3CPLA

Crystal structure of h-2db in complex with a variant m6a of the np366 peptide from influenza a virus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
275
structure length
275
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Complete modification of TCR specificity and repertoire selection does not perturb a CD8+ T cell immunodominance hierarchy.
pubmed doi rcsb
source organism Mus musculus
total genus 65
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cplA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3cplA01
2XTJC 5B4MC 1EVUA 1Q9WB 1WAAA 3M8OH 4HT1L 3U7YL 2Z35B 3UZQA 3W82A 3BKJH 5IB3B 5E2WL 2LAGB 1NCCH 3PWUA 4O9HL 5HTSA 4HX1B 1MJ7H 2AEQH 1FFNA 3D87B 4MQSB 3QHZL 4Z7UF 2BVUA 4HS6A 2CGRH 4KK5D 2IMMA 1HI6A 2IH1A 2R9HD 4OF6A 3E3QC 1M05A 2QJDA 2VKWA 5TF1H 3O6FB 1G7HB 1KPRA 1A3RH 3CLEH 5F89A 1K3IA 4Y1AA 4GQPH 3IJSA 3O9WC 4DUXA 1MRDH 3T65A 2QEJA 1MCSA 3O4LD 2AV7A 2MKWA 2HJLA 4O2FA 3S7GA 4LLAA 1KTLB 2ADFH 2R29L 5CZVH 1FL5A 3IAQA 4RAVA 5IVXE 4NDMB 1KCSL 2EE6A 4NQDA 2AEIT 3X13A 5IMOA 1YY8A 4P5KA 4NSKA 1LMKA 4EVNB 5DK2A 1G0DA 4YIQB 4WJ5B 5IEHA 4CN1A 4PRHE 4H8WL 4PRIB 5FOJA 2GEEA 4WEUD 2I9LA 4C58B 1DUYB 3FB6A 1YEEL 3QYCA 4RAHA 1YNKH 2H3NA 4LPCA 4FTVB 3VWJA 5BXFB 4YXLH 3B8SA 4Z76B 1LO0H 3BGMB 1VFOA 3AB0C 4PJ9D 4OTXL 1I3GH 3QUXC 3WDIA 3O3AA 4KUZL 3Q2CA 5CP3H 1FPTL 3KPRB 2VR5A 4M1CC 5SWSD 5T3ZH 1INEL 2PUQT 3O6LH 3OV6A 5ISZE 3WS6C 3VMPA 3JV6B 3BMWA 5BMFH 4ISVA 3SKJH 5HHOD 4XXCC 4Z7WE 4YXHH 2YK1H 5FO7A 4JCLA 2P43B 4I2XA 4YDIL 2K1MA 3Q5TA 4KDVA 4LKCA 1QFOA 1BQHB 1IKNC 4NM4L 4DCQB 4J7RA 1DANU 2A6JB 5E8DH 4YGVB 3KPSA 4QXGL 3QIBA 5F1IA 3F6LA 4F37K 1MCPH 2GSGA 1RZGA 2EEBA 4B41A 1GIGL 2PO6B 1FFPA 4LDLB 4B7IA 4CVUA 4MMZC 4NWTL 4HZAA 2C1PB 2X4QB 1D3CA 2XXCB 1EA9C 4KROB 3OAZK 2ICWA 3MJ7B 5EIQA 1NCDL 1BWMA 2COQA 3KPMA 1I8LA 3GMOB 1FLRH 5D71H 3RPIA 1ZTXL 3AFLA 3S36X 5HYJD 2CUHA 2XFXA 4N0UA 1E0OB 5BV7H 2P7TB 2FO1A 2EDDA 4ZUUA 1MFCH 3UJTH 2Z0BA 5F96H 5D5MF 2FLRT 1H3TA 1NDGB 4HIEA 4HCRA 5F3HB 3MRFA 4NJ9L 5IHBA 4AENA 3GI8L 4O02H 3GSWB 2DQGL 3WSQL 2CDEB 5I9QC 1U9KA 2VDML 3WFCH 4LRIA 1BOGB 4YO0B 5FUZH 3C5JB 1EO7A 1RZFH 4N68A 2O61A 1ORSA 4U1MA 1URLA 4DW2H 3WNKA 1AHWC 3DXAB 5TE6L 2HJKB 2EDQA 3ZDZF 1MHCB 3GBML 5MP6H 4WO4C 2XA8L 3IDGA 5JZ7D 5DJDA 2FEDC 1BF8A 4G43A 3TC9A 4F57H 1VHPA 1LQSR 3H8NA 2VLRE 1QSEB 1I8IA 3LN4B 4CU8A 4YDKH 1R3KB 2DBLL 3AS1A 3FO9A 4PJ8B 5A2LH 4QRQB 4XVSL 2BC4A 4B53A 5FKAB 4GG6F 4M7ZC 1HILB 3GMQA 5E7BA 4PJXE 5EOCH 1Z9MA 1NFKA 5JPNA 1K5NB 4JB9H 5AZEH 3AAZA 2OK0L 2K9UA 4JO4L 4Z7UE 1OAKL 1OM3L 1J0IA 1QLRB 1QOKA 3U36A 4HUMB 3TPUA 5CIPA 2C4FU 2W9EH 5I17A 3GO1L 4XPBL 1HINH 1YC7A 4MNQE 2XT1B 2YUZA 3O6MH 5D7JD 5DT1H 2NW3B 5IEKA 7CGTA 2MKLC 3MV9B 1CFVL 2CMRL 4XNXH 1AP2A 4F9LA 2H1PL 4PS4L 4OGXL 3CX5J 3B3IA 1JGEB 1FG9C 4HKBA 1XGUA 5LWYH 1SM3L 2ZUUA 5M94B 3MLYH 1CE6A 4WEBL 3EDEA 1IGTA 4K8RH 1KXQE 4IOFD 4U0RC 5C0IA 3CCHB 3O45A 4I0PB 2A9ML 4ZSOB 3V5HA 5LBSH 1LO3L 4NNXA 5IT2H 3G5ZA 3QFJE 4YC2C 4ZUTB 4PJ9A 4E5XB 2R2HA 1Q38A 1UM5L 1J5OH 2YBRA 1TDQA 1N59B 4NQSA 5SWSA 1T20B 1JE6A 3BZFB 1KOAA 5F7NC 2E7BA 3RWDB 1KIQB 1BP3B 2YD1A 1VKXB 2J2ZA 5L9DL 3ZTJG 3RWHA 1RVFH 2XRAL 1IAMA 3MCKB 1G6RH 1MRCH 3U0TA 1MHEB 4XPHL 1PKQE 1P69B 5EOQH 3IXAA 1H3WM 2QADD 2UWEB 1NCBL 3QG6A 4IRSC 3CFKA 4BJLA 3MLVH 2AQ3A 1SMOA 3GNML 3QI9C 4FXKB 4ZOBA 5JXAL 1H5BB 1BM3H 4BK4A 4YHNA 4AH2B 4EI5D 4ZUSA 3RIAK 5J13C 2FCBA 4AL8H 3F5WB 3F8UB 1CFTB 4YAQB 1H0DA 2BDNL 4HUVA 3P4NB 2Y5EA 1F5WA 3WFHB 1FG2A 1UB5A 1INQA 1AD0B 3SDXF 2OJEA 4L8SA 4JR9H 1WLHA 3U46A 1B0RA 1BJ1J 4MQTB 2OBGA 4XH2A 4OZGB 2J12B 1IM9D 5CFHA 1BIIB 1FL6B 5HYJA 5ACZA 1Y6KR 2F54D 3SGEI 3QHTC 4HUKB 1S7XB 3G9VA 4KXZI 1ZE3C 4KJYA 4MS8C 3VXTA 4XWGH 2WBJA 2V7HB 3C2SA 3CDYA 1CFQB 3KPPB 2XN9B 5C7XL 3HMWH 4QY8A 1RJLB 4HZLB 1FZJB 5ERWA 4D0DB 1EHLL 1FO0B 3GEWB 3OKMA 5B21A 3TO2A 4QYOA 3RWJA 1NEZB 3PHOB 3B2VH 1F6FB 3PWJA 1O7VA 3GBLA 4BH8A 3ZDYF 3FQRA 1ND0B 1BHGA 3S9DB 2YD5A 1QNZH 4KV5F 5D5ME 3EAKA 1KXVC 2XV6B 1CYGA 1DLHB 4OIIL 4A6YL 3UTZA 3KPSE 1T21A 2AAVA 3V5KA 4K23H 1KJVB 5IIEB 1Y0LB 3KPOB 1D5MA 2EIZA 2D4FA 2OJZL 1EH9A 5IFJA 4ODBD 1U8IB 3VDBA 4M9OA 3AY4A 1EEZB 1A6TB 3ZDZE 5KJRL 4HWBH 5LXGH 3IFOA 4FFVD 3KLHC 1FVDA 4I0KA 4IMKC 2VLKE 4NQEB 5IMMB 4MJ6B 1RZIA 4HPYL 4OQTH 2RFXA 3O2DL 5GS1A 4YE4H 4LGRB 1C5BL 2K7PA 4WNQA 2OTUA 3TIDB 3VXRA 3L3DA 4L8DA 4MVBA 3TFKD 5D93B 4ODHH 4GG6E 4NUGL 5ESQA 4NO0B 5D7KE 2FATH 1FJ1A 2CUMA 4NM8L 5D7JA 2L7JA 3R8BB 4QHMA 3DBXB 5EC1A 3RDTD 1KT2B 3TN0B 5K33A 2B4CC 1UFUA 1VB9A 1YECH 2YN3A 2A74B 2DI9A 4OZ4B 4RRPG 3L6FA 4KJWC 3R8QA 5MENE 4LCWD 4ODTL 2DQFB 5EU7C 5IK3A 4NO5A 2EDEA 1UVQB 5JA8B 3GMMB 5LGJB 1P6FA 2WUBL 5I1AB 1BJMA 3TO4D 5FO9B 4S1DC 4BFIB 2X4OA 1JI1A 3B9KB 3OAYH 2H8PA 1HHGB 1YNTA 3CVHH 4HGWB 1MWAH 1X5FA 3N1FC 4RAUA 3OL2A 4N0FA 3M45A 2W07A 4M6ML 1IEAA 1F8TH 4EDXA 1G9NC 4LEXH 1AC0A 1X6LA 4EXPX 3HRZB 3J7HA 3MFFB 4DEPB 2IPKB 4QWWD 1VACA 4GSDL 2YR3A 2IEPA 4H26B 5H37H 5IHUL 3ZYJA 3FTGA 3OKDB 5EO0A 4LSPL 3TBYB 2BNRA 4RMRA 1T1ZB 1YUHB 4A6YA 4DZBB 3BZ4A 4I3RH 3MRPB 4KRMB 5DD3H 4G7YL 4L8BA 2YA0A 1AKJD 3QDMD 2X4SA 4W6YB 2C7UA 4PJGF 1CG9A 2EDJA 1LP9B 3REWA 3O4LE 5DVNA 5JMRA 3PDOA 2GCYB 4TSCL 5DVOA 3BGFC 4R7NA 3DVGA 4GKZA 4RA0C 1ONQB 2BP3A 3LEYH 3FMGL 4BUGA 1A7OL 2J8UB 5BV7B 5IHZA 4HK3J 4Z7VB 2IFFL 1GOHA 5DLML 4CVXA 2SEBB 4WI4A 3KDMA 1OSPL 3NTCH 3GSOB 1IM9A 5CJQH 4X4YB 4Z7OF 3SDYL 4LSRH 1JPFA 3UYPA 1MI5D 3BGAA 1X5LA 4XCNA 3A6CL 1I1FB 3SDXE 5C0JA 2VSDA 1I1CA 5KSAC 4PP2B 4Y19D 3X12B 1WCQA 1AXIB 2VZVA 1JHLH 4NHUA 4LLMB 1W0VB 4H1LH 4NZRL 5DD5H 2I5YL 4GRMA 2Y07L 4G3YH 4N90E 4YBQD 5DSCB 5SX5K 4HUNB 3WXVH 4MAYA 5DDHB 3WHXB 4WV1A 2RAMA 2VXTL 4QO1A 2X4RB 1QSFB 3WS3A 5FA3B 5HHOE 1V8HA 1I3UA 2ZCLH 1AY1H 4ELMA 3W2DL 3QWRA 1DLFL 4P3CL 3C2AH 2F5AL 5GRWA 2DMCA 3W81A 5EA0H 2DQJH 1A7RL 2XY1A 3ZDYE 2DD8L 2HG5B 3I6GB 3UC0L 1V7NH 4KV5E 3PHQB 4KRPB 1MH5A 2PKDA 5FIEA 1WJ3A 3BYTA 4KH2A 3SDAC 4BYHA 5D1QD 5EZOL 5HVWA 4YHLH 5ITFA 1QR4A 4KZDL 4KTDL 1L7TL 3EZ8A 5DWUH 1IC7L 1QA9A 1NUNB 3BP5B 4PG2A 3UPCA 3FQXB 1L0QA 4OCRL 4Y16D 4UT6H 1LK3L 5L7XL 5D9SB 5HYJE 1JGVH 3RNKB 3P77B 1BVKA 5GGTA 2VUOA 4TUKH 1EZVY 4WCYL 1RZKL 4OV6F 5I71C 4BQ8A 4V3EB 2XZCL 4DGIH 5C6WH 2B8OT 3R4DA 4TSBL 2Z92B 5FYKU 1TPXB 3HCVA 4WI2A 5IJVA 3L5XH 5SWQA 1UWEL 1Z9LA 4LSVH 1AH1A 3MNWA 3EOBA 1RPQA 3QEQB 1SBSH 4KKLD 1DJSA 4HULB 4OUOA 5T1KA 2VDOL 1HIMH 3TM6A 2FBJL 5T5NG 3SDDB 1KCUL 5IR1B 2VB5A 3KXFB 2D03L 2Q76B 5DXWA 1ES0B 1T0NB 4GXUM 5CBAA 3LHPL 5DGQA 1BBJA 2MPAH 1T66D 2VRAA 3HNSH 4Z7QF 1CXIA 5EUOB 3WO4B 2FSEA 2KH2B 4LCWA 1IAII 1BZ9A 2R0ZL 1T89C 3O3BB 5I76B 1VDGA 3FOMB 1I9JL 1RIHL 3BKCL 3SKOB 3DSFL 3HLAB 1DQMH 1X5IA 2FX8L 2QHLA 3QG7H 1D7FA 4D3CL 4DWHA 1FV1A 1CZ8H 5EU6B 1G6RB 4C56D 3MA7A 1LNUA 3ULVC 1DQDL 43C9A 3V6ZB 3IDMB 1QQDB 5HHMB 3HUJB 5CEZH 3VE0A 4XCYA 1TVBB 1PLGH 5E6ZA 4APQB 4M5ZL 1PY4A 1CQKA 4DQOL 5TE4H 3FO0L 1YPZF 3ALPA 4PJ5D 5JTWA 1ZHNA 3HC0B 4OT1L 5IOPA 1AKJA 1FNEB 3BIKA 3HR5B 3QDMA 2C9AA 3TCXA 1AE6H 4MB4A 1ZWIA 1KELH 2BRRL 4DKFL 4G6KH 3N0PB 3C6LC 1T5WA 2Z31D 5I1IH 1HZHH 3OR7B 2HTKC 1U2CA 3JXAA 4WW2F 3EHBD 4NN7B 5I66A 4PV9A 1DL7H 4N5EC 4PJGE 4LASH 1CL7H 4K3DL 2E9JA 1OAQH 2XG4A 1VGEL 3HE6C 4V1DD 3HE7C 1I3RA 1JGDA 2ZWLT 3T2NL 3GJEB 1NBYA 1LE5B 2EKJA 3N50A 4J4PC 4RMTA 3PXJA 5C86A 4M3JA 1MPAH 1MI5A 5AZ2H 5ID1B 4FFWD 3DMMD 3L3GA 3LRSA 5CEXB 1H3PH 1RU9L 3WDHA 3VFWB 4Y19A 4MJID 4HKJB 1I9IL 1QFPA 4Z7OE 2R0LL 2QKIA 3NCJL 1BIHA 4YHMH 4WUUA 4JKPL 3OZ9H 4L3AA 2FGWH 3FCTA 5INDA 5C2BH 1W0WB 3FT2B 5GGRA 5CGMA 3HNVH 4XGZA 2MQ3A 5IW1A 5KVDH 5BVPL 4OF7A 4PJDA 3V4VH 1TZHB 3WNMA 1EEYB 1R3IL 1MREL 1ZLVK 2OTWA 3GRWH 2G2RB 4Q2ZB 1H3VA 3SJVB 2X7LA 1QZ1A 5ECJE 1QVOB 5FECA 4U1IB 4R4FL 4L3CA 3HNTL 4FABH 2E27L 4NN6C 4X98B 5D1QA 5F88B 5GRYA 1ZLWH 3C9NA 1NSNL 4XPGL 4NKQB 5A2IH 4JAMB 3BE1H 4Z0XB 3OB0H 2BY0A 1RUPL 4OD3L 3GKWL 2NY5L 1VENA 3BISA 1S5IH 2F54E 3PF2A 3U7AA 1A47A 3WN5B 5D7LD 3TBTA 1FNFA 2R0KL 5IVNA 2J3SA 3QJHB 1OGAD 1E4WH 3G5YA 1JZ5A 1PYWB 5C07B 3ZZ1A 2DRUA 2JJSA 5IG7A 3MGTB 4N9GB 1KJ2A 2HYMA 1DQQB 3DUUB 3Q3GA 4IBLT 3T4AA 4J8RB 4RMWA 4FQXA 1T5XB 5K9KB 3VXQB 3BHBB 3TVMD 3BN9C 3QO0A 3UPAA 3UBXB 5DJ8B 4LVOB 4JE4B 5J1TC 3WIHL 5AWNL 1FIGH 1NMBH 3FAXA 1NEUA 1J12A 1EFQA 1MWAB 3CVHB 5FCUL 5EO9B 2EDLA 3WD5H 1KACB 4ZFGH 4NKOA 1VADB 4KI5D 5TFSH 1OSZA 3D9AH 3W11C 3OHXA 2DQUL 5IB5B 5H94A 3REVA 5H35B 4M7LL 3WIFB 4KKAD 2V7NA 5DJYA 2EDRA 4HF5H 4LEOA 4Z7QE 1AFVL 3EYQD 3VFMA 4AY0A 5DD1L 3P40A 4C56A 2FRGP 1D5ZA 1FNGB 3ULUL 2GUOA 4HXBH 1C5CL 2PYFA 4LRNL 4CJ0A 3TF7A 1EO8H 5DTFA 3QHZH 4YHOH 4CADA 1GZQB 1F3JA 4F7PB 4DZ8A 5F7HA 1QLFA 4XNUL 1I1RA 2CIIB 2IJ0C 3ES6A 4PJ5A 3A0OA 2DLHA 2IQ9H 1JYWA 2H6PB 2H41A 5IVXB 2DTML 3SKNB 2ZCHH 1KPVA 1A7PL 3OKLB 1MIEH 2W91A 1BGXL 5DMIH 3QULB 4KRLB 3VMNA 5E1HB 1YPZE 4HWZA 3EO9L 4Y4FD 5C0AA 3RAJH 3T0XA 1JV5B 5EOCJ 2BERA 2FNBA 3QAZB 3MGAA 1I8MA 4U1NA 3WDJA 4DFIA 4LCWE 1IGYB 1W72L 4V1DA 3I6LD 5FXCH 4IS6A 2E5EA 4H1LB 2DICA 4FQ1L 4MXQD 4XP9L 4UNTA 4AMKL 1LO2L 3JWOH 4JFEB 5IVOA 3IETA 1A7BA 4LLQA 3A67H 1R24A 3CD4A 4D0CA 4X7SL 4D2NA 3EFDL 1RURL 3OKNB 2NY4C 3BP7A 5HHNB 3L95A 1IE5A 4MJIA 2AJVL 4HPOH 3QO1B 3P9MA 2AQ2A 3IF1B 1OY3B 3CPLA 3NA9L 2A6KB 4KUZH 1FVEB 3GHBL 3ARDB 1PZ5A 2CLVA 2X4PA 1ZT4B 3S3JA 3VDAA 4PJBF 2GHWB 2UVFA 3QRGH 3LKNB 2WUCL 1DBML 3G08B 3IDUA 4EN3A 3H3KA 3WLBB 1CGUA 5JHDD 3AREB 4GXVH 5M7QA 5GS2D 4QXGH 2KQNA 3IFPA 4EI6B 1IZJA 4RISH 3ROLB 1NMCB 3IVKB 2K3TA 4GMTH 3ZE2F 4ODWB 5CSBA 4PGCA 3QUZB 1NKRA 4HJ0D 4UT7L 1WZ1L 3LV3B 4M1DH 1AGBB 4GRLB 1T2XA 2F58L 3RL1B 2YWYA 3DROB 1OGAA 4HIXH 1FN4B 3QQ9D 1DBJL 2JJVA 2A73B 4Y19E 1FLTX 3ZMRA 3MR9A 4MA3B 4M61B 1AGDB 1I7ZA 2WIIA 3TYGH 3SE8L 1RUQL 4HQQL 3NAAL 3T1FB 2HFFA 4FQJL 1EMTH 1N0XL 2XTLA 3IKKA 5E4IA 2DQDH 1XGTA 1NQBA 3GGWA 3U4BH 3STZB 1KNOB 3EYFA 1F13A 3FN3A 4PJDE 2YD2A 2DBJA 4HAFA 3VFSB 2JCCB 4X6BA 1VEOA 2HRLA 2XYCA 3LDBC 5EC2B 4WW1B 1KLUB 5JPMB 3I2CL 4FQCH 2AJYL 3MV8D 3TT1L 3VXMA 3WNOA 4QXWA 3ZKXB 4YHYB 2A77H 3Q6FA 4MDJB 1Y18B 3ULUF 3FO1A 3SBWC 3QXDB 4J6RL 6FABL 5TE6H 2VLRB 5D1ZB 2XQBL 5E08L 2D7MA 2FX7L 1T1XB 1UQSA 4ELKA 2FJGA 4JFDA 1P4BL 2E8YA 4LDEB 1U36A 3V0VB 4LLWB 3V0AC 3QDAA 2GY7B 5DHVH 1IAKB 1K2DB 3VWJC 4LQ1A 5LCVH 3QXTA 4J1UA 5BS0A 4WFFD 5E99H 4XVTH 2CRMA 4UUJB 5FYJU 2O5ZL 3W9EA 2JIXD 3E6HA 4O58L 4Z7UB 4NQXA 5TGBA 3FRUA 4M9PA 1JZ4A 4P5TD 4U2ZA 2AEPL 1AR1D 4XAKD 3MBXL 5IBUB 3X17A 3RZCD 3WXWL 2BVQA 5LQBL 2ERJC 4ZS7L 5AAWA 1D9KD 1LHZA 4BZYA 1FAKT 4N8PA 1OM3H 1KEML 3LH2L 3BP4B 4OI7A 4ZTOH 1NGWB 3THMH 4JO3L 1LEKA 1XGRA 1XCQA 4Y4FA 5C92A 3HC4H 4NWUH 2DIJA 5IB4B 4R7DA 5E00A 2OSLA 4KJQC 3FT3B 4NFDA 1AQDB 1OGTB 4OCLC 3MACL 4MXQA 2R0WH 1ZT1A 3L1OL 2GK0A 2CXGA 5C0EB 3TWCH 4JPKL 4KWUA 4OUUA 1M6OA 3UTOA 2Z8RA 1CFBA 1JCKA 5BVJA 1XF5A 2DTSA 1I8LC 5D2LA 1QR1B 3ETBF 1G7QB 4XNMA 4C56E 5I74C 2V5RA 4OGYH 4M8QB 2F53E 5EU3B 3S4SB 2CR6A 5DJXB 3C5ZD 1WIOA 5J6GB 3EJYC 1JPGA 1PKQB 5D7IB 1RUAL 1HHKB 1G7MB 2F8XC 2KBGA 4YBHA 1WIUA 3MO1A 1OAZL 1IVLA 3O8XB 4QRPD 4PJ5E 5GGVY 3UYRL 2CKBL 3PQYA 1FYTD 2WINB 4X4XB 5J6HA 3Q0HA 2JKXA 1PSKL 3TBVB 4LRIC 4AK1A 1B4RA 5F7FA 4K94C 2UUDK 2R56L 5JLZA 3V5DB 2K7QA 1CBVH 4F7EA 3P73A 4MJ5A 5EBLB 3QQ3B 5LJYH 3RUGB 5DMYA 5E94A 3WJLA 4NRYA 3LZFL 2DN7A 3UAJD 4LCCB 1BAFL 4NNPH 3VA2C 3EKCA 2UZXB 4WWKD 2V6HA 4NQCA 4BKLB 2HWZL 3I6KA 3O41A 4HUUB 5KS9F 3VFRB 2V5TA 3CDFA 3O0RH 3NFPA 3X11B 1L6XA 2GK2A 3S6CA 3GMRB 3ZE2E 4EJ1C 1S8DB 3G5VA 3ROOB 4RGND 2J5LB 2XZQL 4MJIE 1E4KA 4F15C 4G6JL 4KK5C 3KVQA 3RVTD 3B83A 3QNXB 5D5MB 1EHLH 1G0YR 4JG1L 4S10A 1S7QB 5L6YL 1ZVYA 5FDYA 3DRQA 1DFBL 1NL0H 4HGMA 2IPTL 2XTJB 1YEDA 3WL9A 2FO4B 4GAGH 4F33A 1CGTA 5CMAB 5DFVD 3NGBC 3JUYA 2DQTH 3MV8A 2V2XB 1JJUA 2X40A 1CXKA 4L3EB 4LSDA 4PRPB 4F9LC 4XWOC 1GZPA 3JTTA 3VFNB 1YMMD 5DVMA 5C09B 1J9CT 5FYKD 1A4KB 1Z0MA 5FOBB 3KPTA 4IM8A 3F58H 1I4FA 4XPTL 3MLXL 4XHQA 5ID0B 3ZE0F 4P2RB 4NC1E 3RTQD 5DJ2B 1V7MH 3LOWA 3ULUE 5JW3H 2DM3A 4OIBA 3T0VA 1REIA 4OLYL 4NZUH 1LEGA 2D7PA 3EO0A 1KEGL 1B0GA 3ARGA 4KKCD 4PJ9C 3L3JB 2JIXA 5D7LE 3HAEH 5EO1B 4BH7A 5C6TH 4MQ7A 1B2WL 4P5TA 4HLJA 4GG6B 3U7WL 1N4XL 1N6QL 1FDLH 4DVRH 3VXUB 5ACMA 5FYLD 3SPVB 4JM2D 4X6EA 3FQTB 4OLXL 3VGAC 4U3XA 4X7EC 5CCKH 5HDQL 3DO7B 1UCBH 3MX0A 3GJFB 5IV2B 5GIRA 4ODSL 1RHFA 1J1OL 3S34L 2DL9A 4KTYA 4HUWB 5HI5C 5MENB 2XZAL 3VXSA 5HVGB 3GIVA 4AQ1B 3V0WL 3MMEB 1CDUA 3CDGB 3BUTA 1QYGL 3D25A 4NPYA 5EWIH 1F11A 1MQ8A 1UKQA 1YEKL 2LAAA 4WGVB 1G7LA 2Q7YA 4X7TA 4QRTA 1DBAH 5C08D 5EORH 4WU5B 4K7FB 2IBBA 4L8SC 5FYKL 4UQ2B 1HXMA 3EDJA 3PP4H 5HHPB 3V79C 4ONHB 3JTSB 1YYML 3TNNB 4PJIA 3ZT5A 4DVBA 3AM8A 3EOAA 2JK5A 1XCTB 4M6MH 2P8PB 2WBJC 3C5ZA 2NY6D 3CK0L 3WKNA 2FZ3A 2NY0D 2ZSWB 3AMLA 4ZUWB 2ED7A 3TA3D 1U3HB 2YXFA 4GSDH 5KVGH 3P2TA 4QRPA 1MCFA 1BQLH 4LSPH 3O4LB 5FYLL 4IEFB 1JI2A 5F7LB 3V8CA 3W9DB 2VXUH 3KYMA 4H20L 3MGOB 1ZHLA 4ACPA 4GUPA 1I3VA 5I73C 1H3XA 3BT2H 8FABB 1UEYA 4X7DC 4MXWL 3Q6GH 1WBXA 1ZGLM 5JO5A 5I1HH 4XMKH 4WEMB 1KCVL 4QRRD 3LQZB 5IQ9B 1ACYL 4P3DA 4QTHA 3MCG1 3O3EB 2VIRB 1UXWB 2P8MB 3I6LE 3NIFF 5I1EL 2IFFH 3GK8L 1CK0L 1YQVH 3SDXB 3WIIL 4ODVL 4ZO6A 4E41B 2HLFD 4KK9C 3AY4C 5ITBL 4AT6A 4WGWB 5DC4B 4DK6A 5KW9H 2G5BB 2YN5A 3SDYH 5D2LE 1GC1C 1NGZA 1PBYA 3DVNA 1G7IA 1IFHH 2P8LB 1S7UB 4I18A 1AQKL 2ARJA 2J7LA 4QRSB 4U05A 3NCMA 3K80A 5KS9E 2R69L 1OARH 3RU8H 5LVEA 3VA6A 2I5YH 5E4EB 3E2HA 4L1DA 3RGVD 1AHWB 2Y07H 5ADPH 5HYQB 5DUPL 2YKLH 1NCNA 1BVZA 4MVBC 1OAUL 1EERB 4O4YL 2R2EB 3OXRB 1ZEAL 3GSUA 3QPQD 1XIWD 3CC5B 4PJ7F 5EU5B 5D7JC 1OP3H 2R1XA 4FZ8L 1DLFH 3CDCA 3GMPB 4YHIB 5JHDE 4Y5YA 1XMWA 2XKNB 1OAYH 3LKQB 4ZD3L 3CFCL 1AO7D 1YMMA 1T22B 5HHXL 1I7TB 3UC0H 2ZSVA 2HFEA 4FQ2L 3CSYB 1MJJA 4JDTL 3LB6D 4P23A 1XT5A 4M7ZB 2D7TL 4YHPB 4UIMA 1J88A 3RTQA 3BMVA 1AGFB 3FQWB 5KOVC 1AJ7H 4HK3N 4MMXC 1OTUD 2F74A 3D69A 3FQNA 3P4OA 4ODUA 3RX8A 4PLJD 1XR9A 3EGSB 3ZE0E 3X3FH 4U6XA 1Q9KB 4OGAD 3OJVC 3GI9L 3V9FA 4WCYH 1A7QL 1CGVA 3CFBB 1GGCL 5D70L 5HHVL 1CVSC 5FDWB 2EC8A 4LOUC 5JORA 5IBLC 1NC4A 5D1XD 2VO5A 2APWA 2VISB 4JRYB 5DJZA 1R3LA 5CLWA 4P2QD 1JNLH 4D0BA 1Q9LA 3TP4A 2ESVA 5EBMB 2Z91A 3OKEB 4OFYD 1S7WA 3L7FA 4LARL 1N8ZA 3CFEB 5GGUB 5JUEL 4L4TD 2VABA 1F4WH 4P49A 3KNBB 4HIHB 3MPCA 1JRHH 2CPCA 3W5NA 2B1AH 5IQ7L 4IOIA 5C08A 1YA5A 4C83A 1IAIL 3KPNB 1FL3A 2EEDA 4P2OC 2DQCL 4QF1B 2E7MA 1RZJL 5CP7B 4NC0B 2VDKH 3CSPA 3DSFH 1SJHA 3GHEH 5HGHB 3MUJA 4WHTB 4KJPC 4M7KL 3GB7A 5J06A 4JM2F 4UU9B 4WFFE 5DRNA 2WP3O 5IB2A 3SE4C 2O93L 3HZYB 3O6FD 4BSWB 5IESH 3MZGB 3TA3A 4M93C 3QUYB 5FF6A 3QI9B 3QDJE 5F8RC 4R4BB 1WICA 3O4OB 1XF4A 3VFGL 5I16A 4MAYC 4XAKE 4WV1C 4CW1A 4PJEB 4DQOH 3KHQA 2DJ4A 3KLAB 2EH7H 2EE9A 3UBXI 1R5VB 4A2LA 3ZE1F 3BZEB 4NCC1 4G9DA 2RHEA 1KIUA 5IM7B 4GJTB 2DWEB 4HIIB 4PJGB 4P5MA 1UKTA 5DHYB 1INDH 5I6XB 1L7IH 1BEYL 4PRID 1YYLH 2NZ9D 4QRRA 2KDGA 2NXZB 4NO2B 1IILE 1GOGA 5IMKB 4FTVD 3ABZA 2GTWB 1BLNB 1RV6X 1N7MH 4KK8D 5J12C 1VGEH 1S9YB 2C3HA 4U1LB 4RGOL 2Q6WA 4PG2C 1QP1A 2BX5A 4K9EL 4PFEA 4Y4HB 2QR0A 3KR3H 5TDOB 3KYKH 4FFVC 4XHJD 3NIFE 3TV3L 2W65A 2IGFL 1SY6A 4ZNCD 1HHHA 1ZSDA 1I9IH 4CBPA 4DOHE 2CR3A 3MBEA 4G8IB 4JFZL 1CDHA 3NCJH 2ENYA 4GAYB 2IAMB 3EYSL 1IKFL 1X5AA 1GHFH 3BAEL 2QADB 1CE1H 5FHBH 1S9WA 1Z9OA 2ZKHL 4GMSL 5KSUA 2VXQH 5CJXA 1WWAX 3B9AA 3LSOB 3ULSA 2EXWD 4QRPE 1XIWA 4TVPH 2CJUL 1KTDA 3K2UL 4PLOB 5GHWH 1FYTE 3DTXA 4BSVA 5B39A 2PO6D 1J10A 4NZTH 2R1WA 1MCOL 3OKOA 1NGYB 4PYGA 4KHTH 1R3IH 4XCEA 4LIQL 1X9QA 3TBSB 5L0QB 4KROD 4J3VA 3IT8D 4PJ7E 3HAEB 1S9XB 5C9JB 3QJFB 4RMUA 4JGUA 2F54B 4Z7NF 1BD2D 3JV4B 3TH4T 4KZEL 1FC2D 2VC2L 1NSNH 1FGNL 4U4BA 2HN7B 2VAAA 4XPGH 3C60D 4XBEL 1IJ9A 3P11H 1A5FH 2ITCB 2QQNH 1A9BA 1C16B 1F42A 5FCSH 3G5XB 1CCZA 4MA7H 4F2MA 1M7IB 3S97C 1JF5A 2Y23A 4PJCF 1YEFH 5IW6B 4RGNE 1ZGLB 1U2HA 1EIBA 3BEVB 5JXED 4L9DA 1DEEA 5B3NA 2Z93B 4QWWC 4KHXL 5GSVB 2BY1A 4OZHA 5DEFB 4P2CG 1UZ8A 3ZLQC 5D1XA 5EH1A 2J6EA 2HT3D 3V6OA 4DKEL 2HMID 2CIKB 3S36H 2FYYA 2X1QA 4MAUL 4P2QA 4WU7B 1SEBB 1WFUA 4OBRA 4ZXBD 2IQAB 1N3NB 3VD9A 3GUTB 5EU4A 3SCMD 4RMSA 3DXAD 4N1CA 4FXLA 4L4TA 5TE7H 2F5BH 5DMGC 5I8KH 1HH9A 2NNAB 3GMNA 5GSVA 2BVOB 5KAQG 1CF8H 3WIHH 4LGSB 5FYJD 5FCUH 3IXTB 2EKSB 1TITA 2B5IC 5DJ0B 1Q9WA 1FC1A 1YMME 2Z35A 3KPQB 1FNSL 5FYKE 1EZVX 1CLOH 2BHUA 2E9WA 4ZFFB 4HX1A 1TTFA 1A9EB 4PJ8D 3BQUA 2HJFB 2C1OB 4CKVX 5DD1H 3HMXH 2EZ0D 3UTSB 5TJWK 1J1PH 4RNRB 3LN5B 3QUML 1G7HA 3N85H 3GMLB 1C5CH 4PUBH 4FZEH 4N8CH 4L4VB 4M6OL 5F7EL 1NC2B 5LAXA 2B7DT 4XP5H 4YBQC 1K85A 4QKXB 5FYLE 3MV11 1KCGC 2R8SL 1UM4H 4S0SD 4RDQF 1K8IB 2Y6SD 1TZGH 1MIML 1OLLA 1KTLA 4DGVH 3BXNA 1P9MA 1WSST 4U6YB 4NDMA 4KC3B 1GGUA 5F7MC 4EVNA 4L4JA 4OSUL 4YIQA 5HY9B 3EYOB 4PRIA 1WFNA 5EIIB 2B1HH 1U95A 1MCQA 3ZE1E 2NY1B 7FABL 5I1GL 1DUYA 5FUOL 3BPCB 4IIQC 4WW2B 4I0PD 4JZNB 4AQOA 1UADC 5BXFA 5FYJL 3ARSA 3F6IA 4Z76A 5D1QC 3BGMA 3ZKMC 1W72H 5C08E 3R06B 1X4XA 2VXVL 1UH4A 3BDYL 5HPMB 1YJDH 2FHFA 5A40E 1LO2H 4OLWL 1KENL 1KJMB 4YPGB 2A83B 1G1YA 3H7LA 4NRZB 5DMJB 3KPRA 3O11B 4N0RA 1F4AA 3Q48A 3IGAB 3EFDH 1RURH 25C8H 4DKAA 4M6AA 2Z4QB 5DJCA 2FWOB 5GGSY 3JV6A 1FRGH 1MFDH 4TULH 2AJVH 1OP5H 3QCTL 1E4JA 4RBPH 1HSAB 3V52H 2ED9A 4TYUA 2C4XA 3OR6B 3NA9H 1MJ8H 3TESA 2AI0H 1BQHA 4DCQA 4R2GD 1P53A 2A6JA 1CL7I 4PLKD 3UO1L 3ARZA 4KKLC 5DZLA 3X14B 1M1SA 3MJ9L 4FQXC 3SDAB 3ARXA 2PO6A 4EOWL 5D72H 1NAML 1VESA 1ADQL 4Y4KD 1G7PB 4I13B 2C1PA 2X4QA 5IGXH 5FK9B 5DMKB 1T66C 3MJ7A 2PYEB 5FGCE 2ILLA 1HOCB 1F90H 2AJUH 3TZVA 5KANG 4HJJL 1AI1H 2AABL 4OCWL 5I71B 2J8OA 2AS5M 4QOKD 2C3XA 3S88H 4OBSA 4AM0A 3VFUB 2CK2A 4GW5B 4ENEC 4U7SA 2J8HA 5ICXB 1CQYA 4Q9RH 4OKDA 4CAGA 3QA3A 2BMKB 4Z7NE 1NDGA 3SGKA 1M4KA 5F3HA 4LLUB 5JXEA 1GSMA 3C8KB 4Z77A 4HWEL 5B8CC 4KRNA 1DBJH 1R3JB 3JWNC 3T0EA 3GSWA 2CDEA 2D2OA 3IDIB 3N1PC 1KFAL 5C0NC 5CJ8A 1BOGA 1GH7A 4M43L 5DC9B 4YO0A 1J18A 1DVFC 3NAAH 4PRBB 3C5JA 4PJCE 2HA1A 3EO1B 4ZQKA 1SYVA 1F4YL 4R0LB 4NP4H 5AYUL 3RY4A 4YQXL 3P4MB 1A6UL 2HJKA 4HJGA 1MHCA 4Q6IC 3WFEL 4YBLB 1LO4L 2KKQA 5HYIA 3U48A 3LVEA 3I2CH 2LABA 2AJYH 4CJ1A 3TT1H 1IEBB 1AO7E 3GM8A 4XP4H 3SOBH 1QSEA 2IH3B 3LN4A 2UY7A 1E4XH 1R3KA 1CXFA 4MD0B 2XQBH 1X5ZA 4U6VH 2WBWB 5HI4D 1NLDH 5FKAA 5CD5D 2EC9T 4EUPA 1HILA 2L4OA 2DKSA 2ZCKL 1I9RL 4JRXB 3FT4B 2QSCL 3VRLF 2DLEA 3QXVA 3BKML 3MREA 4LSQH 4XXDB 4GAJL 5E2UH 4OZFB 4LU5H 1QLRA 4UMGA 1DBBH 1FO0L 4JRWA 1HDMB 2QHRL 3MJ9A 3EYUL 5DYOB 2DQIL 5J11B 2NW3A 1OCWL 3V6OE 4MNGB 3ZHDA 1ADQA 3MV9A 4JPWL 4ZS7H 5LQBH 4MCZB 1IGCH 4P2QE 3T3MF 1MVFA 3TN0D 2JJUA 2JB5H 3NACH 3HE7B 3MNZB 1H3GA 1JGEA 1S7SB 3M8OL 4EN3C 3GSNH 3BKJL 2N1KA 2VWEE 4L4TE 4HFWB 1NCCL 3PNWA 1EHNA 3H42H 3IU4H 3CCHA 1MJ7L 5T3ZD 2FJHB 2AEQL 3VG0H 2FB4H 4I0PA 4QHLB 2CGRL 4JREC 5DQ9A 1ORQB 3B9KD 1TMCB 4BFBD 1UJ3B 1DSFH 1PAMA 3MROB 5TQ2H 3D2UD 4OZIB 2F53B 5TF1L 3DGGB 2P5ED 2F8VA 2DIBA 1A3RL 3CLEL 4Z95H 1T20A 1Z6JT 3BZFA 1YY9C 2E7LE 1AD9B 3FZUD 5IROA 3RWDA 1KIQA 1MRDL 3VH8B 2XI9A 2OP4H 2R2CA 2CXKA 1HSBB 3HC3H 3MCKA 1MHEA 2FH6A 1FAIH 5CZVL 3DV6B 4X5XA 1KN4L 2GT9B 4IDLA 2UWEA 1TJGH 4CNIB 1RUAH 4O5LH 3A6BH 4HCRH 5JW5A 4ZFZB 4FXKA 4NN6B 4PJBB 1H5BA 4AJ0A 1OT1A 4LIQE 2Z31B 4AH2A 1A1OB 3MQIA 4K71B 1CFTA 4YAQA 3OAYK 1YNKL 4K94H 3P4NA 1B4JH 1HH6A 4P46B 3WFHA 4YXLL 1U8LB 4H0HB 1KV3A 1LO0L 1AD0A 1UM6H 1X5HA 1A8JH 3QNZB 3PIQA 4YR6B 4PRIE 3CUPB 4KI5C 1I3GL 2IALB 4OZGA 3D18B 1G6VK 1II4E 3ECBB 4CDGC 1R6VA 2IADB 3RVXD 4XNQB 2W92A 1S7XA 4FTVE 5T3ZL 3RKDD 3N1QC 1QFUL 3MLUH 4KKAC 1N2RB 4G9FB 3L3OB 1AC6A 2RB8A 5EPMA 3O6LL 4LLDB 1T0PB 2V7HA 4LKXB 5BMFL 2XN9A 3SKJL 1P4IH 1RJLA 3WNNA 4YUEH 1FZJA 5AG9A 5BZDB 1Q72H 4YXHL 1LK2B 4D0DA 5DR5L 5ETUB 2D9CA 1KG0B 2UWEF 5E8DL 1NEZA 3PHOA 3ZTNH 3BPLC 1MCPL 1QSFD 3Q1SL 4G6JH 1NMAH 1ND0A 2A38A 1CWVA 1A02N 1MLCB 4W4OA 1DLHA 4K7PY 5EFIB 1TJHH 5L6YH 2BVPB 3U2SA 2C5DC 4LAQH 5ESVA 2VDPL 3EOTL 3P30H 3QH3B 5CIPH 1XGQB 2VDLH 5IIEA 1Y0LA 1C7TA 3KPOA 3CIQA 4XVUD 3DO3A 3ET9F 4KRPD 1FLRL 3MLRH 1KGCD 2MWCA 4LLYB 4K3HA 2VQUA 1U8IA 4X4ME 1LVEA 2IANB 2W0FB 1R0AH 1EEZA 1A6TA 5BV7L 1I1YB 1MFCL 2I60H 3FQUA 4TTDD 4JPIA 4M03A 4MXQC 3UJTL 5F96L 1SEQH 1BD2E 3LPWA 4YDLB 4JM4H 2EXYC 4NQEA 5IMMA 1A14H 1JWSA 3MLXH 2O5YL 4MJ6A 3MRKB 5D96B 1CFNA 3RA7H 1A6AB 4O02L 3WHE0 2P47B 3WFCL 3TIDA 2ATKB 2M2DA 3B6SB 5FUZL 1RZFL 3QEQD 4AYFA 4NO0A 2Y7QB 3PABB 5GSRB 3VRLE 3U7WH 2AW2A 1N6QH 3TVMB 4K8RD 1U8HB 3DBXA 3SDDD 1I7RB 5MI0C 4G8FB 5DFTA 4JQIH 1KT2A 3PHSA 3TN0A 1S9VB 2A74A 1W72B 4OZ4A 2ZJSH 4F57L 3DXAE 3RZWA 2DQFA 3PWLB 4YDKL 3MRDA 1RY7B 3OGCB 5ENWB 2YRZA 2NR6D 2EDTA 2WLZA 5JQ6H 3GMMA 1KIRB 5FYJE 3WV0A 5I1AA 5LGJA 5KSVB 5FO9A 1N26A 4BFIA 3MRIA 4WY7H 5BRZA 1HHGA 3CMGA 4HGWA 3WJLC 5EOCL 3FO2B 4JB9L 5AZEL 5GPRA 4UDUB 5B39G 2H26B 3HRZA 4XNZC 4ZAKD 2IPKA 5HXMA 4H26A 2W9EL 1HINL 4GXUN 4P9HC 1KYOJ 4APQD 5HPOA 3O6ML 4OF8A 5K9JH 3DLQR 4M62H 5DT1L 3TBYA 4IRJA 1T1ZA 1YUHA 2AJXH 1E4KC 5I8EB 1MCBA 1ZA3B 4G42B 3MRPA 4XNXL 2OR8A 3M1BB 5D2NB 1MCWM 3LRHA 3OG4B 1CIDA 2Q87A 2N7BA 4PV8B 5LWYL 1ZVSB 3MLYL 1HXYB 5HVFB 5DI8A 4K8RL 2ZPKH 2NW2B 5GGQH 1ONQA 4N0YH 4PLNC 2J8UA 4X5WB 4H20H 4Z7VA 1QUNA 2EC9U 5LBSL 2BOBB 2ARWA 5IT2L 2SEBA 4PDCE 2AK4A 5DHXB 2CSPA 3GSOA 3GSXA 4MXWH 4JFFB 1J5OL 1A2YB 1UWXH 1U8KB 3PL6D 3T3PF 1KCVH 4MLSA 3HFMH 4ZSOE 2H45A 3JV5A 1I1FA 1M71B 4PP8C 3WIIH 4PP2A 2GSIB 2GJ6D 3HRPA 4ODVH 1W0VA 1RVFL 1MRCL 1RIUL 3NABL 5KS9B 5F89B 5EOQL 1GC1H 4NFCA 3ARGC 4Y1AB 5DDHA 2OI9C 4PY8J 1NCTA 3MLVL 3MRGB 2X4RA 1QSFA 1LP9F 1MOEA 5FA3A 4GG8B 1AQKH 4P5TC 1KPUB 3LQAC 2ZUQB 2VL5B 4KGJA 1BM3L 1WIPA 4AL8L 2R69H 4M3KB 3VFTB 4NQDB 1BFOB 1QG3A 2UWEE 2WMPA 2J8UF 4TRPH 5JHDB 5E5RB 3F7RA 4PB9L 2WWMC 5GRXG 4OLVH 2HG5A 5IEHB 3I6GA 3SJVD 4NYLB 2A6DB 2G75B 4FNLH 3MUGB 3FN0L 2DLGA 3PHQA 2GJZA 4UAOB 1IM3B 3IAGC 4FZ8H 5T1DH 5A2FA 1VGKB 4MJ2A 5I1DB 1CD9B 4XWGL 4U31A 3FQXA 5HHXH 1CU4H 4FQ2H 4OZGE 4JDTH 3O3AB 5D9SA 4QOKE 4RFNB 3RNKA 3MNVB 3P77A 1CN4A 1HHJA 5ILTL 1NCWL 1ZANL 5C0BD 4ZUVB 2EDFA 3CSBA 1JNHB 5F9DC 5F3BA 3B2VL 3PG2A 2FIKB 5C07D 2Z92A 4P4RB 5CHNB 1DCLA 1QNZL 5FO7B 3VI3F 2NY2D 3LQMA 3AM8C 3QEQA 1OQXA 3GSNB 3SHSA 3C5ZC 4XRCB 2V5MA 2YPKB 2E6JA 4K23L 3ARRA 3SDDA 4HEME 5IR1A 3KXFA 2Q76A 1ES0A 1T0NA 4OF5A 4XP6H 1MVUB 5BCAA 1ZLWK 1P7KB 1X5GA 1ZA6A 1IC4H 2H2PC 1H3UA 4HWBL 3O3BA 2NY3B 5I76A 5LXGL 3FOMA 4K55A 4PTTA 3DI3B 1U93B 3CGTA 5I74B 4DUVA 4KGLA 2XFXB 4OQTL 3HLAA 4UINL 1BQHG 5T5FH 1WWBX 1U3ZA 4PB0H 5C0FB 5MEPA 4YE4L 4ZUUB 5JOPD 5EU6A 1G6RA 1A1MB 4ZMAT 4EBQH 3MYJB 3V6ZA 4LCUA 3IDMA 1IL1B 1QQDA 5HHMA 2DQCH 1YEIL 4QT5A 3HUJA 1MCLA 2GQHA 4ODHL 1TVBA 2IBZX 3QDJB 1FSKB 4OFVA 2FATL 4LF3A 4R8WH 3QXUA 1P84J 3BPOB 3RZCB 5C0CB 4WWID 2BOCB 1D9KB 3RVTC 4I18C 1F2QA 2AJ3B 4PJFA 3HC0A 1IARB 1YECL 3HR5A 1K9TA 1A3LL 3E2HC 5EUOF 4RFEB 3VFGH 3BWAB 1WCBB 5ESAB 1KTKE 3OR7A 1EHXA 5DFVC 2A6IB 1KBGL 4G43B 1F00I 3EFFB 5CBEB 4CN6A 3CVHL 5SWZD 1MWAL 4Y5YC 3IKCB 5K93A 2YD6A 4GT7A 1GPOL 3T08A 1F8TL 1LE5A 5T3ZE 2Q8BH 3ALXA 4LEXL 3B4NA 4JFED 2BJMH 3LN9A 3ZYIA 2AP2A 4F15B 3HUJF 1RZ8A 2APXA 3R1GH 4P23C 3GMQB 1J87A 3VFWA 3RTQC 1J05B 4HKJA 2P5EE 2WM0A 5KVEH 5FUCC 4XMPH 4U6HA 4I3RL 5D6CA 3T3PE 5DD3L 3TPUB 4BFGA 5CIPB 5GGTH 1U3JA 2WANA 1W0WA 1I1AB 3FT2A 2DOCA 3ARDD 3NGBB 4XI5D 3QEUB 4LPUA 2VLMD 5EB9A 3UXFA 1TZHA 1W8NA 4X7CC 1FYTB 1WFTA 2NXYB 4MA1C 3QXAB 5DO2D 1IKFH 3BAEH 3B3IB 2G2RA 4Q2ZA 4GMSH 3ARED 2DI8A 1LP9E 4LHUB 3SJVA 4EUPG 1I9EA 4MZ3A 2JLLA 1UWGH 3BW9A 5DVKA 3NTCL 1QVOA 4PJ7B 2WLYA 4X98A 4Y7MA 5F88A 4LSRL 2J8UE 3V5HB 1B88A 4JAMA 4WWKB 4X6DB 1JHLL 1FHGA 4GFTB 5DD5L 4PG9B 3O6KH 2HFTA 4GRLD 4AEEA 4E0RB 4G3YL 3WN5A 3WXVL 4GS7B 1Z3GH 3VGAB 2Q3AA 3B2UD 2X70B 2DIAA 3JVGA 4XBEH 3DNKA 1HWHB 5DD0H 2RQ8A 3RWHB 1UT9A 2ZCLL 3PE9A 1AY1L 4N9GA 1FZKB 1DQQA 3BSZH 3VGGA 3DX9B 5J4MA 3DUUA 3C2AL 5DS8A 4XBGB 1OQOA 4J8RA 5EA0L 2DQJL 3TA3C 2VZSA 1T5XA 5K9KA 3VXQA 1QSFE 3ARBC 3VWKB 3RVWC 4S11A 2M1KA 4ZYKB 4E42B 5DJ8A 2VNCA 3VI3E 4PRDB 4LPYA 1NFDB 3CVHA 4U1SB 1MWAA 5EO9A 5FM5M 4YHLL 1VADA 4DTGH 3C09C 2EH8L 1OB1B 5DWUL 4KK6D 2VLRD 2ENSA 5IB5A 5D1ZD 5H35A 1KGCE 2AQ1A 1JGVL 5C8JB 1XH3B 5ACZB 5CEZD 2APBA 4TUKL 1U8PB 1GAFH 4PREB 3VXTB 1WBYB 1X3DA 5SX4H 2WBJB 4DGIL 1FNGA 4QY8B 4V2CB 1SHMA 1OPGH 5ERWB 3KYOB 4OCXL 2HLFC 4H88H 4LSVL 3TO2B 3G6DH 4HC1A 4R90H 3RWJB 3UPRA 4F7PA 1VFUA 1CD1B 2FBOJ 5GJTH 4BH8B 1S7RB 4F7TB 1HIML 1MSPA 4JM2B 1CGSL 5KBNC 3QUMH 5I73B 5CZXD 2CLRB 1JRHI 2IMNA 1EGJA 2MPAL 2H6PA 3QEQE 4BELD 3MBEC 4JG0H 3U0PB 5IVXA 3WFBH 3SKNA 3ARPA 3HNSL 4ALAL 3S5LB 5IKCB 3OKLA 1CTOA 1NGPH 3HB3C 3QULA 4G80A 5TPWH 5CJXC 3HZKB 4QXTB 4PRHA 1XIWC 1JV5A 5ALBH 1CTNA 1UH3A 3LPFA 5EUOE 1CT8A 1XAUA 1IGYA 5MEOB 4NOBA 3U30C 4H1LA 3QG7L 1NEZG 1CZ8L 5D7SH 3EOYG 3GKZA 3K8KA 4JFEA 5JIKA 5FGBA 1Y6MR 2R4RH 3RBGA 3KLSA 4LPVA 1JWMB 5FUOH 3LB6C 1RZJC 4G6ML 5CEZL 1QRNB 5HHNA 1K8DB 1PLGL 4WI6A 1CLYH 5TE4L 3IDNA 3QO1A 1X4YA 3IF1A 1J0HA 2FJFA 1JIBA 1V3JA 3OAUH 4L8DB 1KENH 2EDWA 3UJIH 3VXRB 2QTEA 4NNYA 3HUJE 4PLJC 1QFHA 2GITB 5ESQB 5KSBF 5C2UB 2MJWA 1AE6L 2C3WA 3R0MA 1PY9A 1KELL 1ZVHA 1MQKH 4YXKH 4LNRB 1ZT4A 4RFOH 1W8OA 2XZZA 4G6KL 3O8XD 3VDCA 4C54A 3LKNA 2YRPA 4HH9B 4NQTA 3G08A 5I1IL 1HZHL 4P9MH 1KJ2H 1UYWL 3WLBA 3TIEB 4Y2DB 4U33A 3AREA 3L6FB 4KPHH 1EUUA 3UO1H 4LASL 1CL7L 1OAQL 1F6LL 3OG6B 4TSAL 3FB8B 4YZFF 3U82B 4EI6A 5IK3B 2B0SH 5BW7A 3ROLA 2XY2A 3IVKA 1N6UA 1NAMH 1MPAL 5AZ2L 4OAWA 4WI9A 5JDJA 3MRCB 2H8PB 3VXNB 1H3PL 4ODWA 5F1KC 4N0FB 3QUZA 4NKIH 3L3KB 3LV3A 2YXMA 4GRLA 3BD3A 1CFSB 3RWIB 3WLWD 3OZ9L 4S1SL 1JPSH 3DROA 1PDKA 5FO8B 5C2BL 2ATPB 2A73A 3NIGF 4S1QH 2GJ6E 3HNVL 3DETD 3MRLB 4MA3A 4M61A 1AGDA 1OTSD 3BQUC 5KVDL 2BNRB 3V4VL 4Z5RB 4O2EB 3T1FA 2F19H 3QIUC 3RGVB 5DJAA 3CLFH 3GRWL 5J9PB 1I85A 4PJCB 2C7UB 4TOYH 1RFDH 2XG5A 1KNOA 2XTJD 1NCAH 1Z0NA 5B4MD 4L1HA 3VFSA 1U91B 2ICEB 1HNFA 2JCCA 2ZOKB 4FABL 5EC2A 4WW1A 5JPMA 4O00A 2EDBA 1P9MC 4V3DB 1Y18A 4L3ED 5DJ6B 2A0LD 4P2OB 5AYUH 3SJVE 4PRPD 3BE1L 3QXDA 2VLRA 1MCJA 5A3IC 5D1ZA 3WFEH 3ZKND 5C09D 2DMBA 4KMTH 2B39A 3VGHA 1TFHA 1S5IL 1T1XA 1MCHA 4OB5H 1JPFB 2NZ9C 3W5MA 4P2RD 3WUWB 4KU1A 3V0VA 1E4WL 4LLWA 1IAKA 1K2DA 1AXTH 4GBXA 3INUH 4EXKA 2EYTB 1QBMH 2VN4A 4UUJA 5C0BE 2P24B 1HNGA 4MAYB 4NKMA 4Z7UA 5I0DA 4HMDA 3L7EA 1EBPA 4XHJC 2ZCKH 3BYYA 1I9RH 5C07E 3VXUD 3DOSA 4ELMB 5I1JH 5IWLA 3LEVH 4HXAL 2JCCF 2EDYA 5IJKA 1G9EA 3U0WL 3QEHB 4FHBD 1FIGL 1A0QH 3BP4A 3WD5L 5GRVL 5JNYB 1T7ZA 1V3MA 1NGWA 5TFSL 1S7VA 4OFIA 4R96B 3D9AL 3JZ7A 3QQ4B 1TZIA 4TQEH 3WEXB 2XWBA 1QSZA 3QIWB 1MAMH 4JPWH 5IB4A 2PO6C 4HF5L 2MCPH 1FGVH 5ITFB 3FT3A 1AQDA 3QUXD 5F7UA 1QA9B 3QFJA 4JDZB 4KROC 2OX5A 4BZ2L 5C0EA 4M1CD 3MCLH 4HXBL 3IDJA 3TZVC 4P4KB 1EO8L 1IAOB 4YHOL 1QR1A 4LLVB 2Y06H 5JOPE 1G7QA 2G60H 2I24N 2YMXH 4M8QA 4Y88A 5EU3A 3S4SA 3RBSA 3GRWA 4E9LA 5F1OB 4IHOA 2IQ9L 2CRIA 5J6GA 3EOBB 1PKQA 5D7IA 4ONOA 1HHKA 3H9YA 1G7MA 5T1KB 3H9HB 1U3HD 2ZCHL 1FQ9C 1W2KT 2E7HA 1J0ZA 1YN6B 3SGKC 1MIEL 2V9QA 5DMIL 4G5ZH 3O8XA 5HYSB 1CXLA 2ADGB 3DWTA 3RAJL 3T0EC 2DLFL 2WINA 1J0KA 4OKVA 4ONGH 1PGRB 4IRZH 3TBVA 1KN4H 5KSBE 3HG1D 2BHYA 2DS4A 2FSEB 1S7TB 2W0LA 4O2CB 2ICES 2I9TA 4LP4A 3V5DA 5CGYC 5FKPB 2EYSA 3JWOL 4JY4B 5EBLA 3QQ3A 1A7NH 3RUGA 3NCEB 5ANME 5L2JB 3A67L 3I84A 3MUY1 3RY6A 5SWZE 1J8HE 2MTPA 3DRTB 1F2XK 3OBAA 4YZFE 4E41D 1ZS8B 4HPOL 4ZFOB 2YS4A 1ZV5A 4JFEE 4BKLA 4RMVA 2X89D 4HUUA 4R97C 3VFRA 4X83A 1A1NB 3TEUA 1MHPH 3X11A 3VE0B 3GMRA 5D7IF 2H32A 4XCYB 3QBTB 4N90D 1QFUH 1S8DA 5JDSA 4BA8A 1KLGB 2NTFB 3ROOA 5HVHB 5F9AC 5JW4Q 1KCLA 2QV2A 4CU7A 3QRGL 3S3PA 3CXHJ 3QNXA 2NY7H 5D5MA 2CLZB 3U4EB 2I07B 3C08H 3PP3H 5DR5H 1G9MC 1S7QA 1KB9J 5GRUH 5EBWB 4GXVL 3NIGE 1AXSB 1DN2A 4WO4D 2VLME 2N56A 2DF3A 4RISL 4S0UC 2FO4A 3Q1SH 3FJTA 4OD2B 2Q86B 1T5WB 1OT2A 1JHKH 4WDIB 5GZOC 3RUGF 1C08A 2V2XA 3I50H 3AC0A 3MYZA 4PV9B 5CUSL 4GMTL 4L3EA 4NQUA 1QD0A 4PRPA 5E8OB 1BWWA 5TDNB 2VDPH 3EOTH 3VFNA 4P3WA 1JGDB 3OX8B 5C09A 4M1DL 1U3YA 1JF6A 4YH6A 1A4KA 5FOBA 4KQ4H 3E3QA 1BD2B 5ID0A 4X6FB 2DL2A 2VLKA 4HIXL 5DJ2A 4MLIA 4LK4A 3C60B 4I0PC 4UQ3B 3QUMB 1LE9B 1SJXA 3TYGL 4U3CA 4KVNH 4MB3A 1P1ZA 3L3JA 1YNLH 4WUUB 2A9NH 1EMTL 2OMNA 5EO1A 5INDB 2O5YH 2DQDL 1ZLUK 4GG6A 5GGRB 3U4BL 3KGRA 2LTQC 4PRAB 3VXUA 3SPVA 1XGPA 1JPTL 5F44A 1OP3K 2YUXA 2DYPB 2NMSA 4OCSH 5IROC 3HTLX 4ETQB 4AG4H 5F93C 3DO7A 4JRYD 3F7VB 4FQCL 2D31B 3GJFA 5IV2A 1GGTA 1EJ6A 1U8QB 4ZXBB 2A77L 4TPRH 4HUWA 1E4XI 3SCMB 3FKUS 5MENA 4OFKA 1Q0YH 4IIQB 5FECB 5GZND 4HSQA 2ZG1A 5CZKA 2JCCE 5A2KH 4X9FA 1RUKH 3VFPB 1DR9A 5IBTH 1H5BC 3MMEA 3CDGA 3HI1B 4H0GA 5I75B 1C1EH 2YD4A 3UTTD 1KLFA 5LCVL 3VG9B 4WU5A 1A6WH 1YEJL 4K7FA 5CEZE 5E99L 4HD9A 4LPTA 4XVTL 4UTBH 4UQ2A 3PGFH 3X3GH 5HHPA 4ONHA 3JTSA 3TNNA 5IG7B 4D9LH 1I8KB 1XCTA 4YDJB 1KJ2B 2P8PA 4LGPB 4H25B 4ZUWA 1U3HA 3QUYD 2P4AB 3QI9D 4GH7B 4OJFH 2FX9H 3FHAA 2BNQD 4P9HH 4ZTOL 2BK8A 3THML 1MEXH 5HD8C 4XP1H 3MOBH 2BSED 1KYOK 1NAMB 3O4LA 1KIPB 4WFED 3HC4L 2OYPA 1RHHB 4NWUL 3ERYA 4IOSD 5A2JH 4QHUB 4W4OC 5T3XH 4JQXA 4J3TA 5H94B 3REVB 2R0WL 1KB5H 1HN1A 3TWCL 3NFNB 4MS8D 3BDBA 5IQ9A 2NXZD 4YPJA 3O3EA 1C12A 2VIRA 1UXWA 2P8MA 4K3JH 4NKDA 1TVDA 2NX5E 3SDXA 4E41A 1H8OA 4OGYL 1VFAB 3IJYA 2GUOB 5MEQB 2ZOLB 1MELA 2X89A 5F6IC 1L6ZA 3UDWA 5B8CB 3FAWA 1IGMH 4LAJH 4R4NC 3MOQA 1LGVA 4Y4HD 5HI4C 4X8XA 1KN2H 3DX7B 4DZ8B 1S7UA 2V2WA 3U9UA 4POYA 3MLZH 1DVFB 3ZHLA 1BZ7B 3NN8B 4QRSA 5HHOA 1EJOH 2LVEA 1HQRB 2JJWA 3GIZH 4L29A 1RIUH 3NABH 4ZG1A 2YC1B 5D7IE 4R2GB 1QSVA 2IAMD 3NZ8A 5HYQA 4Q6IB 5H37G 1U92A 1PG7H 2CK0H 4OM0L 5D93C 3IS0X 2R2EA 3OXRA 1KC5H 4FRWA 4UV7H 1DDHB 1CBVL 3CC5A 5EZIH 5EU5A 3AXLA 4WI5A 3GMPA 4YHIA 4Y4KB 3NCYP 4U1NB 2XKNA 4JFQB 1ZLVH 3TN0C 5IF0B 3FOLB 4PB9H 4NNPL 5I1KH 1I7TA 5I15H 3CSYA 3KLHD 4D8PA 3IETB 4I4WB 4Y8AA 3FN0H 3RUGE 3FB5B 4LLQB 5BOPA 3O0RL 4YHKH 4QOKB 4YHPA 1ZHBA 4D0CB 5E6IB 1FFQA 1HHIB 5J57B 5F7DB 2W59A 3GSVB 3HZMB 4ZDHB 1AGFA 4X6CF 3FQWA 4R3SA 4TUJA 2X1PA 3U4AA 5BJTB 4NBYB 4XX1E 3CPLB 3PXHA 4OF3A 4BK5A 3EGSA 1GYAA 5ILTH 1NCWH 1ZANH 1Q9KA 4Z78B 4NBZB 5L8KB 4L9LB 1NL0L 4DEPC 1CR9H 2X4PB 3T77B 2G9HB 5FDWA 2AK1H 4JJ5A 4K7PX 3FZUC 4GAGL 4F9PA 4H1LG 2VISA 3CAFA 3K81A 2DQTL 2VSCA 4IJ3B 4KJWD 1FCGA 4IRJC 4QTIH 4KY1H 4DGYH 2XTJE 4D94A 4UV4H 5EBMA 3IFPB 4Q58C 4NHCH 3QDHA 3CFEA 5GGUA 1HKLH 5HJ3B 2C3VA 5KTEH 5MHSE 1F3DH 1V3KA 2E8ZA 3F58L 5LGKA 3KNBA 4HIHA 3LKSB 4L3EE 3L3IB 1V7ML 4PGCB 4PRPE 5JW3L 4GKSB 2BFVH 3PWNB 2HT2D 3ISWA 5DEZA 5C09E 4NZUL 1JL8A 3KPNA 1MAKA 2YPLD 5IMLB 5LKNA 3TJHD 3E3QE 3P9LB 4FFYH 4P2RE 5CP7A 2DWDB 2O26U 3RVXC 5C6TL 1NBVL 1J0JA 4JPVH 4UINH 4AEHH 5HGHA 4WHTA 5MERB 1FDLL 4DVRL 1UGNA 5DVLA 2WIIB 1BMGA 4UU9A 3UTSD 3HZYA 4G8GE 1DQTA 2ICCA 4BSWA 5CCKL 1UCBL 4ZO9A 3QUYA 1YEIH 3QI9A 4L4VD 1ZAGA 1NC2D 4JZJB 5E1AA 3VRJB 1MCIA 4NT6B 3VXUE 2VDNH 3O2VH 3BWUC 4PJEA 2LE9A 3LKRB 3ZL4H 3NOIA 1P84K 3V6FA 1R5VA 1U0QA 3B8YA 4JDVB 3BZEA 3VXMB 3U6RB 4PTUB 4HW6A 5EWIL 3Q6FB 2DWEA 4HIIA 1X5XA 3MV7B 1A3LH 3FO1B 4UNUA 4PJGA 5DHYA 2JB6B 1DBAL 4OGZA 1E28B 3QSKB 5EORL 3KJ4B 4MS8A 2GW5A 2NY1D 2IF7A 5FA4B 1KBGH 4Z9KB 4KRPC 3BZDA 4NO2A 1B0WA 5KSAD 2ORBH 1GOFA 1KJ3L 5IMKA 4CMHB 3PP4L 4WI3A 2GTWA 2X4NB 2Q20A 3D2UB 4MD5A 1G9NL 2BVYA 5BS0B 5I8OH 1GPOH 2P5EB 3BDXA 43CAB 4Y4HA 2P42B 5TDOA 5KVGL 1TXKA 1GCFA 3K7UA 4PJEF 1BQLL 3PWPB 1OF2B 2BY3A 1PX4A 4GAYA 3HZVB 1TPXC 1E6JH 2IAMA 3W0WB 2VXUL 3OPZH 2HTLC 4KUCD 3BT2L 1MFBH 3LSOA 1P5VA 3K8MA 3MLTA 1X5KA 2P44B 3SDAD 1OTTC 3Q6GL 4CVZB 4EI5A 4LVNB 1NGYA 1X44A 3CMOH 5I1HL 3HG1E 1QFWH 4XMKL 2OR9H 4JANB 3VW3H 3TBSA 1CGXA 4W68A 1YQVL 2PYED 4NCC2 5FV2A 3C5SB 3WO4C 1MCWW 4OFPA 4PJHF 1NH6A 3HAEA 5C9JA 3QJFA 2PCPA 5IBUG 5KW9L 2F54A 2APVA 2NR6C 1FIEA 3JV4A 3O2DA 2HN7A 1OP5K 1IFHL 4E41E 3CH1B 5HI3C 1C16A 1CDJA 2C3GA 3ZDXF 3LKPA 3G5XA 3RU8L 1OARL 4Y5XB 4Q9BA 5KVFH 5I30H 1M7IA 3LIZH 3N1GC 1T3FB 5ADPL 5IW6A 4J3UA 2YKLL 4GKNB 2VXSL 3BEVA 4K07A 4X6CE 4XAWH 5AD0B 2UYLB 5GISH 1J8KA 5DEFA 5F9OH 2P48B 2OQJA 4LMQI 2X9YA 4HGKC 2CIKA 3PQYB 4N8VB 5J6HB 4WU7A 2WQ8A 1SEBA 3HI6L 2CKNA 4UT9H 1OAYL 3JWDC 3VXOB 2IG2H 2IQAA 2VH5H 4U1JB 2AKRB 2DM2A 3GUTA 2X1XR 3TH2T 4QHNB 1XZ0B 5JLZB 5E8PB 5F72S 3EDDA 2NNAA 2ITDB 1NANH 4QHKJ 3NCCB 2BVOA 4M1GH 3S4SG 4P59H 5BQ7B 3IXTA 2DQHH 1ZLSH 5DJ0A 4PBXA 3KPQA 2OS7A 2VKXA 1QFWM 3CFIC 1AJ7L 2EH8H 5AEAA 4X80L 3I6KB 3TJHA 3NFPB 5E9DD 2Y25A 2X05A 3X3FL 2CQVA 2HJFA 4JRXD 3UTSA 2WW8A 1TTGA 5C3LD 4RNRA 5BO1H 1U6AH 3ESVF 4OCXH 1NGQH 4C4KT 3TFKA 4L4VA 4F7CA 1T7YA 2D4DA 1NC2A 1JNLL 3H0TB 1WUNT 1FZOB 1KB5B 2I27N 3C6LD 1YEDB 1K8IA 4LVEA 2ZUXA 2HTKD 1SY6H 3FRPA 4PRNB 1YPZA 2EE2A 2OZ4H 1CGSH 4JRYE 3RDTA 1F4WL 3QWQB 4KMQA 1LD9B 5KG9B 4XX1G 4U6YA 3LS5H 3HE6D 1JRHL 3UP1A 3HE7D 4LBEB 4YDVB 4ALAH 4ZO7A 2B1AL 2Y5TB 5HY9A 3I75B 1ZT7B 4UNVA 4OCYH 3EYOA 5EIIA 3H9SD 4CDHA 5E0QA 3ILPB 2O5XH 3TO4A 3BPCA 4WW2A 5F8QC 5CD3B 4JZNA 4C57C 4IDJL 3H3BC 2VDKL 1IQWH 1OD7A 3UTTE 3GHEL 3R06A 3MRNB 4ORGB 4LFHD 1UACH 3VRIB 3W39B 5HPMA 3ULVL 2NCMA 1WGOA 3F12B 2OI9B 1KJMA 2F53D 4YPGA 5IESL 2A83A 2HRPL 3O11A 2W0PA 3C6SB 4ZAKB 3SQBA 1J11A 1BECA 1O0VA 3VFVB 4G6MH 2Y36H 3VXPB 2RIKA 4TVPD 4L8CB 2FWOA 3WN5C 2HKHH 1HSAA 2EH7L 3JVGC 2DB8A 4O51B 3OR6A 2BNQE 3UTPD 4D9RE 2YEZB 2BSSB 3STLB 4JY6A 5GRJH 1MJUH 4PJEE 3X14A 4WFEE 3OKKB 3VXSB 1INDL 4JKKA 3AS3A 1L7IL 1Q9OB 1YYLL 3GIVB 1T2QH 2J6EH 1S9KC 3D25B 1F11B 1UYWH 3DVIA 4LVOC 1G7PA 2BVTA 4P46D 1VEMA 4X7TB 3AU1B 1QO3B 1FZMA 3DURB 1N7ML 1HOCA 5CWSB 4U1KB 4TSAH 2BZDA 3JUZA 4MCYA 3MXWH 5K9QG 2XWTA 3PL6B 2JELH 3KR3L 1F97A 3ZSSA 4RIRA 3KYKL 3VFUA 2E3VA 4G9FD 2QQLL 4GW5A 3ARTA 4DVBB 1PW3A 4PJHE 3EOAB 2GJ6B 3PGDB 5FHAH 1A21A 1UZ6F 5EZLA 3PV6B 3T04D 1C5DB 3VFOB 3D85B 1WEJL 2H2SC 1GHFL 5FHBL 4LLUA 1CE1L 4S1SH 3C8KA 4KUCF 3RWFB 3BN9D 4UB0H 2VXQL 4XC1H 2EIDA 1R3JA 1UC6A 1IC5H 1OVZA 4TVPL 5IFHH 1FVCB 1P4LB 3ZDXE 5GHWL 5B38B 1YMHA 4NZTL 3SDCB 3MOAH 2YZ8A 4UIKH 4KHTL 1KCRH 3EO1A 1T89A 3DIFB 3W11D 4R0LA 3P4MA 4HKXA 2AXJA 1TNNA 4MD4B 3T2QA 4JO2H 1P7HL 4LQFH 1L9NA 1FNHA 1AGEA 5JO5B 5DURB 4I48B 1MF2H 4GO6B 1IEBA 2IAND 2Q8AH 1MUJB 2IH3A 4AZ8A 3QAZC 3ULUD 3P11L 1A5FL 2J88H 2QLVB 4Y16A 2QQNL 4MD0A 4POZC 3FFCB 3FB7A 3MXVH 5DQJB 3BH8B 3G6JF 4MA7L 5C0BB 5FGBC 1YEFL 2BSTB 3DVNB 4RQQA 3FT4A 1ODAA 4KKBD 4XXDA 1U8JB 4OZFA 3S36L 2NY2B 4X9IA 3QDGB 1NDMA 3RWEB 4YGAB 1HDMA 3BD5A 3MUZ1 5DD6B 3GSUB 2OL3H 3MC0A 3U1SH 4OF0A 5TE7L 2F5BL 5I8KL 1JPST 1JN6B 5INCB 4HS3B 4MCZA 4HXAH 1CF8L 3BIAX 3U0WH 1Q94B 3HE7A 1L9MA 1NBZA 3MNZA 5SX4I 1S7SA 3ULVF 2PW1B 5T33L 1WK0A 2ZNWA 2ZSVB 3AREC 3HS0A 5FB8B 3SGDH 4HV8B 1CLOL 4QEGA 4UDTA 2NY4D 3D39D 2NYYC 2FJHA 5BW7C 1NMCC 4QHLA 3VCLA 2MOVA 1NBQA 3MLSH 1ORQA 2PXYC 4TNVK 1IGJB 1TMCA 3ARUA 1UJ3A 3HMXL 1S5HB 1DZBA 2F74B 3P4OB 1J1PL 2L7UA 4IMLA 4WHYG 2YPLE 2F53A 3DGGA 4BZ2H 1EBAA 3QUZC 3N85L 3QP3A 5DRWB 4NUJB 4PUBL 4FZEL 4N1EA 4N8CL 5HHQB 3M17B 1R5IB 3BO8A 2P5WB 3PJSB 3UCRA 1AD9A 3I3BA 4XP5L 4Y0GA 4Q97A 1TENA 1JNNH 5DK0B 3UTSE 1UM4L 3STBA 3B2UC 1NUDA 2WV3A 3VH8A 1TZGL 3U9PH 2FL5B 4Y5VB 4DGVL 1R3LB 4L4VE 4EIGB 3DV6A 2GT9A 4WHCA 4D0BB 3BPNB 4CNIA 1Q9LB 5KSBB 3T2OA 2ESVB 1I85C 4ZFZA 1S7WB 1EFXB 4PJBA 2UZIH 5EUKB 4XMLH 2B1HL 1GL4B 2Z31A 1A1OA 2ADJB 1JMZA 1AIFB 4YK4C 2DLFH 2IPUG 5ANMB 3PGCA 3IU3B 3NFSH 4XCFH 4P46A 4PJAB 1X7QB 1U8LA 3TNMB 1CD8A 1TQBB 5SWZB 1J8HB 4U1GB 4C83B 4YR6A 2N7AA 3CUPA 4MHHI 1YJDL 2IALA 4OZIF 3D18A 3ECBA 3LS4H 2IADA 4JFFD 4XNQA 3LD8B 3DMMA 1N2RA 4G9FA 25C8L 1IMHC 3L3OA 4LLDA 4OCNC 5F9JB 2BXYA 3NPSC 2XPGB 4LKXA 1BFTA 1FRGL 1MFDL 3OJ2C 4TULL 4J2XA 5BZDA 3SGJA 3V52L 1LK2A 1XF2B 1MJ8L 3ARBB 4GBXC 2AI0L 4YHZH 4Y1AD 1XF4B 3DGCR 4Q0XH 1A22B 3BVNB 4EUPH 4CW1B 4RWYH 4RMQA 1UZ6E 3WIHA 5D72L 3OWEA 5L8LB 1MLCA 3CXHK 1G9MH 5IWLC 4N9OB 5EFIA 4NQDD 5J3HC 1XR8B 2BVPA 3BKYL 5IGXL 1E27A 3KYNB 1KB9K 3QH3A 3VGDA 1X4ZA 1GGYA 2AJUL 1F90L 3D3VE 1UWXK 4JFPA 2APFA 1AI1L 3BEWB 4LHQB 4HLZH 4QHKI 3S88L 2IANA 2F8OA 1WZMA 2W0FA 5GGVH 3VWJD 5CUSH 1P6AB 4G7VH 2PYEE 2XOTA 2PETA 4QGYA 1I1YA 4Q9RL 2YPVH 2VDRH 1DUZB 3MLPA 4PY7B 4PP1C 2BSRA 5D7LA 3MRKA 3MRHB 5JOFA 5F7YC 2W65B 5I18H 4PPTA 5EOTB 1A6AA 5D8JH 4YNYA 1PVHA 2X4UA 2R1YB 3MBEB 2HT4C 3P0VH 4EKXA 1FE8L 2CRZA 1JMXA 3TBWB 2ATKA 3B6SA 4AIZB 4LP5A 5ICZB 4NP4L 2Y7QA 3PABA 5DK3A 2VN7A 1H15B 3TVMA 1JPTH 1U8HA 3DTXB 1I7RA 1ZOXA 4MZ2A 4G8FA 4FQQA 3S35H 5I8CB 4HEPG 3SKMA 3O8XC 1S9VA 2AV1B 1XEDA 2C4FT 1W72A 5TDPA 4K7PL 1QHOA 5IFAL 4XP4L 3SOBL 1T0MB 3RVVC 1E4XL 2IC2A 2NY3D 3PWLA 3OGCA 5ENWA 3VJ6B 4U6VL 1KIRA 5IB1B 5I19H 5KSVA 1NLDL 4CMMA 4WHDA 4BSJA 3ULVE 2OM5A 3RY6C 3FO2A 3QPXH 3P9WB 1BFVH 3EJZC 1YDPB 3EJYD 4LSQL 5E2UL 1YEJH 4LCIL 5E9DE 4UDUA 1YQ2A 4HFUH 4LU5L 2H26A 1EPFA 2GTZB 2PR4H 4JCMA 3KWWA 1DBBL 1W0YT 3WLWC 4JRXE 3QDJD 5GS0C 1JZ2A 1GGIH 1F3DJ 1D5XB 3LRGA 4LSSH 3UX9B 2AEWA 3DETC 5C0CD 2QQKH 5I8EA 1ZA3A 1IGCL 4G42A 4MQXD 3NPZB 2QSVA 3HAEG 2JB5L 3M1BA 3NACL 5D2NA 3IDYB 3E8UH 3GSNL 2DJUA 1ZVSA 3DX8B 4MNGE 4OCMC 1HXYA 3DUSB 2NW2A 3H42L 3QIBC 1D6VH 3IU4L 1L8JA 1S78C 3VG0L 4Z8FH 2FB4L 1U58B 4UBDD 4X5WA 2BOBA 1N64H 3CX5K 4PJXF 3WFDL 3H9SE 1DSFL 1CICB 2NX5B 4MWFB 5DF0A 2A0LC 5TQ2L 3SQOH 3TYFA 4JFFA 1A2YA 2ED8A 3ZKNC 5L2KB 2JF1A 1U8KA 4Z95L 3BQUB 4OV5B 1M71A 4FFZL 1T03H 2DQEH 1Z5LB 3QIUB 4PBVC 2GSIA 1I7UB 2GYSA 5EN2B 4OZIE 1BX2B 2OP4L 4M6NL 2ADIB 1QBLH 3HC3L 3DI2B 5E5MB 5KS9A 4BQBA 1FAIL 2LU7A 4TTGA 4TVPE 5LAXB 1TJGL 4O5LL 2CDFB 3A6BL 4HCRL 3H3PH 1WZLA 1I1AD 3MRGA 3H6JA 4MX7B 4JN1H 1FFOB 4LSUH 1DQLH 4GG8A 1SQ2N 1CS6A 3ARFB 3AS2A 1KPUA 5ALCH 2VL5A 2B2XH 1ZXQA 3BXNB 2AXFB 3OF6D 3VFTA 5C0GB 2VZUA 2NXYD 3SBWA 1BFOA 4XWOD 4K94L 3UTPE 1OHQA 2EIEA 5JHDA 1B4JL 2V9TA 1WAAF 3HI5H 1RI8A 2GY5A 4OM0H 1UM6L 4LHUD 2ZUVA 4LL9A 4PJBE 4PYHA 4NYLA 2A6DA 2G75A 3MV01 3MUGA 3TGXA 4H8WC 1LEIB 1U95B 1IM3A 3JWOC 1V3LA 1EAPB 1JVKA 4MYWB 2PTVA 4JFXB 4I77H 3ZHKA 1TCRA 1VGKA 3MLUL 5DQDH 2YOCA 5I1DA 2PNDA 1IT9H 1MFAH 1P4IL 4YUEL 4XPFL 4AIOA 1Q72L 3MNVA 3FRPG 4NQVA 3QHFH 4ZUVA 2W9DH 1JNHA 4DK3A 2OL3B 4G9FE 5DJCB 3QWOB 3ZTNL 2BXZA 2BNUB 2FEEI 5AAMA 2FIKA 4F7MB 1NMAL 3IYLW 4P4RA 5CHNA 3QQNA 1M7DB 2R9HC 3RL2B 4X9BA 2CO7B 5HI5D 1TJHL 3GSNA 4XRCA 2YPKA 4LAQL 4L5FH 2P45B 3P30L 4HAGA 1D5IH 1U3HC 3VWKD 1RULH 2VDLL 4XZUB 1R5WB 1OAXH 1K6QL 1MVUA 3MLRL 4JLRA 2H9GB 3PWVB 1P7KA 1KCKA 2DKUA 2VITB 5CJOH 1T6WA 2X44D 4JQVA 4OLUH 1R0AL 3O3UN 3FONB 2HP4A 5T5NF 4FQIH 3CSGA 2AXGB 1FCCA 3TZVB 3HN3A 4KKNA 1K4CB 2I60L 4JQXC 3EUUA 1SEQL 1U93A 3MTRA 4I3GA 3I02A 4JM4L 2IANE 4AM0B 1A14L 5JR1H 2Q3ZA 1MHHB 4XNYH 5C0FA 3ZKSD 3RA7L 2WBJD 2QSTA 1A1MA 1RMFH 4PGDB 3MYJA 3QA3B 3NZHH 4ONFH 2YWZA 1IL1A 1CLCA 1WV7T 4G8GB 5DFWH 5ADOL 4U7MA 2VLJB 3WHE1 5FM5O 5HDLA 3O9WB 1K4DB 4Z77B 3UDWC 3QDJA 3TT3L 1NBVH 3LKOA 1ZHKB 1WC7B 3T0EB 4C59B 2CO6B 4FN0A 2CKBA 3DYPA 3RZCA 5C0CA 1HYSD 2BOCA 1D9KA 1E6OH 4JQIL 3VU2A 4M48H 2AJ3A 3O81A 3RIFK 1QLEH 1NLBL 4ZQKB 5KZCB 1SYVB 1VERA 4ZTPL 5E4EC 4GW1B 1QBBA 2ZJSL 4RFEA 1TVHB 4HJGB 3BWAA 1WCBA 4C4KO 3TPKA 5ESAA 2PW2B 5JQ6L 2B4CH 2EDXA 5CEYB 3ARQA 2X5PA 4X7FC 2A6IA 1DBKH 3CVIH 4GW4B 3BI9X 4HKZB 4NIKB 3EFFA 4WY7L 3AB0B 1QBAA 5CBEA 5J7CC 4KK9D 6CGTA 4NJAH 3QUXB 4R97B 3IKCA 3MFGB 5F1NB 3D39E 4NO3B 4KAQH 2PTTA 3MRBB 4X0KB 3N06B 1OWRM 4EUPB 1TTUA 1KJ3H 1JYNA 1QRND 1LDPH 1XGYL 3ZT7A 5J8OA 3K3QA 1J05A 5K9JL 3DJ9A 3HHRB 3MREB 3QZWB 4M62L 4UILH 1G9NH 4HK0B 9CGTA 2AJXL 1LQVA 2HVKB 3VXRD 3G6AB 4MVBD 2X1OA 4GQ9L 1RSFA 4JJHA 3NMEA 1I1AA 4M5YL 3QEUA 4I5BB 3PV7A 2VR9A 2ZPKL 3OF6A 1MCCA 1FYTA 1PJ9A 5GGQL 2VLLB 4N0YL 4F9PC 5J89A 4NN5C 5D2NE 3QXAA 3HG1B 4Y2DD 4HDIB 1FYHB 4ETYA 4LHUA 5E70A 5BZWB 3BJLA 5FFLA 3PNWB 3CZJA 4PJ7A 1EV2E 2DM7A 5A16B 2A1WL 5GZNC 4KMLB 4OZFG 2RCSH 5DQ9B 1WAAE 3HFML 4JVWA 5JZ7C 1MY7A 4WTZA 5HBBA 5AG8A 4Q9QH 1HH9B 1BBDH 4WWKA 3KLDA 2VE6B 2Q7NA 4X6DA 4JFFE 4PG9A 1JP5A 4E0RA 2LTQB 1GC1L 5F9WC 1AGCA 4QCIB 1JFQH 4LOUD 2D3VA 2X70A 5I9QB 4WRLA 5IBLD 5KANI 4X6CB 4LNVA 4ZPTB 1EEUA 1ROWA 3D0LA 3ZSTA 1TETH 2BNRD 4TUOB 1FZKA 2YD9A 4NRXA 5GS1C 3DX9A 3MRJB 3RWCB 1JNJA 1WITA 4X5XB 4Y1AE 2FD6H 3NIDF 4XBGA 4TRPL 4WENB 4UOW0 2VXSH 1TJIH 4OQ1A 4WO4B 3QUYC 5E8NA 4W6WB 4OLVL 5JW5B 2DM4A 3VWKA 2BY2A 3OXSB 4RGMC 4FNLL 3O4OC 1OWWA 4LFHG 5E6YA 3ZO0A 4E42A 4ZYKA 3E6FB 5E2VH 4PRDA 4NQDE 3LMJH 1NFDA 4U1SA 3HI6H 5T1DL 2E6QA 1HH6B 3JWDH 4HH8A 4TNVF 5DHVB 4DN4H 3K1DA 1D5BB 4P2OD 3PIQB 1HWGB 1OB1A 2X42A 2Y72A 1CU4L 32C2B 1YEHH 4X6DF 1T1WB 4X8JB 3VH8G 5C8JA 2PN5A 1RK0B 1XH3A 5DRXB 2Y4SA 1JUFB 5I6XC 4KJPD 1U8PA 4IOFC 3D0VB 4PREA 4LCYB 5CSZB 1WBYA 5EPMB 5AUMB 4HUXB 2NXZC 1N5YH 2LVCA 3HPLB 5J1AA 3KYOA 4X80H 4S2SB 3RHWK 1RZ7H 4MAYD 4MNHA 5EZJB 1MAJA 1Q0XH 4Y4HC 5JW4M 1CD1A 4X99B 1S7RA 4ODXB 4F7TA 4JM2A 2OCFD 1R3HA 2PF6A 4I2XE 1CVRA 4RWHA 4XP6L 3QWRD 1U8MA 2CLRA 3S37H 1JGUH 1NFDF 4OLZH 3U0PA 3U2SB 1IC4L 5ESVB 3S5LA 2IAMC 3OJMB 4JO1H 2HKFH 5IKCA 4YFDB 4XVJH 2QADC 4U0RB 1F4XH 3HZKA 4QXTA 3QIWD 3I3DA 3AS0A 3RWGB 2GFBA 4YC2B 4EI5C 3LEXB 2NQCA 3G9AB 4JHBA 5MEOA 5T5FL 4PB0L 5F6IB 3QCUH 3UTTB 4Z0BH 4UI2A 1UA6L 3MJ8B 3SE9H 5HGAA 3K46A 3FQUB 5L0QC 3MRRB 4EBQL 4JPIB 3QNYB 1J1XH 1JWMA 2GJJA 3CFDB 1JWSB 3K1KC 4MA8H 4P4KD 4N0UE 1PG7W 2ZP0T 3RVUD 1QRNA 4WFGD 4IDJH 1K8DA 3DV4A 1CFNB 3L5JA 4EEEA 1UB6B 5D4QA 4J23A 4JN2B 4R8WL 4NFBA 1RJCA 3OQ3B 2MQ0A 5GJSH 3ULVH 2BCKB 4IRSB 2VERN 2YSSB