3I6LD

Newly identified epitope n1 derived from sars-cov n protein complexed with hla-a*2402
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i6lD02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3i6lD01
3BKJH 1JWUB 5JORA 1AHWC 4NKIL 2KL6A 1NMAL 4J4PC 4WTZG 5C07D 2YPLA 4HUVB 1ZGLB 5HGBB 3N1PC 4HWBA 2DQJL 5F7EH 4NC1E 3KYMA 2W9DH 1PLGL 3GMOA 4LCWB 5HYJD 4QHLB 4JO2L 2AVGA 3L6FB 3WYRA 2YC1B 5LAXB 1KJ2H 4CN1A 4M03A 5T5NG 4FG6D 4K3JL 4UDUB 4YJZL 3RY4A 2PYFA 4HS6A 4A6YL 5MI0B 5I71C 5BVPH 1C12A 4O2EA 1BQSA 1EGJH 1T20B 1Z9SA 4DQOL 4ODHL 5AZ2H 2XXMB 5IFAL 1KG0B 5CSGA 4MD4A 4TSCH 3DV6A 4FQXB 5I1GL 3T77A 1F2QA 1V7NL 4G5ZH 5TJWK 3MUGA 2OX5A 3R1GH 3L3DA 3MRJB 3T2NL 3L3GB 4GFTB 3NCBB 4QRPB 1FVCB 4BUHA 5I19L 2GSGB 1TZHA 2P8LA 3REVA 1FZKA 2OJZL 5ISZB 4DGVH 2DM2A 3G5ZB 4LLVA 3FQNB 3V9FA 3STLA 3Q5YA 4TUKH 1I7UA 1OAXH 5E0QA 1IGTA 4WEBH 4IRSD 1FLTX 5CZVL 4MWFB 2BDNL 1MCWW 3LVEA 4I18A 4HGWA 2F9BT 1B0GA 4NRYA 3QBTB 2CDGB 2OL3B 3DRTA 1INEL 5E8NA 5JOFB 3U1SH 3PWPD 5F3HB 3F5WA 5I1EL 4K9EC 3GNMH 1A1MB 5HI5D 4QRSB 4PBVC 4H8WH 4L9LB 3HNTL 2EKSB 4UU9A 3ROLB 1QFWH 1GGYA 4GMTH 2NY6D 4LIQL 2XICA 4OQTH 5I1DB 2FGWL 4P46B 5K9JL 2A9MH 3GO1L 3NCMA 1AI1L 1NSNL 5C08A 4IRJB 1CGVA 3OKKA 2ICWA 4M5YL 4AEEA 2Q7NA 3EGSB 5T1KA 4MD5A 3QEQE 1N0XL 1I75A 1UGNA 2OK0H 1QKZL 2P1YA 3DX6A 3R06B 4OLZL 5MEOA 1KN2L 3BT2L 1SEQL 3FT4B 4HJ0C 5DRWA 3QT2A 5E9DD 4KY1H 1QACA 4X6CE 2HMID 1J05B 5D7SL 1EAPB 1BREA 2DYPB 4IOFC 3FZUC 3O2DH 1FYTA 3V5HA 4HC1A 1FO0B 1KCRH 2B1AL 1FVDA 3HR5A 4PR5A 3FB5B 1TNNA 5FUZH 3UTSD 5IMLB 2VTFA 1HHIB 1WIOA 3DVGB 4B0MM 2YXMA 4XP5L 4ZQKA 1KLGB 3D3VA 1V3JA 1BPVA 3HZVA 15C8H 3ZYOA 5JPMA 2ESVA 5ID0B 1QRNB 3TNMA 3HLAA 1AQKH 4H0IA 2AV7A 3EYSL 4CU6A 4NWUL 3MXWL 4MX7A 4KRNA 4IS6A 1F45A 2VE6B 3SGDI 4Y88A 2MMXA 3EOYG 1D5MB 4FHBD 3WFBH 2DM4A 3PJSA 3TJHD 3B2UD 4N5EC 4BQ6A 5CMAA 4PGEA 4GW5B 3TBWA 4J6RL 3SE8L 1S9XB 5CP3A 4LLMB 4IDLA 4F2MA 3BVNB 2BNQB 3NFNA 4KV5F 4Y4KA 3FB8A 3DV4B 1ZVSB 4GUPB 1JHLH 5BVJA 5BW7A 4JN2A 1FFPB 4UT7L 3U4BH 4IEFB 2DM3A 3E2HC 3KLSA 1VACB 2R0KL 3RRQA 3AVEA 4GXVH 4MNGE 2LU4A 4AH2A 3HTLX 1ZA6B 1U95A 2FIKA 3H9SA 3BZEA 5DD6B 4NQCB 3C8KA 3IJHA 3LRGA 2LVCA 4JGUA 3D5OF 3NA4A 3HMXA 1KEMH 3HI5L 4CJ1A 5IESL 4LLDA 3VFOB 5FO8A 2N56A 2HRLA 43C9A 4TQEH 5D1QD 4NT6A 4I77H 5HDLA 3MJ9A 4FQCL 4QCIB 1G9NC 3KPOA 4LDEB 3MRLA 4XP4L 1V3MA 1CGWA 1KN4L 3GGWA 2FX9H 3HPJB 3KJ6L 32C2A 4OGXH 1CFNA 2XWBA 3JWOC 2Q7YA 1VPOH 3ES6A 2XY2A 4LGPB 5HHXL 1IZKA 3TH4T 1ZVHA 1KLFA 3V95A 2VC2L 3RY5A 3FAWA 3STZA 4BQ8A 2HKFL 2HT4C 1GC1C 2BSTA 3U0TA 4RGMB 4NZJA 4E41B 1TENA 2X4UB 5HYQA 1KFAH 1FC2D 3IFOB 5KSVB 4HKZB 3O6FB 3BPCB 4ODTL 2VQTA 5EO1A 2E9BA 3OAUH 3CZFA 3V8CA 4JPVL 2HFEA 2MOVA 4DTGL 5KVGH 4L3CB 1IL1B 2JELH 4U6XA 1PYWA 3E1F1 5HHNA 4KKCD 1GOFA 2P48B 3ZKSD 1OSPH 1UEYA 3O4OB 2J5LC 3DX8B 3QHFL 2PR4L 3ZT5A 2ITDA 2FJGA 2G60H 3HC0B 4U1SA 3EOTL 1L7TH 1U8IA 4U49A 2X70A 4OZGE 4Q9BA 3MCG1 1UWXH 1BECA 3HAEA 4G42B 1PSKH 2LAAA 5C6TL 4P2QE 4OCWH 1INQA 1S5IH 3DSFH 5AAWA 4J1UB 1CIUA 1D5ZB 4W81A 1F4YL 1MQKH 2L7UA 1KIPA 3AMLA 3W2DH 2OSLB 4JFYB 1C1EH 4OFPA 4I4WA 3LQAH 4PJFA 1M6OA 1MFBL 4OZIA 3MZGB 2VXUH 3PP4H 1JYXA 4DVBA 2APWA 4XCNA 3S4SA 5TDOB 3AS3A 4R4NC 4JFHE 5MHSD 1CFQA 1QG3A 2FO4A 1MJ7L 2X4TB 3W9EA 3VCLB 1XZ0B 1W2KT 4LLWA 4UBDC 4XXCA 2O5ZH 3LD8B 5ALCL 1J10A 4HUXB 4MCYA 5CD3B 3TBTB 5E8OA 3H7BA 1G7MA 4P59L 4HGKC 1DBBL 2FD6H 3SDXB 1NANH 3VH8A 1XCQB 3OPZL 1HNFA 2YWYA 4NQSA 4TTGA 2R4RL 1HSBB 5C0AA 3PDGA 4OF3A 5DMKB 2P5WA 3AAZB 2O61B 4ZFOB 1A6ZA 5I1HL 1NCAL 4NQVA 1FAKT 3WXVL 2EEBA 1MAMH 4XAKD 1RZ7L 5E4EC 3LKNA 1NEZA 4X7EC 5EBMA 4M43H 4LP5A 4HIHB 1VFOA 3KPQA 1KNOA 4JPIB 2LU7A 3FL7A 3HZYB 4Q58C 1IM3A 4PJGE 1EHNA 3DX7A 2VLMD 5HDQL 3HB3C 4X7TA 3U9UA 5IQ7L 1AP2A 1NCBL 2DAVA 2JKXA 4PP1C 3IB4A 4XAWH 2ZZUT 3ZE1E 4XBEH 5I18H 4JKPL 4FN0A 1C16B 4LKCA 1YYML 1IKNA 4EUPB 1S3KH 2YD4A 1KJ2A 1U3HD 3RHWK 3MFFA 1L8JA 4PGDA 1SY6H 4NRXA 1I3GH 3L5XH 4Q9RH 4KU1A 3QCVH 1SEBB 3LKQB 1XGRB 1EGJA 5D7IA 5JXAL 1G7IA 2VKXA 3F12A 5TE6H 4YEEA 3HCVB 4YC2B 3N1QC 3UO1L 1X6NA 1JTTA 5BRZD 4KKAC 1PBYA 4TSAH 1MEXL 4Y4KC 4N0CA 3B9KD 5DK3A 2I27N 3AS2A 3VD3A 2D7TH 3ARTA 3L1OH 4KROC 2UWEF 1EFXD 2D31B 1UWEH 4H26A 2BMKB 1W72L 2JJVA 2LV4A 2VDNL 1A0QL 5BO1H 4UAOB 2ENYA 4LPCA 4OBSA 1S7TB 4M7ZC 4I2XB 3TZVD 3SJVD 1J1PH 4PRDA 2ATKB 1UJ3B 4PJBB 3BUYA 2QSCL 3DLQR 3MRRB 3MYJB 1S7XA 3MJ8B 2Q8AL 3MLZH 5C0RL 5DMIL 3RWIB 3TPUA 1MI5B 4PYHA 1AFVH 1KIRA 3Q5TA 4YNYB 3BN9C 1SYVB 4EN3A 4DK6A 3WXWH 3GRWA 5E70A 1BVLA 4MQXC 3FOLB 1QP1A 2NMSA 4FQHA 4PJ9B 1XGYL 2DTMH 1AD0B 2CKBB 3PDOB 1U8LA 5E6IC 5JQ6L 5FA3A 2H6PB 3QYCA 3MBEB 5F7YC 3QIBA 1P7QD 3QI9A 3K2UH 5IFJA 5KTEH 2AAVA 1P4LA 4PRHD 2H1PL 4L1DA 4NO5A 5E8DH 2YD1A 3QO1B 3KYKH 1XF3A 2YS4A 1PKQA 1VB9A 3SEPA 4NDMB 3PHSA 1NGQH 5FA4B 4WU5B 2VITB 4MS8C 3RWDB 2BK8A 5TDNA 2MSPA 3WJLA 5EFIA 1A22B 4APQA 2V17H 1AE6H 2Z35A 3O2DA 4UTBL 4R96B 3PNWB 4TYUA 1YY8B 3TBSA 1HHJA 3GI8H 4F3FA 4ZTOL 2ZJSH 1NDGB 3HS0B 4R26H 4KKLC 3C09B 1EIBA 3QA3B 1TZGH 4N8PA 3P4MB 1HQ4A 3TBYB 4F15C 4X7FC 3UTZB 1YEHH 5EWIL 2DTSA 3C5JB 2I07A 2YUWA 3CU1A 4I0PA 3TCXA 4G8IA 2FJFB 1OARL 3JTTB 1TJGH 4M1GL 1WICA 3E6FB 2WIIB 2RFXA 1CXIA 4NQDE 4LHUD 2X44D 2NY4B 4MNQD 3HZMA 1CR9L 4XXCC 3Q48A 2VZVA 3B8SA 4YX2L 5F96L 4PJHA 4HPYH 4LU5L 3U83A 1T6WA 2L4OA 1J0JA 4RX4D 3WHXB 4YHZL 3IDIA 1WFTA 2Q76A 5AWNH 4NCC2 1Q8MA 5CKAA 4K55A 1J7VR 1INDL 3K80A 5IBUG 1L9MA 2IAMC 3LHPL 3FQXA 4ELKA 5BV7C 3ME0A 3C2AL 2PYED 4M62H 4LFHD 5HGAA 4R4FL 1CBVL 4GO6B 5E2TL 3ZDXE 4G59A 3FRUA 4R90H 4DFHA 4NSKA 4BSWA 2XN9B 1I1AB 2ERJC 5E99L 2WSKA 4PJEE 2MWCA 2F8XC 3EYOB 1OTTD 2AJYH 4MAYB 1NH6A 4BKLB 2BX5A 1RZ8B 4CAGA 4K3DH 1JNHB 2CK2A 2AJSL 4YFLI 3V0VB 3ARGB 3BKML 3UAJC 4ELMA 1HKLH 4D8PA 5GGUB 4XMPH 1OAQH 2Z92B 3MXVL 1BBJB 4GG8B 5DEGB 1FGVL 2NY3B 4LLQB 5EIVA 3THMH 1EBAA 1JNLH 1MWAB 4PRID 3EBAA 1EUUA 5EN2B 1R3KB 4H88H 2NY0B 3VJ6A 3T0EE 4Z7WF 4HXAL 3T4AB 3OR7B 4GKSA 4QYOA 4Y5YB 1M71A 4GG6E 5EOTA 3K2MC 1E6OH 1B2WL 4KVCH 3FFCB 5T3ZL 3Q3GA 1T21A 5CSBA 3UJJH 4M8QA 3LZFL 4KAQH 4DJMA 3TO2B 5IHUL 1A4KA 4M7JH 2AP2A 2NR6C 3V5DB 4HCRA 1I8IB 4A2LA 5I8EB 3MGOA 1NC4B 3G5YA 2Y5EA 4G6FB 3DROA 1JZ2A 1A4JA 1PEZA 5JDJA 4I5BA 1DBJH 3JTSB 1K3IA 4FQJH 1N6UA 5GGQL 3RX8A 3DO7A 1LK2B 3D39E 1RIUH 3MUHL 5KZCB 5JLZA 4O4YL 4ZOEA 3IT8D 2Z31A 4E5XB 2IPTH 3I6KB 4OZHF 5EBWA 4O5LL 3DSNA 3X11A 3EYVB 2BJMH 2ZSWB 1FGNL 1IARB 1DQDH 2AXGA 5JHDD 1CN4A 1OLZA 1YYLL 1T04B 5EU5B 3D9AL 4K8RD 1LEGA 3CUPB 4MDIA 4IHOB 5EU4B 4CGTA 3VXUE 3CDCA 4OCSH 1IT9H 4HV8B 2YRPA 4R2GD 4NM8H 1C5DA 1E6JH 1HZHL 1PQZB 4X9BA 4IDJL 4HS8L 2EH8H 4P23C 4AYFA 2DQDL 2BC4A 3FO1B 4EN3C 3WLBB 4UB0H 3GMPB 1IFHH 1CGSH 1R5VB 5K9KB 1MIEH 1QSED 5E08H 1DEDA 2F8OA 4N0UA 2A6JB 4W4OA 1WK0A 5E5UB 1FAIL 2J2ZA 2EH7H 4ODXA 3WS6C 5D1ZD 5F89B 4P5TC 5D72L 4H5SB 2NXYD 4LKXB 3O3AB 4OF8A 5D4QA 3QI9C 3RDTB 1IM9A 4BH7A 4WI2A 1HK6A 4G8GE 4GRMA 4BFIA 4TVPL 2R8SL 1EO8L 4G6AD 4RMSA 2W0PA 3QUXA 2VL5B 5E8PA 2CLRA 1N2RB 3MZTA 4G7VL 3QEQA 4ALAH 4OI8A 6CGTA 3C6LB 4PFEA 1X5HA 1UEMA 4BELD 3VXTB 3DI2B 3FAXA 3RNKB 1JPGB 4L8CA 4QXGH 3IXAA 2VSCA 5GGSY 2PXYC 1YPZE 1BBDH 3HNVL 4X6CA 4AG4H 3LH2L 1KTLB 1R3HA 2ARJA 2GT9A 3ETBF 3IGAA 4LPVA 4I48A 5EZLB 2EDXA 4JVPA 5C07B 2ZOLA 5IK3B 3SDDC 3LY6A 2CK0H 4WHYH 2RIKA 1Y18B 4FTVB 3FMGL 4JFED 1DQJB 5AZEL 4NO0A 5IBTL 3ZE2F 3NIGF 4YDJA 5L2JA 3QEGH 3SE4A 5D1XA 3BEVA 1SY6A 3U36A 2A74B 2Q20A 4LGRB 1V3KA 5C8JA 1TJHH 2JB5L 2AJVL 2AJ3A 2C3GA 3E3QC 4KK8C 5KVFL 5I1IH 4K23L 4LDOB 4PP2A 1A1OA 2OP4L 4ZFFA 1YEJL 4MAUL 4ZNCD 5T3XL 1H8SA 4OCYL 1CT8A 1LO0L 3O9WA 3CMOH 2DBLH 1G7LB 1YMMB 4NNXA 5DJYA 3RVUD 3BN3B 3NIDE 5E1AB 4PLKD 3X17A 4Z7VF 5IOPB 2BNRE 3VXPA 4K94L 1XH3A 4NN7B 4WO4A 1MLBB 3EHBC 4UIKH 1IAOB 4G7YH 1BAFL 2ZUWA 2MTPA 4FOMA 1ZTXL 1LDPH 1U8PB 1NGZB 4TTDD 2WP3O 2VLRD 3EZJB 4C56D 4KMLB 4OCXH 4JZOA 4OFYD 3G6AB 1NFDB 5SWZA 3O8XA 3NH7L 4U6TA 1T1ZA 3RWGB 3RZCD 4JHZA 5HHOA 4PP8C 1CFVH 4I1NB 2X4SB 5CUSH 3A67L 5LVEA 3PWPB 2IADA 1HHHB 2VLKE 2VQ1B 2VAAA 5T1DL 2Q8BL 4JM2D 4U1HA 4WRLA 4F7PB 1RHHB 1YNKH 2B39A 4Q6YA 5T1LD 2LTQB 3P2TA 5HYJE 2V2TB 2NY6B 3QH3B 4DAGL 3TFKD 4LQFL 4DN4L 2SEBB 5DURD 2APTA 5ICYB 4NFBA 5DJAA 4U1JA 1ZLSL 1EJOL 2F54A 1W0VB 5KOMC 3GJFB 1DQQA 3JVGA 1CLOH 1CTOA 1G0XA 1BD2A 4JG1H 3QRGH 1KBGL 1SJEA 3FB6A 1QNZL 1RZKH 5E7BA 3SDCC 3SHSA 5DTFA 2WBJD 4M7LH 5E9DB 1U8KB 3MROB 4LSRH 1U8HB 2Y5TB 5H2BA 3MOQA 4XCFL 1OSZB 1A6VL 1A1NB 5T3ZD 3ZO0A 2QQKL 1QR1A 1U9KA 1I3UA 1I85C 3JSSA 4O51A 3L9RA 3MJGX 1IGFL 4NO3A 1A21A 3GSVA 4S10A 4P2QA 2XT1B 2EXWD 3WCYA 3ZDYF 4XVTL 3O41B 4G8FA 1CFBA 4QXUL 5TE4H 4B7IA 5I71B 4YHPA 3JWDH 3C60C 2KPNA 1ONQA 1I8LA 3VA2C 1LK3H 1RAMA 2B2XL 1TPXB 1HINL 3RUGA 5HSFA 2VLLB 3DARA 4U1MB 3P73A 5CGYC 4XCYB 4LSVL 1FORL 1H3GA 5EU7E 4J12A 5C0IB 1I3VA 4HFWA 3ARFD 1SYSB 3VFGL 1H8OA 3FN9A 1UVQA 4JFFB 3QUML 4O58L 3R0MA 4P9ML 5F9DC 4X80H 3HI1A 4NWTH 2VLJB 3TT1L 1J8HA 2EIEA 3VXSB 3LMJL 4LLYB 1CLYL 2NY5C 2BNUB 8FABA 1JWSB 1EHLH 2P47B 3SKOA 2F53A 2IMMA 1ZA3B 1QLFB 1EEZA 1YEFH 4N1HB 4BH8B 3VWJA 4W70A 5TQ0L 4D9RE 2BSED 1QO3A 4YFEA 4HKJB 3LEVH 1E4JA 5DD0L 3GMMA 1U6AL 1CICC 4FABL 4OM0L 2VXVL 4DKEL 1VHPA 3LV3B 2XACC 3QPXL 2DQTH 3OJDB 3CFJA 2HT2C 3I6GA 5F3BB 3CVHH 2EXYC 4NKOB 5CIPH 3LKRB 1CD9B 1KUMA 4E42A 1P1ZA 2EDFA 1JCKA 4PTUB 1A7PL 5IVXA 1X9QA 1H0DA 2GCYB 2Y72A 5I1JL 1FFNB 3UTSE 5D1XC 2HFFA 4ETYA 4FMFA 1JVKA 3RFZC 3VXRA 5C0DB 4P99A 1DQLL 4R0LA 5JW4R 3ARYA 2Y1VA 2HTKD 1GIGL 2C4FT 3RVVC 5JW5B 4QTHB 5F1NB 3QIUC 4EDXB 3O9WC 1I9RL 3DOSA 4FA8A 2PKDA 4PRPE 3BO8A 5IB4A 2ZOKA 4KK9C 5JW3L 4Y19D 3PWJB 4GSDL 3KLHD 1K4DB 2JJUA 4OFIA 1BF8A 1KC5L 3F7PC 3JUZA 2NY1C 4PJ5B 5DSCB 3S9DB 4HK0A 4MVBC 3IDXH 1E4XL 1CL7L 2C7UB 3ZLQC 4OKVA 4LNRB 2FECL 1RURL 3EOAA 3X3FH 2EYSB 4QY8A 1GZQA 3KJ4C 3ARDA 4D0DB 3BSZH 1GOGA 3GSUA 4D9LL 5CCKL 4KDVA 1QZ1A 1YEDB 4MA8H 3MRIA 4A6YB 2ENSA 2BXZA 5IB1B 2WK2A 3SO5A 3H9ZA 2R15A 3WD5L 2OTWA 5D2NB 1RK1A 1MRCH 5FKAB 1KACB 5H8DA 4P2OA 4G3YL 3TA3C 3PWLB 3QIWD 3BPOB 3MLVH 4Y4FB 3OKMB 4V2CB 5K9QI 4Q7DA 2AK1L 4F37K 1WISA 5JIHA 3MRDA 4PGBB 3O2WH 4AIZA 4JN1L 2XG4A 1QYGL 1JFQH 4CL7A 1YDPA 5D70H 2HAZA 2EO9A 1R3IL 4W6YB 5KW9H 4U1NB 5MEQA 4GW1B 3S36L 5CWSB 3JVGC 3H0TA 1ES0A 3A0OA 4XXDA 2YN3A 4LEOB 4U1KA 3K4ZA 2UUDH 2YPVH 3RIFF 3STBA 4TPRH 4BUGA 3DXAD 3FCTB 4OSUH 5H35B 5I8CA 2BSRB 4RZCA 2NW3B 4C83A 5EU3B 4UNUA 5EC1A 3SCMC 5L7XL 1AC6A 1C08B 4C4KT 2FYYA 2X4RB 2A73B 2FB4H 4MCZA 5A2FA 3V7AG 2GSIB 3RU8L 3QUKA 5DT1H 5BXFB 4FZ8H 5EORL 1FFQA 2F5AH 5D6CA 5GS1A 4QTIH 3TJEL 1HCFX 1FZMB 4KWUA 3TESA 1I8LC 2O5YH 3CH1A 3BI9X 1H3VA 3LS4H 2O5XH 5C0NC 3PWVA 5MP6L 1CF8L 1GGBH 4YE4L 3B2VH 5JW4Q 4RRPG 3N9GL 4MJIE 3BP6A 1I7ZB 3QWRA 1U3HB 1FC1A 4HIJA 1WBXA 3DJ9A 4PLOB 3RJDA 3MV7E 2W65B 1LE5A 3CFKB 5MHSE 4NQDA 4KJYA 2R23B 1FSKC 1NCWH 5HHMA 2H8PA 3KPRD 4KDWA 3D18A 4KRPB 3BQUD 3CFEA 1DP0A 4OJFL 3IFNL 2IC2A 5FYJL 1QSFB 1CDUA 4QNPF 2VJXA 1AR1C 2Y07H 5BRZB 3B9KB 3GIVB 1WIUA 4OZFB 4MA3A 5CJOH 3X14B 4MSWB 3HE7C 1EFXB 4YUEL 4KRLB 1JGUH 3V7AE 4Z6AT 2D7QA 3BFOA 1R5WA 2XZAH 1U8JA 3GMNA 3PGFH 3WLWD 4XAKE 1H3TA 5I76A 1LO3H 4KVNL 1KIQB 1MAJA 2BVQA 4M1DL 3U4AA 3ESVF 3GKWL 3J8F7 1OQOA 1XR8A 1ADQA 1DL7H 4HX1B 4UDTB 5DO2D 1QQDA 2VLME 3G6DL 4ETQA 4HS3B 3QUYA 4WHTA 5DD1H 1K9TA 2QKIB 1JNNH 1S7SA 5ICZB 4DGYH 2DQHH 3VD4A 3AROA 3V6OE 3TVMA 2FR4B 3ULSA 2XY1A 1HWHB 2VXQH 3T0EA 4KXZI 1D3CA 1JPSL 1B9ZA 1BIIB 2B7DT 4OLVL 2W0LA 1J0YA 3DIFA 3FOMB 5D2LF 3EJYC 3PV6A 3U82B 4Z0BL 3IKCB 2JIXA 2O26U 2OS7A 2EICA 4G9FB 4OLYL 4X9HA 1P7QB 3ABZA 3GSQB 3VFMA 5HVHC 3MNWB 3H6JA 2EDRA 3LS5H 1FNSH 2J6EA 2MJWA 4HWBL 4ONOA 1WITA 3DGCR 3NTCH 3CSYA 4X6BB 3MCKB 4W4NA 3E8UL 5KANI 5I9QC 3ARBD 5J57B 3LKOB 4LARH 5TF1L 4UINL 4GS7B 3WS3A 1U8MB 1FFOB 4NUGH 4R7DA 1QPXA 2OR8A 3X13A 3M8OH 5J1AB 4AL8L 3KR3L 3D39A 1HI6A 3OKNB 3ARDC 3QFDB 2HRPH 4Y16A 5GRUH 3T1FA 2E7HA 5IBLC 1RUPH 4X4MA 2UUDK 1FVEB 3UEZA 4L4TD 3VW3L 5L88L 2V9TA 2W9LA 4YPGA 5JIKA 3TT3H 4PJ8D 2DJSA 3WNOA 3ARED 3SJVE 4Q2ZB 3QG6B 3VXUA 4J4PD 2XFXA 5EPMA 4IJ3B 5ESAB 4MMXC 4Y5VA 1HWGB 3UTTD 4IMKC 3V4VH 4MNQB 5TQ2L 4URTB 1MJ8L 4KROB 4X6FA 1DUZA 2NCMA 2AEQH 1NDMB 25C8L 1A5FL 3ZKXC 2IQ9H 1OW0A 5INCA 1QBBA 5TH2A 1EEYB 4LHUG 2BHUA 1E4XI 4JB9L 1CL7I 1E28B 4HXBL 1S7RA 2X1OA 1E27A 5GJSH 4UV4L 2VDKH 2FECI 3EYFA 4P4KD 1N5YL 1UM6H 4G8GA 4LASH 1BQUA 1T1WA 5DUMH 4F58L 1H8NA 4PRHE 5GS0L 1X7QA 5JW4M 4KTEL 3O3BB 1ZE3C 1Q94B 4GRLD 1JGDB 2YD8A 4Z7WB 3LIZL 2E27L 1KENH 4LFHG 1OLLA 1HXMB 1JJUA 5GS1C 3CVHA 1MCSA 3VMPA 5BS0D 1WFOA 5CIPA 1MUJB 5E6IB 4YR6A 5TPWL 3T8XB 4XRCA 4NNPL 1GHFL 5IVXF 1J0KA 1T66C 1WAAF 4XP1H 4ZFGL 5CILL 2HTLC 2NTSP 3CSGA 3PL6D 4FQQA 2AERT 4GKOA 1ETZB 4ZOBA 4NPYB 5B39B 5HD8C 4Q6IC 5GRJL 4ONGL 3V4PH 5JMOC 1R3LB 4P2CG 3GSNH 2FJHA 5L8KB 1P6FA 5HYSA 4KJWC 1GXEA 1A3RH 4WI6A 1F42A 5F88B 1FLRH 4ZFZA 4YXHL 4ZUWB 4HC1L 4OZHB 2EE2A 1EERB 2APFA 3BAEL 3QEUA 3IF1A 4S1DD 2N1KA 2MPAH 4LVOC 1LEIB 3VXMD 5KS9B 3MV8A 4L4VD 5J12B 1OGAE 3JV4B 1A7NH 3NZHH 1DQMH 1XF2B 2Z8WC 3IRZA 1Q0YH 5GGSA 3WIFA 1HOCB 4OV6F 4F8TA 4RWYL 2QSTA 1LO5A 3F8UB 2PYEE 3W5NA 4MD0B 4QHNB 4P9HL 4KI5D 1ZWIB 2AK4D 5IEHB 4PJXB 3SGEH 5JHDB 2RQ8A 3I50L 1ORQB 1EHAA 3N06B 3SKNB 2Y6SD 3H2WA 3IAQA 3P3YA 5EB9A 5DHVH 2DJUA 3TEUA 3P9LA 2R69H 4Z7QF 1BVKB 4M7KL 3S3JA 3VDAA 3NAAL 2EKJA 4IOFD 5IFHL 4PDCE 4R2GB 1RULH 3F7YA 5SWSD 4OLXL 3KXFB 5I8OL 3TVMC 1FPTH 4QRQA 3MODH 5DJCB 4XWOC 4Y4HA 4OT1H 4PRIE 1GPOL 1QPPA 1YY9C 3ZDZF 1CLCA 1BEYL 1W72B 2VLKA 5KAQF 4CMMB 5C0CD 1TCRA 2IH1A 1JPTL 5EUOB 2CMRH 1PFCA 2ERJB 1PZUB 4MXQA 2PETA 3LEXA 4G8EB 4LK4A 4JE4B 4OGYL 2BY1A 2H32A 3HMXL 3NGBC 3Q6FB 4S1SH 3QQ3A 3OKOB 1D9KA 1NBVH 1Q1JH 5D71H 5HGHA 1X3DA 4ZXBA 3TO4B 4OI9A 5EBGA 1F58H 1MCPH 4MA7H 4EBQH 1Z0MA 3GJEB 3MJ9L 1G6VK 3ZKNC 2AKRA 1A3LL 4L3AA 2N7AA 1RFDL 4NUJA 1HHKB 1LO4L 2BOBB 3DGGB 4KK6C 4NQXB 2FIRT 4Z5RB 1H5BC 4M5ZL 1YEGH 3EZ8A 4JRXE 3KNBA 4XPGL 5IVZA 2Z8VC 3PF2A 3GDBA 1M7IB 2DDQH 2EYTA 3DHJA 1X5FA 2HH0H 3RX7A 3DUUA 2PW1B 3G6JA 3DURA 4JZNA 2YPLD 1OTUD 2J4WL 4NJ9L 2VDQH 1HXYB 1OAUH 2DM7A 1EXUB 4GLRI 3NACH 1PAMA 3BP7A 1A2YA 1X5YA 1MH5A 4WFHE 3BPLC 4OLUH 3U46A 2NX5A 3GUTB 2E9JA 5FOJA 2EYRA 1JV5B 3SPVB 4H1LB 2IALA 4ZO9A 5BQ7B 4PJ7A 1QSEE 5GXBB 1M7XA 1OW0C 1P84K 4ZYKA 3ZL4H 1RZGA 1JMZA 3OKEA 4TNWK 4FXGB 4YWGL 3ULUL 4XNXL 2G9HA 1V05A 3S36X 2GHWB 3SN6N 2FH6A 3QNYB 4J3TA 3IJSA 1G9ML 3OXRB 4H1LG 3IDYC 3BEWA 4KZEH 2DLFL 5ESQB 3WSQL 5C9JB 1IVLA 3B9EA 5LGHL 3BIAX 1XR9A 2X41A 3HRZB 4ZMAT 1KEGL 5ACZA 3QXUA 5IEKB 2GI7A 4WDIB 3AFLA 4UUJA 4XVSL 4HWEH 4N9GB 2P8PA 2XKSA 3CX5K 2IF7A 5EBLB 4D94A 1TETL 2HFGH 2FH8A 2FX8H 2VLRB 4CVZB 3CZJA 4C56B 3W5MA 5EOCJ 5INDA 3RKPA 1F4XH 2YKLL 5JDSA 4P5TB 1DLFL 5LCVL 2QL1A 5EA0L 5DJ0A 1FBIH 3RZCB 4PTTA 2YUVA 3FT2B 3PQYE 3K74B 2DKUA 3GHBH 4KPHL 4MB4A 1PG7X 2X4QB 1FCGA 4D0BB 4JFEE 5GIRA 4NQTA 5C0EB 1S9VB 5GS0D 5T1LB 4JG1L 5DEFA 1YEIH 3BKJL 5FUCC 2VSDA 1LNUA 3TCLA 4QOKE 3BH9A 3QO0A 5DURB 4YBQD 4JFOB 5MENB 1MFNA 4Z78B 3RL1B 4GW4A 4WHDA 5F7EL 4PRPA 1EFQA 3PG2A 5C08D 1ERNA 5CEXA 2W9DL 1A7RH 3B8YA 5T1KD 5E8EA 4C57C 5GISH 1RJYA 2WBJB 1L0YA 1VGKA 3CXHK 1KJ2L 2C4FU 4XC1H 1U92A 3VG9C 3P4NB 4F37F 4LCUB 2ICWI 5J9PA 5BVPL 4Z7NE 4CBPA 1EGJL 5GS2D 5IB5A 1WBZB 3QXDA 5AZ2L 3BRGC 3OJVC 2NNAB 4BQ9A 4TSCL 4BSJA 4PV9B 3CC5A 4HFUH 1FYTD 3HB3D 1JL8A 3ECBB 4G5ZL 3SQBA 3R8QA 3RWJA 3R1GL 1Q0XH 4ZPVA 1VEPA 1A6AA 5FGSA 1I8KA 4EQ2A 1T5XA 4AIOA 3F62A 3U7YH 1UFUA 1EJ6A 3L5WB 3HC3H 4DGVL 2I9TB 3VI4E 3KAAA 3D3VD 1UQSB 4RGOH 2DWDB 2H9GA 4GMSH 2ESVD 4TUKL 4Y0GA 1OAXL 2FGZA 4PJDB 4WEBL 3LN5A 4MXQC 3FB7A 4NNYA 2DI8A 2X1XR 5F9WB 1D9KC 2PF6A 3P0VH 3LKPA 4ZXBC 2VO5A 5J06A 1NJ9A 2OTUB 2CO6B 4ONHA 2NW2A 1Q9LB 4RMQA 3VG0H 4N8VB 3U1SL 5B8CC 2HJLA 1P7HL 2EDTA 4RGNE 4KDTA 2QHRH 4RA0C 3GNML 4NKDA 1ED3A 2W0KA 4Y4KD 5D7JA 1AGDA 1QRKA 1MVUB 5CZXD 5A43C 1SVZA 1PG7W 1QFWL 4GMTL 2UY7A 4X4YB 4OQTL 2CXKA 3VFVA 5L2KE 5DXWA 1BFVH 4POUB 3HN3A 4JRYB 5JOPD 1AD9B 5I74B 4ODWB 4AENA 4NZRH 5EIIB 1HYSC 3H9SD 4JLRB 5FDWB 3MRPB 3U2SB 4NKMB 2OK0L 5A2JH 1A7QH 4CKVX 3UJIH 3MV01 1MCCA 1G7QA 3GSNA 3UYPA 1FYHB 1X5KA 5FOBB 4K8RH 1MNUH 4EVNB 4UI2A 4POYA 5GGTH 5FV1L 1YEKH 1RUMH 1BFSA 4MJIA 3SDCB 4RQQB 2IBBA 3AXLB 3O2DL 1B0RA 1BGXL 3MV7A 1G7PA 4F7CB 1KCRL 5I16B 3TIDB 5FUOH 5I1KH 2J8UF 2VDRH 4YHYC 4PJIA 5ERWB 5IV2B 5FECB 2AS5M 1K3ZA 2GAZA 1IGJA 4K3EH 3DETD 5FUZL 3MNZB 4Y19B 2KZWA 4WUUA 2YZ8A 1JWMA 5KVDH 2YRZA 4PRAA 3LSOB 15C8L 3KGRA 4LCYB 5K9OA 3FO9B 1ZT7A 3QQ4A 3LN4A 1AQKL 4GKZA 4Z7UA 1IC5H 3INUH 4U3XA 4M61B 3MA9H 2QADB 2BRRH 1JYNA 35C8H 5DHVA 4L1HA 3WFBL 4ZAKA 3S37X 4OD1H 2VISA 2FWOB 4HWZB 5A40E 2YR3A 2OXHA 4XPFH 2DRUA 4JO1H 2CR6A 4J3WA 3ULUD 1KJMA 1XT5A 2PCPA 1ZHLB 2R0ZL 4KKLD 4HBCH 3VXOB 3NFPB 3BZ4B 3U4BL 3KPLB 1Y6KR 3OX8A 2ZUQC 5IB2A 2WANA 3V6OA 4LHQB 2WWMC 4OCRH 4UZGA 2YBRA 5L6YH 3QDJA 1KEML 3C08H 5ICXA 4Y5XA 4LBEB 1CICB 4TQEL 4I77L 4GXUN 2IMNA 3OGCA 3M1BA 2X4PA 1U93A 2QQNH 1TVHA 2NYYC 4UQ2B 1SBBA 4N5UA 1S9KC 1XGTA 2FX9L 4HAFA 5C0AD 2P5WD 4OGXL 4HUVA 1ZGLA 3NIFF 2YA0A 1VPOL 3MA7A 4BQBA 5E03A 5FKPB 3UBXG 2X7LA 5JIPA 2DMKA 3M45A 2VAJA 2NY7H 4PJAE 4LCWA 1GGIH 4Z18A 1OY3B 3KVQA 4KHTL 3MRQB 3L6FA 3I02B 2YC1A 1EDQA 5LAXA 1QA9B 5DJZB 3QZWG 4X9IA 4UDUA 1ZANH 3QIUB 1KFAL 3UAJD 1E4KA 2BP3A 3OAUL 5GS3A 5KVGL 2JELL 5B4MC 3LDBB 4X6EB 1OSPL 1T2XA 1KG0A 4PJ7F 5LQBH 3BZFB 1L7TL 5GJTL 4NKQB 5LG1A 2E7LC 2WV3A 1LP9E 1MAKA 1PSKL 4OCWL 1NQBA 5IHZA 1FV1A 1S5IL 3DSFL 3H42H 1IC4L 3KPRB 1IMHC 3BQUB 5CEZD 1MQKL 2GSGA 3W2DL 1BQHG 5ISZA 3LQAL 2VXUL 4X9GA 4AT6B 1OAYH 3QQ9C 3NCYP 3V5KB 4J3XA 3V6FB 1NUFA 1EUTA 4MWFA 1JK8B 3QCTH 1R0AH 2RCSH 4N0CD 4M4PA 4KZDH 4GRWB 1OB1B 2NZ9C 2O5ZL 3DXAE 3KPSB 5C7XH 1IBGL 2CGRH 2OL3A 2ICEB 4P5MA 2X1PA 3HRPA 5JOFA 2W9EH 3BGFC 5MERA 2FD6L 4QWWC 5F3HA 12E8H 4QHUB 1MHHB 3QUMB 4K7PY 3MACH 3W0WE 4D9QD 1A1MA 2B5IC 4QRSA 4L9LA 5IKCA 3ROLA 1DUYA 4HIXH 3IU4H 3MV9E 4PD4K 5IM7B 3ROOB 1BZ9B 1NBZA 1I9IH 4M43L 1A6TA 5SWQB 2F74A 3NN8B 3UDWA 1ZT1B 3SY0B 4EN3D 4CNIB 1MCOH 2DD8L 4TNVF 3L5HA 3RGVB 5IGXH 1FZOB 3NFSH 2BOCA 2FL5A 3C5ZC 3FT4A 4S1QH 2Z0BA 4XAWL 5I0DA 1J05A 1JP5A 1JGLL 4JGMA 5ESVA 3BE1H 4HH8A 2GK0B 5D8JH 1VSCA 1EAPA 2P7TB 3QIBD 4M00A 4WW1A 1OD7A 4L3EB 3QI9D 1QFWI 2ITCB 4BM7A 5KANG 5BZDB 3ULVC 1FO0A 1S3KL 4XGZA 1AGBB 1EK3A 4YHIB 4NO2B 1TTFA 1OGAA 5HYFA 4JDZB 2WZPD 2F8VA 5LWYH 4LVNB 1SY6L 4XBPB 5FIEA 1I3GL 4KJPD 5IMLA 2X4OB 3L5XL 4Q9RL 3QCVL 3SKJL 5C09E 1BF2A 1KLGA 3BYYA 3MRNA 5KSAC 5TE6L 3MRBB 4ZUSB 4WHCA 4APQD 3B6SA 1QLRB 1FSKB 4PJ8B 1T22B 3RQ3A 4O9HH 4TSAL 1PZ5B 5FM5O 1VKXB 3VXNB 5D7LE 3AREB 1TVDA 3L1OL 2VE6A 3IXTB 5FM5M 1UWEL 1KLUB 3DX9B 2FBJL 3K4DA 5BO1L 3U4EB 3UTTB 4I0PD 4GW5A 3QUZC 2E9IA 3MUZ1 1S9XA 2YPKB 3VFUB 4LLMA 5CKGA 3ZKQD 3RPIB 3BVNA 2BNQA 4X7SH 4PS4H 3DV4A 5KN5A 3T3PF 5C0BB 1ZVSA 4GUPA 1HEZA 4XH2A 1FDLH 1J1PL 3CXDH 3VGBA 1FFPA 4Y5XC 4X6DF 3LQAC 3OKYA 4KK8D 1VACA 3RWHB 4JY6B 2GFBB 1F2XK 3MLZL 2A77H 2BCKB 1WF5A 3G04B 5DD6A 1AFVL 4P4KB 4YH6A 5MEPB 5ITFB 3RVWD 2HVKB 3WXWL 3SDAC 3JBG7 5HHPB 3VFOA 3TV3H 3VGGA 1OHQA 4L8SB 3BPNB 4XB7A 4GRLB 2PTVA 1WWCA 2DTML 2LABA 4OLWH 4QCIA 3U6RB 3EO9H 4ZG1A 1M05B 1AGCA 3RP1A 1JUFB 1T7ZA 4MDJA 3K2UL 2XPGA 1AXTH 3B3IB 4JRXA 1RJZA 5KTEL 3P9WB 4I9WD 5GSVA 1Z3GL 1AJ7H 2HYMA 3EO0B 4L4TE 4OFVA 5MI0C 4JQXC 3KYKL 2P42B 3PL6B 5DJ6B 3PWUA 3F7QA 5GGTA 2Z8RA 1NGQL 4NC0B 2A0LD 4HHAB 4HG4K 1G7HB 1NGXA 2BHYA 4FQXC 4CVUA 2V17L 1AE6L 3E6HA 5DQJA 2X4UA 3BKYH 3IFOA 5KSVA 3HZKB 4HKZA 3BPCA 2Y25A 3GI8L 5EUKB 2ZJSL 4G43A 4R26L 1IL1A 5JHLH 1TZGL 3O3UN 1F11B 3ARPA 4XI5D 3DX8A 1YEHL 1XIWC 3D0LB 3ULVF 4G42A 1U58A 3QQNA 1TJGL 3AUVA 5FHBH 4J1UA 4Z7UF 5IMKB 3QR2A 5ANME 3HR6A 1T83A 2VDPH 5LJYH 3K8LA 2AK4B 1BJMA 5KSBB 3IDNB 5DMGD 2Z31D 4GQ9H 1ZAGA 4HKBB 2H2SC 3S3PA 5TDOA 2XA3A 4KV5E 2K7QA 2X4TA 5AWNL 5JQHC 1XZ0A 4FMKA 4JFFE 3FTGB 4L9LC 1PGRB 4K07A 3ARWA 1MRDL 3RWEA 5SWSB 1T7WA 1A7OH 4M62L 4P46C 3FQUB 5CD3A 5BS0E 4F57L 3TN0C 4OLEA 4LP4A 1GSMA 4IRJC 4R90L 3SDXA 2E7MA 4PRNB 1XGQB 3PQYA 1XCQA 3PHQA 2AJYL 2X05A 4Y1AE 1HSBA 4JVUA 4XP6H 5DMKA 4QF1B 4YBLB 3AAZA 4K3DL 4R97B 4ZFOA 2PNDA 2O61A 1Q9WB 1NL0H 1CVRA 2GEEA 1HKLL 3UZVB 3D48R 3PXJA 4XMPL 1OAQL 4AM0B 4BSVB 4J3VA 4TRPH 4DFIA 4HIHA 4QRRE 4JPIA 4QOKA 4U1LA 4WFED 3THML 3O11B 3T04D 1JNLL 3KWWA 3HZYA 3RA7H 1RJLB 2V5SA 1IM9D 1S5HB 4K2UH 3VXME 5I2IB 4UIMB 4M1CC 1E6OL 4L4VE 5T5NF 1NANI 1I1CA 3QUXD 4KVCL 4LSQH 3LN9A 3QEQD 3UJJL 4CMHB 4U1GB 4KAQL 4HDIA 1G6RH 2BVUA 2KDGA 3MLSH 4K7PH 4EUPA 3OB0H 1JZ5A 5EO9A 4YDVB 5JZ7D 1HKFA 3A6CH 5E4IA 5JR1H 1F3JA 5JORB 1SEBA 1DBJL 1XGRA 1G1YA 4DKFH 4FQJL 1E0OB 3GSWA 4RMVA 1K6QH 1RIUL 4R8WH 3DVNA 4PG9A 2EXYD 4NO0D 2GJ6B 4AEHH 1B4RA 1BQLH 2BJML 3D69B 4YGAB 5D1XD 1DQDL 2VDMH 2OMNA 1KTDB 2D31A 1CGUA 4HPOH 4RNRB 2BMKA 5GHWH 4OCSL 5C0CE 1IT9L 4HS6B 4U0RB 5I8KH 2AEPH 2FLBT 1E6JL 4NM8L 4PBWD 1IKFH 3QXVA 3T4YB 2EH8L 4I3SH 1U8QA 1D6VH 3O9WD 4I2XA 1AO7E 2CKNA 4MQSB 4UB0L 1IFHL 2UV3A 4KK9D 4MD4B 1MIEL 3DV6B 5E08L 4R7NB 3NCJH 2XRAH 2ATKA 3MUGB 5D5ME 1UJ3A 1RUAH 2NY1D 4PJBA 4WO4D 7FABH 1YEEH 2EH7L 3H3PH 1S7UA 3UXFA 4Q0XH 1QFUH 1MI5A 3VFSB 3WBDA 4YNYA 3TPKA 2IQAB 4UILH 5ILTH 5L2KA 1J1XH 4NBZB 1I7UB 4G80B 5J8OA 3FQRB 3IETA 4PY7B 5EU6E 1ZEAH 2P4AB 3BIKB 3FOLA 1KCLA 2DLIA 4FNLL 2ZKHL 1AD0A 3PDOA 4ALAL 5SWZD 3O8XD 4KKBD 3MBEA 5IT2H 5HHOD 3UC0H 3KHQA 2YPLE 2IPUK 4RGMC 4QXGL 3DRTB 5E8NB 3K81A 4NM4H 2DN7A 5TGBA 2ZUXA 4AG4L 3O6FC 1DZBA 4ZS6C 3FKUS 4OB5L 2ZWLT 4HJJH 2A9NL 1G0YR 4YDLB 1V3LA 5IW1B 4UU9B 3ZT6A 4NDMA 3O4OC 5FA4A 3ZE0F 2VITA 1MJUH 2CK0L 2XG5A 3N1GC 5C08B 1X5GA 2F54D 5SX5K 5A1AA 3QEGL 5J1SC 3HS0A 4PJCB 1BD2D 1RK0A 1U2CA 2ZCLH 4DKAA 1FCCA 3DX6B 1TJHL 3P4MA 4J7RA 2M26A 3TBYA 3H3BC 3HE6A 3UTZA 3B9DA 3U0WL 5I1IL 5DRWB 1BOGB 2X1QA 2FJFA 1HH6B 5DFTA 1PX3A 3CMOL 2DBLL 2WIIA 4Q9QH 2UWEE 4RIRA 1KYOK 2WBWB 2XTLA 3LD8C 1FYTB 2XNAA 3V5HB 2PO6A 3OXSA 4FXLA 4UOW0 4WW2B 1FVDB 4P2QD 1CXFA 5BMFH 4UIKL 3QDGE 4G7YL 4NN5B 1RU9H 3BWAA 1LDPL 5GGVY 3OB0K 4ZQKB 3WUZA 3HKFA 1UYWL 3FQTB 2UZYB 3I75B 4JDTH 2ESVB 2UYLB 3BGMB 3TNMB 3OAYH 2CDFA 1U3YA 1ZHKA 4OCXL 4JFHD 4K3HA 2XKNB 1VEOA 1M7DB 1AKJA 2NXZD 4UT6L 1F6AB 2XN9A 1I1AA 5DRNA 2HLAB 5E2WH 2HA1A 5DZOA 3WN5B 2CPCA 1J8HD 1CFVL 3BKCH 1OPGH 1A6WH 1J86A 1I9JH 4Z95H 5CUSL 1RZ8A 5KJRH 4UOW1 3TBWB 4YDKH 3V0VA 3V4UH 3ARGA 5F70A 2AGJH 4K9EH 2QSVA 3CFDA 2DQUH 4F2MB 3NFNB 5GGUA 1Y0LA 2F53D 3FB8B 3HUJB 1BBJA 4DCQB 4R3SB 4BZ2L 4JN2B 1MWAA 1YQVH 1MRFL 5SV3A 5EN2A 3VWJD 1H3UA 1R3KA 2FATH 1JMXA 4UMGA 1N26A 4Y5YA 3GSXA 3GB7B 5EDXA 1CLOL 3BZEB 3C8KB 5DUBA 4PJAA 1W0YT 1PG7H 3QRGL 4ZSOE 2P5EB 3OHXA 3O81A 5I1AB 1RZKL 4X98B 3WKNA 3QWQB 1I8IA 3C9NA 5I8EA 5LBSH 1U0QA 1NC4A 5DC0A 3KPOB 1T1XB 3GGWB 3T0DA 3VXRD 32C2B 4MJ6A 3WV0A 3ZHLA 3D3VE 1CFNB 2XWBB 3BRDA 2QTEA 3DECA 1N3NA 4LPWA 3VG9B 1LP9A 4XCEB 3ES6B 3MLRL 4UAOC 5D93B 4EJ1C 4E5XA 3I6KA 5TE4L 3JWDL 2V7HB 4XMKL 3EJYD 2ZG2A 1IRAY 4JGJA 4ENED 2ZSWA 5C0JB 2ID5A 1LK3L 4JQVC 3WDHA 3ZE1F 3GJFK 5EU5A 3WJJA 3T08A 5CJBA 5CINH 4AEFA 4IHOA 3VE0B 4PGJA 5HYQB 2YD9A 1UJ3C 2WUCH 1EZVX 4HV8A 3OF6A 1TVBB 3CZFB 1PQZA 4LSPL 3S96A 2HFEB 3JV5A 1AXIB 4LAJH 2ADFH 4X80L 4NWTL 3WLBA 5IWLA 1I7TB 3GMPA 3IVKA 2A6DB 5GSRB 5K9KA 4U1SB 2FJGB 1U8OB 1U8IB 2IWGA 2VUYA 2HVJA 1EHLL 3QZWA 5DEZA 2HT3D 4PJ9C 5B21A 4U7SA 3TNNB 3RBGA 5JOPE 2Q6WA 1LMKA 3W0WA 3ARVA 2Y36L 1KIPB 3H9SE 43CAA 4H5SA 3MBEC 1O0VA 2X6MA 1YEFL 4I4WB 4LKXA 1UH3A 3RDTA 4DUWA 4OZIB 5DRZA 3MV9A 1AIFB 4P2OD 2G2RA 3HAEG 4XCNB 2BVPA 3LEVL 5B8CB 1CFQB 1DANT 3W9EB 3LQMA 4P49A 2DQTL 4LLWB 1F97A 1N2RA 3MREA 4AY0A 3C6LA 4IRZH 3MRMA 1CDHA 2VABA 1JF1B 3CVHL 3BP5A 5FYKU 2VIRA 1JPGA 3S4SG 5AG8A 1G7MB 3G5VA 2GY7B 4KGJA 2BVOA 4U2ZA 1G9NH 1I1YB 1NGWB 1CE6A 4GBXA 1KTLA 4NQSB 3WL9B 3LEYH 3O2VH 3IS1X 4HIEB 1MY5A 3C09C 4CW1A 3OAYK 3OJMB 5C0AB 5FM8A 4EI5B 2P5WB 5FYKE 3JWOH 5HVGB 1A6ZB 4MJ4A 1J12A 4ACPA 1Y18A 4FTVA 1G6RA 3V52H 4W68A 5DHYA 1DQJA 4FFWC 3LKNB 3MSPA 3VH8G 2VDLH 3ESUF 2ZCKH 2CXGA 4L29A 2CLVA 5IJKA 4M93B 1IILE 5ALBH 2GTWA 4JJ5A 5C09A 2NY4C 2A74A 1GC1H 3DX7B 4ZUVA 1QKZH 4MXVF 3U0PA 3U9UB 1RZKC 5EZJA 5E5MB 2QR0B 1SEQH 1NEZG 1ITCA 3IDXL 4F7TB 5D7LA 2DLTA 2XI9A 3BGAA 1T2QH 1G7LA 1YMMA 4N0FA 5D7SH 2HTLD 4LKCB 5EC2B 3PDDA 3MFGB 3X3FL 5IOPA 5L8JB 3QWRD 1KJ2B 3BSZL 4OAWB 1MLCA 2HKHH 5CD5C 1MLBA 3L95A 4MA8L 4ZUUA 4PGDB 5F8RC 5DF0A 1IAOA 1FG2A 4NQDD 5HHMD 4MAYC 1U8PA 1MRCL 1QFWM 3CSPA 1NGZA 4PGCB 1QTYT 2RB8A 5FB8A 3ARGC 4AMKH 1WGOA 1IQWH 3MLVL 2DBJA 3QJFA 3WFCH 4PJBF 1NFDA 3MXWH 3O2WL 4HZAA 1P7KA 3RWGA 1MCRA 4GKNB 2YXFA 4H26B 1JFQL 3S37H 5ETUB 4OGAD 2R2CA 2NY0C 2ZUQB 4KQ4H 5D70L 3UP1A 5KW9L 1X6LA 4J6RH 4NGHH 1HHHA 3BD5A 5IROA 1ZLVH 3OGOE 3WDJA 2VQ1A 5IJVA 1LVEA 4WY7H 4F7PA 5AUMB 1RHHA 1OQXA 4G6KH 5EG6C 4YZFF 2YPVL 3QEHB 4UT7H 4OSUL 3K7UA 2ZUSA 3QUYD 1RMFL 5T33H 1S7XB 4YHML 1W0VA 5DA0B 3EOBB 3GJFA 5GS2H 1G7JB 1T03L 1LILA 2FB4L 4GT7A 4LQ1A 1NMCB 1AHWA 4XPHH 3TVMD 1VCAA 4FFZH 5DT1L 1BP3B 4FZ8L 3T0ED 3VFPA 2E5EA 2F5AL 1BVLB 4NC2B 4QTIL 1OL0A 5B38B 4FQHB 1U8KA 4WWKB 3NABH 3MROA 2Y5TA 4G6MH 3LS4L 2JIXD 3BDYH 5CEZE 1GGBL 1MFAH 1OSZA 3B2VL 1D5XA 2ARJQ 5D7IE 5IFJB 2YUXA 3X12B 4JFDB 1LD9A 4Y2DC 4NZDA 3WUWB 1PY4A 2ZUYA 3IU3B 4GG6F 3V0WH 3W9DB 1OP3H 3L7EA 1GH7A 1NCWL 3ZKND 4NOFA 3WFDH 2VC2H 3VD7A 4Z7VE 1ZHNA 2VLLA 3EJJX 5TDNB 4LPUA 4U1MA 3D39D 2YSSB 4XCYA 5EFIB 4KK6D 4APQB 5CP3H 3U79A 2Q87A 2OMBA 2Y07L 1F8TH 4Y16D 5C0IA 4O2FA 1SYSA 3LPGA 3GMLB 3E0GA 4JPVH 5CAYB 1W8OA 4DTGH 4QHKI 5CJOL 4JFFA 4D9QE 5ABDE 1BLNA 2W60A 5GQBA 2VLJA 1JGUL 3RDTC 3VXSA 2HG5A 2XWJB 3TC9A 5IMMB 4MB5A 3TF7A 3VXUD 2I07B 4DWHA 2XZAL 3PGFL 1I9EA 1KT2B 3BW9B 2WBKA 2VQUA 3CVIH 4HT1H 1LO3L 5DQ9A 3TPUE 1AR2A 1ZA3A 3BESR 4Y1AA 3C6LC 4HJGB 4JDVB 4BH8A 5C2BH 4PJHB 3T2PA 1JN6B 2W07A 4HKJA 1BM3H 1T3FA 1JNNL 1JZ8A 2BY0A 3HC4H 4QRRA 2DQHL 2NZIA 4Y7MA 4BFGA 1A9EB 2NLJB 3OJDA 4UNVA 4XZUB 1K2DB 3FQXB 1A9BB 2VXQL 1RZJC 5F3BA 4G8GD 2FNBA 5CP7B 3LKRA 1TQBB 3FRUB 2YMXH 1JPST 4PTUA 4BSWB 5E6ZA 1FFNA 5FYKH 2VN4A 2D0GA 1MREH 2QQQA 5C0DA 3LS5L 4PRBB 1OCWH 3KPMB 4FG6C 1FNSL 5IHLB 1Z6JT 3ILQC 2R2EA 1BZ7B 4XNUH 3NTCL 4ELMB 4KUCF 4LARL 4QTHA 5FM4A 5HGDB 3WKMH 3PE9A 5JW5A 4XPTH 1PD6A 1EVUA 1UH4A 4NUGL 4EDXA 3M8OL 1P5VA 5DVMA 1J0HA 5GRWA 2R56H 2H45A 1ZLVK 3VJ6B 4QHMB 1K4DA 5LKNA 2PN5A 3HAEH 4KTDH 4QYOB 5DQDH 4NN7C 4PJ5A 5EOTB 3FT3B 5DSCA 5J4MA 3VXQB 3NVQA 1C5CH 3O45B 3EAKA 3QAZB 4LNRA 4GJTB 1A4KB 1YYMH 2EYSA 4CADB 3NCEB 4JG0H 4PBXA 4UQ3A 3QPQC 1YEDA 1KXVC 3MV8D 1AO7A 3P9MA 3V4VL 1A02N 4I5BB 4N90D 1SJXA 5D2NA 2AEQL 2FSEB 5FKAA 2IQ9L 3REWB 5JLZB 3CLEH 3QUZB 1HDMB 2X10A 3PWLA 5IROC 3OZ9H 4Y4FA 3OKMA 5HI5C 5JA9A 2AXGB 3I3DA 2LTQC 4PGBA 1LEGB 2R0WH 5BV7H 2NY6C 2VDKL 2DI7A 4LASL 1OP3K 1A0QH 3D85B 5EU6A 3L5IA 3QSKB 4I9WE 5DUML 3E2HA 2XA8H 1C5DB 1EEUA 4U1NA 5DFVD 4GW1A 5CWSA 2XZCH 1B0WA 2BC4B 2J1KA 3ZYZA 4PPTA 5D9SB 3TBVB 4YGVB 4LEOA 4Z76A 1HN1A 4E9LA 1J1OH 4Y4HD 3UTPD 3SDAB 3PGDB 5DMJB 3VFTB 1IE5A 4IIQB 3SDYH 4O02H 3FCTA 4OV5B 2VLKD 1PX4A 1C08A 2B0SH 5FO9A 4MXQD 4XP1L 1P4BH 3VRIA 1IM9B 1D9KD 1WCBB 4DK3A 1JI1A 3D0VA 2D9QB 3NCYS 1KTKE 4BFIB 1XFPA 4ZXBD 3TIEA 3GSNL 4OF0A 1XGYH 5CEZH 1A3RL 4ODSH 1FZMA 2CLRB 3QEQB 5JQ6H 3QG7H 1FLRL 2O93L 5B3JF 1TPXC 4BFEA 4WIQA 5D96B 4CN4A 4L8CB 1HNGA 3IXAB 2EE9A 2MPAL 1J11A 1WEJH 4MA1B 3IDGB 4N8CH 4X6CB 2Y4SA 3FHQA 2W65A 1R3HB 2XQBH 2ARJB 3SO3B 2VZOA 4HIIA 3GSOA 3VI3F 3GBNH 1QR4A 2UWEA 1A7NL 3NZHL 4I48B 1DQML 1RIVL 2ZOLB 4PY8I 1YC7A 4HH9A 4XWGH 3TJHC 4PB0H 2Z91A 3KLAA 3QFJE 3TF7C 1QSFA 3MRHB 4JKWA 1XIWB 2VXTH 2BRQA 4NO0B 3O4LE 5L2JB 3MBXL 5CGMA 2Z8SA 3QDGA 3GIVA 3BEVB 3WEXA 4Y8DC 1R6VA 1OAKH 2JJSC 2NX5D 4MSWA 4P5KB 3X14A 3T0AA 3SE3C 1IGMH 1NAKH 2ZPKH 3C8DA 3AC0A 4U6HB 4WFGE 2R69L 3MOBH 1YJDC 3CDFA 4N0UE 3CIQA 1A1OB 1RULL 4ZFFB 3JV6B 4NNXB 1TFHA 5DJYB 1FNLA 1KIQA 1FPTL 4WFEE 3MODL 3GRWH 1NFDF 5DVOA 4OT1L 1IGYA 1HHGA 3VXPB 2Z93A 4HX1A 5D1QC 4WO4B 4HS3A 3K4AA 3TN0B 3DRQA 1UZ6F 2QKIA 2YK1H 5HVFB 5ICZA 2CMRL 2YZ1A 3AS1A 4EI6A 4S1SL 1NC2B 2FX7H 3L3IA 1NBVL 4D9RD 1Q1JL 5D71L 4CJ0A 4U4BA 5E00B 1F58L 4MNGB 1WJ3A 3SGKC 4MA7L 4F9LA 4R4FH 1C7SA 5HTSA 4KI1A 1DE4A 2QBWA 3VWKB 4JZOB 4NQEE 3FOMA 1CLZL 5FO7A 3G9VA 1KPUB 3O8XB 1T1ZB 4ZSOA 4G9FA 5HYIA 3MNWA 3W11C 5T1MB 3OB8A 2IADB 4MLSA 3BKMH 1YEGL 3S35X 1TQCC 3LQZA 2VAAB 4U1HB 3LKOA 1CD8A 1RZFH 2WWKT 1U8MA 5TF0A 4KKCC 2DDQL 2WWMD 2HH0L 5J1AA 2VDOH 5J6HB 4WU7B 1SQ2N 1PKOA 3OKNA 2C26A 4RDQF 2VDQL 1OAUL 4U1JB 5F7DA 3NACL 3IAPA 5FK9A 1JZ4A 1FVEA 2ILLA 4ZO6A 2XKUA 4PRPD 4OLUL 1EZVY 5HDBF 3LZFH 2A6IB 5D2NC 3BHBB 1MHEB 4DUVA 1SJEB 3C87A 2V5TA 1H3PH 2NTFB 4QNPE 2APVA 5DTFB 4X0KB 4Q2ZA 5EOQH 3ZL4L 3ZSSA 2ZUUA 4MNHA 4PUBH 5ESAA 3BPOC 4Y4FC 3HG1E 1JGVH 4H25A 3DMMB 4KZEL 2WUBH 1NDMA 3VFNA 4OZGB 3ARSA 5DUPH 4JHWH 2Q86B 1KB5H 4P2QB 4O4YH 4B53A 5IQ9B 3EDJA 1EEYA 1NLDH 1ONQB 1KJ3H 3MUY1 4HWEL 3WNNA 1E28A 1N59B 4Z0XB 5SWZE 5E95B 3MNVA 3EIFA 3WIIH 5B4MD 5HHOE 1YZZA 4I3RH 1VFBB 4M02A 2ATPA 5CBAA 4LCIH 4YK4B 1HZHH 3QNZA 4IDJH 4HS8H 2NXZB 5DRXA 1UVQB 3O3BA 3EDDA 3UTQA 2DIAA 1FBIL 3B9VA 5DJXA 1JGDA 1WWWX 4Z7WA 2FEDD 1T7VA 3GHBL 1HXMA 8FABB 1A14H 5D2LE 1NAMH 3BIBX 5J11B 3QQ9D 2F54E 5A3IC 3ALXA 5E6IA 1EEZB 1YEIL 1WTGT 1BD2E 1V8HA 5D7JD 4FQ1H 3VWJB 3KDMB 4HCRH 5B39A 4NPYA 2MNUA 1T1YA 3C5SA 4OUOA 1U3HC 4WCYH 3D2UA 5TFSH 3GMMB 1ZGLP 3BH8B 2B4CL 4MB3A 1T5WB 4QWWD 4PJGB 5F88A 1A7RL 3I6GB 4LMQE 4KRPC 3SBWC 4MS8A 5GISL 3AB0B 5BJTA 4ZUWA 3S34H 3VGFA 1D5BB 3O6LH 4OZHA 4EDWH 4C59B 4XC1L 4PLJD 1P1ZB 2JCCF 1W8NA 1H0DB 3HNVH 5KS9A 5FCUH 3B9KC 3JV4A 2BVYA 1XF2A 2RR3A 4R0LB 5DYOB 3RUGE 4MJID 1HOCA 4MJ5B 3JUYA 4UTAH 4MD0A 5CBEA 1T6VN 4QHNA 3MV7D 4IOIB 1GCFA 2ICES 1DDHA 1GGCH 1ZWIA 4DKDC 4J8RB 5IEHA 5IB4B 1XF4A 1K8IB 5JHDA 3CPLB 2ZOKB 3VMOA 1EMTH 1ORQA 3U7YL 4YXLH 5SX4H 4WUUD 4H20L 3HC3L 1J8HE 4LVHB 5TDPA 5CHNB 1BVKA 5AEAA 5TE7H 1ND0B 2UVFA 4GMSL 1TTGA 3D25B 2R1XB 4HK0B 2OP4H 1NUGA 3KS0J 3IRPX 1F3DJ 3K8MA 3IYLW 3KXFA 2F53E 1SMOA 2C1OA 4OKVB 1X4ZA 5FV2A 5C9KA 2NY5H 2IAMA 4QY8B 1GZQB 1JGEB 3P0VL 1X4YA 3GSUB 4F9LC 1W72A 4ZAKD 5JA8B 3VG0L 4CMMA 2OCFD 4DVRL 3GIZH 5EUOA 4V2BA 1BAFH 3SGEI 2QHRL 1M4KA 2OTWB 4G8EA 1RK1B 2XTJD 5E2UH 2DOCA 3Q6FA 5DDHB 3ZKMC 1PEWA 2VZ3A 4L8BB 3TO4A 1YNLH 2HN7B 1BFVL 1U41A 3GJEA 4X99A 1ORSB 5IVXE 4EIZC 4GS7C 4YQXL 1WAAE 3MRDB 5EIQA 4NZRL 4AIZB 1F02I 4IOSD 4GXUM 5FGCE 3VXRE 2BOBA 1A7QL 2YD3A 3DGGA 3UJIL 4Z5RA 4EOWH 4YXKH 1WZMA 1QOKA 1X4XA 4K8RL 3RZWA 1MNUL 2ZP0T 1M7IA 5GGTL 1YEKL 1RUML 5KAQG 4LQFH 1XCTA 4C83B 5EC1B 3UCRA 5KSUB 4IJ3C 4LL9A 5FUOL 1EXUA 5I1KL 5JTWA 3WNMA 2CRZA 2VDRL 1WZKA 2ED7A 3WFEH 4K3EL 2B4CC 1EA9C 2IH3B 4Z7VA 1Z9LA 1JV5A 3RNQA 3SPVA 5KVDL 4LCWD 5BQ7A 3VGDA 5D6CB 1ACZA 1RUQH 2L0DA 1BZQK 2M8XA 1NMBL 5C6WH 1T0NB 1A6UH 4FXGA 4L4JA 1IC5L 5LXGH 4XNQB 3INUL 3QNYA 3MA9L 3RTQB 4C4KO 4EQ3A 4M9OA 5CSZB 5GGRY 2BRRL 4Z7QE 3BP6B 5ESQA 4WHYG 1IEBB 3BXNA 1WBXB 4OD1L 3HRZA 1LE5B 2YA2A 4LSUH 3RAJH 5IEKA 4XPFL 2CLZB 4JO1L 4NQDB 4A2MA 4WDIA 1MCWM 1RSFA 4FQ2H 4P23A 5FGRA 1JF5A 4N9GA 4WV1C 3D18B 1H3XA 1GZPB 3ZDZE 1QHPA 3TLRA 1NBQA 3MLTA 4HBCL 4LSVH 3MLXH 5ISZD 1AQDA 3L7FA 1CFSB 4PB9H 1ACYL 3WS6A 2VRAA 3WMSA 3QUMH 4P5TA 4JO3H 4OCRL 2EDWA 5L6YL 1XGUB 3LMJH 1KPVB 3K0WA 3C08L 1U8JB 2X4QA 5DK0B 2D4DA 2GKIA 1KV3A 4D0BA 1B6UA 5T5FH 1OWRM 2WIMA 4PJEB 1EX0A 2GYSA 3NPSB 5C0EA 4K7FB 2QQNL 3OKDB 5H94B 1S78D 2C4XA 2A6KB 2DQCH 1QQDB 5TQ0H 3WO4B 1DVFB 4WHTB 2WINA 2K9UA 5MENA 2PXYA 4Z78A 2D7NA 1S7SB 1LEKB 4R4BB 5ENWA 5F6IB 3WNPA 5J12C 2JB6B 4JR9H 4KUZL 2NY7L 8CGTA 1ZMYA 3T0EB 1GGIL 3SDDA 5JOEA 3RIFK 4GG6B 4DUXA 1II4E 1Y6MR 1ZANL 2AV1A 1IC7H 3PV6B 3P4NA 4RA3A 4KHXH 1REIA 4DOHE 4NCDA 3MRKB 2VZTA 4P3DB 1B90A 1P4IH 4UNTA 5HHME 3VFMB 3L3HB 4FFVD 5IBUB 2NNAA 3E3QA 2DQGH 4PV9A 5LQBL 4R2GC 5F7WC 3ECBA 4XNMB 2FDBP 3H42L 1OGAD 3VDCA 4M1CD 3X13B 1JPFA 1ITBB 2D03H 5JW3H 3D39B 5IF0B 1HI6B 3HNSL 3L5WA 1I4FB 2I9TA 4Y16B 1UQSA 2OR7A 6FABH 1CTNA 2DWDA 2H2PD 4TSBH 1KB5A 1WC7B 4DZBB 4DN3H 3VA6A 1TITA 5D1ZC 1FN4A 1NUDA 1D5IH 2VWEE 3MV11 3QCTL 1R0AL 2RCSL 1PJ9A 5HHQB 3VXUB 1L4IA 4PGZA 4XPBH 3TO4C 1N64H 2OTUA 5C7XL 4G6AC 2CGRL 3RWCA 4JEGB 4RAUA 4Y5VB 2IANE 2W9EL 1RIHH 3P11H 4HUUB 4YFLF 1ZS8A 2F15A 4P2RE 12E8L 1U91B 4LLUA 4X6FB 5JNYB 3LKSA 2BNQD 4OZ4A 4YHOH 3MJ6A 4X4YA 4MZ2A 2ZG3A 3IU4L 1UXSA 3RIAF 1NAMA 4JRYA 3R0NA 1I9IL 1MVFA 2E6PA 3MOAH 4P2YA 1S7RB 1E27B 2OI9C 3UPRB 2B20A 3EYFB 3LAFA 1F4AA 4G8GB 4M6MH 5J3HD 3U2SA 1MCOL 1T1WB 2AQ2A 5IGXL 1R3IH 1VFAB 3WFZA 3O3DB 3NFSL 3Q2CA 1RZIB 4QO1A 5FOBA 1WFUA 1IAKA 2EDBA 1U42A 4E0RB 3BE1L 1EAJA 5D8JL 1EH9A 2H3NB 2IEPA 3D1MC 5GRYA 3SDCA 1N4XH 4RQQA 3CVHB 4H0GA 5BCAA 1YPZB 4JRXD 4F7CA 3PABA 5I16A 5CIPB 3TIDA 4LCCC 4WJ5A 4YR6B 3O3EA 5IV2A 4X4ME 5LWYL 3IDMB 3RVUC 5KS9F 3MNZA 1NGPL 4F9PA 1FRGH 3QFJA 1I85A 5AD0A 1Z0NA 3O4LA 3EUUA 3LSOA 4NRZB 4LCYA 4Y2DB 4POZD 3FO9A 1VFMA 3AU1A 1MF2H 2ADGB 4WFHD 1BX2B 1NUNB 3C60A 4O9HL 4YHNB 4M61A 3G08B 2GJZB 4PJXF 1NBYB 2ZCHL 4QXTA 4TTDC 2AJUH 1WBYB 3IF1B 1RI8A 5HYSG 1S9YA 2FWOA 4HWZA 4PG2A 2JJTA 1BWWA 4X7SL 3RZCC 4PS4L 2BNRB 1L0XA 1ZHLA 3VXOA 5BOZG 3CXDL 3L3OB 3IDJA 1GAFH 3KPTA 2E9WA 4XB8A 4P57B 3BX7C 1PW3A 2A77L 5EUOF 1QVOB 3FFDB 3P9LB 3VRJB 2E3VA 1F5WA 3TV3L 3L3KB 4KMTH 3U30B 3WO3B 1XF5B 3F7YB 2MHAB 4LBEA 2NY2B 3KPPA 1CICA 4NQEA 1NGYB 4S11A 2ZSVB 1HH9A 4LSDA 4OLWL 3EYQD 3EO9L 1LQVA 3CX2A 4UQ2A 3PQYD 1JFMA 2LU3A 1CGYA 2WBJC 1AXTL 2VLKB 1TCRB 3BP4B 3MLPA 1MHPH 1AJ7L 2JTDA 5I6XB 3T0VA 3LEXB 1AXSB 1CG9A 5HYJB 5FKPA 2F5BH 1SBSH 5GRVL 3QQ3B 5FUCE 4QOKD 1VADB 3PWNB 1GRWA 3MRQA 1YA5A 3I02A 2IBZY 1QA9A 2E6JA 2J8UE 1A7BA 1KELH 2HFTA 3QIUA 1CFTB 3BKYL 4NHUE 2L7JA 3MV8E 1DBMH 1CGXA 1JHKH 4L8DA 4XHQA 4N90E 3BMVA 1GVIA 1TXKA 5JHLL 4NUJB 4MHHG 3MX0A 2MQ3A 3KNBB 3ARFC 3BZFA 3VGAC 3HG1A 5TF1H 4MVBA 5ADPH 2MCG1 2V7NB 2N4IA 3EDKA 1Z5LB 5FHBL 1HSAB 3WNKA 1S7WB 5F9WC 4HMCA 1UA6H 2OZ4H 4JZNB 2RHEA 2VDPL 1YMHB 2R1YA 4IRSB 1MH5B 4GQ9L 3V5KA 4HZLB 4V1DE 3U46B 4RFNB 3U7AA 3V6FA 2UY6A 1ADQH 1KPRA 2EYRB 3HPLB 3ZMRA 4YO0B 2IALB 1MJJB 3VU2A 1TMCA 3UTPE 3TA3A 1RZGB 5L9DH 3KPSA 1CWVA 3OKEB 2G9HB 2ICEA 4M6AA 5IMOA 1HIMH 1KCUL 2APBA 4Z7OE 5I74C 4QHUA 5JPNB 1MJ8H 1MHHA 3QUMA 2A38A 4N1EA 4HF5H 1NCCH 4U6VH 1A5FH 2YD5A 4XP6L 4RAHA 3IFLH 5D2LA 5IR1A 5JXEA 1QSZA 4UUJB 1NL0L 2VR9A 1JBJA 5IM7A 4RGND 1BZ9A 2W0FA 4TRPL 1NKOA 1J88A 1MI5D 5FGBC 4CUCA 5C70A 1ZT1A 1IEAA 2J6EH 3RA7L 4OGZA 1JI2A 3NIFE 5INDB 2HLFD 3RGVA 5L2KD 3IFPB 1FZOA 4K2UL 3SCMA 2M1KA 5JDSB 1UCTA 3N85H 1ZLWH 1N6QH 4LSQL 4PTTB 2AXHA 3KLHC 4F9PC 1F13A 1DLHA 2GK0A 3UYOD 4JJHA 3MBED 2P7TA 3G6JE 2IPKB 1FJ1A 4L3EA 1G6RL 2EDHA 2ITCA 1MIMH 3CNKA 3MLSL 4K7PL 1FNGA 4AQ1B 5BZDA 3JZ7A 4JANB 5C0FB 4DZ8B 3UTSB 1AGBA 2ADJB 7CGTA 4YHIA 5DEFB 4NNPH 4BK4A 4JDZA 5F1OB 1IJ9A 3DYOA 1N7MH 4X5WB 4D0CA 4XBPA 1RVFH 5JR1L 2NX5E 1LNUB 4JFPA 1S7QB 3QO0B 2QADC 1VEMA 5DI8B 4DKFL 4PJ7E 4ONGH 1K6QL 5DD5H 5E94B 4GW4B 1KIUA 3S5LA 3MRBA 3RPKA 4ZUSA 3Q6GH 4PRPB 4AEHL 4PG2C 1BQLL 2JJTC 5I1CH 1T22A 1UH2A 1PZ5A 5EOCH 1VKXA 2VDML 3RKDC 1RJYB 3IXTA 1VGKB 5F9JA 2VKWA 1YN7A 4HPOL 1KLUA 1MFCH 3QIWC 3I2CH 1WWAX 4K94C 4NFDA 4WI8A 5GHWL 2H26B 3DX9A 3OR6B 1OOAA 3HE6D 1BHGA 3U4EA 3QULA 5I8KL 2AEPL 5J9PB 2C9AA 1IKFL 2YPKA 3VFUA 4KK5D 2ZUTA 4I3SL 3WIHH 5HY9B 2B1HL 3HE7A 2D7MA 2EDKA 4PJDF 3RPIA 2BERA 3QXDB 3VMNA 4EKXA 2DF3A 5C0BA 3NCJL 4WTWA 2XRAL 2PO6D 1RUAL 2EDLA 7FABL 1YEEL 1A6AB 3RWHA 1I8KB 3H3PL 4OIIH 2GFBA 4S1RH 2BCKA 1QFUL 2VZ1A 4JFXB 2XWTB 2X4NB 1RPQA 4GAFB 5MEPA 5D1QB 5ID1A 4M7KH 5ITFA 3T65A 1YN6B 4UILL 5ILTL 2H9GB 2HVKA 1J1XL 3S6CA 4L8SA 1ZEAL 2GUOA 5KVEH 1R24B 3LN5B 1WAAA 4PV8A 1Q9OA 1AKJD 4XPAH 3U6RA 2XN9D 1I1AD 1M05A 5IT2L 1JUFA 5JO5A 4ONHB 3UC0L 1JIBA 2JK5B 1UZ8B 3CDGA 1HE7A 2K7PA 3MRCA 4FP8L 3ARGD 2Y06H 3EO0A 5LGJB 1CU4H 4JPKH 1CD0A 4GAYB 2E7BA 4HJJL 2EZ0C 3PL6A 5DJ6A 2NY3D 3LDBC 3ZTNH 2JCCB 1MJUL 3DBXB 3V79C 1TQCB 1QBMH 5KBNC 2PUQT 3RX5A 3HZKA 1KGCE 3BQUC 1NEUA 3IJYB 3CH8A 2ZCLL 1JZ6A 1MCBA 1F11A 4L5FH 3S35H 1G7QB 3GSNB 5CLWA 1VDGA 3DI3B 5A2LH 1N5AB 3D0LA 4CN6A 1NC4D 2V6HA 1MFEH 4ODUB 3ZSTA 4Q9QL 4MJIB 1VGEH 3FRPG 3N1MC 2Y7QA 1N8ZB 1B0RB 3MV7B 1ZLWK 1WVZA 3WLWC 5FEBA 5KZCD 3IDNA 5BMFL 2XYCA 3A6BH 4IMKA 3NMEA 1RU9L 3T3PE 5F93C 4RFOH 2XOTA 4PRAB 5DO2C 3FTGA 3SKMB 4QT5A 2LVEA 5F6HJ 4X6DE 3ARXA 4JDTL 3RGHA 4NJAH 1ZT7B 5JXEC 2ZUVA 3LN4B 3FQUA 4NZTH 3OF6D 2YOCA 2H32H 4LSSH 4O2CA 5E2WL 5DHVB 2N7BA 3BKCL 3FO0L 3LB6D 1OPGL 5DJ2B 3PIQA 1A6WL 1I9JL 4UV7L 2VISB 4Z95L 3RGVC 4QF1A 5KJRL 4ZPTB 5DLMH 4HMDA 4NBYB 4YDKL 3V4UL 3MGTB 4K9EL 5GGRA 1CQYA 2EIZA 3UBXI 2DQUL 1UM4H 5F7NC 1KJMB 2OR9L 2X89A 4IBLT 4AM0A 3W0WD 3ISWA 2PCPB 3NCCB 2I9LA 4JCLA 3O11A 1X5ZA 1RJLA 1YQVL 3DYMA 3OX8B 2FATL 3MV9D 1E4WH 1FH5H 5IB2B 1NCDL 5I2IA 2GJJA 4UIMA 4F7EA 4LVNC 2YBRB 4X5XB 1UB5A 3BYTA 4XVUC 1P9MC 1F3RB 2W91A 4XCCH 1PG7L 3K3QA 5AYQA 3RL2A 3C6LD 4Q6IA 1DN0A 2CJUL 2ZG1A 1B4JL 3QHZH 1GGTA 3OGCB 3M1BB 5GZOD 1F4WL 1U93B 4PJIE 1CS6A 2J3SA 1T0MB 4KQ3H 4PJ8C 4YDVA 4GBXD 4M7LT 4XTRC 1BJ1J 1LO2H 1PDKA 3AREC 1LE9A 1XGTB 2FLRT 2G5BB 4HK3N 4BQCA 4WUUE 4OCLC 2IFFL 1IZJA 4ISVA 3ULVE 3MA7B 2FEEI 4FTVD 4LEXH 3QDME 5J13B 1CDJA 2AJXH 2GJ6A 4Z7UE 5F6HI 2X7LB 5IUSA 3D69A 1CDCA 5DJDA 5C09D 1KTDA 5CINL 2OZ4A 4RNRA 3QB7C 3ILQD 3H3KA 2WUCL 4RMRA 2YEZB 3TZVB 3T4YA 5D7LD 3SJVB 2XTJE 2ADFL 4P4KC 1YMMD 3BUTA 4JPWL 2YWZA 3FQWB 4U6YB 2DQEH 4V3EB 4GRWF 4R7NA 2R9HD 1J0ZA 3GFUA 2IANA 4L8SC 3BPNC 4JY4B 5IHZB 1T0PB 1FV1B 4GRLC 4P2RA 4JHAH 3B5HA 4JAMA 3VFSA 2DS4A 1FIGL 3QDJE 4ODBD 4RAVB 4XBGA 2IQAA 2GITB 4P4RB 3U48A 2E6QA 4GOSA 3AY4C 4G80A 3FQRA 4PY7A 4PREA 1DQTA 3WFHA 3BIKA 3QPQD 1TJIH 3JV0A 1OP5H 3PL6C 5F97E 3DHMA 1UACH 4IRZL 4AZ8A 4PRHB 4P5MB 1C7TA 5MERB 3FN3A 4X7CC 5I17B 2VH5H 1G9NL 4KRMB 5E2VH 1AGEB 1CDGA 3KYNB 2IG2L 4WENB 1SM3H 3LEYL 3O2VL 4XHJD 1VESA 4F33A 4PIRF 5IKCB 4LCWE 5IW1A 3JWOL 4S1DC 1DUYB 1H5BA 2MQCA 2FHBA 3V52L 1MHCB 3CK0H 2VDLL 1NBZB 2ZCKL 1A6TB 1TZIB 1GL4B 3GHEH 1MOEA 2F74B 5ALBL 4PJCA 1GC1L 3DTXA 3VFRA 4EEEA 4D3CH 4EXPX 1H15A 1UM5H 4KI5C 2BOCB 2FL5B 1G9EA 1P69B 1BOGA 4Q97A 4LHUB 1HH6A 3CD4A 2Y6SC 3VRLF 2K3TA 5ESVB 4QRPE 1DSFL 1T2QL 2OTPA 1QFOA 4OF6A 4WW1B 1FL3A 5C3TA 1QBAA 4XMLH 1CXEA 2C3VB 5ISZE 1BGXH 3CAFA 4XGZB 3RI5F 4WW2A 2HKHL 1JTOA 1OGAB 1QD0A 3GBLA 4NBXB 4YLQT 5HGGS 3WIHA 2PYEB 3MRNB 3FQTA 1SJHB 3HFMH 4YBLC 3I75A 2UYLA 3QXWA 4Q74A 3BGMA 3FONB 4R97C 2GTZB 3GSRB 3B6SB 4AMKL 1IQWL 4BZ1H 2XKNA 3WFCL 4WV1B 3B5TA 4NYLB 1M7DA 1FNAA 3L3JB 1F6AA 4JFFD 3MJ7B 1NFIA 4I8DA 2HLAA 2AEWA 2P46B 2VLJD 3S37L 3WN5A 1UCBH 3VXSD 3X3GL 5CJXA 5DJ8B 4AEIH 4KQ4L 5FHAH 4K7PX 4HKXB 4NGHL 3ZHKA 3LPWA 4KC3B 3M17B 1J18A 1YECL 4U7MA 4WY7L 4PRIB 4PLNC 5KN5B 4WVRA 1DR9A 3HUJA 4CMHC 4DCQA 5E24E 2R0ZH 4G6KL 1HEZB 4U1GC 4XH2B 4M6OH 2I5YH 4R3SA 2MCPH 4Y1AD 3H9HA 2DJ4A 5CJQH 5ADOH 5GGVL 1EBPA 4RMTA 4YAQA 5T33L 1DFBH 1QBLH 4Z77B 3GB7A 2G75A 1OT2A 5FYLD 2IJ0C 4RWHA 3S98A 4QRRD 1NLBH 2CUMA 1KSRA 3EFFB 4XPHL 1MCHA 3ZE0E 4FFZL 2P5EA 1I8MA 1OTUC 4X5LA 2J8UA 4X4XB 5I1AA 4X98A 2VZUA 4NHUA 2ED8A 3HHRB 3VFWA 2V9QA 1SHMA 3NABL 3U7WH 1CXHA 4G6ML 1XGPB 1AGCB 3BDYL 1T1XA 1MFAL 4XC3H 2C1PA 4MDJB 1U8NA 2XPGB 3ULVH 1MSPA 4JRXB 1RJZB 4TNVK 5GSVB 5AAMA 1K5NA 4YEFA 1OP5K 1S8DB 5JIIA 4FXKB 4XCEA 1EO7A 1QRNE 4U0RC 4HJ0D 3ILPB 3ET9F 3V0WL 1M1SA 4GAGH 2V7HA 1YNTB 3PWUB 3WFDL 4YHKH 5C0JA 3SOBH 1HILA 4KHTH 5DR5H 4BK5A 3W11D 1NGXB 3FZUD 3VE0A 3E6HB 5DQJB 4HSQA 4XNZB 2AEIT 1F8TL 4X8JB 1IAMA 4V1DA 4PJ5D 2CH8A 3MGAA 3MYZA 4KI5F 1TVBA 4ZUTA 5KSBF 2V2XB 4NHCH 4G43B 4LPXA 1QSEB 2BNQE 2X2YA 1I7TA 1NKRA 2A6DA 5GSRA 1U8OA 1IAIH 5GJTH 3SE9H 1OF2B 1U58B 5D1ZB 3CVIL 4HT1L 4NP4L 5JUEH 3TNNA 1IC4H 1A8JH 1J0IA 2NXYB 3H9YA 4UT9H 2DKMA 1AO7D 3EO1A 4I18C 4NQCE 2VR5A 4N1CA 4U1IA 5C2BL 4NZUH 4YHLL 3OJ2C 1AIFA 4N5ED 1K4CA 1BM3L 5GS0C 5DS8A 5B8CA 5I1LB 3HC4L 4Y4FD 4MXWH 5I15H 4YDLC 1AY1H 4YBQC 1IGCH 2R1WB 1FL6B 4ZOAA 3RWEB 1JF1A 1IBGH 5I66B 5EU6D 4LSTH 5HI3C 5D5MF 2PTTB 2YMXL 1WFNA 4XP9H 1TCMA 2BSSA 5C71A 2Z4QA 1I1YA 4AK1A 1NGWA 3PQYB 4LAQH 2OI9B 2ARWA 3BD4A 5FYKL 3WL9A 3PHQB 4OF7A 1I1FA 4HIEA 4QRTA 3MLWL 4FQIH 1MREL 1VENA 4HD9A 4JFEB 4FQLH 4EI5A 1OCWL 4OM1H 1LGVA 4OTXH 4XNUL 2CDEB 4F7MA 3H7LA 4E41E 3WKML 2KUTA 2FZ3B 2QSQA 4XPTL 2CIIB 2VNCA 4QOKB 4U1LB 1I7RB 3KWWB 5L0QB 2A83A 2R56L 3D6GA 2DD8H 4AIXA 4KTDL 4EXKA 4LCCB 5DQDL 4QGYA 4WW2C 5E5MA 2QR0A 2AQ3A 5A3ID 4JKLA 4NN5C 4F7TA 1C5CL 2D7PA 1JGLH 1FL5A 3CFBB 2ICWJ 1FZJB 4HDIB 1QHOA 5EC2A 2HT4D 3SGJA 5K59F 3OKLB 4P9HC 5F1IA 4JG0L 4OAWA 1C8PA 2ADIA 4JFZL 5EO9B 1UB6A 1JYVA 3O0RH 1F3JB 5F21B 4M4RA 5IIEA 4AQOA 4ZS7H 3SKJH 4ZO7A 1L9NA 2J88H 3GSWB 3QNXB 3WN5C 4KRPD 3UZQA 2OL3H 1O7VA 5CJXC 4EUPG 3DVNB 4PG9B 1QSFD 4PGCA 4WTXA 3CLEL 3OZ9L 4WNQB 3QDGD 5F9OH 1CDBA 2QJDA 3SDXE 3M07A 4TVSa 1D6EB 3G9AB 2R0WL 5CZXC 5BW7C 2AJZA 5BV7L 5I73B 4GKNA 4KH2