3RWCA

Crystal structure of rhesus macaque mhc class i molecule mamu-b*17-iw9
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
276
structure length
276
Chain Sequence
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYGCDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGNRYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
molecule keywords Major histocompatibility complex class I
total genus 72
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rwcA01
3GMQA 4LSPL 5T1LB 4PYHA 2O61A 3O6KH 5L2KE 3SGDI 1TTUA 4G9DA 1Q9OA 4QO1A 5D7JD 5JR1L 4O58H 4KQ3H 4MAYB 2HN7B 4XMKH 2A73B 3PUCA 4F80A 1JWSA 2CSPA 2DF3A 3SKMA 3PWNB 1R5VB 1JNLH 4TPRL 5D7KE 5T3XD 5LGJB 4A2LA 5GSVB 3MZTA 1QSFD 3DVGB 5DUMH 1CTOA 1UWEH 3BD4A 3QI9B 5HGAB 3T4AA 4M93C 2WM0A 2UWEB 3RPIB 2MJWA 1CBVH 4LLDB 3S36L 1VEPA 4RBPK 1HHIB 5E5MB 2EE9A 5CZXD 3BGFC 4Y19A 4PRPB 3MNZB 5C09A 2AS5M 1K4DB 3B6SA 4HFUL 1TNNA 3MLVH 4PJEA 3JV5A 1A7PH 5IR1A 2GSIB 4PRHA 1JGEA 2X10A 1Q9KA 4OAWA 3GJFK 3SDYH 1LO0H 4HIHB 1PFCA 4MXVE 4ZO8A 1A6ZA 4JR9H 4ONGL 1KIUA 3N85L 4CVUA 4K3EH 4QHNB 3BH8B 5DHYA 1NJ9A 3C6LD 4Z7NE 1AKJA 1OCWL 3TO4C 3D5OF 1U8HB 4PV9A 4M9PA 5DFVD 5KN5A 4BYHA 4DKAA 2BNQA 3ET9F 5ID1A 5JW4M 3BKCH 1FAIL 1FL3A 2X4QB 5D9SB 3A67L 1TCRB 3UC0H 3GUTA 3IFLL 5K9QI 2B2XH 3VFMA 1S9WA 1V3JA 1WFUA 4MD5B 3TNNB 1J18A 1I1AD 4YX2H 4UTAH 43CAB 3CFKA 3SE9L 3L5HA 5C0IA 4DVRH 5FOBB 2XA3A 3VXSA 1FJ1B 1T21A 3GRWA 4FP8L 5I1EL 2A74A 1N59B 3CSGA 1F4WH 4Q2ZB 5T3ZH 3CFDB 3HHRB 5CSZB 4WFHD 2QHRH 3O3EA 2VH5H 4Q58C 4OM0L 2QL1A 2WBKA 5C0JA 1TMCB 2R8SH 3O6LH 4UOW1 5C08E 1NMAL 1Q9OB 1VPOH 2LVCA 3C9NA 4ZUTA 1WTGT 5DK2A 5FGBA 5GHWL 2CDFA 2XZAL 2I5YH 3I85A 3I02B 1JWMA 4HKZA 4X6CF 5HD8C 1R0AL 4F7EA 4LASH 4I3SH 3F12B 1HNFA 4N1HB 2FD6H 4LVHC 1PVHA 1E0OB 2NY6B 4ZFGL 5AG9A 1IZJA 3BXNA 3DUUB 1VA9A 3IJHA 4MJID 3RBSA 4KV5F 5HYIA 1AI1H 2IG2H 1MAKA 3F7RA 4EXPX 3RY4A 4PDCE 3VWJC 1D5ZA 3D3VA 1MVUA 2XYCA 1KPRA 1BEYL 4OBRA 3MV9E 4X5LA 3W5MA 1GCFA 2LAGB 4U1MA 5D96B 2YPKB 4WI8A 1CLOH 4OIIL 5E7FA 5IQ9B 3S8WA 1V3MA 1P7HL 3HUJB 1MQKL 3M07A 3QCTL 4Y16A 5ID0A 2KKQA 4FFZL 4JY4B 2VLRB 4P5KA 2GYSA 2OTPA 3MUGA 1FZMB 2FB4H 2OR9L 3AFLA 4JO4L 1ZMYA 2P5WB 2YK1H 5B39A 1XF4B 3LKRB 3VXNB 2FZ3B 4X80L 1HH6A 5GSVA 4UBDD 1WBZA 3CSYB 1MEXH 2B4CH 3PV6B 1WF5A 3AAZA 2VDRL 4JG1H 1OW0C 5MEPB 4ALAH 4AENA 3E3QC 1BAFH 3FONA 2NTFA 3FTGA 4HHAA 4P9HH 1LHZA 1WWAX 3MXWL 2VQ1A 2Z0BA 4PGBB 1HIMH 15C8L 3U79A 1RU9H 4OLWH 5E9DE 2RIKA 4NWTL 1SY6L 1RZKC 1ZEAH 4OFPA 4Q0XL 4JFDB 1AHWA 2NYYD 2N4IA 4AL8L 3MBEC 1CE6B 1JGDA 4GOSA 4BSWA 1BP3B 1II4E 3C60B 5BJTA 3IXAB 3M17A 4YR6B 4NP4H 4F57H 3MLYH 1RUML 4N0YL 4NZRL 1HDMB 1XMWA 4MA8H 4ZO7A 4G9FB 4LRNH 5MHSD 1FIGH 3LDBB 4D0CA 2FECL 3BP5A 3OKOB 4OI9A 4KY1H 3KHQA 5D70L 1HWGB 1ACYH 3W0WE 3T0EC 1DBJH 3JWNC 3DRQB 4KHTH 3P0YL 4PY7A 4U6XB 4HUUB 1VENA 5DJAB 1A6UH 3QYCA 2NW2B 2F54B 4FQIL 1T6VN 4HEME 4R4ND 1F3DJ 1EHLH 1TVHA 3HE7B 2VLRD 1EHXA 2GT9B 4LSUL 3GSNB 1BVZA 3VXPB 2FR4A 2R2BB 3VW3L 2VXTL 4J4PA 3HS0A 1PG7H 5I16B 2UZIH 2F19L 4WEUD 5CSZA 4HULB 4RFNC 1JHTB 3UTTB 1DQDL 4XXCC 1ZLVK 4L3CA 4FFYL 2OI9B 1QRNE 3BP4A 4O2FA 3PGFH 1NL0H 4HWBA 3W39A 4OM1H 1J05B 4EI6A 5KANG 5C7XL 5TE4L 1CGSL 4KKBD 1T4KA 1I7ZA 4XNYL 1U58A 1I3VA 3S5LG 3TT1L 4LIQE 3HI5H 2ZUXA 2PR4H 4E41E 3CVHL 2EYSB 2D0GA 5KS9E 3DO7A 2ARJA 1FDLH 3G5ZB 3WV0A 1TJHH 4Q6IA 2MSPA 2H32A 5FM5M 4P2RD 3UBXG 3AREC 2IGFH 3S97C 1KENL 2DDQL 3C6SB 1KT2B 2J3SA 4LLUB 5I1IH 4PRPA 3SDAD 1F3JA 1HNGA 3KS0J 4O51B 3ULVE 1PZUB 2BNUB 1EEZB 1T83C 4FQXB 3DJ9A 4OD2B 4APQD 1X5YA 1TQCC 4Y16B 4NQXB 4WTZG 2Z8WC 1AGEB 1G0YR 4U1SB 4F33B 1UWGL 4XZUA 4I48B 4NDMB 4YDLB 4XPFH 2KUTA 4BFBD 1IEAA 3WFHA 2JELH 5I30H 2CLVB 3V6BR 2VZTA 3EW3B 1RZ8A 2DLHA 3QSKB 4FZ8L 2VUOA 2VZOA 4Z7QF 5DYOB 4JANA 1QQDA 4HMCA 2VKWA 2HTKD 3STZB 1MRDH 3MRKA 5HYQA 4ZUSB 2BRRL 3EJZC 4KROC 4PG2C 4RMVA 3G5XB 4MXVF 2ADIA 3LQMA 5IFHL 1P1ZB 3EO9L 1RIUH 3E3QE 3LEXB 2EZ0D 2NX5B 5HGDB 4OLYL 5GS2H 4LSSH 1CLYH 4YHNB 1W0YT 5I1HH 3BO8A 4XNZB 5I0ZA 3LPGA 4YDLC 3T0EA 4UV7L 1OP5K 4JO1L 5K9KA 1WLHA 1CGYA 5I8CB 1U9KA 1ZOXA 3HZKB 4HFWB 5F1OB 2OI9A 2DLIA 3GHBH 4Z7OE 4YLQT 3JWOC 3PNWB 5IEHA 4ZO6A 1JZ5A 1SJHA 1P4IH 3L7EB 5HSFA 1GGYA 1YUHB 1NFDB 1AD9A 2XQYG 4X99B 2H6PA 5GQBA 2MHAA 2JB5H 2X4SB 4I18B 4RMRA 3K81A 5IJKA 3JTTA 3CDFA 4OIBA 3BDYH 1ACZA 2NXYB 5E0QA 5DK0A 4YNYB 1J8KA 1TDQA 5HHPB 4MNQE 3V79C 1BIIA 3CFBA 2BSTB 2X41A 5BRZD 5C0IB 5DRWB 3G04B 3HNTH 5FK9B 3RTQC 2HKHH 4UT7L 3ZT6A 2UWEE 3RNQB 1NAMH 4KUCD 1NGZB 5CJ5A 3R1GH 4XVJH 2VDNH 4UNTA 5F89A 4AG4H 4GSDL 1DQLH 1FYTD 2BY3A 4RGOH 7FABL 3MLZL 1JPSL 2C1PB 3FB5A 3U46B 4IRJC 5F96H 5EBWB 2N7AA 4L9DA 5CGYD 4JQVC 3E1F1 1A02N 2R0KH 5HHMD 4M5ZH 3P40A 4HPYL 1NCAL 3CVIL 3KPQA 1B0GB 1DVFA 1AIFB 4GAJL 2H3NA 3HN3A 5F7WC 4Q6IB 2YA2A 3TV3H 2D03H 2PCPA 5C09E 1WBZB 5FM8A 1U6AH 5HYJD 3C60D 2Y7QB 5JMOC 1CFQA 4X7EC 1ZHKB 3UBXB 3DX8A 4Z5RB 1IKNC 1HYSC 1YN6A 3B9KB 4EZMA 2YD9A 1LEGB 2GAZB 1LE5B 4QXTB 5AAMA 4IDJH 1K85A 4Y1AA 1REIA 1RMFH 4DTGL 5DDHB 4YX2L 3RVTC 4QRPB 3SKMB 2NY2D 3RX7A 5FECA 3BO8B 3VFRA 4BQ9A 4PJBB 4FQXA 2XN9D 2OX5A 1G9ML 4YDKL 1HK6A 2P45B 3WIIL 2GCYA 3WO3B 3LSOA 2FWOA 1T20B 3HMWL 1OWWA 2MPAH 1AGCB 3FHAA 2FSEB 2A2QT 1YYLH 1RZ8B 4LVNB 3J7HA 5EBGA 1KJMB 4MB3A 4POZD 1IGIL 3D85B 1N0LA 3WNPA 3ZE2E 1LD9A 3MJ9H 1JGEB 3DOSA 2ICWA 4Y19E 4NNYB 1F45A 4NBZB 1MWAA 3MXVL 3UO1H 3DYPA 1N6QH 4JPIA 1MRFH 3DARA 8FABB 5MEOA 3MLRH 2VABB 1R0AH 1OGTB 3RX8A 1BLNA 5GRZA 1QBBA 5CSBA 5L8LB 4Z95L 3LPFA 5ID1B 2OLDA 2P5EA 1XZ0B 5F88B 3ECBA 3ZKND 1JZ7A 1AO7B 3FB8B 5INCA 1FSKB 3FO9A 2QJDA 3PXHA 5I66A 2J6EH 3IDUA 4H20L 1CVSC 4M6ML 4MB4A 4U0RB 3VE0A 1N59A 4O4YL 2AV7B 3SDXA 1FFRA 3ZTJG 4P4KA 3MRBB 2YD8A 4FQCL 2GITB 4GMTH 3L3GB 3ERYA 1TIUA 2AABH 4I13B 3ALXA 1U3HA 4N0FB 5EU6E 3LS4H 4FOMA 3TPKA 3AMKA 4V1DE 4N90E 3OZ9H 4OCXH 5ISZD 2BSTA 2NLJA 5C3LD 1D6EA 4XP4H 3ALPA 3O8XC 4XNMA 1NLDL 3BDXA 1ND0B 3AROA 1CL7L 3QEHB 4HJJL 2D7PA 5DRXB 5IW6B 3QZWG 3UTTA 3ZE0F 4FXGB 3JV4B 5MERA 5DGQA 1G7HB 4PJIB 1F42A 4HV8B 3BYYA 5A2JH 3MV01 1GGBL 1G6RH 4X6CB 4CRPA 4K9EC 3EOYG 1OTSC 1AO7D 4U1GB 4NP4L 1WEJL 1NC4B 5DMGD 5I17B 1IC7L 4KJWC 1V5JA 4HWEL 2CRYA 3SDAA 1AJ7H 3Q6FB 2EYTB 2P8MB 1MHHA 1A4JA 3ABZA 5ADOH 1GC1L 3KXFD 3V6FA 4MNGB 1WIUA 5DT1L 3V5KB 4CBPA 2RAMA 5DMJB 4JVPA 3T0EE 3QHZL 1I3GH 4PUBH 4XX1E 3TCLB 1AXTH 3NCCB 1LEIA 4G9DB 4AH2B 1Z5LB 4G6FD 1CDGA 4HBCH 1NDGB 5D1ZA 1RPQA 4WI4A 3QUMB 2QSCL 2APBA 2XV6B 5C0BD 5JPMA 1HEZA 3V4VH 2BK8A 5C8JA 4I2XA 5CKGA 2DI8A 1CQYA 3WDJA 4HQQH 3DBXB 3TH3T 3EJZD 4KROD 2AJSL 5I19H 3U4BH 5DJ2A 3QPQC 5JXEC 5C0GB 1A7OH 3GKZA 1G7LB 1X5HA 5SWZA 3CH1A 3WSQH 3B9AA 4JDTL 4HT1L 4N8CH 1UXSA 3M8OH 3RVWD 4I18A 1L0YA 3DVIA 3ES6A 4R97B 3GMLA 4F37F 5B3NA 2X09A 4ODUB 3THML 1UM4H 4QRRB 2X4PA 2VE6A 4OQTH 1ULVA 4UAOC 5IR1B 2Y5TB 3W9DB 1TXKA 4NNYA 2BSRB 4ZFOA 2YBRB 3VXRA 1QOKA 3BZFB 2ZKHH 1Y6NR 4F7MA 5E24E 2QR0A 3L1OL 4EEEA 4JM4H 1I1FB 4Y4KC 4W6XB 1P5UA 1BOGA 1ODAA 4NC0B 3H9HA 1ZHLB 1A1NB 3CUPA 1T1XA 4MA3A 4YDJA 5C0FB 3PDOA 4NKMB 2Q20A 1OLZA 4DOHE 4JY5H 3HI1A 2J8UA 3VA2C 12E8H 1MCQA 1T2QL 1DQQB 1X5XA 3TC9A 4B0MM 5MERB 3DVNA 3FQXB 1YMMD 5IB2A 2M8XA 4XPGH 5C71A 5EA0H 2EXYD 3FB5B 3U46A 1MCIA 5EZJB 5EU4B 3QFDB 3ARED 2QADB 2YSSA 3ZTJH 3UTTE 1QSEA 2HJLB 2ERJC 4PJEB 3PP3H 3WHXB 4NJAH 4MQXC 1KACB 1Q94A 2PTTB 1RUKH 2DKSA 1C5CH 4HS8L 5F8QC 2DQJL 2D0FA 5DRWA 4HKXA 3GKWL 3MRGA 4IOSD 1WZMA 5C0JB 2ED7A 1KYOJ 1JUFB 4NIKB 4YDVB 4G3YL 4PS4L 1KBGH 1ORQA 1ZV5A 3WL9B 3EO9H 3I6KA 3VWKA 2WIIA 1UWEL 1VFUA 4X5XB 5KS9A 3IFPB 3PXJA 1N7ML 5FOBA 1MOEA 3TEUA 2A1WL 1CTNA 4NZJA 4RMWA 4X6CA 1NPUA 5C0AB 3N06B 3NFSL 3FKUS 4LCCA 1QEWB 3PL6B 4NQDB 5DLML 2BNQD 1FORL 1A7PL 4DOHB 5LBSH 5IB4A 1X4YA 1MF2H 1I75A 3OXRB 5E1AB 5I8EA 1CFTA 4NNPH 1FG2B 1KXTB 3T2QA 3TFKA 4X4MA 2F5AH 3NIFF 1S7UA 2YRZA 1S9XA 4PJ5B 4K8RC 2WBJA 1SMOA 2CR3A 3BEVA 1J8HD 3PG2A 4HF5H 4M00A 4LCYA 2KPNA 5IB3B 3QDHA 5L2KD 2HG5B 1WTLA 2GJ6A 3UC0L 4YFLI 4O9HL 5KANI 5KZCD 4ZXBB 4ZYKA 1AO7A 2I25N 2HKHL 2WMPA 5EU7E 3I6GB 3PWPE 2X4TA 3RU8L 4G42B 1DEDA 2FJGA 4DVRL 2HRPH 2X70A 3V95A 4R90H 5C0GA 4KZEH 4TUJA 2DQIL 3F58H 4HS3A 3QG7L 2DIAA 1DQLL 4YBLC 4YHOL 5E00B 5HGDA 1TZHB 2G5BA 1NGWA 3BAEL 4JGJA 3FCTA 3JWOH 4OI7A 1XGRB 1DBAH 1MCHA 2GTZB 1N5YH 1UYWL 4Y5YC 1A4KA 2AJYH 3ILPA 1X5JA 4R26L 2JB6A 3ARBC 3U0TB 4BQBA 4I5BB 4RAUA 3OAYH 1VPOL 3RUGF 1LILA 1JPTL 3BT2L 1SJEA 5JOPD 4CMHB 3LN5B 1DN0A 1UT9A 3TZVB 2A6JB 4DFIA 3TJHD 2W65A 4GLRH 2PKDA 4GMSL 1AP2A 3OF6D 5GISL 4HIEB 4GG8B 2P8LA 2XI9A 4HWNA 3VH8G 5D1XC 4DTGH 4HIXL 3IXTB 3MA9H 1RZFH 4RA0C 1IC4H 3VXRE 3VGDA 1JF1B 3GSNL 1RULH 5D7JA 1N8ZB 1NCTA 4UQ2B 1IMHC 1IGML 3IVKB 3QI9D 3HLAB 5FUCC 3VXQB 3FRUB 1CLOL 4OIIH 3TESA 1WK0A 4NKOA 5GS2D 5FDYA 3O9WB 4HKXB 3LQZA 2P5ED 3PP4H 2GEEA 3EYQD 1NCBH 3TN0B 5IOPB 4Y88A 2OL3H 1KCRL 3U9UB 2OL3B 1L9NA 3IETB 2F54A 2WW8A 3QJFA 3QI9C 2F5BL 4TSCL 1FCCA 2YD5A 4LMQE 3MLRL 3S36X 3HUJF 1LDPH 5T1KA 1MEXL 1CGTA 3MNVB 3AREA 1U3YA 4JG1L 2GT9A 3STLB 4NPYB 1C1EL 4WFFD 4WI6A 3HZYB 5BO1L 1EO8H 1NFIB 1FJ1A 3HPJA 1GH7A 1HINL 1OTUD 4HUWA 3BZEB 3SJVA 1DBKH 4N9GA 4OLWL 3HZVB 4L8SA 4H88H 4OJFL 4Z78B 1R3HA 4UQ3A 4P99A 1JCKA 2J6EL 1I1AA 2CLRA 5DQ9B 4LLMB 1YEJL 1J05A 4PRIA 4HWZB 2FGWH 1I8KB 3VH8B 1NEZG 3VG0L 1LO5B 3N1FC 4RAVB 4XBGB 3VWKD 3AY4A 3RAJL 1GOFA 3GJFH 4UOJA 1S5HB 4HAGA 4JVUA 4N5UA 2F74A 1LO2L 4U1HB 2Q7YB 1T1XB 1EIBA 1Q8MA 3E6HA 1HKLL 2J8UB 4OFKA 2FEEI 3UP1A 2X4RB 3VFVB 4NQUA 5CS7A 4XAKD 4YEFA 3QQ3A 4JKLA 5I71B 4EBQH 3FHQA 4JPIB 8FABA 5MEOB 3EOTH 2FBJL 2EEAA 2DQGL 4K2UH 4PB9H 4OLZL 3GHEH 5HJ3B 3TIEB 4XCFL 3LDBC 5FV1L 2HFEB 1N8ZA 1CFVL 1JE6A 1MY7A 2J12B 3NCBB 5LGHL 1NGPL 1K4CA 3O2DA 1G6RL 3HNVL 4ZPTA 3SDDC 3WUWB 4L8DA 5ESVA 1CDBA 2NX5E 4H5SA 5DVNA 4AJ0A 4I4WA 1RJZB 3HI6H 5IOPA 3RWFA 4OF3A 1H5BB 3EUUA 3L5WB 2P5WA 4HK0A 3HFMH 3VXUD 1MJ8L 2YHGA 4G80B 3ZDXF 2DWDA 5DMGC 3PL6D 3VXSE 3MRRA 4FXKA 2ICWI 2V2XA 3VWKB 4AMKH 3FONB 3RHWF 1QPPA 3KR3H 3LMJH 3L3DA 1TVBB 2F8XC 1F6FB 1I9JL 5ADPL 4K3DL 4Z6AT 2FGZA 2FO1A 5JIHA 1H3GA 3BE1L 2QSCH 5AAWA 1ZT4A 2VLJE 5CEXB 5GSRB 2E7BA 4JFHE 5IB5B 1V7MH 4C57C 2C3XA 4YGAB 1JYNA 5JTWA 2CKBB 5D96C 4WV1B 4GKSB 1HHKB 2D0HA 5DQ9A 5J8OA 3WSQL 3LQZB 2X42A 1IM9B 4NC1E 4N8CL 3HUJA 3VWJB 1JPGB 2EIZB 4QY8B 3WFDL 1OSPH 1NGYB 1G7PB 4LKCA 1UWGH 2IJ0C 3U0PA 2LTQC 4P2YA 3F62A 2Z31D 4PRDB 1D5IL 4X9FA 3T1FB 2EDFA 1M4KA 4QT5B 4MSWB 2P8PA 4P59H 2D7QA 3H42L 4IMKC 3N9GH 1M7DA 1MHEA 4G6JH 1CK0H 1NCUA 4M7LL 4H8WC 2FIKA 3NCJH 1PY4A 4Y1AE 3TYGL 1PYWA 2OZ4H 4ZUUB 1EAPB 2A83B 3OAZK 4KI5F 2NY4C 4R96A 3VRIA 4MWFA 1PX3A 3L7FB 3VXUE 4M1DH 4JLRB 4WGWB 4LSVL 3WKMH 3QUYB 4DGVL 4F58H 1Z0NA 4X83A 2A9ML 5IK3B 2EH7H 1BOYA 4QRUB 5INDA 2H9GA 1I7RA 3ZDZF 3H7LA 3NH7H 4HKBB 4B50A 1FL5B 5FYKL 1NMCB 3CCHB 4JFEA 1DUZB 4WFEE 2BMKB 4RGMC 4YHML 3P0GB 5KG9A 3NFNB 1FVDB 4EQ2A 2MWCA 5DD6A 3IYLW 4HDIB 3KJ4B 1RK1B 1IAII 1S9VA 1KCKA 3UTSE 4H0HB 4H1LG 4EIGB 2W91A 3VFTB 3PWNA 3QCVL 1LNUB 1MJ7L 2X4RA 3ZT5A 1DN0B 3MV7B 3BJ91 3MRRB 2NY0C 4NN7B 4FMKA 4CW1B 2O5ZH 3VD3A 3QG6B 1JWUB 1CYGA 1BM3H 4CDGC 1MAML 5EPMA 1MWAB 4N9OB 1UXWB 4QF1B 1OGTA 3ZKXB 3UTZB 5E5MA 1RFDL 2J4WL 1T7WA 3ZE0E 2CDEB 2P42B 3B8SA 3EJYD 4OLUL 1DVFD 4MJ5B 4ISVB 1WFNA 2IPTH 4DKFL 1H3VA 1KFAL 3H0TA 2JJTA 1K4CB 5SX5K 5J11B 2H45A 4QWWD 3JTSA 5D7KD 4U3HA 5T3XE 2R29L 4RWYH 1JBJA 2NQCA 1WC7B 1JPGA 1OPGH 3IJSA 4XHJD 5IIEA 5IROC 1FRGH 5JW4R 3BKYH 2B39A 1FNSL 4QTIL 5GGRA 1ITCA 5CBEA 4UTBH 2FYYB 5EIQA 1OHQA 5IBTH 2AK4A 3G5ZA 5EO0A 1QPXA 4ZQKB 4JHWL 4LCWB 3ULUH 5HVHB 2LU7A 4LNVA 4D0DB 1HE7A 1MREH 3V0VA 1EHNA 3NPSC 3F7YB 4Y5XA 1JF1A 1MHPH 4QRRE 4IDJL 1N5AB 2HT2C 1JHLL 4XNUH 1FBIH 1HH9B 3AS3A 3QEHA 4KK9C 2APVA 1YY9D 3O6FC 5AYUH 1JGUH 3MRQA 4U1MB 4O58L 4DZ8B 1T7ZA 1JZ2A 4YXLH 5BZWA 3QG7H 2P5WD 3UJJH 5FFLA 1AQKH 4PGCA 2AJZB 1KGCE 5D2LB 3RGVB 3P9MB 5DMKB 4P4KB 3PL6C 4Y0GA 2W59A 4KXZH 5BW7A 4XI5D 3NIGE 3S36H 3T04D 2DWEB 4YHKH 3FAXA 2FJFA 1Q1JL 1RD6A 4KDTC 4HMDA 1KF9B 2E27H 3QO1A 2RGSA 3G04A 2HFFA 3ARDA 4EI5B 1V7NL 5K59F 35C8L 5EUKA 2I60H 3RA7H 3SDDD 2BOBA 4LSRH 4LOUC 4WUKH 5IQ7H 4FQ2H 1L7IL 5A3IC 4PD4J 1VCAA 3MFFB 2XRAL 3MJ7B 3GM0A 5D7LE 4HIXH 2VLLB 3M45A 4JRXB 1RVFH 1QD0A 2VOTA 1J5OL 5E9DB 3RKDC 1IGMH 4YDIH 3O6MH 1NFDA 4JY4A 4KQ4H 4RWHA 4IRJA 5T1KD 3TVMB 4NJ9L 4WWKB 1OQXA 1J1PL 1RHFA 3EGSA 3NCEB 5FOJA 1I1YB 1NBVL 1NGWB 3DROB 4D0BB 2P46B 2FRGP 5D1QB 1LDSA 2EDWA 1MI5B 4CW1A 2BSED 4OGAD 4BFEA 4FQHA 2R0WL 4LLWA 3ILQD 4QHUA 4QHLA 5EOTB 3MV8E 1URLA 3MO1B 3MLUH 3RDTD 2ATKA 2RCSH 5SWSB 3HUJE 2VXSL 5DJ6A 1XGTA 3RWEA 5ILTL 2R8SL 1DANT 4PRHB 3TPUE 3QDMD 4P2QE 5GS1B 4DN3H 1Q0YH 3EYVA 4NOBA 3REWB 4L8CB 4MCZA 5JOFA 3HE6C 1PG7W 3EDEA 4L5FL 3TYFA 3V8OA 2JE8A 3BP5B 4OLVH 4FTVE 4GQPH 2YPVL 4UT6H 4NRZA 3AB0B 2CO6B 3NIGF 4HUMB 5JDJA 1AGFA 5IGXL 3ARGD 4OD3L 4FTVB 1NFDF 4PJGA 4WO4A 5E9DD 1AI1L 2EDQA 2IPKB 3C5JB 4BFIB 4L1DA 3PWJB 3QFJB 4PJ9C 2PTTA 3QUZC 2FJFB 3EZJB 1KNOB 3PDDA 3WS3A 2N7BA 1HKFA 3FN0H 4PJFF 1DSFH 1E6OL 1LO2H 3U36B 4IJ3B 1HKLH 1WBYA 5IB1B 3ZKXC 2BOBB 1IQDB 3D85D 5J0BA 1BX2A 3O4LB 3D18B 1A0QL 4EXKA 4KHXH 5AEAA 5BOPA 3DGCR 2OQJA 4KK9D 4OZFB 3PHQB 2DL2A 4EBQL 4ERSH 2NY0B 3PWUA 1ORQB 3WL9A 1J0KA 1NAKH 1XCQB 4MAUH 4OLZH 2HVKB 3NFNA 2X05A 5EDXA 5GZOC 3GI8H 5KOMC 1P84J 3CFIC 4X6DA 5FDWA 5D2NE 2YWYA 1RI8A 2GITA 3BRGC 4JFZH 1JZ8A 4L8SB 2P43B 3IDNB 1AXIB 3QIUB 3PP3K 1I1YA 1LO3L 4IRSD 4UILH 2DWEA 1IZKA 1Q94B 4NYLB 3AU1B 3ROOA 2QQQA 4NFCA 3DI2B 1VKXB 3IDIB 1ZHBB 1MFBL 4ZUUA 4NWTH 4R2GD 4RQQA 3TF7C 4LEOA 3P0VH 3P9LA 1SEQH 3W2DH 2F8OA 1MI5E 4WENB 4L4TE 3O3BA 2OCFD 3UTZA 3FZUD 4TUKL 4PGEA 2NX5A 3AMLA 1P2CB 4XPBH 5CJBA 4M4RA 2VQTA 1OAQL 5T1DL 1KPRB 2HG5A 1P4LB 1CXEA 3TNMA 1S8DA 4RGND 3P11H 1KTLB 4JJHA 1BGXH 3BP7A 5EBLB 4A6YB 3QQ3B 4NSKA 1FN4A 4Q9QL 1V7ML 3MNWB 3MLVL 4V2CB 1NGQH 4CN1A 2P7TA 4KKLD 3VE0B 3I6LE 3VXSD 3CFCH 1QFHA 3SGJA 4F9LA 4C83B 3HE6A 3QDGB 4GW5A 3ROLA 3D0LB 4Z7UB 3VW3H 3GSOB 1A6PA 5DFTA 3TH4T 2PW2B 5CEZE 1O5DT 1RUKL 4APQB 4F7PB 3KLAA 4P3DB 4J4PD 1H3PL 4IMLB 3GO1L 3QG6A 4MDJB 2XZCH 4OZGB 5E8EB 1BIIB 2UUDK 3CFBB 4R9HA 2Q76B 1FAIH 5B4MD 4G5ZL 1MFEH 2HT4C 4J3TA 5DVKA 3TCLA 3WDIA 2VN4A 5FF6A 5LAXA 4FFVC 4OZFH 3H42H 1A1MA 5DGRA 5D71H 3V4PH 1I85A 4WI9A 4K55A 2FH6A 1QFWM 3CFEB 4QRRD 3FO0H 4NGHH 4X7FC 5GGTA 3SE9H 2AI0H 1K6QH 1QO3A 1HHGB 3H0TB 1HEZB 1IJ9A 1FCGA 3C8KB 3CVHH 2CK2A 4U33A 5IEHB 5F6HI 4G42A 1EO7A 2EH7L 2R56L 4V1DD 1ES0B 3BRDA 1FZKB 5DUPH 1FDLL 1XF1A 4NRXB 3NH7L 1NSNL 3RIAK 1GZQA 3P9MA 4YFDB 1CDJA 1FP5A 1ZT4B 4RGNE 2OBGA 2ZUVA 4LCCC 4NWUL 2DTSA 4QRPD 2EYRA 4PBWD 2P8MA 5HHPA 1A9EA 2NNAB 4RNRA 4PJEF 3LQAH 5FXCH 3MFGB 4S1RL 1OOAA 5I1IL 3X12B 1L6ZA 4KAQL 4X6DE 4TNVK 4POUB 3DPBA 1I1FA 4N0RA 3V0VB 4DQOL 5IV2B 1OF2B 1N5AA 3LIZH 3QDME 4P2QD 3T0XA 5I16A 2QKIB 3MRIB 3CK0L 4NFDA 3U9UA 4W68A 2QQKL 3X14A 1U8JB 1BM3L 3MGAA 4E0RB 1MRCL 4IRSA 3ULVD 3G08B 3VG9B 2OSLA 3F7VA 2PYEE 3ARGA 3LOWA 3CLFL 3SO3B 4ZTPL 1EEYB 1ZE3C 3C5SA 2Y07L 3WFCH 3VXRD 2VDMH 5DJ2B 5EBWA 1G9NC 2MCPH 4XPTH 3VGAB 2ENYA 2V7NA 5H35A 1MRDL 3V6ZA 4W70A 4I1NB 4JFPB 1VFAA 2DQEL 2MMXA 4M8VA 5BVPH 5IFHH 1UB6A 4ZAKC 4QXGH 2AJVL 2J88L 1KIPB 3L6FA 4WEBL 4JHAH 4GH7B 3OKLA 2ZUSA 4P2RE 1YMMA 5HDBE 2P48B 4P5MA 1T04A 1YQVL 4YAQA 5CUSL 4JFDD 3UTQA 1C7TA 2FO4B 2VC2H 5C0AD 1LK3L 4FQJL 1XR9B 5IMKB 4GFTB 2VDRH 3UXFA 4JHBA 1WCQA 1P4LA 2XOTA 1G7MA 3G6AA 4GXVH 1LP9A 4XT1C 2Q86B 4NKMA 5EORH 2VZ1A 3CVHB 4MCYB 3VXUB 5IVNA 5C07B 1MREL 5EOCL 1AC0A 3T65A 4KKLC 2AKRB 4NHUB 1MHPL 3DWTA 1OGAE 1E4KC 3B9KD 4R3SB 2AQ2A 4M1GH 4NOFA 3CXHK 5I73C 1T66D 1NQBA 1HSAA 1YC7A 3SE8L 3GSNH 4QGTA 1CIDA 3VGGA 3WFHB 4NZRH 3QEQB 4KJPC 3U2SA 4JFOA 3MNZA 1PQZA 3HNTL 1S9KC 4I18C 4U31A 3AM8C 1KPUA 2GK0B 3GBML 5HY9A 4AEHL 1KNOA 1GOHA 2Q76A 2NY5H 3R1GL 4EN3A 4WNQB 5IBUG 5K9JH 2A6KA 2Z35B 4JM2F 2VDNL 1RJYB 5B38B 4BUHA 2OS7A 2QV2A 4OGYH 2UUDH 4N8PA 1KCSH 3Q6GL 1QLFA 1ETZB 1M71A 2CDGA 5JOFB 1AQDA 1BJMA 1C5DA 1Z0MA 5GS0D 5HGBB 4PJ9A 2G2RB 3WYRA 3UJIL 1DL7H 5M94B 4Y8AA 2XICA 4JN2B 4GG6A 2CGRL 5I1JL 2BJMH 3MV7D 4Y19B 3FQTA 1NL0L 2NR6D 4PJGB 2C7UA 1WBXB 1VACB 2I9LA 1IAOA 4L4VB 2R23B 3SDAB 3O2VL 5GGQH 3AC0A 1YEJH 2G9HA 4J2XA 1C8PA 5KJRL 1E4KA 1OAUH 2IFGA 3B3IA 1FGVL 1G7JB 5HHOB 5FV2A 3PWLB 1QVOB 4I0PB 3RWCB 4JN1H 3QUZD 4FRWA 2QKIA 5DJDB 2Z93B 1OAKH 3ULUE 1RUAH 4TTDC 4YEEA 5IB3A 2DI9A 5F1NB 1INQA 2XKUA 4ZXBC 5F3HA 2H32B 1Q0XH 3CFKB 1AY1H 4NM4H 3JWDC 4BZYA 4DUWA 1AFVL 3IGAB 1IGIH 4ZAKA 1K5NA 3BWAA 1LO4H 3GB7A 1RSFA 4KFZC 1OP5H 2P7TB 2ZSVA 1X3DA 2LE9A 4JJ5B 3VJ6B 5CCKL 3HNSL 3QRGH 5J6GB 5TDPA 3KPNA 4D9LH 1F3JB 4KI5C 3D0LA 2GTWA 2ICES 3CLEH 3KGRA 5AYQA 3MJ6A 2PW2A 1K2DA 1QSFA 4BH7B 1Q9LA 1JFQL 2VSCA 5FGCB 4LSPH 1BPVA 1F90L 2OTUA 1NKRA 3V7AE 1GAFH 1QFOA 1OB1B 3HI6L 1I8LC 4PGEB 3OWEA 2XY1A 1BOGB 2FJHB 1RZGB 3H9HB 1N26A 5TDOA 1DDHA 5IW1A 1N4XH 1VFBA 2SEBA 1R3LB 4WHYG 1D9KA 3TNMB 2A38A 4ELME 2HT3D 4M8QA 4K71B 4LSTL 3T65B 3UZVB 3BP7B 3OJVC 2A6JA 4O4YH 5C2BL 3CDGA 1PW3A 5L2JA 1KCVL 3FFCD 2R9HD 2PN5A 3AAZB 4LLQB 5MEPA 2HMID 4FQHB 1AD0A 2KBGA 3MV8B 1BECA 3RKDD 5ADPH 3QEUA 4X9BA 5CMAA 3SKJH 1U91A 4XNQB 5JW5A 1NAKL 2G75A 5JDSB 4JPVL 2XTLA 1P4IL 4M62H 2K1MA 2BNUA 2EYRB 1CD1A 3CPLB 4LLMA 4ZOAA 5K9KB 2ZCLL 2IC2A 1ZLUH 3NVQA 3UTOA 2F53A 2IBZX 4K7PX 4GKZB 3PABA 4Y2DC 3FFDB 4Y4FC 3UJTH 1D6VL 3FOLB 3C60C 1DQTA 4R8WH 5E99H 3A67H 1BBJA 4BK4A 1GGBH 2MKLC 3DI3B 3GSUA 1OQOA 4UOW0 4YIQB 1OTSD 3PV6A 2PXYD 4DAGH 1A6VH 4OSUH 2COQA 4LQFH 5CIPA 3ARDC 5E8NA 5JOEA 4O02H 4L29B 5HJ3A 5TF1H 4L8BB 3QWQB 2VLMD 3AGVA 2XIDA 4GUPA 1UVQA 2C7UB 1U8MA 5HYSG 4DK6A 4JZJB 4PUBL 5E2JA 2RJMA 4L3CB 2QEJA 2B1AL 5KTEH 2R0ZL 5C0CA 4WUUA 2K3TA 4U1KA 2HLFC 2IQAB 2O5YL 3Q0HA 2DYPB 1P7KA 1YJDL 3WN5A 1MCKA 2FH8A 3DUSA 4PJ9D 2XZAH 4HD9A 3L3JB 4S0SD 1EGJL 5FHBL 4PJ8B 1MCSA 2AJSH 3L95A 3RWDA 3OB0H 3LRGA 4LEXL 5J4MA 4BZ2H 5KSBF 3SJVE 2O5ZL 4D0DA 1YYMH 2VWEE 2A6DB 5I2IB 5D1XD 2H32H 3PGCA 1MFDH 1XR8A 2ATPB 1J87A 2Z4QB 3IU3A 4V2BA 1ZGLP 4GQ9H 1U92B 1BEYH 1R6VA 1EFXB 2B20A 3G6DH 3U2SB 4K3JL 4JM4L 3HG1D 2KDGA 4XRCA 4ZOCA 1TVDA 2GTZA 5E94A 25C8L 4JRXA 1F6LL 2R29H 4E41B 4XMLL 1SVCP 4HIHA 5DHXB 2EH8L 3T4YA 1UH4A 4X6FA 2VLME 2VZ3A 1IAKB 3PJSB 1U3ZA 2HTKC 1Z5LA 3U0PB 4X6EB 1ZLUK 1N2RA 5E2UH 2SEBB 4G80A 4KAQH 3SE4A 2DWDB 3ROLB 3S34H 3U30C 4DQOH 4HPOL 4JHWH 5ICYB 3ULUL 5D5MB 3IFNL 1BAFL 1LD9B 3N1QC 3T4AB 3OGOE 3EIFA 4PJ9B 3MLSL 3VRIB 4EDXA 1CD8A 4GJTB 4GG6F 3WN5C 3RI5K 4OLXL 3G6JF 3QWRD 1C5CL 4RMSA 3GMMA 1E28A 3I9GH 1ZEAL 2HH0H 1CU4H 3OKEB 3B2UD 2PYFA 1F8TH 1ZXQA 4OF5A 4AEFA 4AL8H 3S96A 1U3HC 1IEBA 1FYHB 2E8ZA 3VXTB 3DX9B 3VXMB 4HC1H 3JBG7 4KY1L 1KBGL 1XIWB 3P0YH 3P77B 1HZHL 2MKWA 3VD4A 4FQIH 1BJ1J 3MCLH 4TTGA 3MRPA 1IGFL 1ZHNB 4A6YL 4PB0H 4KZDL 4LSUH 2NY3B 5E8PB 3P3YA 3X12A 4PJIE 5EOTA 1KB5H 2HTLD 5DRNB 5DSCA 1VEOA 3N1PC 3MRDB 1W72A 5GZND 2ATPA 1YNKH 2OJZH 1NAMB 4KUCF 3ME0A 2HWZL 2R2CA 1IAOB 2DN7A 2H9GB 3T0VA 5SV3A 5CGTA 4K94L 1TITA 3VCLB 5HHQA 1PD6A 2E9IA 1U2HA 3JV6A 2W9DH 4Y5VB 3QISA 5INCB 1RVFL 3NPZB 3W5NA 1AKJD 4Z0BL 4JGUA 4MNQA 1GPOH 1JK8B 1FPTH 5IIEB 4KQ4L 1XF5A 1AGBA 5C07E 2Z91A 4PFEA 4LKXA 5HTSA 1GC1H 3L3JA 3IFOB 5DFWH 1EV2E 4AEHH 4NM8L 1BFOB 1NGXA 5DT1H 2WWKT 1TZIA 2VLKE 4N0UA 2EYTA 1T5XA 4CVXB 2QLVB 1BHGA 3D87B 4TVPD 4BFGA 3CDGB 3SHSA 4Q7DA 1CFQB 5TPWL 4OGYL 4QYOB 2GQHA 2DDQH 2NXYD 4GAYA 3H9ZA 4OZ4A 5DRZB 3FTGB 4HHAB 4D2NA 5J6HB 4YXKH 4QF1A 1KCSL 5KSBE 2JCCB 4XNMB 5C0CD 4QNPE 2B5IC 3GNMH 3RZWA 5I76A 5L0QC 1T0MA 1ZT1B 1TFHA 1WISA 3FT2B 1DVFC 4FXGA 1MCBA 3EJYC 1G0DA 4DZ8A 1I8MB 5BV7B 2ADFL 3JTSB 3VGBA 4HWZA 1OY3B 2H8PB 4NSKB 2OZ4A 1QSZA 2VLJB 3IAGC 3BH8A 3MOBL 2OXGA 2QADD 5LWYH 1G7LA 2P5EE 5GGQL 4JDVB 1YN7A 4LNRB 4OUUA 1T1ZA 1OAUL 1IFHH 1JNNL 3BN9C 2Q87A 3S35X 2WAHA 3MA9L 3VDCA 7CGTA 3SQOH 1IGJB 5EO0B 1RULL 4ODBD 4B5EA 4HJGA 1F97A 2VQ1B 1E6OH 3BZFA 1PSKL 2AQ3A 3EOBB 2UYLA 4C56E 1SEBA 3UDWA 3FQRA 1A0QH 1JNJA 4MS8C 5GSRA 4D3CL 3QIWD 5A16A 3SDAC 4OI8A 2EDDA 3CFJB 5F3BA 1GGIL 1E4XL 2FCBA 3HC4H 3L3OB 4GAGL 1VGKB 4X6CE 3ECBB 4NCC1 2GFBA 4NN5C 5ENWA 2HJKB 4Q9CA 1HHKA 5E2WL 3C5ZA 4G9FA 4F9LC 4DGIL 3BRFA 3O41B 4XVUD 1VFMA 1FIEA 2JB5L 1AGCA 2AXGB 5D2LA 3RDTB 3SOBH 4GG6B 3EYSH 1OVZA 4XTRC 1T7YA 1GIGH 1C1EH 2EYSA 2HJLA 2YZ8A 2Z31C 3RWDB 3T09A 3NCYS 4MJ2A 3MUY1 1FNAA 1BREA 5HVFB 1ZA3B 2FIKB 3E6FB 3TLRA 1I3UA 5D1ZC 3V4UL 3QQ9D 4AIZA 2ILLA 1EMTH 2ORBL 1F58H 4YHZH 4DUXA 3RGHA 5MI0C 4KPHL 2CIKA 4O2EB 4O00A 3AXLA 5HXMA 1F02I 2VITB 4ZFFA 5C0FA 1U92A 2VL5A 2JCCF 1ZT1A 1QG3A 3TJEL 5AWNH 4JB9L 2D7MA 2YC1B 1CT8B 5FGSA 4ETQA 3HR5B 4I77H 1ED3A 4R4FL 1SJVA 5HHME 4NNXA 1MFCL 4OD2A 3LN9A 5SWSD 1FZKA 1TMCA 3UYRL 5E4EC 3KYKL 3MODL 4MJ4A 4M62L 1I9IL 3RL2A 3OKNB 2R0KL 1IBGH 4J6RH 5I1CH 5LBSL 4L3EB 1S3KH 1T80A 5CD3A 4F7CB 5I18L 2F5AL 2YPLB 1KJ2L 2Y06H 2FBJH 4JVWA 4RISH 4L4TB 3DLQR 3D25A 1A4JB 5D7IF 1TZGL 2BVEA 3B9VA 3MRJA 4XCEB 4Y4FD 4PJ7E 3O45A 5SWZE 5ABDE 4PP1C 3FO2A 4HC1A 3ESVF 2O61B 1V05A 4IMKA 3H6JA 4M03A 3T3MF 4TSBH 4RMUA 1RMFL 2XWBB 2DD8H 3RP1A 3VXMD 1S7RB 3DECA 1QYGH 2ENSA 5GS0L 5FYJH 2UZYB 3KPSA 5DJ8A 3U6RA 4R90L 4WFGD 4AM0A 4GRWF 1RJLB 3FB7A 1QSVA 2WIIB 1FVEB 3M17B 4R0LB 4DN4L 4PLJD 2H8PA 2E8YA 5DUPL 3WLBA 2XNAB 2MPAL 4ELMA 1OAYH 2DQDL 2NY0D 3QULA 2DMBA 2EDTA 3TJHA 2B1AH 3LEYH 3KR3L 4F37K 1I9JH 1JNHA 1LK2A 3VWKC 4RQQB 1WZ1L 2GHWB 1D5MB 1HCVA 5DI8B 5ANMB 4WW2B 3K74B 3UTQB 3K0WA 2XXCB 3B8YA 1ZSDB 1OSZB 1X5AA 3VFWB 3LEXA 2X6MA 1JYVA 2UVFA 2R0LL 1VGEL 4KDTA 5E70A 4PV8B 4X0KB 3S96B 4C58B 5KSBB 4U1JA 1YEHL 1QLFB 5I9QB 4XMPH 1QFUL 2AAVA 3HR5A 3GBNL 4RX4A 4HIEA 3DETC 4RFOH 3TFKC 2C4FT 4UIMA 5B8CB 5BV7C 4O2CA 4OFYD 1TETH 4M43L 3H2WA 3SO5A 4IBLT 4GMTL 2WBWB 2AABL 3KNBB 4NC1C 4UT9H 3LS4L 3EOAA 1MCOL 4QRQB 5EC2B 3F6IA 4KRMB 4B53A 5J1SC 4HIIB 4P5TD 4DK3A 3OBAA 3MRJB 5KVMC 3ILPB 5C0AE 1IE5A 4TVPH 5C0RL 4NQVB 4FG6D 4UV4H 1DBBL 4OM0H 4U6YB 3WIHH 5ERWA 1WWCA 3RWCA 3RZCB 4U2ZA 1QKZL 4HPOH 1NAMA 5HHMA 3BQUB 1YEFH 2QSVA 4ONHB 3IFNH 1F5WA 2X1OA 3WJJA 2A0LD 5BO1H 1P7QA 3QO0B 4KJYB 5DA4A 1W0VB 3BP4B 2EC8A 4KTDL 5T1KB 3DSFL 3V7AG 3I2CH 1NBZB 1IKFH 1UB5B 3KWWB 3I9GL 4RA3A 1B0WA 2A6DA 2FD6L 2FDBP 5MP6H 1FAKT 4GS7C 5FO7A 5D7JB 1Q9WA 1WEJH 5JPNB 2ED8A 3X3GH 3EYFA 3VD7A 3BESR 2CLVA 1TCMA 3EDJA 2DQFA 5J12B 3S9DB 1JGLL 3DMMB 4CL7A 3CDYA 1RZIA 5CD5C 5E1AA 3ZL4H 3UTTD 3V0WL 2C1OA 3ARFC 4JZNA 1B0RB 4KKCD 5SWQA 4ZPVA 3SKUD 4IRZL 4XBPA 1CFNA 2ATKB 5SWSA 2YWZA 4NQDD 5DDHA 1IQWL 4QRPA 3FQWB 3KYMA 3KLSA 3EOTL 4AM0B 2WQRA 4PRNA 1BQLL 4NO0A 2UVEA 4QCIA 4X5XA 3DXAA 2HWZH 4FQQB 4OV5B 2CK0L 5HI3C 4PJ7F 4P49A 5JUEH 4F33A 1ZS8A 2CGRH 4X4ME 2WLZA 3OJ2C 3SBWA 2Y25A 2DQUL 3FT3A 1AGFB 1JNHB 1J88A 3LRSA 1HIML 5TFSL 1UGNA 4X4XB 4HGKC 3KPRB 5JIPA 4Y1AD 3SCMC 5IB4B 1X5IA 4IIQA 3GSRA 1UJ3C 2BVOA 1GL4B 1JN6A 1MJ8H 4NQVA 4YAQB 1EFXD 2ZSWA 5FYLE 4XCNB 1F3DH 2WUBL 2MQCA 4Z18A 5L7XH 3MLYL 3QDJE 1WBYB 4N0YH 5LCVH 1CICD 5EIIB 3E2HC 3FMGH 2ZZUT 3MROB 1F4YL 1NGZA 1A6TB 5CP3A 5DRXA 1U8QB 1KIRA 3JXAA 3VDBA 1PZ5A 4KHTL 1CT8A 2Z31A 1CLZH 3ARSA 4UUJA 2HLAB 3CX5J 3BPOB 1GGTA 1JRHI 2ZOLB 5ISZB 1NBZA 3KDMA 3GNML 4ODVH 1EHLL 4OFIA 1EVUA 2F54E 2Q3AA 2O26U 2VN7A 4NQED 5F21B 2EXWD 1QSFE 2WIMA 3V5DA 4D9LL 4H25A 4YO0A 5DJ0A 4ZNCD 2Z8SA 4YPGB 4KXZI 5C70A 1CFSB 4JG0L 3QUYD 5KSAC 1F2XK 1RIHL 2RHEA 2IAMD 4MS8A 4KMQA 1HSBA 2XRAH 1GAFL 1UA6H 1XGQB 1YN6B 3B9KA 3BGFB 3QEQD 2VXQH 3KPTA 1FLRH 4TN9A 4M7LH 3CZFA 2XQBH 1BBJB 1Z9LA 4PS4H 3KAAA 3ARFB 4JCMA 1PSKH 2EXWC 4XCYA 4CVXA 5HVWA 4F58L 1XGUA 1G7QA 3SPVB 1EFQA 1KCVH 3EFDL 2W0FB 1PYWB 5TE6L 3LV3B 1NBVH 1INDH 1R3KB 3EO0A 4MQSB 2BHYA 3C6LB 4LIQH 2CRIA 5DEFB 3IAPA 3PGDB 2AGJH 2X4UB 3QXDA 1EXUA 1AR1D 3IU3B 3C87A 2V5RA 1TTGA 2AJXH 3VFNA 1EX0A 1A21A 1CICC 1QBLH 5DFVC 5I8OL 1MF2L 1XCTA 3KPOA 2Y7QA 4K07A 1A7QH 1T6WA 4JPKH 2FHBA 1NUGA 4JZNB 3MV9B 1MJ7H 4UMGA 2VXUL 2V9QA 2FHFA 5F1NA 1V3LA 3B5GA 5FECB 2F74B 1GZPA 3H9SD 5FB8A 3WS6A 2IAMB 4U1JB 5HHOD 2IANE 2V17H 3MGTA 1F58L 1UM5L 5ITBL 4Z7VE 6FABL 4PBXA 4OLUH 4JFXB 5CEYB 1SYVA 1W8OA 3MUZ1 2DQIH 4TNVF 4W4OA 1XR8B 1UXSB 1YEGL 1FNFA 4LQ1A 1UKSA 4F7TA 3FQTB 3EHBD 3C8DA 4RBPH 2E9BA 5D2NC 3QFJE 1XF3A 4H8WH 1N5YL 5GRVL 1GVIA 1T0NB 2NY6D 5TH2A 3W9DA 4PPTA 2W0LA 5E03A 1CFSA 4KKCC 3CJJA 1X5KA 3U4EA 3EBAA 1WC7A 3PDGA 3P73A 4LL9A 5FO8B 2L7JA 4Y5XC 4MJIA 1XIWA 1JPTH 1U2CA 4NO0D 3G5VA 1XGYH 2MHAB 3RIFF 4PV8A 1JWSB 1TENA 2W92A 4KI5D 1CXKA 1QR4A 3GRWL 3LKRA 1INQB 1LQVA 2V5TA 4JM2A 4EOWH 1AR1C 5DQDL 3SKOA 5HGHB 3RVVD 3BZDA 4JRYB 4HUVB 1G7HA 3T2NH 4XP9H 3FO9B 2DM7A 2AEIT 5F6IB 1YC8A 1V8HA 2CMRH 2VISB 3SDXB 1QBAA 5JO5A 3ZKQD 3ULVC 4GQ9L 2DICA 4C59B 2A0LC 4N68A 1AQKL 4XP5H 2WINB 4JQIH 2V5YA 4NQCD 3LKPA 5DXWA 5F9WC 3MQIA 5T1DH 4JDZB 3D39E 1PKQB 1CBVL 1HQ4B 4GKNA 3MMEA 5E2UL 2JIXA 2BSSB 1C5BL 1LDPL 3S34L 2I60L 4MLIA 3V5HB 5T3XL 3D69B 4LSRL 1DEEB 4TRPH 4BQ6A 4WUKL 3MCKA 4D94A 5IQ7L 2X9WA 1G9NH 4NO0B 3MLSH 3C5SB 1KYOK 2BFVL 3BDBA 4NBYB 5DEFA 5GS0C 1JTPA 5D1QD 2PXYC 1UJTA 4ELMF 2RBLA 4G7VL 5ETUB 4NHCH 4OFDA 3GGWA 5FKAB 2Q7NA 3QEQA 5I1AA 4MS8D 5EUOB 1CDCA 1T0NA 3IFLH 3NGBC 4Z77B 2GSIA 1JP5A 2Q6WA 5KG9B 1E4WL 3K2UL 4HJ0C 4PG9B 4UT9L 2D31A 5F71A 2CH8A 1ZLSH 2LU4A 1IM9D 1TTFA 3BMVA 5AZEL 1G7MB 3G6AB 4OD1H 5MI0B 1OWRM 4MDIB 1T5XB 3MGTB 2DLEA 4P3CL 1TJGH 2EDNA 1PKQE 4PB0L 2Z31B 5DYOA 5FGRA 4PJCB 4XCCH 4OCWH 4MHHG 5EZLB 3P2TA 1KB5L 5IHLB 4X4ZA 5TF0A 1G9MC 2Z4QA 3LQAL 1D5XA 4KTEH 4X98A 1UH2A 4K94H 3IJYB 2YRPA 1ZLWK 2ZCHH 4MNHA 2NCMA 3DTXA 3HNVH 1N64L 4IOIA 1ADQH 3DV6A 4NKOB 2WBJD 3ARFD 2QQKH 4JKKA 3MLPA 2EEDA 4FZEL 1NCDL 5TQ2L 1IC1A 1MRCH 1BQHA 3MRCA 4L4VE 4N8VB 3RVXC 4XB7A 3DUSB 3HFML 2X4SA 5IW3A 2OL3A 3EGSB 5BV7L 3VRJA 2OP4H 1CF8L 1T1YA 1DSFL 2NY1C 4LGPB 4ZOEA 5EC2A 1C5DB 1O0VA 1U3JA 4IRZH 4ENED 3HB3C 2VL4A 4M3JA 4MVBD 4D9RD 1IQWH 1CCZA 5F9OH 3ARQA 5IHUL 4KJQC 4LHUA 4FFZH 5EC1A 4F3FB 1UJ3A 3WD5H 2VDLL 1JV5A 1NKOA 4WEBH 5HHMB 5T3ZE 5ECJE 3VGAC 4YPGA 2NX5D 3X11A 3MRQB 5DEGA 5JUEL 3O8XD 4LCUB 3DO3A 1IRAY 1WAAE 3MBEA 4ZS7H 4GXVL 5E8OB 1CN4A 3EYUH 4MD0B 4X8JA 1BQSA 1OB1A 3VFOA 1A22B 5FO7B 1UZ6E 1FZMA 1TNMA 1S7WA 3OMZA 3GFUA 4HKJB 4TVPE 1SY6H 4YPJA 3C5JA 1CL7I 3DMMA 3SE8H 1BBDL 5DHVH 5BS0A 1FNGA 2W9EH 4XNXH 5KS9B 1ONQA 3DX6B 3P4MA 2UWEA 3RPIA 4JGMA 2ZJSH 5IMLB 5AUMA 3T2OA 3HE6D 1LEGA 4WW2C 5EUKB 5HI4C 2A9MH 1BD2B 4S2SA 1FO0A 2XWBA 1ZGLA 5CKAA 4K9EH 2WUCH 3D9AL 5E6YA 1MCCA 4R7DB 5I8EB 3IXAA 3W82A 1U8KB 5DWUH 3FFDA 3NCMA 2AJZA 4U6HB 3UPRA 2NPLX 3DVFA 2DLGA 4E42B 1T20A 5IMKA 1G9EA 3SCMD 4P46C 4L3EA 1NCCH 5E08L 1YEDB 5J3HD 3RJQB 1EUUA 5EO9B 2IADB 5F1IB 5DD1H 1KJMA 5D1QA 3HZMB 3RVWC 4GBXC 3D25B 4DZBB 1WFOA 4P2OC 1DZBA 4P46D 4PJCA 5EOQH 4RZCA 1X6NA 4IMLA 3BIKA 4U05A 2XG5A 2XQBL 4KI1A 2DKMA 2CO7B 5IMMA 1IC5L 1JN6B 1J0HA 4PJGF 2R4RL 3PWVB 3O2VH 4LHQB 2Y6SD 2X89A 1K8DA 2YOCA 2V2WB 1C7SA 5EU3A 5EZOL 4PRAB 3S4SA 3HI5L 2NY2C 1JRHL 5HYJB 4KU1A 1T22A 4MZ3A 1T5WA 1NSNH 4PY8J 4R4FH 5DEGB 2IAND 2P5WE 4M1CC 4MHHI 5EBLA 4YWGH 1RUAL 2VDOL 5DJXB 4JY5L 4GRWB 4NWUH 3QQ4B 1EZVX 2PO6D 2H26B 5I66B 5D1XB 3MODH 1I7ZB 1I9IH 1MELA 5F7KC 3BKYL 4XZUB 1T89C 1C08B 4P4RA 4XPGL 3LHPL 4S1RH 3VRJB 2EDBA 4PJ7A 4DEPC 1WSST 3QEGL 5F7DA 1U8NB 1HQRB 4IS6B 3GSUB 4YIQA 1LK2B 3OKMA 2W65B 1BFSA 1I1CA 4KC3B 2V5SA 4YQXH 3O8XA 3GZKA 3CK0H 4DW2L 3DUHA 3QH3B 2GSGB 5TE7H 2EDRA 5FYKU 3TBSA 5HDQL 2DJSA 4MXQC 1FBIL 3SJVB 4PJCE 4XXDA 1OGAA 4GUPB 3D18A 5C08D 1W8NA 1XZ0A 5F88A 1QRNB 3HLAA 3VXQA 5GRJL 2VDML 2GFBB 3HAEG 3C5ZB 1DCLA 2OSLB 4DN4H 1JGVL 1V3KA 3ZTNL 4E41A 2LFGA 3W0WA 1QLRA 1N4XL 3ARDD 4I0PA 1T83A 2H6PB 4ODSH 4JFYB 1VHPA 5C2BH 4PRDA 4HX1B 5IVXE 1E27A 1YPZA 5EO9A 4QRQA 2B0SL 1QFPA 1FZOB 1LK3H 1BZ7A 4TUOB 2DQHH 1WZ1H 4OB5L 4NQEB 43C9A 2IQ9H 3GHBL 4XVUC 3BKMH 1H3TA 4ZSOE 1UCBH 2WBJC 1DQJA 1K8DB 4S1SH 3RVUD 1D5ZB 1P69B 3LN4B 4Z7VA 3QA3B 3TA3B 4W6YB 2ESVA 5DD3H 3WXWL 5FM5O 4QOKE 3LQAC 3UJTL 1NEZA 1ED3B 3TO4A 1CZ8H 2Q6WB 1S8DB 1KTLA 4CADA 4U1LB 2AKRA 4JFDE 2IMMA 5D7IB 4A2MA 1OAXH 4Z8FL 2NW3B 3BEWA 5E8DH 2Z9TA 3O2WL 3OKNA 4QLRA 3G5YA 1DP0A 2ZCKH 4UDUB 5EULV 5BS0D 4CMMA 4YXHH 1Z2KA 1A6VL 1I4FB 3ZYIA 1DVFB 1S7VA 4JAMA 5HHNB 1JPST 2G5RA 4XVTH 3VFVA 1UEYA 5D6DC 2QQLL 3OKMB 3WFBL 3WDHA 4R6UA 4TVPL 1QFWI 2Y36L 3WNMA 5F6IC 5IMMB 4GT7A 2WK2A 1JPSH 4RRPA 1WCBA 2D2OA 5CMAB 4I8DA 4JZOA 3WIHL 1XGPB 1C5BH 4HIJB 5KTEL 2VNCA 1I7UA 2V9RA 5JQHC 3E2HA 4NUJA 3VGEA 1ZA6A 2XWTA 1H8SA 2DKUA 2ITDA 3B6SB 5ILTH 2ZNXA 3CVHA 3KYMB 4MCYA 4EKXA 3PQYB 5L88H 1T5WB 1T1WA 4WJ5B 4L5FH 4GRLA 3DIFB 3SKNA 1IM9A 2CJUL 2NXZD 3UBXI 2EIZA 4OFVA 3LAFA 4GMSH 5GISH 1JJUA 1QSEB 4LPTA 4JFOB 5GPRA 3EKCA 5FUZH 1RZFL 4X6BB 5JHDE 2WQ8A 5IM7B 2ARJB 4G6MH 4MSWA 5BRZE 2ADGA 4QRSB 4OZGF 1TQBC 1AH1A 5JLZA 32C2A 3TPUB 1G9MH 5EUOF 4OD1L 4L9LC 5F7LB 3PQYE 5B38A 2V7HA 5KVEL 2R2EA 1UJ3B 25C8H 4P3CH 3HMWH 4BZ1L 1U8MB 4Z7VB 3X14B 1MFAH 1B6DA 1C16B 2XACC 4NKIL 3DURB 3RGVC 1JI2A 1S7TA 3UYPA 4R7NB 5BZWB 4U1LA 1FC2D 3KDMB 3NIFE 3N1GC 4LGRB 5E2VH 3IU4L 1AGEA 2CK0H 4P2QB 3VGHA 4PRHE 1J1XH 4ENEC 1R3IL 3O6FB 1X6LA 3MRBA 4JFZL 4NQSA 3LKQA 2ZSVB 5AZ2L 2DQUH 3V6ZB 3B4NA 4F8TA 5ICXA 3UYOD 5TQ2H 3HCVB 1IGYA 2FL5A 1MFBH 1IGJA 2BVTA 4TULH 3NMEA 2N1KA 1JWUA 3MRKB 3W2DL 3OKLB 4XAKE 4PG2A 3QNXB 4QOKB 2JCCA 2WUBH 4X4YB 3JVGA 5H37G 3TVMD 5I1DB 3EDFA 5JHLH 3MLWL 3FMGL 1S5HA 3U30B 5IW6A 2IH3B 3W11C 4W81A 1S78D 3QIWC 3VI4E 1I8MA 4ZSOB 3RWHA 5F7YC 3SPVA 1UB5A 4K23L 4NQXA 5DD6B 1KN4L 2VLRA 4P5KB 3VFSA 5DEZA 4YFEA 4M7JL 1CI5A 5DD0H 2WZPD 3KNBA 1A64A 5D2LE 2DQFB 3CD4A 4BSJA 2I07A 3MRHA 3QEQE 2FLRT 2DBLH 5ACZA 1LP9E 2FECI 1CFVH 2OJZL 2K7QA 5JZ7D 4J3VA 4G5ZH 1ZANL 1NGPH 2XG4A 3QAZC 3BEVB 1CGWA 3ZHDA 5IT2H 4DAGL 1A6AB 3BKJL 4N90D 4P0DA 4DVBA 2W9EL 3B83A 2AJ3A 4BKLB 2Q8AL 4JFQB 4L9LB 2J5LB 4Y2DB 5GS1A 3LN5A 1NBQA 4PJ8C 3RVUC 3WEXA 1QACA 5ESAB 4QOKD 1Z3GH 2DJUA 3EFDH 3DIFA 3SKNB 2I9TB 5E4IA 1A3RH 5JHDA 2J8UF 3L5JA 3PHOA 2DM4A 2GUOA 1ORSA 2L0DA 4L29A 3SDCC 3CU7A 5F7HA 5TPWH 4HBCL 5C08A 4XI5C 5IB5A 5F1SA 3VGFA 3BE1H 3IDNA 3QIUA 2VE6B 4C56B 1QBLL 4ZQKA 2PUQT 1BZQK 4IIQB 5FYJD 3V4VL 2F53B 2BDNH 5I1LA 2BVOB 4U1KB 3GSNA 3HG1A 2AV1B 5JA8B 3O45B 1YEKL 5FO8A 5A43C 2DI7A 5FKPB 4D8PA 3QNZB 3U4BL 2IANA 4UIKH 1IGCL 1MQ8A 4DWHA 5HHOE 1FE8H 5DJCA 1YYML 4NCC2 3PHQA 1KOAA 3IS0X 1RIVH 3TM6A 3QUMA 3ZE1E 3UZEA 3RWJB 3GSQA 1T89A 4X7SL 4ZTPH 4EUPA 3RL1A 1EK3A 1HXMB 1XF2B 2KZWA 3HZYA 4YE4L 4Z0XA 3VXSB 3N9GL 5KVGL 3MJ9A 1KEGL 5DMKA 3K46A 1YMHA 4WV1C 3NCJL 4ZG1A 3OQ3B 2WSKA 1OAZH 2EE6A 4PJXA 5IK3A 4XMLH 2NY1D 2NY7L 3IDYC 4IHOA 1IGYB 2FL5B 3HCVA 2XFXA 3HMXL 2ICEB 4G8FA 3T0ED 3P30H 5GGSA 3JSSA 2DLTA 4RGNB 4QNPF 1HI6B 1G6RB 5L9DH 4MDJA 1D5MA 1EHAA 5E8EA 3LHPH 1M7XA 4XH2B 4J4PC 2XT1B 4C56D 1YQ2A 3MLXH 1JZ6A 4I0PD 3FT2A 4XC1H 1HHHB 2R39A 1J0IA 4M02A 4JO2H 1QO3B 2ZUWA 4P4KD 4ZSOA 3RWHB 5DO2D 4CADB 3TBTA 3EYSL 1G6VK 2GJZA 4GXUM 3AS2A 4QTHB 1JTTA 3BISA 1CU4L 3BIKB 5BRZA 2FWOB 1EZVY 4IRJB 3SDCB 1AE6L 3GB7B 3T2PA 1EGJA 1WVZA 1MAMH 1DLHA 4UBDC 2C5DC 4Z78A 1S78C 1EMTL 2ORBH 4JFDA 2OJEB 4R4BB 4WY7L 2YD4A 4M6AA 1QQDB 4ODSL 2ICWB 2BNRD 4G8GA 1HILA 1ROWA 4DKEL 2IPTL 3L3HA 4V1DA 5T33H 1T7VA 3WFEL 1S9XB 4JB9H 4KK6D 4ZUVA 2A1WH 1FL6B 2BVQB 1IILE 4TQEH 1LWRA 4NQTA 4OB5H 3RI5F 1MVFA 4L9LA 5BMFH 1TCRA 3KYKH 2FYYA 5C92A 2AQ1A 1YEEH 2IEPA 1FORH 1W0VA 4EDWH 4ZTOH 4FQLL 1YPZE 1E4XI 1FNSH 1G9NL 4QTIH 1AGDB 1YNKL 5I18H 3DYMA 1XAUA 4UTBL 3N85H 1EEYA 2ZUQB 4WFHE 5C9KA 1EJOL 1U91B 4XNQA 5IBUB 3NGBB 2BJML 2DJ4A 5ANME 1CZ8L 1UEMA 3BW9B 3ISWA 3L5IA 1JZ4A 3BKCL 1KC5L 2UZXB 2GIYA 2YRLA 1T03H 4PJAE 4Z8FH 3GSVB 2Y4SA 3BZ4B 2B2XL 5J9PB 3D39D 3OGCB 5IHZA 2BP3A 3QIWB 3E8UL 2OTWA 1HI6A 4LCUA 3P73B 4ZS6D 4MNGA 5F9DC 3VXMA 3WLWC 5KZCB 3CMOL 3RU8H 3OB0K 2HLFD 2V7HB 4JN1L 4FP8H 5EU6A 5SWQB 4PP8C 4LSQH 3WFBH 4ONHA 1NCWH 3IDXH 1FL3B 1ERNA 2X4QA 3WJJC 5HPMA 4E5XB 5E7BA 2VLRE 3O2DL 4NO3A 1QUNA 2DQDH 4QRPE 4LRIA 1T2JA 1AY1L 4XAWL 4WW1B 1C12A 3H3BC 3Q5OA 4Z0XB 4U1IA 3O9WC 2MCG1 1A3LH 2OK0L 2R1XA 4MB5A 4FS0A 1HSAB 4DJMA 3TJHC 2QTEA 3LZFL 5CCKH 3LVEA 5GHWH 4FABH 1SYSB 1J0YA 1LEKB 4PLKC 1TZHA 4JZJA 4LASL 1X4XA 2EDLA 2J8HA 2E6QA 2ZCHL 3MJ7A 2EE2A 4WV1A 3MJGX 4QHKJ 4FQ2L 5LWYL 4ZFGH 1BFVH 3TT3L 1EEZA 1QSEE 1KIPA 4L4JA 5GJTL 2ZNWA 3ARBD 4Y4HB 5B4MC 1OTTD 3O4LE 4X6FB 5DC9B 3BPOC 1YEHH 1P53A 3EO1B 5KAQF 2OR8A 3UTPE 1IC4L 4PJDE 3IFOA 3ARZA 2BSSA 3RIAF 4YH6A 5DVOA 3EHBC 4LSTH 5HHNA 3H3PL 2FEDD 3QDGE 4LARL 5SWSE 3T77B 3O0RL 5E56A 5EN2B 3V0AC 4XPHL 3C09C 3DV4B 4EDXB 5C9JA 4X6DF 4LK4A 4JN2A 3BZEA 3WD5L 2VDLH 2V2WA 5EU3B 4G8GE 2H2SD 2CPCA 4JPVH 5JO5B 1KCRH 3BPCB 1BJ1H 1VACA 4Z76B 3NIDF 4FXLA 2QHLA 2MQ3A 4U1NB 3QQNA 3TIDB 2RCSL 3SOBL 1T22B 3QUML 1P7QD 5ALBL 3T08A 5DTFB 5B3JF 1GIGL 4U7KA 3X3FL 4ZS7L 5ACMA 3MXWH 5E6IC 5BOZG 1YUHA 3U0WH 1QBML 4I0CC 5E99L 4M5YH 2ZPKL 4Q9BA 1A1NA 3OR7B 4M9OA 3D0VA 4K3GA 5CBEB 3NA9H 1Z6JT 4M6NH 4WO4B 1N3NA 2FNBA 1YDPA 1AGDA 4XNXL 3MACH 3WHE0 5JIKA 4Y4FB 4MA1C 5E6IB 4NT6A 1F4AA 2L4OA 4LBEB 1DBJL 4L4TD 2HYMA 3X13A 5FCSH 1D3CA 2YD3A 2RQ8A 2OQJB 5TDPB 2ZG1A 3WFZA 1FHGA 3MUHL 5F89B 5BJTB 1JFMA 4PGZA 4EUPH 4Q74A 1MH5A 5T5FL 4FG6C 5DD0L 1BMGA 4RFEB 2AXGA 3RDTA 5MEQA 5C0BA 5KSVA 3L5WA 3OKKB 3GHEL 1EGJH 4LCYB 4WDIA 4OBSA 3GI8L 1E6JL 4NQEE 1P7QB 5GGVL 4LEXH 1ZANH 3JVGC 5C07A 4XTRD 5AD0B 5DF0A 3HA0A 4JRXD 3T3ME 4QTHA 2DD8L 3BKJH 1LO3H 4UILL 2PO6C 3N0PB 5TFSH 3C2AH 3RPKA 2Q8AH 5B21A 4WI3A 4X7TB 5BQ7B 4KQ3L 1EXUB 2DQCH 3OJDA 5EU7C 2C3GA 4K3JH 1MHCB 3AS0A 4ETQB 1UB6B 1MCWM 3K7UA 1B90A 1ZT7A 2X9XA 1OAQH 5J57B 4YWGL 1FLTX 2VDOH 3CC5B 3LEYL 2WP3O 5CZVL 3RKPA 5EFIA 2VAJA 1U58B 1YPZF 4NO5A 1RJYA 1BGXL 1KLUA 3QPXH 1MIEL 5IVXA 1CS6A 3I6LD 4PGDB 4MX7A 4LHUD 3G5VB 2NY6C 3MYJB 4G6KH 3ZDZE 4N0CA 3T1FA 4ODVL 3RJDA 3LD8B 1NGQL 5CJ8A 5DURB 1J0ZA 4K3HA 3UDWC 3CXHJ 3ARVA 4YQXL 3QI9A 5HGAA 3CFCL 2BNRA 3DX8B 4JFXA 3QPQD 1IAIH 4DW2H 1MSPA 3H8NA 4K3EL 3EZ8A 4JY6B 4S1DD 4RMTA 4DEPB 1OCWH 5LAXB 1F8TL 1GGCH 3PWPA 4GRWE 3BPCA 4X7SH 3QT2A 3MFFA 4GW1A 3TN0C 1SQ2N 2D7TH 2VXQL 4LPWA 4YE4H 2Y1VA 1B2WH 3WJLC 3V52H 1TETL 4FN0A 4M43H 5JXAL 3SDDA 1BD2D 5F72S 3PABB 1OAZL 4HC1L 1K6QL 3RZCD 4PP1D 4M6OH 3GJEB 1ES0A 1NUDA 1S9VB 1GC1C 1J8HE 2X2YA 2NY7H 4X99A 5FUCE 1CGUA 5FA3B 2BVYA 1DQML 2DMKA 1ZHLA 4OCNC 1YJDC 1S7VB 4JAMB 4UV4L 2OMBA 4UV7H 3EOAB 1EUTA 2VH5L 4MD5A 3F6LA 1SBSH 3MBXH 5L6YL 1I85C 1M05B 4P57A 1CDIA 1WZKA 4IJ3C 4WWKD 1P1ZA 2ED9A 3QNZA 3TH2T 4JKPH 5FO9A 3DMMC 4S1SL 3E2HB 5GXBB 2XWJB 1TQBB 1UVQB 3WCYA 1IKFL 1UQSA 3ZE1F 3DRTB 1X5LA 4Y5YA 4D9QD 3IRPX 3NABL 5L2KA 4IRSB 3ULVL 3QCVH 4MXQD 2CXKA 4XRCB 5GZNC 4WUUB 2GJ6D 4RIRB 4O5LH 4OCSH 5T5NF 1TLKA 3CC5A 1SM3L 2HJFA 5EU6B 5JW3H 1OT1A 1UM6L 1UWXK 5ID0B 2H2PC 3HPLB 4YXHL 4YDVA 4ZUTB 3NTCL 1RFDH 4ETYA 1KLFA 3NZ8A 4OZHB 5EH1A 2FJHA 4PRPD 4U1HA 3QXVA 3V0WH 3MA7B 1Y18A 2MCPL 3QR2A 1F4HA 3HAEH 2C3VA 5TGBA 5MHSE 1DEEA 3VMPA 5JLZB 2NXZC 3QCTH 4YBHA 4U6YA 2GW5A 2I27N 3DV4A 4MLSA 2R1XB 2WWMC 1T04B 5IFJB 3WXVL 2VDKL 4V3EB 4JHAL 4PJ8D 3VJ6A 3IAQA 1EFXA 4AEEA 2YK1L 3IF1B 3B2UC 4M7ZB 3GMOA 5L88L 3F5WA 1CE6A 3F65A 5IBTL 2XA8H 4WI7A 4FNLL 1XIWD 1MFNA 1MJJB 3IDJA 1KJ2B 1NUNB 2C1PA 4MXWL 1Q38A 2CJUH 2K9UA 5ELIA 5KVFL 3M1BA 5GS3A 3SDCA 4YK4C 4XXCA 3T2NL 1H9VA 3MYJA 3GM8A 1NCNA 1JHLH 3H9YA 5F7DB 2YN3A 5LGJA 2F58H 3MRPB 1ZHNA 1WICA 2VR9A 2GKIA 1LQSR 5ACZB 1KTDB 3TBYA 2AXHA 3BP6A 1F4YH 2X70B 4LP5A 1ADQA 5B3JE 3O3BB 2FR4B 3UJJL 4WHTA 5IMOA 4IOFD 1ACYL 3MLTB 4PP2B 2B8OT 2HRLA 5TQ0H 5K9JL 1FFPA 3VCLA 3IDGB 3MV11 3WNLA 3W9EA 3WEXB 4QCIB 4L8DB 2DIJA 4LCWD 2HLAA 5ESVB 2WWMD 3H9SB 2E27L 3Q6GH 3GJEA 3CSPA 5IKCA 3MNWA 2XNAA 5K93A 1QLRB 3L5XH 5J7CC 3AM8A 3QFDA 3TBVA 4N1CA 3C5ZC 5CWSA 5IG7B 2AV7A 2UZIL 1I7TA 2YD2A 1DL7L 4OCMC 4L4VA 1MI5A 5I1JH 3KJ6H 5EOCJ 4WI5A 3PGFL 5LQBL 5HDOA 3C09B 1KCUH 2YR3A 2NXZB 1J5OH 2OTWB 4XGZB 3VD5A 4LLWB 3I50H 4PREB 4TSAH 4KK5D 2AEQH 4GBXA 2R4SL 1A6AA 4UINL 3RGVD 4NJ9H 1ZA6B 2XWTB 3MX0A 1ZGLB 3D3VB 3K2UH 3QA3A 4PJCF 1U8JA 1WZLA 4AEIL 4LIQL 5J89A 1TJHL 5D4QA 5C86A 3EYVB 2NY3D 2VDQH 3FB8A 2M26A 1HXYA 1FH5L 4WU5A 1F4XH 4Y4HC 3RL1B 4MNQB 2PXYB 4YGVA 1NH6A 4WHYH 3NZ8B 3BN3B 1IL1B 4M7JH 4MX7B 4EUPG 3I02A 3WHXA 2YA0A 3MV8D 5HDLA 1MHHB 3QUXC 2OM5A 4U6TA 4ZD3H 2XN9A 3P4NB 5ACLA 4ZUSA 3FQNB 6CGTA 3H7BA 1MAJA 2VLJD 1X5FA 1U93A 4LMQI 3QXWA 4XBPB 4MAYA 3D39B 3LKNA 4B41A 5KSAB 2VKXA 5I30L 5I1AB 3KYAA 3OR6B 3OG6B 1HHHA 1RZ7H 2Q86A 3VXUA 2D7NA 3JV4A 3QUXB 5JPMB 3RDTC 4M8QB 1M7IA 1YY8B 2DLFH 5C8JB 2WLYA 3OXSA 2BHUA 5BV7H 3I6GA 4M61A 3T0DA 1A3RL 1KJ3L 3FN0L 4LLDA 1OAYL 3KPLB 1I3GL 3LEVH 4J3XA 1IAMA 4PJBE 2FEDC 5DJZA 1CG9B 5C0CE 1JHKH 5JDSA 3NBNA 2BOCB 4ZO9A 1HH6B 3SKJL 4DUVA 3TZVC 2X1PA 3GMNA 4YHIB 4PRHD 1KB9K 3STZA 1UCTA 4NQCB 5BXFA 1FG2A 2FEEL 1A6ZB 1ZGLM 2UYLB 4ELKA 5JORB 1N0XL 3GEWB 1A7OL 5GGVH 3U7AA 4YFLF 1VGEH 3TIEA 3I75B 2WWKO 4OFYA 4U3CA 5I6XC 2C3WA 4X98B 4XXDB 1S7XA 3IJYA 2VL5B 1MWAL 4P23C 2A77L 3GBNH 3HAEA 4P5TA 4Y2OA 1YDPB 2KL6A 2G2RA 1FN4B 1U8LA 1QHOA 1SYVB 2ZKHL 2VLKA 2YSSB 1A9BA 4PGCB 2LAAA 4JQIL 3T3PE 3O4OC 3QUXD 3GMLB 5AG8A 4KVNH 4O02L 5TF1L 1NFDE 2AEWA 5ICXB 3KPRA 5BVJA 4AG4L 5TH2B 3NCFB 5HY9B 1M05A 4P57B 2FLBT 4RGOL 5L9DL 1MIMH 3VXPA 4PJHB 2PO6B 1OD7A 4LEOB 1MJUH 3WLWD 5I9QC 3U0TA 4Y4HD 2IAMC 5IVOA 4LVEA 2AK4E 4Y89A 4S1QL 1QA9B 1YEFL 5IJVB 4ODTH 3BGMB 2HFGH 2E7CA 4JFQA 1ZWIB 3HRZA 4RSVA 4ODWB 4S10A 3V7MA 2D03L 4ZDHB 2JJVA 2Q1EA 5E08H 4WWKC 2VIRA 3V6OA 3QQ9C 3HMXA 4Z7WF 5DD1L 2GCYB 2X7LB 3HKFA 4ZAKB 5GGUB 4K7FA 1KB5A 1B2WL 3BW9A 4NDMA 4JZJC 4ZOBA 2V2TB 3FL7A 4HKJA 3IDMA 1T1ZB 2H1PH 1Q72H 4GRMB 3O3UN 4XBEH 2R4RH 5KVDL 3MREA 1BZ7B 4TUOA 2IFFL 1IT9L 5CEZL 1RHHB 2P24B 3GMRB 1KTDA 1Y6KR 4OZGA 1PKQA 1FFOA 2GAZA 3RZCC 5T1LA 5K59E 1B4JH 1LE5A 3S98A 5I75C 4MXQA 1I3RA 1XGPA 1FO0B 3S7GA 2EH8H 1A1MB 3INUL 4TQEL 2PTUA 3ARFA 2P5EB 4KJPD 3ZYOA 3VU2A 5GJSL 2BMKA 5H94B 5LKNA 1JYWA 3STLA 3BVNA 1P4BH 4M61B 4KMTL 3RNKA 2X4TB 3TYFB 5JQ6H 4U6HA 3G5YB 4IIQC 4UDUA 4O2CB 4Z7OF 1N64H 3LIZL 1WQVT 1DBML 2XTJD 2F53E 5KS9F 2AJUH 5IWLA 1SM3H 3SE3C 5TE7L 2CLZB 5IM7A 1BFTA 4DCQB 1K8IA 3C2SA 5BXFB 1ZA3A 1I1RA 1U8IA 3T0WA 1CF8H 3FN9A 4HG4J 4PREA 3EO1A 5L7XL 1D6EB 4H0GA 3WFCL 1RJZA 3FOLA 3F58L 4JFHD 5GRYA 3AXLB 2WANA 1PY9A 4HZLB 1VFBB 4PTUB 4Y4KB 4TYUA 3AS1A 4OZFA 5F9OL 1M6OA 4UAOB 2VWEC 3QAZB 3OZ9L 3T77A 1I9RL 4YHLH 5IJKC 2B1HH 5HI4D 4OKDA 4EUPB 2AJVH 4PR5A 3LY6A 3BOVA 4BUGA 1T7XA 1GRWA 4KZDH 1C08A 2VC2L 2R2HA 1RQ5A 4YBLB 1J8HB 4YNYA 3T3PF 3WUZA 4HIIA 1F6AA 2CIIA 2BXZA 1BFVL 2W38A 3TT3H 5EOCH 1A4KB 3GMPB 4XGZA 4KKBC 2VRAA 3KLHC 1KLGB 5J1AA 3BWUC 3KLHD 4ZS6C 3MV7E 1DTUA 2YD7A 4ZMAT 2JK5B 4J3SA 1BX2B 3O4LA 4WWID 4Z0BH 4I3RH 5CINL 3TA3C 5DS8B 4YUEL 5E8DL 5I1GH 3MJ8A 4HWEH 3JZ7A 1YNTA 4MQ7B 2ICCA 4ZDHA 1NBYB 1Z9OA 2GJZB 3O0RH 4NM8H 2HKFL 3GBMH 4XPHH 2BHZA 4X8XA 4FFEX 3FO1B 3LD8C 3A0OA 3QHZH 5AUMB 3SGJC 3LSOB 4K7FB 5F9AC 4F15B 1MCPL 4OCLC 5FDWB 1GXEA 2OL3L 1INEL 3U4AA 2EDYA 4CVZB 4Q2ZA 1CG9A 3Q5TA 4Z7QE 4N5EA 5ISZE 3KPQB 4GS7B 3QZWA 2JTDA 4HKBA 3OGCA 2CLZA 3PE9A 3RVXD 1KPUB 1ZHBA 4Z77A 3MUJA 4OGXH 3OJMB 2YBRA 3QDMA 2YUVA 4HCRL 5DMIH 4KUZL 4XPAH 4KI5E 2XKNB 5IVZA 3M8OL 1CXHA 1KG0A 3FQWA 5LQBH 4OJFH 1A7RL 3NA9L 5IESL 3MOBH 1EO5A 2Q3ZA 5ITBH 4PIRF 1QFWL 4MDIA 4OQTL 3S37H 3HZMA 4DZBA 1DUYA 3BXNB 4H26B 4ODXB 5E9DA 3BEWB 2NW3A 2FATH 5ESQA 5FUZL 3DX7B 5DHVB 4ELMB 3QFJD 1FGVH 2R9HC 4IDLA 1A9BB 5K9QG 1BVKB 2UY7A 5B8CC 4AIXA 3GMMB 5BS0E 4PP2A 1W72L 1FH5H 1CICB 5HGGS 4H8WL 3QXAB 5C08B 1FNEA 3D85A 4GW4B 3GSVA 1J8HA 5BVJB 4HAFA 1UENA 4BSWB 3O3DA 5D7JC 3S4SG 4GKOA 1FFNB 2AK1H 3H9SA 1GGIH 3B3IB 3QEGH 1Q0XL 1RK1A 2DTMH 5F7NC 5HDBF 2YKLL 5FF6B 4PB9L 5D1XA 3OKOA 1XGYL 5CD5D 4Z9KB 4X6EA 5E2TH 5CWSB 5IG7A 3CUPB 3ARYA 5T3ZD 4S0UC 3E6HB 1R3LA 1WFTA 1NFKA 5DQDH 2QBWA 5FAAA 4MA1B 4XP9L 2KQMA 3REWA 4HV8A 1JFQH 5BZDB 4HUNB 2CMRL 4U1IB 5JR1H 3Q3GB 5IUSA 1RZ7L 3IKKA 2CIKB 4MGXA 4GBXB 1NC2B 3OKYA 3MRDA 3HS0B 2EDXA 5C6TH 1MLCA 1A6WL 1UQSB 1JNLL 4WO4D 4J7RA 4JFPA 4KPHH 3TA3D 4GRMA 4TTDD 3PWJA 1R5WA 2XFXB 3OF6A 5A1AA 3DV6B 5JHLL 2Y72A 2NLJB 3IS1X 3VFPA 3SO3C 1U8PB 3IJSB 3L9RB 4JO3H 2B0SH 3U7YH 2FO4A 4PV9B 3CZFB 4PY7B 4U6XA 3KYNB 3OR7A 3NFSH 5GGRB 5IVZB 2IQ9L 4L3AA 4PJ7B 1NDGA 2PF6A 3UYRH 4OZIE 2R1YA 4P23B 1ZWIA 3HRZB 4ODWA 5T3XH 3SGKA 4FA8A 3NCYP 2OYPA 4WIQA 3RWJA 4PJIA 1BIHA 4XP1L 1EJ6A 4NQEA 1KJ2H 2Y06L 2A83A 2BFVH 2AXFA 5DD3L 5A40E 4OF6A 5I8KL 3ORJA 3UAJC 3DX7A 5DHVA 3WNOA 5J6HA 3B5HA 4I0KA 4G7VH 4HF5L 3WIHA 5E4EB 3LKQB 1GGCL 3ZE2F 1Y0LA 5I17A 1RV6X 3QHFH 1KXQE 1QRNA 3FT3B 3O2WH 1BQUA 1OLLA 3VFGL 1QZ1A 3D6GA 3FOMB 2NY5C 3IDYB 1Z9MA 2EICA 4N5EC 3BH9A 2HT4D 4EI6B 3VWJA 4QXUH 1FFOB 1H0DB 4UDTB 4KVNL 3RWGB 4LDEB 4HDIA 4MD0A 4X8JB 4M7KH 1PDKA 3TVMA 4ORZC 1U8HA 4OZHA 4YHOH 3KPMA 2ZOKA 3BN9D 1IEAB 4POZC 3VFTA 2CKNA 4NZUL 1AC6A 1TJGL 1PX4A 1J11A 1DBAL 3MOQA 4W4NA 3UTSA 3VDAA 1LE9A 1SBSL 2LTQB 3MBXL 4U49A 4HUVA 5DUBA 3MV9D 3VRLF 5IMLA 4MWFB 4H1LB 2O5YH 2G60H 4TUJB 5J1TC 1XIWC 1BLNB 5F9WB 5A2IH 5MEND 5INDB 3K8LA 3QDAA 4C83A 3FCTB 5A16B 3SY0A 4JM2D 4JRWA 3BZ4A 5J9PA 2AVGA 1ADQL 3LKPB 1FVDA 3CXDH 3KPSE 4O5LL 2BCKA 4X7CC 1U8IB 3EDDA 3RHWK