL 3C8KB 4KXZH 2ZUXA 5D1XA 5D7IB 2FSEB 1D5MB 1QPXA 3GSNH 1MFBH 2OP4L 5F1IB 5GS0C 4FP8L 2QQLH 4OT1H 3PHQB 1NAMH 3R0MA 3QNZA 5EOCJ 5FHAL 4L4TA 2WP3O 1JI1A 4QRQA 1I7TB 2E9WA 3RJQB 1EMTH 4HQQL 5I2IA 4NP4H 2FJGA 4LPUA 1RZ7L 5CFHA 4NO5B 4FMKA 4ZPVA 4PY8J 1U8OB 3VXSE 2PTUA 1GIGH 3S37X 4FQ1L 3KDMB 1INDL 3C5SB 1KJ3H 4XPBH 1HXMB 2F5AL 3BN3B 5JMOC 1MQKL 1X5ZA 5EFIB 1KN4L 1UYWL 5JA9A 1Y18A 2F53A 2P8LB 2V17H 4NKDB 3F5WB 3VFWA 1WITA 3FN9A 4UQ2A 1JJUA 4QTHA 5MP6H 3PGFH 3BT2L 4AG4L 5C6WH 1FV1B 3L3KA 4CMHC 5HYJE 5ITFB 5KZCB 3LH2L 4XAKD 4ZUSB 3P0YH 1RZJC 1IKNA 4IS6B 5ENWA 3U1SL 1MRDL 4R7NA 4GG8A 1G6RB 3MRIA 1HILA 2PYED 5DJ8A 2XYCA 4MYWB 4L29B 3QPXH 2CR3A 1G7IA 3PGDB 4JR9L 2OTUA 3DXAA 1HXYA 4BZ1L 5B39B 1WBXB 3QAZB 4NQUA 4AH2A 1NAKL 2XQYK 5JW4R 1FNEB 1CGSL 2L4OA 2OK0L 1DLHA 2WZPD 3WKMH 4P99A 1U8QA 2FATH 4I8DA 4KZEL 2YRZA 1J5OL 3SDXB 1OTUC 1X5KA 3CXDH 5EO0A 3BEWB 1MI5B 3LEYL 1PYWB 2X40A 2HJLA 3U9UB 1TPXB 3EDDA 1QTYT 1NDGB 2EDWA 3H9HA 4U1JA 5KSAB 1JYVA 4KQ4L 4RBPK 3H3KA 4PUBH 1HCVA 1QHPA 5J11B 4W70A 4WWID 1JFQL 4XVUD 1CL7L 5IB3B 4WFHE 3IDUA 3MRGB 4KPHL 3MRLA 3W0WA 4U6YA 4KHXL 3C8KA 1QFOA 3RBSA 2YUXA 3KAAA 4WI5A 3MRJA 3BXNB 4V3DB 1AXTL 5BV7H 1UM5H 5J1TC 4IRJA 1TZHA 4JPWL 4NNPL 3R4DA 4PJEF 3ROLB 5I66A 5JHDD 5F9WC 3V7AG 3OKKB 3HUJF 3MLSL 1A7QH 4K94H 2RFXA 4N0RA 2ADJA 4TVSa 1B4JL 2VLRE 5CUSH 2XZAH 3PABB 3PV6B 1FAIH 2W60A 2HYMA 1TDQA 1NCDL 2BHUA 2CMRL 4KH2A 4MSWA 1DL7L 1YY8B 2IQ9H 1ITBB 1KPRA 4WUUA 4NYLB 4JM2B 3D39D 4ZS6C 2EXWC 3K80A 4NZRL 3N85H 4G7YL 4KUCF 3CFJB 4KQ3L 3UTPD 3G5YA 3TIEA 2YK1L 2AI0H 3E6HA 4JDTL 1JCKA 3QXAB 3AC0A 2FB4L 4UAOC 4OCRH 4GG6E 1FL3B 2CR6A 5L88H 3D0LB 1A0QL 4GXUN 1FYTD 1F97A 3D1MC 5INDA 1OGAA 4NQCB 4Z77B 3MXWH 1BMGA 2XZCH 2VXVH 3FT4A 3UPCA 4YEFA 1CICC 4GAYB 2GKIA 3U46B 1KCRH 2R0ZL 4G59A 4M5YL 2AEWA 4PD4J 3RNQB 2BSRB 3BESR 3CFDA 4JO3L 5GGUA 2DMBA 4NC0B 2VDKL 5BQ7A 5BVJB 1FAKT 5SX5H 4TUKL 3P4OA 4HPOL 4DFIA 2ESVB 4G43A 5L7XH 3QUML 3P2TA 2FRGP 5EDXA 1T5WB 2D31B 3DX8B 2JCCF 4DZ8A 1ZHBB 1UH3A 3OHXA 4HMEA 4AEEA 4NJ9H 4OV6F 3TNMA 2K7QA 3RGVA 4LSPH 4FQCL 1VACA 1MEXL 4NT6B 4NN7C 5FDYA 4YX2L 2RAMA 3BPLC 4OZFA 3X3FH 4HC1A 3VFRB 4WTZA 1K2DA 3QT2A 1BFOB 1AGDA 1IT9H 4XH2A 4OAWA 4EN3A 3O81A 2E8ZA 1QLFA 1CFBA 4X5XB 3ZE0F 4I9WD 1U2HA 4YXLL 4Y8AA 5E5UB 4P46D 4LGSB 2A83A 3IFLL 3NABL 1DBBH 3SDYL 3TFKD 4IOIA 4PLJD 1BAFL 2NLJA 4KROB 4J8RB 2VL5B 4M9OA 1BZ9A 4R26L 3K2MC 3GK8L 3SKMA 3W9EB 3O11B 3MR9A 5HHVH 2DJUA 4RRPG 3QA3A 4J3OC 4KJWD 2OMNA 4NQVA 4QHLA 3SDXE 2CIIB 2W9DH 3QWOB 4QHMA 4MNQA 3BGFB 3WNLA 5E9DA 4X6DA 2VSDA 4P2RA 3QQ9C 4IRSC 1JWMA 2HRLA 4OQTH 3MLVL 5JPMA 3FO2A 4JY5H 4MSWB 1WT5A 3ARSA 5K9JL 1YPZE 2AEPH 5AWNL 2AJUH 4GKSA 4UDUB 4O5LH 1FG2A 2OR9L 3ARGA 1YNTB 5IMLB 2WANA 1NGWA 2OI9A 3O2DL 2W65B 2XTJC 3CMGA 1F6LL 1P6FA 2JCCE 1HH9B 5CJQL 3MV7E 1U93A 5IVXE 1F2XK 5MEOA 4NFCA 2FNBA 3OXRB 3P30L 4HAGA 3U0WL 4RGOL 4OSUL 5HHMA 4EI5A 1RHHA 2HP4A 4I2XE 1ZT7B 1TVHB 1NBYA 2LV4A 2VXTL 4Y19B 1MLCB 2Q86A 3B2VH 1LO0L 5I1CH 5IF0B 2A74A 3N1GC 3BKCH 2V2TB 1I9RL 3ZDXF 1GGCH 2BSRA 3LSOB 5JDJA 3EYQC 3OB0H 3SE8L 1QOKA 4L4TD 2X09A 1VFBB 1VSCA 3RJDA 4YZFE 4DFHA 5AG8A 5JIPA 2CKNA 3WN5B 1T1XA 5TH2A 4PJEA 1T7ZA 3LRSA 4WI8A 1CF8H 4MJ5A 1NLDH 5DMKB 4F7TA 2EDOA 5IW3A 5DHVH 5SWSA 4YHPA 3PWPA 4PJ8A 2Y06L 3I84A 4WTWA 2LVEA 1AO7E 3C6LA 2VDRH 1OAYH 4XVJL 5E2WH 4KTDL 4JN1L 1UWGH 4PJ9D 1VPOH 3AY4C 4OZHB 4U6HA 4DAGL 3DGGB 5T1LD 2Z93A 2P24B 3HS0B 3TCXA 4BFIB 1OSPL 4TTDD 2Y7QB 3TBWB 3D3VA 3QYCA 2M26A 4G9FD 4PJCB 1XIWB 1CIUA 1T5XB 4NQCD 4HUUB 3OKMA 2ESVE 3THML 4NQDA 4OM1H 1QYGL 1A4JA 1K85A 4MNHA 5CIPB 1EEQA 1TQCC 2ICWB 3E2HB 2KKQA 1LE5B 1EV2E 1OQOA 2AJZA 4FQLH 4C56B 2J1KA 2F19L 1JPTL 4U31A 5K59E 1FJ1A 1U92B 2HT2D 4G8EB 4K55A 4ZO9A 4ODUA 2EDJA 3GRWL 1H9VA 1NFKA 3PL6C 2WQ8A 4LLUB 4Z7UB 5DO2C 3CPLA 5IP4A 2OJZH 2UUDH 2VYRE 2Q7YB 3SCMC 4FFVD 4EZMA 2BCKA 4H8WH 4EI5C 4NQED 1N2RB 4BJLA 4K8RC 4RAUA 1OB1B 1EGJL 4JAMA 1S7RA 5BZDB 4ZFGL 3ARGB 5J13B 4X7TB 2E3VA 5KSUA 1DCLA 5T3XE 5BW7A 1R5WA 2XV6B 5HGDB 2DDQL 1F45A 5T1KB 4WWKD 3LVEA 1NFDB 1CFVH 4YBHA 3VMNA 1F6AB 3O9WB 5C08E 1JZ8A 5GJTH 3SPVA 4HEPG 3FAWA 4D9LH 1E27A 5JR1L 1PD6A 5IT2L 4HJJL 4N9OB 1CI5A 4MAYB 2QHRH 1MOEA 2NY2B 5L2KB 1Q9OB 6FABL 1YEIL 3LN5B 5B3NA 1LILA 3BUTA 4F33B 5C0JB 5KVDL 4NZUH 1DQQA 3TWCL 4O2FB 2DM3A 1EA9C 1HIMH 1YMMB 4PRAA 4AQ1B 2EYRA 1JUFB 4OLWL 4JQXA 5J12C 4K23L 4ZXBB 4HGWA 5GRJH 2GTZA 4S0SD 4EVNA 4WV1C 1MREH 3RPIA 2J6EH 2KQMA 1QBLH 4ZNCD 4YHPB 4PJEE 1RUKH 1RZKH 3SJVD 2QBWA 2CLRB 2FJGB 1IM3B 4NSKB 4XNYH 2VZVA 4X7SH 1T04A 4X98A