3I6LD

Newly identified epitope n1 derived from sars-cov n protein complexed with hla-a*2402
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 76
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2009-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i6lD02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3i6lD01
3V5DB 1G0DA 1NC4B 4N68A 4X9HA 5HHOA 3BKCH 2AGJH 3UTQA 2GIYA 1HI6A 3UO1L 4RZCB 4ZXBB 2NXYC 2NY4D 1D5XB 5DD0L 3WN5C 1YA5A 2MCPH 1QSFE 3E6FA 2YPLA 1H5BC 1A1OB 4K2UH 4BH7B 4UV4H 3IB4A 4RFEB 3W9EA 3D69A 2AQ2A 3ARZA 1KSRA 1A21A 3P30L 3KLHD 5GZOC 2YUZA 2W9DL 4U3XA 2NY2B 3DTXB 4WEUD 3FQRB 2EE3A 2X4OA 2QHRH 5JQ6L 1FYTE 2EH8L 1F4XL 4KJPD 3VGFA 1A3LH 2V6HA 2K9UA 4O02H 1A6TA 2DLFL 3U4BL 1VEMA 4Y5YA 3KPOA 4WO4A 3CH1A 3S3PA 1XGTA 5DT1L 2YPLE 1N3NB 3MV8B 3ULVD 1HKLH 4L8BB 3QUXB 4Y19A 4HUVA 3LD8C 5K59F 2ESVD 3EZJB 3HAEH 3GIZL 3T0EA 2CDFB 5I17A 4LCWD 4LLWA 3LKOA 3QDHA 4PJCF 4WEBH 1J0KA 2Q3ZA 5B38G 1MJUL 2R2HA 2EC9T 4KKAC 1VSCA 1I8KB 4A2LA 1Y6MR 3UTOA 5E2VH 1F42A 3QT2A 1KXTB 2DQTL 3EDKA 4NPYB 1ZWIA 3REVB 1KUMA 3VFSA 4KRPC 5TDOB 1T3FA 3SDDD 1KJVB 2VDNL 1JGVH 1KCSL 4ZUWB 3JV6A 4P59L 3IU3B 3O3DB 4FG6D 4ORGB 2CRMA 4IRJA 1U2CA 4UNVA 5IK3A 3D39A 2VJXA 1T1ZB 5CLWA 4JY5L 1VKXA 3EO1A 5HJ3A 4EI5B 1ZT1A 2AXGA 4P46C 3ARXA 3AS3A 2UWEB 3KXFB 4BJLA 1M1SA 1NFDA 3QAZC 2ADIB 5C2UB 4C56E 4P2QA 3VFSB 1YNLL 3O0RH 4OF6A 4OQTH 5EULV 5DK2B 3MV01 3SBWA 5BW7A 3RWEA 2C4FU 4O2EB 4U1SB 1MH5A 2NY7H 1ZHKA 3PWLB 3UO1H 3BEVB 3O4LB 4NSKA 4WFFD 3HUJE 2EDRA 3WEXB 1P5UA 5E94B 3QA3A 3TBVA 3NA9H 5A3IC 4LU5H 2IQAA 2NY1C 5DJ2B 5GS0H 3GSRB 4M43H 4LEOB 4N0CD 3EYQC 3SPVB 5JXAH 1JPTL 3VD9A 1BZ7A 3U79A 2A74B 1SM3H 4PLOB 4GG8A 1A6TB 4KQ3H 1L6ZA 3MUGA 1MOEA 1OT2A 4NKOA 1TFHA 3KG5A 2FJFA 3F7YA 5T3XH 1L8JA 4MJ6A 5CP7B 4EN3C 3OKDA 3HNVH 5MEND 3DO7A 1N7MH 5D1QD 4ODSL 3VFRB 2ZSWA 3HZVB 5DDHB 1KB5B 1MCOH 4WHTB 4W81A 1YEGH 5I8EA 4M1DH 5KAQF 3U9PH 2XTJC 3WUWG 4PGBA 5C07A 1XIWB 2ZCKL 3UTZA 4XMKH 1PG7X 3QWOB 4KGLA 4YWGL 2M2DA 3G5VA 2APXA 5GS2D 1BP3B 2BVOA 4NN5C 4WU5A 1AO7E 4KRLB 3RVWD 4DGVL 2AQ1A 3MUZ1 2BVTA 1A47A 5MERA 2VQUA 4L4VE 1CFQB 2P5WE 2ZUUA 1CWVA 1RUML 1FDLL 5DK0B 4JM2D 2D4DA 3LPGA 3MJ8B 4QHNB 1PZUB 3QULB 4R4FH 5JW5B 4XCNA 5FYJL 4Z7NE 1BFTA 4KDTC 3ARBA 4RRPG 1CYGA 3DNKA 2FX7L 3WXVL 3NFNB 2IF7A 3OAYK 2A6DA 2YD1A 1T5WB 1ZV5A 3W5NA 4QRPD 3VG9B 1KCVH 1S3KL 3HUJB 1P2CB 4NM8L 1UKQA 4E41D 2X09A 1X4YA 3Q1SH 1Q9WA 1NUNB 1LO3H 4JVUA 3GKZA 4UINH 1FLTX 3RWEB 4QTHA 1JI2A 5SWSD 3S97C 3VXMB 1EZVY 4I77L 3KPSD 1YEJL 5T1DH 2R15A 4HKBB 4C54A 3ZKMC 5FM5O 3G9VA 4JFOB 1H8OA 4LPCA 4PJIE 5IVXF 4NYLA 3QUZB 5GS1A 2JCCA 3SKMB 2DQCL 4KDWA 5I15L 3FQTB 4Z8FL 4TRPL 3FHAA 5C7XH 3QNXA 1A1MB 3HI6L 1U8JB 3CVHB 5DD3L 2VZUA 3G5ZA 4KKCC 3BQUC 5JHDA 5JHDD 3PGCA 4KRNA 4AENB 3CFKA 5KSBB 3QWRA 3D6GA 2HFFB 4K3EH 1QUNA 1U8IB 1F3DH 4K8RC 5IQ9B 4YHNB 4KZEH 1CFSB 1TZHA 2FL5B 1KCRL 2HLFC 5E2UH 1U2HA 1PLGH 4GRLB 4WV1C 2E6JA 3VXUA 2EZ0D 1Y18A 4FXKA 4W4NA 3S96A 1YY8A 4N5ED 4WHYG 4YXKL 4WI5A 4MNGB 5A16A 2J4WL 2WUBH 4V1DD 5L6YH 1FFNA 1DBAH 3U0TB 1Z5LA 3X13A 1NBVL 4TNWF 5DD1H 4QRRB 4OCSL 4W6YB 4ZAKC 3QG7L 4GJTB 1NBQA 5C3TA 1YPZF 1U8PB 3LV3B 3OTTA 4MXQC 4WGWB 1NGYA 1DFBL 2DWEA 3H9SB 1FL5B 4OQ1A 3GIVB 4KJYA 4XH2B 2PW1B 2GSGB 1PKQB 2EDNA 5JOEA 2VYRE 2P5EB 2VDOL 2MTPA 5IHZB 2DTSA 5GRWA 5F7HA 3UDWA 5GS0L 1CDUA 4JFDA 1GGCH 4PTTB 4BSJA 4ELMF 5FO9B 1DP0A 4XWOC 4PBXA 2ZUVA 5J9PB 2J8UB 1U91B 4Y8AA 2AEWA 4N9GB 2R0ZH 3IJHA 3QXUA 3ALPA 5CKAA 5IEKB 5EUOB 4UDTA 2YZ1A 3PDOB 2X4RA 1CFVH 3V5DA 3VGAC 2M8XA 1J05A 5KVEH 1MLBA 5SX5H 1ZGLA 4M93B 1BJMA 1NMCC 1T83C 1QVOB 4Y4HD 4JQIL 4WUUE 1QEWB 2D7PA 3S37H 2A77H 2FWOA 3TCLB 4QY8A 2R0WH 5I71C 1YN7A 4OIAA 4PTUA 5IHUH 5TF1H 4M7LH 1WAAE 3MV8A 1EH9A 1VPOL 4JDVA 3WO4C 1HXMA 5D7SL 5KTEL 3T3PF 3SBWC 4IIQA 4P49A 1H3PH 4JN2A 4QWWC 2P46B 3KS0J 3ZE0F 3BQUB 3MNWA 2XKNB 1JRHH 1WEJL 3H42L 4UV7L 1HWGB 2WMPA 1IGFH 2NY6C 1HKLL 4HW6A 4EXPX 2X89D 4HV8A 4K7PH 5DC0A 2PYEE 3VWKC 3SPVA 2FBOJ 1U8LA 2IH3B 1FZMA 5DRWA 1NLDL 3W9EB 1RUKH 2WUBL 1KJ2L 4X4XB 2F5BH 4P2OB 4KUCF 4EN3B 4LLYA 4BFBD 1CGSH 1JHKL 3G08B 3QXWA 2BVOB 3DUSB 1EGJH 4Q6IC 4QRQA 5CHNB 5HYQA 1WSST 3EDEA 4XAWH 2IGFL 2H32A 1FQ9C 3MV8E 4LLMA 2FD6H 4NUJB 3NCYS 2VDNH 4B53A 3O6FA 2VZ3A 2VUYA 4MJ4A 5D1ZC 4ZPTB 5TE6H 1OD7A 3NGBC 1E4KC 4OD2A 4S0SD 4HPYH 5BXFB 1KB5A 3ESUF 4PJAA 4Z7UB 1IAII 4PLKC 5KZCB 4P2QB 1A6WL 4JAMB 3RIAF 4G8IA 4BFIA 1CLYH 4QRPA 5F70A 5IVNA 2ADGA 1KN4H 3WIIH 5SWZE 5EOQH 1FBIL 1VGEL 2VDLL 4LSVL 1FFPA 3KVQA 1LDPH 4HK3N 2FJGB 3M8OH 2XN9E 1NGQL 5KSAA 1QSFD 5DO2D 5FYLD 3PE9A 4ONHB 3I9GH 5FM5M 4X6CB 1EEUA 4YHYB 1VADB 4MLSA 1T2JA 4XNYL 1KPUA 3FZUD 4Z7QF 3HNTH 4HC1H 5CIPB 3HNSH 1CLCA 2J7LA 1FGNL 2BNUA 3OF6D 3QEQD 1HHJB 5DFWH 5E94A 1H0DA 4NO0A 1WT5C 1PEWA 1ZVSA 3SDAC 4V2BA 3E3QA 2B1HL 1V7ML 1KT2B 1ZGLP 1PX4A 2IBZX 5GS0C 1MH5B 1CGVA 1OQXA 5GRJH 2AKRB 1VFOA 5EC1B 3TZVB 2KDGA 1WUNT 3O41A 4RNRB 1MRCL 2PKDA 4K3JL 1AR1C 1U8KB 4ZSOA 1CXHA 3QUXA 4HUVB 4R2GB 4I0PD 4Y4HC 2VITA 4K3DH 3PHOB 5FO7A 1ES0A 1UFUA 1FL6B 2V7HA 2BMKB 4LPVA 3WN5B 3KJ6H 4TVPL 5E6IB 4W6WB 3KR3H 4ZAKB 1XCQA 2R1XB 1NGWB 3QFJB 1C16A 2GTZA 1FPTH 5DK3A 4K3HA 1E27A 2AW2A 1QA9B 5KS9E 4LK4A 1EXUA 4OFDA 1J8HE 3WCYA 3W2DL 3DIFB 3NABH 2IANE 3ZKQD 3PQYD 1KLGB 3MFFA 5DD5H 3ARVA 3SDCB 1DLHB 3GUTA 5C71A 1UM5H 3HC3L 1I8LA 4ZTPH 4FP8H 5KSVB 3NZ8A 4YHOL 2OJEB 4LP4A 2PYFB 5I1EH 2YXMA 3UPRB 1NGZB 1ZGLM 3MJ6A 1RFDH 5I17B 4H5SA 3CFJB 5K9JL 1T03H 1MQKL 4IRZH 2XXMB 1UA6H 5C08A 3ARFD 1D5MA 3MNZA 3VXQB 1CTOA 4AM0A 1JFQL 2GI7A 4M93C 3LKRA 4HK0A 5DMGD 3L3DB 4PJCA 3NCJH 4WIQA 5DEFA 3BKML 3BIBX 2OK0L 2E7HA 3HC4H 4PRHE 4GRWH 2OI9C 3MR9A 3S34L 1BM3L 3GBNL 3A6BH 5FO8B 4LAQL 4P46D 4G6JL 5MEQA 4QHKJ 1BX2B 2DQEH 3QA3B 3MA9H 2DBLL 3MGOA 3G04B 3V95A 1IEAA 4F37K 1EEZA 3LS5L 5IP4A 5IKCA 1A6WH 1W0VB 3V6ZB 4DEPC 3RU8L 2D7NA 4GS7B 5CMAB 3DUUA 1NGWA 2BNQA 4XCEA 4GT7A 2FHBA 2Z35B 1QLEL 3VGDA 3R0MA 3KYMB 4N8VB 4PG2C 2ADJA 5F3HB 1P7QB 3MV8D 4L4TD 1OARL 4LQFL 4AZ8A 4CDGC 3H7BA 3I6LD 2HT4D 1JN6B 1R5VA 1WZ1H 5JIIA 3AB0B 4XC1L 4BKLA 1CE6A 1JPSH 1AR2A 1D5BB 5ANME 4QHLA 1C08B 4K94C 4Z7UE 5K33A 4TUKL 3LD8B 1I1FB 3KJ4B 1XGQA 3U4EA 4KKBD 5E24E 4M6AA 1G7MA 4ORGA 2A1WL 2HVKB 4DOHB 3VGBA 1RUQH 1NBYB 1SEQH 1A1NB 2BNUB 4OV5B 4GQPH 3STBA 5FUCE 4PJEF 2JCCB 4C83B 4KZDL 5L9DH 4G9DB 5EBLB 4LAJH 5TE6L 3IKCB 5H35A 3RBSA 2X4SB 4X7SH 3ZT5A 2CLZA 4L4VA 5T1KB 3OKLB 4HKXB 4PP1D 1HHHB 3IDYB 3T8XB 3SO3C 4P4RA 3HA0A 1ADQA 2UY6A 4LNRA 3LEXB 2OJZL 4W6XB 1LEGB 3HZVA 3BN3B 1KIQB 4J23A 1Q94A 1FP5A 2HJKB 3RWGA 1EO7A 1NFKA 1INEL 2H9GA 2I07B 4FTVE 2D03H 2PUQT 4LCYA 4G6FB 3NIDE 4UT9H 3WL9B 3CFKB 3TJHA 3IYLW 2ZCLH 1ZA3B 4PRID 3DX7A 3LY6A 3NCYP 1P84J 3ELAT 4EVNB 2Y25A 5IMKA 1A4KB 1S7WA 2NY3D 3TV3H 1NC2B 5L88L 5ESQA 1KB9K 2B4CH 3MJGX 3FQRA 3FFCA 3FO9A 5FUOH 2UUDH 4R26H 1C5BH 4N1EA 3ILQC 3C2AH 2XTJD 4ZUUA 32C2A 4J8RA 4Y1AE 3P4NA 2DQJL 4WO4C 1UWXK 4PLKD 4N0FB 4DAGH 1T7ZA 4NFDA 1JJUA 2GJZA 3BKCL 5DMIH 3SDYH 3TYFB 4ELME 4OQTA 1JZ3A 3V5KA 4DGYH 2CGRL 1J88A 5FYKU 3T0XA 2NQCA 5GZND 4N0YH 5E6IC 1KC5L 1K9TA 4HUMB 5C92A 2DQHL 2DBJA 2X4TA 5D6CA 2A77L 3LPWA 3DROB 4XGZA 4EUPH 3D0LA 1MLCA 4Y4FA 4I48B 4XC1H 4F58H 3RGHA 4O02L 1V3MA 2WM0A 1YN6B 1JPGA 3QXDA 4RNRA 4N90E 1QNZL 2XZCL 4KVNL 4BSWB 1EPFA 3BYTA 4NHCL 3SDAB 5DFVD 1IEBA 1CU4H 3B9VA 1QEWA 4XVSL 5DEZA 4TNVK 3L5XL 1XF5A 3RBGA 1DQML 3BP4A 3L3JA 3BH9B 1AE6H 1VEOA 2FJHB 1T3FB 4Y4FD 5GXBB 3SGEI 5C0CE 2WWMD 4BYHA 1T21A 4Q9BA 1AC6A 3OXSB 2ZUYA 3QIWC 4UTBL 4XPHH 3RZCA 1BQSA 4HIXL 2QLVB 1UJ3C 3HAEA 2CXGA 2DM4A 3L5IA 2C7UA 4Y19E 3BGFB 5IVZB 3RPKA 4GMTL 2EO1A 5IBUB 2JB6B 1KACB 1LP9B 1ZHKB 4FRWA 1LO5A 4OD1H 4LCWB 4N0UA 3MV7E 4JGMA 1QFHA 1INEH 3QUXC 4ZOCA 2FEEL 3X14A 4XBGA 4F8TA 3IETB 2W60A 1WV7T 3ULVL 2ZSWB 4HS8H 4JPKH 5C8JB 2BVEA 4BFIB 4I5BB 2FRGP 4X5XA 1EIBA 1UJ3A 1FL3B 1FLRL 1MEXH 4GRMA 3EJYD 4HUXA 1BQLH 1NGYB 4MXWH 4AL8H 1IM9A 1TCRB 3DX9B 4PJAF 2GYSA 3EO0A 3GJEA 3MROA 3BPNC 5D1ZB 3GSVA 1LK2A 1I3VA 2AQ3A 4HIJB 1K8IA 3LKRB 3CVIL 3OAYH 3IDJB 3MUGB 1U8MA 4HS3A 1Q9KA 3GJFK 1INDL 4LFHD 5KSBF 1CXFA 4NQXB 1U8QB 3QUZD 3FTGA 1WZ1L 3RWGB 3U9UA 4U1NA 4MA1C 5J06A 3ZYJA 5IFHH 4F9LA 4KROD 1L4IA 4HFWB 4R4ND 2DYPA 4KROB 4ERSL 1FJ1A 2YA2A 1F2XK 1L7TH 3I3BA 3HE6C 1WTLA 1A14L 1L0YA 1N0LA 1RUQL 3UPAA 1R3HA 3N85L 4NO3A 2EYTA 4XAKD 3WFDL 4PJBA 3IDYC 3DX6B 2XFXA 4ZFFA 4KJPC 4G42A 4DZBA 4B5EA 4WDIA 5EFIA 4N8CH 3K2MC 3G6JF 1U8MB 3FFCE 4GKSA 4ZUVB 4N5EC 1K4CA 4U05A 5BOPA 1FV1B 4PRBB 4MXVE 1GHFH 5IROA 2YD6A 3MGTA 3CDFA 2XA3A 1YEIL 4FFVD 1IQWL 3P40A 5C0AA 4KAQL 4OLWL 4XP1L 2WLYA 1I1FA 3IRPX 2R8SH 1BQUA 3O6MH 1P9MC 3R8BB 1KXQE 3RX7A 4HULB 4KK6C 5E9DB 5BS0B 3NCCB 2AKRA 1S7VB 2C4FT 4HLZH 1CXEA 5D1XC 2PXYB 3BEWA 2YPLB 4WI8A 4TNWK 1FPTL 5HI4D 5CEXB 2NY5L 3WJJC 1ZHLB 2VZVA 4PD4J 4N1CA 2ARJA 4NOBA 3GSNA 5HHOB 4NZUH 4IOIB 3V4UL 3VGHA 3MO1A 4G80B 3L3GB 1G7LA 2EIZB 3G9AB 2OL3L 4HWEL 4DN4L 4D8PB 3UEZA 5TJWK 3T04D 2AI0H 4U6HB 1AFVL 3CIQA 5I1EL 3PABB 4NN6C 4XH2A 4MNQE 1T22A 1XGTB 2GJ6E 3GK8L 4YGAB 5F9JB 2R23B 3BKYH 5CD5D 5HI4C 2WBJA 5CZKA 2E5EA 3SDDC 2I9TB 1TMCA 1YMME 4S1DD 2DQGL 4P3CL 2AERT 3QQNA 4G9FD 2D0GA 4OCYH 5D7JA 1WISA 4GBXA 4JFFB 4G8IB 1S9XA 5J6GA 4JHAL 3BZEA 1KENH 4JY4A 1HN1A 4WU5B 4XHJD 4XVTH 1KJ3L 2VE6B 1J10A 1TZIA 3FT4A 1DVFD 3O9WA 5D2LA 4MS8A 1V05A 5L0QB 5FF6B 1HYSC 1AXIB 3NBNA 5B39A 4D9LH 1K3IA 3BP7B 4OZ4B 3ES6B 2ED8A 3GMOB 1BPVA 2Z91A 3RL2A 2OJEA 5DMJB 4Z77A 4MZ3A 3NAAH 3BRGC 2P44B 1Z2KA 4HZLB 4I4WA 4PB9H 1UWGH 2O61A 3U9UB 4U1NB 3RVUD 1CG9A 4DOHE 3O4LE 3MXVH 2W0KA 2FLBT 5L0QC 3PGCB 1FNSH 1NCWH 3MODL 4HS3B 1EXUB 4S1QH 2O26U 4L3CB 4LIQL 2A73A 5C0CD 3W0WB 3HR5B 5CINL 4NM4L 4LSSL 5FA4A 1S9WB 5D1QB 1CXKA 2EKJA 2Z31A 4JN2B 2C3VB 2RFXA 3DPBA 3RWCB 1AGEB 1MCCA 1CXIA 5EU5B 1ES0B 2IQAB 1Q94B 4X5XB 2CKBB 4GW1A 4X6EA 3MRFB 4WFHD 5FA3A 3RNQA 4LPYA 5DHXB 1CF8L 1INQB 1QBLL 3P0VL 1FYHB 3NPSB 3NPZB 4TVPE 1FE8H 2XWTA 3REWA 2DI9A 3IGAA 4LDLB 3VXUE 3STLA 5F9WC 1RZ8B 1BJ1H 1RHFA 5D7SH 5IVZA 3VU2A 4XC3H 1HOCB 5B22A 5FOJA 4HHAA 4XP9L 4GKZB 3RWFA 3BD4A 4GSDH 1YY9D 5I30L 3B2VL 3FTGB 1H3VA 3EO9H 4HJGB 1H3WM 1RZKH 3N50A 4PGCB 4GRLD 5INCB 3DXAD 4PJFB 3BP6B 2GFBA 3IDGA 3TVMD 1J18A 4YBQC 2YR3A 4JRXA 4E41E 4PY7B 1OAKL 4NZTL 1D6EB 4XNQA 4C56A 4M7ZC 3B3IB 4OZIA 2F58L 4UT9L 2FO4B 3N1PC 1MCNA 1OGTB 1FG9C 1NFIB 4JQIH 5IW6A 3GI9H 2VDPL 1XGYH 4XAWL 3S37L 5JOPE 1IT9H 3GI8H 3CSYB 3D0LB 1B88A 4XP4H 4ZFGL 4APQC 3GSUA 1SJEB 3NOIA 4YJZL 1MFBL 5D70H 3KPNA 4OGXH 3S4SB 3BISA 1MCSA 3S4SG 1F8TH 3SE4A 3UAJC 1E4WH 3MACH 5ADOL 2NZ9D 4DAGL 1NCNA 2VZOA 3TT3H 5EU4B 1GSMA 1GC1H 5IKCB 2DYPB 4YDIH 1JMZA 4UDUA 4JZNB 2F5AL 4FFYH 5D4QA 4O00A 4OI7A 5C0RH 4P2OC 1QSEE 2PCPB 4WI7A 4X7EC 2RGSA 1RIVH 5H94B 4TUJB 4O2CB 4AYFA 4XNUL 3QUYD 1S9WA 2E9WA 4LCUA 4BZ1H 2H1PH 5ESQB 2ZUTA 1HQRB 4RX4D 2E7LE 4JRYB 2OL3B 2P5WA 4IEFB 3GRWH 4HWNA 4KJQD 1FNAA 3TPUE 5DLML 1G6RA 3Q1SL 4NN7C 5I75C 3U6RA 5CZXD 4HCRL 1SMOA 2PW2B 1KIQA 1IGFL 4B41A 3SGKC 4JZOB 4QCIA 4IDLA 2G60L 3ZDZE 2X4QB 4HUNB 1MHPH 4P4RB 1GOGA 3O4OC 4Y2DD 1GGBL 2HYMA 2X7LA 5I73C 1V7NH 3ARED 3C5JA 3DECA 2CLZB 4PYHA 1QVOA 2C1OA 1K5NB 4Z8FH 2BSTA 1QRND 3TFKD 4P5KA 1NCDH 3CVHL 4C83A 4HH8A 1KJMB 1OW0C 2OR9L 2PTTB 2F9BT 3ZE1F 4O5LH 4CU6A 4GMSH 1VKXB 2BXYA 4XX1E 4X4YA 3PWPE 4HDIA 2H6PB 2ERJB 4I3SH 5LXGL 1T5WA 3Q6FA 3UJIH 1PQZB 1MFAL 4TSAH 3ULSB 1YNTA 4YFDB 3NPSC 5E8NA 1FIGL 2J8UF 1X4ZA 4MD0B 2I9LB 4XRCB 2GW5A 4F37F 4X83A 3QNYB 4ZODA 4JR9H 3L3IA 2F74A 1IL1A 3DMMD 1KIUA 2JELL 1QLRA 1KTLA 3HG1A 5DHVA 5IR1A 3DUUB 5C86A 1J1PH 5IFHL 1N2RA 5ENWB 3DV6B 4V1DA 4AEHH 2JK5A 2X9YA 1BM3H 3GBNH 4M8QB 3JWOL 4G7YH 4JQXC 5EIQA 3B9KA 5LQBH 3EYOB 3DSFL 2F8XC 1HHIA 4YNYB 4GH7B 3BESR 3WDHA 4Z7OE 4PB0L 1XCTB 3GSNL 4B50A 1HKFA 3RIFF 4TTGA 3OBAA 2IC2A 3TPUB 1U8NB 1YEEH 5DHYA 1IKNC 5E8OA 4GXVH 3KYNB 1MFEH 4PBWD 3GSWA 1HINH 5D8JL 4KUCD 5FGSA 2ITDB 3K2UL 4LSTH 2H8PB 3FOMA 3PWJA 3MUJA 2YC1A 1GJIA 2VDKH 3JTSB 3O9WC 3CFJA 4ODVH 3MRMA 4OBRA 2OL3A 1UH3A 4P9HH 3U36B 1AKJD 1I3UA 1GL4B 1KIPB 1NC4D 5F7DB 4YZFF 2XY1A 4R2GD 2BNRB 4KJWD 4XI5D 4MAUL 4WWID 4HQQL 3U0WL 3VGAB 1NDGA 3QIUD 3TBYA 4J3WA 1NEZA 3QCTH 1S5IH 5I1GL 5BZWA 5DS8B 4ODSH 2NY2D 4GO6B 5DSCA 1BBDL 3MGOB 3TZVD 1JNNL 2W92A 1BX2A 1KTDB 3E2HC 4KHTH 1GOHA 1KCSH 3ARDB 1SM3L 5BV7B 3MBEA 1TJIH 3WFCL 1KLUA 4PS4L 5E6IA 3TJHD 1BGXL 2V9RA 2HT2C 4MNHA 5T3XL 4APQB 2PETA 4P4KD 4HBCL 4AJ0A 4G6ML 2CQVA 1L6XA 4OZIE 5FO7B 5GGVY 2BP3A 4HKZA 3HLAB 4NBZB 5IW1A 5IF0A 1GRWA 5IB2A 3RJDA 2YD7A 1DR9A 1OGTA 3VI4F 4DK6A 4ZNCD 5EC1A 3TZVA 2D9QB 1MNUL 2A6KB 4PRDA 4ZFOB 5IQ7H 2VDQH 1MCOL 3C5ZB 5I74B 5EU7E 3MLPA 1RZJC 3DRTA 3BW9B 2D03L 1WF5A 1DUYB 1BWMA 5HTSA 1F58L 3KPLB 3D5OF 3VXTB 2QADD 2MFNA 3O11B 5DGRA 4L8DA 5IJVB 1JZ2A 1X5IA 5GSVB 1DQJA 4KTDL 1TJGH 3PL6A 4JDZB 5LGJB 2AABH 3LOWA 1L0XA 5GZOD 2DQJH 5JA9A 1QQDB 3ZYOA 2V17L 3QWOA 5HVHC 1I7TB 4G6KH 4OCXH 1QLFB 4TVPD 1GGTA 2XWJB 4WNQA 2XQYK 1D9KD 2ICWJ 3ME0A 5BVPH 4TNVF 5DDHA 4I13B 3SEPA 3KYAA 4GW1B 3HZKB 1I9JL 4EBQH 4PJAB 1MFDL 2VLLA 3Q2CA 3C09B 1IAKA 3U30C 1AP2A 1T7VA 4HJJH 1FZOA 3F62A 3G6AA 3SY0A 1YQVH 5DEGA 4XMPH 5B4MD 4U2YA 3ROLA 2NYYC 2DIBA 5T1LD 3SKOB 1IAOA 1CT8A 1F3DJ 2VQTA 1I9IL 5JHLH 2B5IB 3F12A 2J88L 3G08A 2ZCKH 5E56A 3V6FA 4Y2DC 4I3RL 3R0NA 4E5XA 3R4DA 2W59A 5DJCA 3HI5H 1FZMB 5DRWB 1VADA 3MOAL 5F3BB 3VGEA 4NQEB 3P9MA 1A3LL 4PBVC 5H37H 4ZD3H 3OHXA 1N59A 2WW8A 3VFNA 3MRMB 1PW3A 2MQ3A 4LCIH 5DJ6B 5IFJA 1UYWL 5GGSB 3B5TA 3QI9A 3NZHH 4WTWA 2V7HB 1ZS8A 4YBHA 5GGQH 4ZYKB 3UROR 4JPIB 3VFPA 3QRFM 2IALB 4R6UA 2XWBB 4WCYL 4Z7UA 3MCKB 3MLUH 4KK8C 4G9FB 5HDOA 3O3EB 1QFWI 4IRSA 4G8EB 4MDJB 3O2DA 4NQSB 2YD8A 5HD8C 1MCDA 3KNBB 3X12B 1Y0LA 4V2CB 1Y6KR 4JFZL 4XVJH 3O45B 3CMGA 4X7TB 5DFVC 4HWBH 3QP3A 5MP6L 2NTSP 1HHJA 2AJXH 3FQNB 3KYOB 3UAJD 1UB6A 2VZSA 5L6YL 3V4VL 1L9MA 1TJGL 4LVEA 3MRPB 2APFA 5IR1B 3L3JB 2HP4A 5FYJE 2PO6C 2EDWA 4BA8A 4RMQA 5I1CH 4LASL 1FO0B 1EFQA 1ADQH 4ODWB 5ITFB 4NO5A 2Q3AA 5KSAB 4GOSA 1YEFH 5ILTL 2WY3A 2YD5A 1R3IH 3REWB 3FHQA 3GHBL 5LGHL 1NFDF 2R0LL 1QRKA 3O3BB 3WE6A 2CJUL 4UV4L 4YFLF 4LAQH 2QSCH 1A22B 4HG4J 3UYPA 3C60B 5IM7A 5JW4N 3A67H 2DBLH 3QXVA 1QSZA 4M03A 5JPMB 2EXWC 3LEVL 4YZFE 5DURB 5ELIA 5B8CB 3LB6D 2D7QA 3BMWA 1OAQL 2ENSA 3G6JA 4QRRA 2F54E 2Q20A 4FQIH 4HUWA 5IBTH 5HGBA 4RAVB 1GIGL 5FGCE 2YMXL 3BSZH 4Z7VB 4IMKA 5F3BA 1K85A 2J4WH 5LKNA 1JZ4A 3IFNH 5MEOA 2ADFH 2X4PB 4OZIF 3UZQA 2MMXA 2Z8RA 4RZCA 4ZXBA 4D0DA 3DMMB 1HI6B 3RL2B 3SE8H 3IU4L 4AM0B 1U42A 4PTTA 3QO0B 5KSBA 2HH0L 2EYSB 4YPGA 3ERYA 4EDWH 3QQ4B 5EZLA 1NSNH 3S35H 3TIEA 4EDXB 5HHMA 2NY0C 1H3PL 4MNQA 1RZFL 1HH9A 2YS4A 3BPLB 2CIIB 2GY5A 2OL3H 1BZ9B 1K8DB 1TDQA 4LKCB 4MJ5B 3WFDH 2J6EL 1FZKA 3AMKA 3SDCC 4OF5A 4P23D 1XGPB 2VRAA 4MX7B 1UYWH 4BELD 1A3RL 1C12B 4OF7A 2QSTA 4P2YA 4ONGL 3X14B 3ARGB 4WCYH 5SWSB 5MHSE 2BRRH 1YJDH 2GTZB 3OKEB 5LCVL 1R5IB 5DHVB 4M6MH 3NFPB 5JZ7C 3N85H 1OP5K 2BFVH 2FL5A 1YEFL 5ILTH 3IKKA 4OKVB 3M8OL 1UG9A 4JB9L 1WWBX 5JO5B 4CADB 4Z18A 4HWBL 2VKWA 1WZMA 3DO3A 5DQ9B 4PJGF 1T5XA 5HD8D 1CN4A 1AHWA 4FHBD 1R5VB 1EVTC 3QEGH 1KCUL 2P5EA 4QRPE 4F57H 1IJ9A 1T1ZA 4OT1H 3Q6FB 4YO0B 2C3GA 4PJGA 3EDDA 4M9OA 1VA9A 2DS4A 4X6BA 4GW5B 5GGVH 3NVQA 4M3KB 5FKPA 2XTJB 4JQVC 1R3IL 3CX5J 1JF5A 1WEJH 4W70A 4UIMB 2JJTC 4WFFE 5FIEA 4PJ7F 5EIVA 2R0LH 2AJZB 2FSEA 4YXHL 1PD6A 4YHIA 2ZG1A 4NC0B 3RWFB 2FCBA 4OM1L 3EOBB 4P5MA 4Z0XA 3KPRA 2GSIB 3O9WD 5D9SB 4OGAC 2DQGH 4MNGA 4H88H 4FFEX 1X5FA 3BO8B 2NY6D 3KNBA 1TVHA 4S10A 5L2KD 5CILH 1J0HA 4X4ME 2Y07H 5BO1H 4KUZH 3T0WA 5GSRA 2PYEA 4Y4KA 12E8L 1SY6A 4JRXD 3F7RA 4PRAB 3RZCC 3BT2L 2RIKA 5FA3B 5IJKA 4P2RD 1YDPA 5BVJB 3WSQH 1SQ2N 3VD4A 4KI5D 3ESVF 3T0BA 2A6DB 4XVSH 1GGIL 5AZ2H 5JMOC 2XTJE 4K3EL 4M00A 3ARRA 2NYYD 2F19H 1E6OL 3C9NA 1I1AD 3IFNL 1XGUB 4JO4H 3WIHA 5GJSL 3BPCA 1JPFB 4K9EH 5CEZD 1BJ8A 4LVOB 3C08L 2FJFB 1YMHA 3F7YB 2ITDA 3MLWL 4FABL 5C2BL 4HEPG 4L9LA 1U92A 4LCUB 4OBSA 3MXVL 3TVMA 3W5MA 4CN1A 3WNNA 1EFXD 3RFZC 5B21A 5H37G 4EN3A 3QIBC 2JIXD 3HE7A 1KFAL 2DL2A 5T3ZE 4PJEE 3QIBD 1UJ3B 2YHGA 3FQWA 1B0GA 2P43B 4M8QA 1KYOJ 1U3ZA 3KLSA 4Z77B 3BIAX 2FDBP 3OAUL 3QO1A 5L8JB 3M1BA 2EDBA 1E6JL 3IS0X 3ECBB 4N90D 4PRIE 1LO3L 4NT6B 1MCPL 2AEQH 3MYZA 1F8TL 2EDYA 4N1HB 2V17H 3K80A 5E99L 1UM6H 3VG9C 5F89B 1FNGA 4RFNC 3TFKC 4LCWE 5ADPL 1RZ7H 3EFDL 1MQ8A 2WBJB 2DQUL 4O4YH 3TIDA 3QZWA 4YHKH 2P45B 5HPOA 3HPJA 2VXQH 1NCCL 4MXQD 5KANG 2W38A 4JO3L 2HVKA 1A2YA 3D39B 4X4ZA 1PVHA 5DK0A 1D6EA 4F9PA 4EBQL 1S8DB 4WW2F 4ALAH 1S7TA 3QPXH 1SVCP 4X98A 2EKSA 1AIFB 3T1FA 4K2UL 1ZHNB 1NQBA 3MCG1 1ND0B 4OUUA 3VGGA 5JO5A 3BPOB 3GNML 4S0UC 5FHAL 5AUMA 5J12C 1W0YT 2VXUL 4XPFL 5IB1A 5DQJA 4NRZB 3PWLA 1NFDE 5I8CA 5T5FL 2XT1B 5SWQB 3OKOB 3MRRB 3TYFA 3O6FC 3RTQD 5CJ8A 1MHPL 2GTWA 2X42A 4LOUD 3MRFA 3U7YL 1N3NA 1SYSA 5K9JH 1AGDB 1RZIA 2J8HA 2Z8SA 3UTPD 1X5GA 3OPZL 4GRWF 5KBNC 3DVNB 2E8ZA 2P24B 1SY6H 1LHZA 4JHZA 1N7ML 2G5RA 3EHBC 4KTEH 4TVSa 4X6DE 1EJOL 1BVKB 1AXTH 5TQ2L 1W2KT 3QEHA 4YX2L 4JJ5A 1FNFA 1WIPA 3G5XA 2X1PA 1I85C 5HDBF 3IXAA 3VWKA 3LQMA 5CAYB 2VLJA 1ACYL 5C0DA 5JW4R 4RFEA 5AAMA 4OLVH 1ZEAL 3DI2B 1YEDA 5BV7H 3WIFA 5KZCD 2VWEE 4XWGH 2OTUB 4OCWL 1NMAH 4NZRH 3TV3L 1QSVA 2C3HA 5EH1A 4WO4D 4U0QB 2B5IC 1DLHA 3QG6A 3WUZA 2VXVL 3DWTA 4XP6H 3GUTB 5E8DL 1T7YA 3V6BR 5E0QA 5K93A 2R29L 3BUYA 4R97C 1Q9KB 5IESH 2GITA 5CBAB 2JELH 4DFHA 2ZNXA 2H8PA 4MHHG 2XZQL 2VMFA 2NXYD 5FKAA 3AMLA 3BHBA 3UTSE 3QDMA 1QFUH 4JM2C 4Y8DC 3FQXB 5FYJH 4JFDE 4OZHB 4AT6A 3ALXA 3VJ6A 1KPRB 1CQKA 2R23A 4NN6B 1DLFH 2Y1VA 5C09D 1R0AH 12E8H 1S3KH 5HVHB 3CFEB 3SGEH 5AD0B 3GSNH 3RQ3A 4PB0H 1HIMH 4HC1L 3RVWC 4BQBA 4R96A 4YHLH 5I16A 5J3HD 3EYUH 1FRGL 4GXVL 3TO2B 1CE1L 2BHUA 4F7TA 4O5LL 5MI0B 1X5JA 5IROC 3PP4H 5A2LH 3HG1D 3SKNA 4PJEB 3VCLB 3JTTA 4K7FB 2V9TA 5JW3H 4BZYA 3LIZL 4TSAL 4N0CA 3IJHB 3GMRA 3C08H 1SHMA 5I1LA 3UTQB 1ZHLA 1DUYA 1IGJA 4GAYA 3OZ9H 3FO1A 4WGVB 3HG1E 4MAUH 3PHQB 1X5HA 2CDFA 4JR9L 5E9DA 5D1QC 2UZYB 3V6ZA 4OI8A 3U0WH 1HSAB 1S5HB 1AC0A 4X80L 5D5MF 1PKQA 4X4YB 1F90L 2ZCLL 2EDDA 4F33B 1ZVYA 5TPWL 3HC0A 5I73B 4PG9B 4NQDD 3IJYB 3ZTJH 2BY2A 1MHCB 1ZXQA 1NUDA 2ICWA 4MJ2A 4G7YL 3JWOH 1E4XI 1WICA 3BHBB 1MCPH 3GMPA 4MYWB 5FM8A 4UBDC 3MRCB 1A8JH 4J3VA 3IDXL 4PJ7A 3BMVA 5GS3A 4C55A 5DJ6A 4ZFOL 4Y2DA 1B0RA 1KN4L 3INUH 3WIIL 2X7LB 5JOPD 1MAKA 4PGBB 5C07B 5F8RC 3MNVA 4UT6H 3QG6B 1MVUB 4OUOA 4ONGH 2VLKA 3STZB 4PJAE 1D9KB 1TZHB 1HQ4A 4GBXC 2YPKA 2F8OA 3WDJA 4LKXA 1IGTB 1YJDC 5DWUH 1T03L 3OQ3B 5MEOB 3DLQR 5KN5B 1KLGA 1MQKH 2Q7YA 3K81A 3RWDA 3KPPB 1PSKL 5LWYL 3HNTL 1IC7L 4Y4HB 3FONB 3KLAA 1I8IA 3IXAB 2DQDL 1JVKA 5DRXB 5F1NA 5FGBA 4WI9A 3RGVC 1G1YA 4UILH 4KPHL 4J3TA 4BQ9A 1ZT7B 3I6KA 2XZAH 2NY3B 1TZGL 3GMQB 4MGXA 4EIGB 4F7MB 4ZFGH 1D7FA 1AO7A 4J4PA 2ARWA 3TIDB 1OSZA 3FFDA 3RWHB 2NTFB 4YE4L 4F3FB 5EZOH 2BRQA 4FFZL 1SYSB 1KTKE 4FQLL 3DVFA 2NNAA 1W8OA 4GKNA 4WTZA 4ZS6D 4DVRL 3MYJA 5DJAA 5HHQA 3RGVB 1NAMB 5IOPA 4LVHC 5DRNA 1FO0H 3SJVE 3C8KA 1S9YB 4N0UB 3ILPA 1JTTA 1E4XH 4U1KA 5F9AC 4KK9C 3CU1A 5FECB 5T1KA 3PL6D 1FGVL 5E4IA 3X3GL 3VD3A 4BH8A 2QHRL 4Y5XB 1CD0A 3GMNA 2VR5A 5JTWA 2B1AH 1MJJA 5EBLA 3I6GB 1I4FA 4QHMB 1UB6B 4ONFH 3D85A 4I18A 3QI9D 1ZEAH 4WEMB 4LSUL 2DRUA 1QRNA 3BD3A 1F02I 2DMBA 2ICCA 5KTEH 4AEFA 2Y36H 3G5YA 1RJYA 3LCYA 2WP3T 4NDMB 5EO9A 1CK0L 2OP4L 1KJVA 1N0XL 4Q6IB 5BZDB 3PWPB 5EU6A 2HFTA 4Y5XA 4LCIL 3TWCL 4FQ2L 4G6KL 3FFCD 3H9SA 4I8DA 1DE4A 2XZQH 4U7SA 3KAAA 4M7ZB 1U6AH 2EDQA 2JJSA 5CFHA 2JLLA 4ISVA 1NUFA 2XXCB 1F00I 3F58H 1EUTA 4PDCE 1W72B 2C4XA 2G75A 5F6HI 5I8OH 3VW3H 4LNVA 2UVEA 1UCTA 3BN9D 1A14H 3EOBA 5DGQA 5DSCB 1MF2H 5J4MA 1GZPA 4MWFA 3NIDF 4PJXA 3OKKA 3RDTC 3K0WA 3L1OH 1PSKH 5LWYH 4P4KC 2VDOH 4X4XA 2E27H 2AS5M 3HE7B 1HNGA 2UZIH 3JXAA 4U1JA 1FG2A 3ULVF 2X40A 4OF3A 1AO7B 4FZEL 4U6TA 3TT1H 4GW5A 1IGML 1OGAD 5DJXA 4L9LB 5IQ9A 2Z4QA 3S37X 2G2RA 2YA1A 3OJDA 3HI5L 1N6VA 1Q0XL 2A2QT 1RHHA 3C9NB 4AENA 1AXSB 1NCCH 4LEOA 4YPGB 3MMEA 2L4OA 1LO2L 4JANA 3VH8A 1KJ3H 1A1OA 4I0CC 4YDVA 1OLLA 5KW9L 3RVVC 4KPHH 1K3ZA 1TQBB 4M7KH 5CINH 1Q38A 5E4EB 3RPIA 1TZGH 2G5BB 4LNRB 5IVXA 4ODTH 1EUUA 4N0YL 1U3YA 3PIQA 2ZJSH 5D5ME 1T1XB 5DD6A 4Z7UF 2HFEB 1HHKB 4Z7NF 5FDYA 4P5MB 1BAFL 3KPRB 4U31A 3HCVA 4L4JA 1XF4B 4EI5D 5GISL 2MHAB 3HMXH 4P46A 4KV5F 2LU7A 1NGPH 2FJHA 4OGYL 4QWWD 2R2CA 2NX5D 3TPKA 3BZ4A 3P73B 3IDMB 1UXWB 3G5YB 4A6YB 1AH1A 3UYOD 4MNQD 4MNQB 3CX2A 4XNMB 1EO8L 4P2RE 4RIRA 3SGDI 1LNUA 1OAXL 4ENEC 4L8SB 1IM3A 4BKLB 1CE6B 3QZWB 1WK0A 2ED7A 3WJLA 2UV3A 2WSKA 4WW1B 2ZWLT 3CDYA 4TRPH 3IU4H 3V0VA 1JP5A 4N8PA 3SE8L 5JDSB 1RUPH 3H9ZA 4G5ZL 2P42B 3CXHK 2HVJA 4P48A 3VFVA 3GIVA 4N8VA 2DWEB 4JG1L 2XQYG 4K23L 3FRPA 2UYLB 2F58H 4KVCL 2XZAL 43C9B 2FX7H 2ED9A 4LSPL 3NAAL 4XPBH 5BV7C 2CDEA 4YGVB 1RZKL 3RGVA 1FLRH 2E27L 1Q72L 3G5VB 2IQ9L 2J12B 2E7CA 1JHLH 3MODH 4I0PB 4QLRA 2OS7A 2VN7A 1B2WH 5IG7B 2NX5B 4ZOBA 3QB7C 3WXVH 3PL6C 5HY9B 1VDGA 3JUZA 1OL0A 3JV0A 3I6KB 4O9HH 2X44D 5IUSA 5FOBB 3MOBL 3NCJL 1Q0YH 3DRQA 4JZJB 5T3ZL 3AREC 5KVGH 2ATPA 1G9NC 2YC1B 3QO0A 4YDJA 2Y4SA 2XNAB 3FB7B 1S7SB 5DHVH 1IGTA 3BRFA 3R8QA 2O61B 3E3QE 4UINL 3QNXB 4B0MM 2QEJA 1LEGA 2HH0H 3DMMA 2QTEA 4WW2A 4GRWE 1I8MA 1UWEL 3GMOA 3PP4L 1BFSA 2BC4A 3Q3GA 1CLZL 3MRPA 3BO8A 1A9BB 1IBGL 2KH2B 4I18C 4NRXB 2XPGA 2AEPL 1LQVA 4JVPA 3ZSTA 4XBPA 3GHEH 3ZTJG 5EN2B 4H1LG 2YRZA 4QTHB 3VXNB 4Y5VB 4TSBL 1X3DA 1IAOB 3WUWA 3W0WD 4ERSH 1WITA 3D3VB 3AB0C 3WLBA 5GHWH 2HJFB 5JPMA 3EO0B 1MHCA 3SCMD 1M7IA 2VLLB 4JFHE 5CJOL 2X05A 3IT8D 2VDML 1G7MB 5D7JC 2B20A 3IDNA 5CGMA 3TFKA 3F7VB 4N8CL 2VITB 3JWDL 4QRSB 3BIKA 4Q6IA 3VWKD 1JGUL 2PR4L 4JFHD 4L9DA 5L7XL 3PHQA 1KF9B 4AH2A 2OR9H 4AL8L 4P2QE 4P3DB 4L4TE 4C56B 3EJZD 5D2NB 4S1SH 4QXGH 4R7DB 1QKZH 2EECA 4NO0B 1XR8A 1UZ8A 5IB3B 4MMZC 5E5UB 4JDZA 1AJ7H 5F88A 3CVIH 1T0NA 3GIZH 1YYMH 1MFCL 3OJMB 1X6NA 2N56A 3DHJA 4LHUB 1L0QA 5F6HJ 1CD8A 1VFMA 3LS4L 1R3KA 2YWYA 4WI3A 5C1MB 3BOVA 3EOTL 4QXUL 1GVIA 1CDIA 3MJ7A 2JCCF 3PIQB 1A5FH 5JXED 1JZ8A 1YNLH 3O0RL 1TPXB 5FYKH 4G6JH 4U1MB 3QDJB 1XF2A 5T1MB 4Y5YC 1G7QA 1NLBH 3PQYA 1BOYA 1JV5B 4Q0XH 5C0IB 4R26L 1ZS8B 3MMEB 1QFWL 1G6RB 2VTFA 2IJ0C 5MENA 3SDXF 3BUYB 2CKNA 3GO1H 5C0BE 5INDB 2A73B 5EBWA 3PV7A 3JVGA 4QRQB 4RBPH 3DVIA 4ODBD 2Q1EA 3EAKA 5DJ8A 1H3XA 5A16B 2AJ3B 1ADQL 4TUJA 3V6OC 4DGYL 2P8MA 5EU7C 3VXPA 2JTDA 4K9EL 2BCKB 3DBXA 5C0BA 2QV2A 3QFJE 4R4FL 5JORB 2B2XH 4G5ZH 2BVUA 3UX9B 4HS6B 1QA9A 3OKYA 1D9KC 3G6JE 1TQCC 2LTQC 4G7VL 4JG1H 4K23H 2C3XA 2AJUL 1G9NL 5IGXH 1HK6A 3CCHA 5FHAH 3GNMH 3DX8A 4WV1B 4LSTL 3RI5F 2QQKH 3G5ZB 2XIDA 3S4SA 4PRNB 4HLJA 2EE6A 1FNSL 1NCWL 2BVPB 2R56H 4LLDB 4MA3A 3MA7B 4U1MA 2CMRL 4XP5L 4ZDHA 1JMXA 2APWA 2MJWA 1OTUD 2EIBA 2H3NA 3WKML 4PRPA 1BEYH 4NYLB 3VFGL 1GAFL 1EEQA 3WUWB 3TWCH 4XHJC 5FAAA 2WINB 3ZE0E 1H0DB 1U3HD 4JCLA 3PL6B 2VWEC 2ZSVB 1CGTA 5JR1L 4YGVA 2AV7B 3QRGL 3ULVE 4JO3H 1K4DB 4M6NH 5CKGA 2R2EA 1OPGL 3C6LA 4QT5A 2XA8H 1T4KA 3PGDA 4NKDB 4MSWB 2VLRD 4HHAB 4HCRA 1RULH 1MUJB 1T2QL 2APVA 3L5JA 3NABL 4HSQA 4LEXL 1UENA 1XT5A 3AXLB 4FFWC 2DI7A 3DRTB 3FN0H 3HB3D 1AJ7L 3C2AL 2B0SH 4JPVH 1DEDA 4NZRL 4CKVX 3HC3H 3JTCA 2WLZA 3B2VH 3NH7L 1GPOL 5IHZA 3MPCA 3TT1L 3FO2B 2GT9A 5HSFA 4LLDA 3CFEA 1WGOA 3CPLA 4JGUA 1H15A 3BPOC 3SDYL 2ADJB 4P9MH 3AAZB 2W0FB 1MCBA 3LKSA 2HT3D 2NTFA 1CICB 3OB8A 3P73A 2IG2H 2YUXA 3EBAA 4FQXB 3C6SA 4PPTA 4RGOH 1BQHG 1G1CA 1JNLL 5I1AB 4OTXL 1KTDA 5D72L 2DJSA 3TNNB 3DJ9A 5DTFB 3U4AA 2WIMA 5KANI 4CJ0A 2RB8A 3Q6GH 3DYOA 4PJ5A 4NQEA 4R8WL 4LLYB 5A43C 4D9QD 2EYTB 4OGXL 1TVDA 4XPGH 5GRUL 2DLIA 1I7ZB 2P4AB 6CGTA 2AJ3A 5I8EB 4E41B 2UYLA 2VNCA 2FGZA 1CE1H 4KY1H 4FTVA 1LEIA 1CT8B 5AYUH 4HF5H 5INDA 1OB1B 2XNAA 2DLFH 4XRCA 3VXQA 2OQJB 1UM5L 4GUPA 1ONQA 3TYGL 4JHWH 5F1OB 4IMLB 1KEMH 4L3AA 1FNHA 3CVHA 3GJFB 3QXAB 1ZLUH 5HHPB 3QWQB 1G0XA 1OD9A 2H41A 2O5XH 1U8NA 4K9EC 4Y4KB 5MHSD 4D0DB 1BIHA 5HPMB 4X5WA 3VFTB 4HUXB 5HI5C 1JIBA 1I9EA 4DGIH 4Y0GA 2Q7NA 2NY5H 4HKBA 5GGSY 3X3FL 2AV7A 3O3AB 3L7FB 2EIEA 3GZKA 4UIKH 1G7LB 3MLSL 3BVNA 1T1XA 2G60H 3H9HB 3IDXH 1J8HD 2DI8A 3MA7A 4ZDHB 3VXME 3F6LA 5MP6H 3QQ3B 2RCSL 1X7QA 5HGDA 2P8LB 3NACL 3SOBH 4KKLD 1MIEL 3PXHA 3N9GL 3WFHB 5DYOA 1DQQB 3AM8A 1NLDH 4YEFA 4P2CG 4CAGA 5DZNA 5I9QB 1DEEB 35C8L 4LSDA 2H6PA 2J3SA 4MB5A 1QRNB 4H25A 1R3JB 3THMH 4KU1A 3QDJD 4APQA 1IGIH 3QYCA 3UJIL 5GS2H 1CFQA 2GK2A 4OTXH 4O2CA 2D4FA 1I8LC 4Y7MA 3P11L 5T5NF 2JIXA 5F89A 3QISA 4KKNA 5JW3L 2MHAA 4YHZH 2C1OB 3LIZH 3S3SA 3FT3A 2OBGA 4XPAH 2FHCA 4CVZB 4C4KT 2YBRA 5HHNA 3MLZH 1VEPA 5EIIB 5DD6B 4OI9A 4LLWB 3O3UN 1B4JH 5FDWB 3QUMH 3WNLA 2AXJA 3H3KA 1R6VA 4NQVB 4DVRH 1E4KA 1XGRA 5GRXG 2R1WA 3V4PL 4OLWH 3P4LA 4GLRH 1INQA 5D6DC 5E4EC 3L5HA 2OR8A 4Y19B 4HX1B 5I2IB 4GKNB 5BMFH 1GIGH 2EE2A 4NKIL 5JZ7D 4JDTH 3CUPA 4JHWL 2EIDA 3TH3T 4EDXA 3LN9A 5FCUH 4M6NL 4ZS7L 1N6QH 3QXTA 5I6XC 2DQHH 2HN7A 3O4OB 5C9JB 4H25B 1NAKL 3HR5A 2YD4A 4M4RA 4LVHB 1T7XA 2WIIB 3C5SA 5F1NB 2NZ9C 4MMXC 1PY9A 2BVQA 1YC8A 4HGWA 2WQRA 5D8JH 4NZUL 5DYOB 1OAQH 4X99B 5TF0A 2VERN 2VZTA 3IXTA 1MFNA 1PDKA 4GRMB 2AV1A 2YRPA 1AGDA 5KSUB 1GPOH 1FYTA 4XTRC 4LQ1A 1D9KA 1DTUA 1XZ0A 2V7NB 2WQ8A 4WUKL 1KELH 2ZP0T 1FFQA 3KHOA 4OCRL 5F9OH 1M7XA 5DVNA 1UQSA 1DN0A 4LCCA 4ODUA 2DOCA 4LASH 4XPHL 4AH2B 1FAIL 3ILPB 4GAJH 43CAA 4CMHC 2QKIB 4HIHA 5F21B 4G43B 3FO0H 5DK2A 1NEZG 1JWMB 4X9BA 4FXLA 5D7LA 3GBMH 3K8MA 2Z92A 4LLUA 1S9VA 4LPTA 3FO2A 1MCRA 1RZGB 3P2TA 1CCZA 1O5DT 1FCCA 2BZDA 1AIFA 3R06A 4BZ2L 1XF5B 3RX8A 4YBLC 2XYCA 1J7VR 3IF1B 3BDBA 4X6BB 5LBSL 3K4AA 3B3IA 4M5YH 4P0DA 5KS9F 4HDIB 5EU6E 4LRNH 4HGKC 1A2YB 1CLYL 4A6YA 3VI4E 5HHME 3FB6B 3LN4A 4RAUA 4PJDA 4YUEH 5IMLA 3O2VH 3Q5OA 3IAGC 2NMSA 4P23A 1WBXA 4QKXB 1MJJB 5IEHB 5I1DB 5HGDB 2GCYA 3QDMD 5IJKC 3W81A 1JWMA 2R29H 5F7FA 3LRHA 1GC1L 3REVA 4X6CA 5GRJL 5EO1B 4JFXA 3QCVH 3I2CL 4DZ8B 4LP5A 3EOYG 4JFYA 4PP2A 5FCSH 3MLRH 2D0HA 2MPAH 2VR4A 4JY6B 4R96B 5I16B 5K9QG 3CSPA 1TXKA 4XX1G 1MWAL 2CKBA 4JQXA 5JIPA 4HJJL 3QFDA 1BBDH 1DSFL 5A3ID 1ZLVH 5CD3A 3V2AR 3VRIA 1SYVB 4X6FA 4UQ2B 2I9TA 4Z7QE 3VMNA 1F4XH 3MGTB 5F96H 3QUMA 4HS8L 4JPKL 4K55A 3QH3B 3OHXB 5C9KA 4NQCD 5D71H 3PABA 2ZOKA 1MI5E 3VXNA 4QRTB 5FFLA 1S7RB 4IRSD 4NFBA 1M71A 3IAPA 1KCGC 2QHLA 1DBBH 3ALWA 1CR9L 3B8SA 1YECH 4OM1H 1DQLL 3G6DL 1DBAL 1CDJA 4XHQA 3TP4A 1C5CL 3F58L 2IPTL 5ANMA 5C2BH 5F7YC 2CIKB 2Q6WB 4Z7OF 4KHXH 5I0ZA 2XG4A 3T77B 1NC4A 3V52H 4XMLL 3T0EE 3O9WB 5D2LB 4Y2OA 4PRHA 3GBML 4PJ7B 1EBAA 4PREA 4CVZA 1WQVT 3QJFB 1DCLA 2HRPL 3DGCR 4ODXB 4ZAKA 4TTDD 4KRPD 4OZFB 2A9NL 3OAUH 3QDJA 2ICES 4L3ED 4M4PA 1XF2B 4OT1L 4CNIA 4JFZH 5E5RB 4OZHA 1SBSH 2A6IB 1MJ8H 3DGGA 1RZIB 3OB0H 2J8UE 1GGUA 3A0OA 4RWYH 1WC7B 4Q6YA 4JO2H 1NL0H 3OAZH 4WFGD 1O7SA 3BDYL 3NCEB 5CJBA 2A38A 3HCVB 1ZGLB 3RUGE 4QHUA 1RZJL 2GUOA 1L7TL 5INCA 2J8OA 3AC0A 3O6KH 4G80A 1FORL 3ULVC 4XVUC 3FO1B 3K74B 5B4MC 4IOIA 1Q0YL 3T3PE 1LVEA 1EO8H 5IMMB 3T77A 3UP1A 3IFPA 3MA9L 8CGTA 1IL1B 2PO6B 2R69H 2R2BA 1JPSL 3MRKB 4X6CE 3L95A 4H20L 2ZZUT 5F6IC 1YC7A 7FABH 1BOGA 4GLRI 1S7VA 4OGYH 5D2NE 3FB5B 3PWNA 4GS7C 4G6AC 3SO5A 1OM3L 4XZUB 1TIUA 5DRNB 2I24N 3LN4B 3RVTC 5A2JH 1QYGL 3GM8A 5F9WB 4KAQH 4O4YL 1OTSC 3IDNB 2WUCH 2KZWA 4BUGA 4MX7A 2F19L 4U4BA 2EDHA 5KS9B 3DETD 4RMUA 1UVQB 3HE6B 3HE6D 1E4JA 2FX9L 4F8QA 1BJ1J 1OP9A 4P5KB 4G3YL 4JLRB 2IQ9H 1CGWA 2EEBA 3BWUC 3IAQA 3HNVL 1S7XB 4JRWA 4UNUA 4LSSH 4PJDF 1TTGA 2NW2A 5E8EA 1OTTC 4PJFF 4WDIB 1ZA6A 5EFIB 5EG6C 2Q86A 1IC5H 1AQDB 4NWTH 1I1AC 1YY8B 3V7AG 1A7PL 4BH7A 3QR2A 2YN3A 5KVFH 3JWDH 3MOBH 2R2BB 1TITA 3MRKA 5E03A 3U1SL 4XMKL 3U46A 3VMOA 3T1WA 3RWJA 4MCZB 1FCGA 1ORQB 2XN9A 4XBEH 3T0AA 4HZAA 3MFFB 4NIKB 5CJQL 1LP9E 1YPZE 4NN7B 4U1GC 1OP3H 2P8MB 4Y1AD 5D1ZD 5FUOL 1UT9A 1M05B 4JG0L 1DQLH 3G6DH 4RRPA 5FK9B 5FYLL 1C5DB 4G8GE 3HRZA 2ZCHH 4R7DA 3I75A 3OB0K 1YNKH 2LAAA 1DBKL 5HGHA 3MRIB 3Q48A 5A40E 4MVBD 2XKSA 4AK1A 4FXGB 1FZOB 3OF6A 3QEQA 5FB8A 1BD2E 3FQTA 5H94A 1MRFL 4HT1L 1ZANL 4JFQA 2PCPA 4TSBH 5AG8A 2A6JB 3I9GL 1XEDA 5ESVA 4HMCA 4RFOL 2DWDB 5F8QC 4JFFD 4I2XE 5IIEB 2A0LC 3B4NA 5LCVH 5EZJA 1J0JA 5D7KD 4PJ8C 3GSXA 5TDNA 3V8OA 1U8OA 2X5PA 3KXFE 1MCLA 4HKJB 3EOAB 2V5SA 3GB7B 2JB6A 1C8PA 2VXUH 1TENA 1NKOA 1IGJB 3H9YA 2J5LB 3QUKA 1MCHA 1VFBB 2ZUSA 2BOBB 4FZEH 3QHZL 1CFBA 1IGMH 5CEXA 1T21B 4OLUH 1FRGH 5F7UA 5DUPL 2AVGA 1FN4B 4PJ8A 1IE5A 5JNYB 1P84K 4C59B 2AJYL 4BM7A 4P99A 2BK8A 5I30H 5B39G 5GGTA 4X8JA 5IW3A 2DM3A 2H32H 1C08A 2RR3A 4JFDB 5E9DD 1Z0MA 3JV5A 1AY1H 4RDQF 2YA0A 4P23C 3SE3A 4LLAA 3I6LE 3Q0HA 2H1PL 2QSQA 3QIUA 3I6GA 4KVNH 2I07A 1NSNL 2EICA 4QF1B 1IKFH 4ODXA 3DETC 2QADB 3ZO0A 4PJ9C 1MCWM 5E1HB 3WIHL 1CFNA 2VSDA 4K94H 3VXSD 2FR4B 3ZHDA 1ITCA 4JM4L 4I3RH 2MWCA 3H9HA 3MNVB 1A6PA 3LKOB 4JFEE 3SDAD 3B9AA 5FV2A 2VL5B 4MB3A 4UTBH 5ITBL 5B3JE 5CHNA 3MREA 1F4AA 2CIKA 2Q6WA 4JKPL 5HHXH 4QXTB 3DURB 1FSKC 3VXRD 3WFBH 2VC2H 1PG7L 4OFPA 4NJ9H 3KPTA 3Q3GB 4MJIE 1WFNA 1H5BB 4PD4K 4XVUD 2V2TA 1CD9B 1C7SA 2Q8BH 1RHHB 3VRJA 5ISZE 4QRTA 4TQEH 1AQKH 4OZGF 3VWKB 1NKRA 2VDPH 3O81A 3NCMA 4OGAD 5ID1A 3A6CL 3MLUL 3MRGA 5EC2B 2X4OB 3T09A 3HFMH 1BVKA 2YXFA 2DMKA 3IFLH 2VLJD 1NCAL 2F5BL 3QQ4A 3R1GH 2OQJA 2AK4B 1VB9A 4O2FA 1LNUB 1PEZA 1D5IL 4OLEA 5CZXC 1EJ6A 4P2RB 1G9NH 2F53A 3VE0A 5IGXL 2GAZB 5E8OB 1T20A 1NCUA 4FQPA 4P4KA 1G0YR 3LAFA 3MRNB 4Y1AB 2VL5A 1PX3A 2F15A 2MNUA 4MQSB 3CDGB 2IAND 3FQUB 1NGXA 2R56L 2HMIC 1IC4H 1K6QL 1N64H 5SWSA 4OLUL 2FR4A 4HK3J 1U3HB 5AEAA 1N2RB 4HIEB 4F7CA 5J6GB 2AJSH 3IKCA 1N5AA 1MELA 2AJYH 4JFPA 4NNYA 3FMGL 3ARYA 2R0WL 4G8GB 5JOFA 2QSCL 5C0JB 1CTNA 2CRIA 2J8UA 3MRQB 1QTYT 3ROOB 3E2HA 5TF1L 2FH6A 4HXBL 1UACH 1N4XL 1D5BA 2AK4A 4U6HA 1AHWB 1BD2D 2CKBL 1IKFL 1F45A 2HWZH 3LQAL 4L8SA 1WJ3A 1IQWH 1T2QH 4U1GB 5CCKH 1A6UH 2HKHH 4Z76B 2NLJB 2GSGA 1E6OH 1NBZB 4JM4H 5CSZA 4GG6E 3L3KA 4C58B 2PYFA 4JPVL 4N9OB 4HX1A 5I2IA 1RVFH 4Y19D 2YZ8A 1LE5A 3O6ML 4PGDA 4ELKA 1FZJB 1KJ2A 1YNKL 1KNOA 1WFOA 4R4BB 3QRGH 4WTXA 2XI9A 3L3HB 2OP4H 4JM2B 1K4DA 4LGPB 2CK0H 3C8KB 3BKYL 5DWUL 5KSAC 3U0TA 4LPWA 1MHEA 1PG7H 3G04A 4ZUTB 1T2XA 4MZ2A 4L8BA 3O45A 3TNNA 1HHKA 4KKLC 1TCMA 4O51A 5C09A 1N8ZB 3H2WA 5FO8A 5HPMA 3IXTB 3CD4A 1M6OB 1NMBL 4G8EA 1ZLUK 3I02B 3VXSA 4UILL 4U6YA 4QCIB 3FQXA 4XWOD 3LQZB 4HK0B 1E0OB 3VG0H 2J5LC 4K3JH 4HPYL 1D6VL 2IWGA 3U6RB 1QR1B 2X6MA 4XC3L 3W9DB 2V2XA 1I1YA 2ZNWA 1ORSA 2C5DC 4XXDA 4FQLH 4G6MH 3ZL4L 1KBGH 5CWSB 3RA7L 2ITCB 2JJUA 5I1CL 1J1PL 3RNKA 3V79C 1KENL 1OAYH 4DN3L 1CGYA 4E41A 2LABA 2DLEA 5E2WH 1F97A 2F54A 1EHXA 2RAMA 1OCWL 3BP7A 4S1QL 5KOMC 3QUZA 1GC1C 1TJHL 1P53A 1JK8B 1YEDB 1O0VA 4L4TB 1B9ZA 4FQJL 4CN6A 3IDUA 2QQLL 3MRJB 4J1UB 3CXDL 2B1AL 1JGDB 5SX4H 5EU4A 1XH3B 2CDEB 1HNFA 1UXSA 3D0VA 4JM2A 3BP5B 1QSEB 3EYFB 1KXVC 3QEHB 4O2EA 4ZPVA 3TNMB 1BFOA 2X1OA 3H6JA 3O2WH 1JNJA 1ITBB 2F74B 4FS0A 3GSQA 4ODVL 1F4WH 1HEZA 1UCBH 2GY7B 1EHNA 4JFED 3U4EB 1F2QA 4BFEA 3HMXA 4OCXL 3WFCH 2W0PA 5CSGA 4F3FA 1KN2H 3ULUD 1JFQH 1Z9OA 1M7DA 3FB5A 3T4YB 5BMFL 2BHZA 1PQZA 4F7MA 3HZMB 2BSSA 5E5MA 5C0GA 3VRLF 3MRIA 1KPVB 1VACA 4QGTA 1XH3A 5F3HA 3OG6B 3F7QA 1OARH 5ISZD 5AWNL 3LSOA 1JNNH 1KEGL 2Z35A 1MI5D 1P69B 4RA0C 3VCLA 3ZKMD 3EYUL 4UDTB 5CJXC 1ZWIB 2I5YL 1ZLSH 4Z9KB 4YQXH 4YIQB 4CVXA 3M17A 1S8DA 4JFFE 4KMTL 1MCFA 3P11H 4RGND 3KWWA 4XP4L 4YLQT 3MRHA 1KYOK 3VG0L 4NCDA 5DJAB 5FYKD 1NJ9B 1RJZB 1RU9H 2FGWL 3MGAA 1BEYL 1MI5A 1LK3H 4JPIA 3VFPB 5D96C 3O8XA 2NPLX 5FYKE 5ISZA 5I1IH 3PWVB 3VA2C 3KPQB 1BIIB 4EIZC 3FMGH 5IBUG 2Z4QB 2OLDA 3B8YA 1JRHI 2FEDD 4AQ1B 3MFGB 4XPBL 1QR4A 3LVEA 4QRUB 3ZE1E 4M61B 2D7TL 1NCTA 1QHOA 1A4JA 3U0PB 4YWGH 4OFYA 3VXPB 1JBJA 3TBVB 4D0BB 2F54B 1T0NB 4AY0A 2CLRA 1RAMA 1H9VA 3KGRA 3B5GA 5HGBB 5DVLA 4ONOA 5DLMH 5E99H 1WWWX 4EOWL 4MDIA 5D7LE 1LWRA 4PJEA 1EA9C 1AD0A 4J4PC 1RZ7L 3DX7B 4PP8C 1IAIL 2WP3O 4XXCC 3F5WB 3U30B 4YC2C 1UEMA 5HGGS 3QCVL 5IB2B 5KG9B 3ZDZF 4RGOL 4WFHE 4XMPL 4Z0BH 3GMPB 4BZ1L 3UTSA 3BUTA 4TN9A 4JDVB 2ORBL 1FVEA 4ETQB 3DSNA 4OFYD 3KYNA 1TLKA 3BZDA 2GT9B 2SEBB 5F7EH 1FAIH 4GAJL 5C6TL 3I02A 4NC1C 3VXSB 2WV3A 2VAAA 1EEYA 1Q1JL 3ARTA 3NFPA 3D3VA 1IGCH 2MQ0A 1NMBH 3EUUA 2PNDA 1SEQL 4K3GA 1AD9A 3L3OB 1G7PB 4XB7A 1FO0A 5H2BA 4LSPH 4LLQB 4OF0A 1QFPA 5B8CC 3OXRA 4GXUN 3L3HA 3KYKL 2FYYB 2DJ4A 1V7NL 3GSNB 3LDBB 3EKCA 4AIXA 4PJ9D 2VL4A 3H42H 3U7YH 1FIGH 3CNKA 3QFJD 2I27N 1U8IA 4DN3H 2OJZH 3P77A 3FJTA 2D0FA 3A6OA 2RBLA 3C5ZC 2OX5A 3AS1A 1P7KB 4D9RE 1CI5A 1LK3L 1G6VK 1DDHA 1YUHB 1I3GL 1FDLH 5C0IA 2NNAB 2LV4A 3MXWH 3VWJB 5L7XH 5HVWA 3P3YA 5I1IL 3DROA 4XGZB 4LRNL 3MLRL 1SVZA 4PR5B 5DHYB 2J1KA 3VFMA 1LEKA 2IEPA 4K8RH 1VFAA 4OLVL 5CD3B 2DQIH 4LVNB 5DQDH 1MIML 1U8HB 1WCBB 3I50H 1RPQA 3PWUB 3CFCH 1IEAB 3BX7C 4QNPF 1MEXL 4K07A 5ERWA 3UBXI 1I1AA 5JORA 3SQBA 3JBG7 3FAWA 1MJ8L 4PY8J 2R39A 4NUGH 3P9LA 3VXRB 2DQUH 2F8VA 1J1OH 4NQUA 5I19H 1JZ7A 3LZFH 2CK2A 2IH3A 1S78D 3V6FB 1LO4H 3QCUH 1CFNB 2X1QA 3T65B 3FFCB 3FO9B 3TN0A 2FATL 1D5ZA 1NC2A 3W0WE 3ZKSD 4BUHA 4YDJB 1P6FA 5CBEB 4JM2F 1DBJL 1DVFB 5I8KL 1R3LB 1IFHH 5JHDB 1ZT4A 4X9IA 4IIQB 1OSPL 1GOFA 1RMFH 3ZKXB 2MCPL 4QRSA 1JGUH 4N5UA 2HJKA 1I7RB 4XPFH 1YDPB 1N4XH 4JRYE 4KWUA 4DW2H 4YHZL 3HMWH 1J1XH 1TNMA 2AJUH 2FB4H 5EZIL 3BZ4B 4OZFG 1A6AB 3QDGD 4PJHF 2JJWA 4F57L 4HG4K 1ZSDA 5MERB 1UXSB 4AIZA 2FX8H 3WFEH 2H2SC 4POUB 5D93B 2XPGB 1C1EH 4HXAH 4JVWA 5EUKA 4LMQE 5EUOA 4M1GH 1Q9WB 1BQHA 1CLOL 4YH6A 3WS3B 1S5IL 5I1GH 3EYSH 1UB5B 4HMEA 1YY9C 4WFGE 4NWTL 2BRRL 1HCVA 1IC5L 3LHPH 5E8PA 1LE5B 2H26A 5IMMA 1NAKH 3FN3A 3WD5L 1DEEA 3HZYA 1DL7H 5IBLC 1CVRA 4KUZL 4PRIB 4H1LB 4ZTOL 2XRAH 5DJDB 2OM5A 4HGWB 4NN5B 4JZJA 4GAGH 4OIIL 3S35X 3ROOA 4FQCL 1DJSA 4MDIB 4MXWL 4B7IA 4W4OA 4M6OL 1G7JA 3RL1A 1UKTA 1MRDH 4DQOH 2HTKD 3IU3A 1KJMA 1LMKA 1RFDL 4NNYB 2C1PA 4PJBE 3FB8B 5FYLH 1QYGH 4QHMA 3WNOA 1HXYB 5ICXA 3S88H 4MA7H 1KPUB 2X1WL 2BSTB 1CFTA 1MJUH 4ZUTA 4XT1C 4ZNEE 1JHLL 2EDOA 3AM8C 1MPAH 4LHUG 4WY7H 1UH4A 5ALBH 3HRPA 5BQ7A 4ISVB 5CSBA 5LGKA 3MV11 2GQHA 2XWTB 2D7MA 4FQHA 5EIIA 5HYSA 1AQDA 3VMPA 8FABA 1QBML 1DLFL 5IB5B 1IAMA 1FZJA 1KJ2B 4P2RA 2R0KL 4N0FA 4NJAH 2QQNL 4GXUM 4QYOA 5HHPA 3LS5H 5JDSA 2LE9A 1YYLL 4WO4B 2CO6B 4IRSC 5C0DB 5I75B 2C3VA 2Y9RT 4XB8A 4TTDC 4ZUUB 2CO7B 5GRUH 4UQ3A 5GJTH 4JKMA 3E2HB 3GMQA 3G5XB 1LO4L 3QCUL 5DUPH 1C5DA 4PJ8D 1DQQA 1BZ7B 1JGEB 3DX9A 2A0LD 3GMLB 3WNMA 5GSVA 2DAVA 1DQTA 3UYRH 1FN4A 3MBXH 5SX5K 5TE4L 5I8KH 5DJZA 5EOCJ 4R8WH 3QIBB 4JKWA 1EK3A 1U8LB 2Z93B 2QSVA 3TGXA 4MXVF 2EYRB 3DURA 5E7BA 1WBYA 1GZPB 4QEGA 2BOCA 1NCBH 3MREB 3OKMA 4JY6A 3BI9X 3TBWA 2BJMH 1BQHB 2Y72A 3WS3A 2VZ1A 1WBZA 3EYSL 1UWEH 5CZVL 4EEEA 5C0EB 4S0TD 5J57B 1I3RA 4YBQD 5TDNB 4FNLL 3RIAK 5TH2A 3EGSA 5HDLA 1RY7B 1WWCA 3GSUB 3ZTNH 4ZD3L 3BDXA 3I50L 2AJZA 2W65A 4JFEB 2I9LA 4K7PL 3RWCA 1ZHNA 5J1TC 3HE6A 3IJYA 1FZKB 4FXGA 4NUGL 4LF3A 3NN8B 1MRFH 5KSBE 3V5HA 3MRBB 1A0QL 1CD1A 1I7TA 1N5YH 2HLAB 4KQ4L 3JZ7A 2IG2L 3F8UB 4NHUB 4MHHI 3TEUA 4DJMA 5DRXA 5C08E 2FECL 1EDQA 2Q8AH 5HBBA 1WVZA 4MA7L 3IDGB 4MSWA 1VGEH 2VDLH 4LSVH 2DIJA 3Q6GL 3CLFH 1FYTD 4WY7L 1IFHL 4XMLH 3GHBH 3DXAA 2ZSVA 4XVJL 5I8OL 4OFIA 4UTAH 1XF4A 4D9LL 2I60L 5ICYB 5JDJA 8FABB 3FN9A 5J89A 3D9AL 1I7ZA 5EU3A 4LARL 1A7NL 1DUZA 3C5ZA 5CUSH 5EZIH 1RZKC 5T1KD 3WIHH 2V7NA 2JJVA 4IRSB 3OKMB 3SOBL 4MA3B 3CFBA 4FFZH 1AGBA 3O3EA 1SBSL 1XF1A 2BNRD 4PUBH 1FVEB 1JE6A 1C12A 3WFEL 5MEQB 2QADC 5DZOA 3MQIA 1NL0L 2X10A 1IC4L 2PXYC 3ZMRA 5IG7A 3NA4A 3UBXG 1C1EL 2W07A 5DJ0B 2MOVA 4AT6B 3TVMB 1T89C 2WIIA 3C5SB 5E00A 3QEUA 4WHCA 2G2RB 3TCXA 4NKQB 2RJMA 4MAYD 3CK0L 3GEWB 2VAJA 3QQ9D 4H1LA 4N0RA 5DS8A 3K1DA 1Q1JH 1IGYB 1NH6A 3U0PA 3LEVH 4PLNC 4ONFL 2XKUA 2FBJH 3SDDA 1JUFB 5CEYB 1RK0B 4DKDC 4NHCH 5I1JL 3D2UD 1VFBA 2PYEB 4C57C 5ESAB 3QUXD 4PJIF 3O4LA 2X4PA 5FM4A 4R90L 5EUKB 5B39B 1BIIA 1JZ6A 2IH1B 5E8NB 3T4YA 2DQCH 2CUMA 5BS0A 2YBRB 3DARA 3E6HA 1ZA6B 1AE6L 4H26A 4F9PC 4L8CA 1EMTL 2QR0A 4KTEL 2P8PB 1SEBB 4JO1H 4I0KA 2B2XL 4MQXD 5HHVL 2R1XA 1ZSDB 2ZG2A 3M45A 2NCMA 4YXKH 2JIXB 3JUYA 2P7TB 2UWEA 1ZLWK 3HFML 2NY4B 3FFDB 4JFPB 4RGMC 4G9FA 4GW4B 1JWUA 1FSKB 1F58H 1OF2B 1QHPA 4QY8B 2WBWB 5I66B 3BJ91 3M17B 2HG5A 1X9QA 1NLBL 2YN5A 1YMMA 4PREB 1R3LA 5E6ZA 5E2TL 1DQJB 4KZDH 5HVFB 1MLBB 2NX5E 2CXKA 4JREC 1PLGL 1I4FB 4XP5H 1KB5L 1LILA 4NQCE 4NP4H 4RA3A 4PP2B 3K8KA 4X7SL 4TPRH 3KPLA 5F88B 3FN0L 4H1LH 3GO1L 4Z7WF 1I8KA 1S7UB 1JGLL 4V3EB 5FYLE 3STZA 1NBVH 3RZCB 1HDMB 3HE7D 2FECI 2EDXA 1A4JB 4N8VG 5DJZB 3O2VL 1Z9SA 3I3DA 4MD0A 4PRPE 1OY3B 4U1KB 4NQXA 1S9YA 5I15H 2AP2A 5IMLB 1AXSA 3L7FA 5TE4H 5DJYB 1I9JH 3BKJL 4JKLA 2UVFA 1X5YA 3GBLA 1FH5H 4FQJH 4KI1A 1B6DA 1BF8A 3EYVA 3L6FB 4M8VA 1M6OA 5IT2L 2ZPKH 5C0AD 4WWKB 1S9VB 1YPZA 5E1AB 3OAZK 2VXSH 3VXRE 3B2UD 1IILE 4Q9RH 4OLXL 1JGDA 5C08B 2DKSA 5BO1L 4UDUB 3CFIC 5KJRH 1F4WL 1XGRB 1X5KA 3OZ9L 4M7LL 1R3HB 3UTTE 1T0MA 4MAYC 3V6OE 4NRZA 4I2XB 4KXZH 1KN2L 1HDMA 4CVXB 3T65A 4Y5XC 4WW2B 5F9OL 3K2UH 4RQQB 1J8HB 4R3SA 4Z7VE 4WENB 4QF1A 2Z9TA 5GGUB 5GHWL 5DUBA 4IS6A 3FRUB 1M71B 1JFMA 1VENA 3HUJF 4RAVA 4Y5VC 1IQDA 1XR8B 3FOLB 3FOMB 2IPKA 3ZSSA 4LVOC 5GS0D 1HHGA 1YEEL 3LQZA 1IRAY 1LK2B 2EZ0C 2JJSC 4GW4A 2AK4D 1BZQK 1XGUA 2QQLH 4DUWA 1F6AB 1HSBB 5EBMA 1AI1H 1XCTA 3C2SA 4NQDB 3QI9C 5GRVL 4HPOH 4JO4L 4RMSA 1GGCL 3WO4B 3V0AC 4Z7VF 1OAUH 1IKNA 1BHGA 3QQ3A 4WUUD 2H26B 1N6UA 5HHOD 3IETA 3S5LG 1HEZB 5HDQH 2VLKD 3WE6B 2GITB 4H26B 3O41B 4HWBA 4K71B 3RGVD 1UH2A 43CAB 4IHOB 4KMQA 1OCWH 2ID5A 3MRDB 1QSEA 3MRLB 5C0CB 4X5LA 1B2WL 1U8OB 4HKJA 2QL1A 4KK9D 4HIXH 4JFXB 5K9OB 3O3AA 5D7JD 3RNQB 3EFFB 4GBXD 3C6LC 5T3ZH 3D87B 5IEHA 1QBAA 4D9QE 1NGQH 5IHLB 5CEZH 1JNHB 4ALAL 1GGYA 4IBLT 2XG5A 1A1NA 5AWNH 5L2KE 4PJCE 5IK3B 1X5LA 1JGLH 4J2XA 1YYLH 1L7IL 3BD5A 5C9JA 1BQLL 1EEYB 5AYUL 5K59E 1CLZH 1UWXH 4LCYB 4KMTH 4I48A 3TYGH 5EA0H 1LEIB 1OW0A 3HN3A 4GKSB 4ZUVA 1K6QH 1HE7A 4QOKB 4GKZA 5CBAA 4UAOB 1FH5L 2QKIA 4HIHB 4J3UA 3VDBA 2VLKB 4LHUD 1J11A 3UTPE 4I0PA 4FQHB 5C0EA 4OLYH 1HHIB 2CLVB 3V4PH 4F7PB 4L8SC 3L5WA 3PJSA 3V0WL 5T1LB 1HHHA 1V3LA 3WXWH 3MRNA 3SE3C 4DZ8A 3ARGC 1W0VA 4JJHA 3OR7B 2BOCB 3FT3B 2AJVH 1CICC 1G7IB 1LD9A 3KR3L 4A6YL 2IBZY 3LMJL 4JPWH 3JSSA 1UACL 3H9SD 3QDGB 2RFXB 3PGFL 3FL7A 2Z31D 1Q9OB 1RZFH 4NP4L 4MJ5A 5GISH 3BPLC 4ZNEA 1WFUA 4DEPB 4CBPA 1H15B 5F7DA 4EVNA 1JPFA 3GSVB 4FMKA 5DUML 1MCIA 5DEGB 3OPZH 5DT1H 4GUPB 4ZQKB 5ACZB 4HIIB 1AXTL 2OMNA 1FNGB 3NIFE 3L95B 5E8PB 3VW3L 4FZ8H 4JZNA 2LQRA 4WEBL 5TE7L 5JR1H 3FKUS 4EN3D 3MRRA 1Z3GL 1LO2H 1I3RB 1B3JA 1TNNA 1N5AB 3PP3H 4CRPA 5FUCC 5IMOB 1RIUL 3QHFL 4UTAL 4AG4L 2GHWB 4H0IA 3D18B 3WHE0 1X5AA 4AIZB 3U7AA 3A6BL 3ISWA 3PWPA 5EU6B 4MD4B 4HWEH 3DGGB 3RKDD 5JW4M 4P4KB 1EZVX 1CICD 3ZLQC 4PJ9B 3MUHL 4QOKD 5FKPB 2BVQB 3TESA 1A7OH 1FC1A 2FEDC 2X4NB 5GPRA 4Z78B 5L2KA 3CC5B 2NW3A 4J7RA 3E6HB 3T0DA 3ZKND 5EZLB 2FATH 3EW3B 5BJTA 1A6ZB 1SJHB 3VWJD 2W9DH 4KJYB 4Q9QH 2R8SL 2XN9B 4LMQI 5IVOA 4S1DC 3TN0B 3UMTA 5GGRY 5D7KE 1WAAF 2ARJB 2EEDA 4U1JB 3X11B 3V0WH 4XCYA 4N0UE 4JQVA 5I1HH 3OSKA 4I2XA 4TULH 4NRYA 3DOSA 2J88H 5F72S 2X89A 4RGNC 5J1AA 3EZ8A 1QLEH 3EIFA 1EEZB 4PJ5B 2AAVA 5T5NG 4AEEA 2ZKHL 1CFTB 1WZLA 1JYWA 3MOQA 1XIWA 4JLRA 3CLEL 3NFSL 4JFQB 5CS7A 3MZTA 1JRHL 1PG7W 2OI9B 1KNOB 2DICA 1PZ5B 2VUOA 1E4XL 4LIQH 2HFGH 1G7JB 3RL1B 1OVZA 4X80H 1HH9B 4OLZL 1JV5A 4MA1B 1QFWM 1RV6X 5F7NC 3VWJA 3VFUA 5DI8B 5GQBA 5BW7C 1I8IB 5I1KH 1BD2A 3LMJH 2B39A 4OZGB 4ZO7A 3OKDB 3RKPA 1DVFA 4M3JA 4OCYL 1I1YB 5CJOH 1JHTB 3D69B 3O4LD 3TA3A 1JHKH 1I85A 1QSED 2H9GB 4WI6A 3RHWF 1EGJL 2ATKB 4MQ7B 2IANA 2I5YH 3HAEG 4HS6A 2H45A 1BECA 4JRXB 4L3EB 1AFVH 2Z91B 4YXLL 3MLSH 4UUJB 3BFOA 5C0BB 5D2NC 5C0BD 3H3PL 1BLNA 1VESA 1J1OL 5I19L 3DIFA 3WFBL 1CBVH 1D5IH 4LDEB 5EA0L 1G7PA 2HG5B 1URLA 4IRJD 3DXAE 2BY0A 4LCCC 2Q8BL 5IMOA 15C8H 4NCC2 3T2QA 5FECA 1S9XB 1FBIH 1U95B 3AREA 3ARFB 4ZSOE 4OV6F 2NY4C 1A3RH 1T66C 1U6AL 4J6RL 4LSRL 2KUTA 5KS9A 4ZXBC 2UY7A 1FL3A 2Z92B 4LLUB 25C8H 3C60A 3ARUA 2CJUH 4YEEA 5D7LB 2NLJA 2GJ6B 1VFUA 5D7IB 4CL7A 3QUYB 1FORH 4PGJA 5MENE 1ZT1B 3DX8B 2R0KH 5EZOL 3MRGB 5EC2A 5L2JA 4K7PX 3MO1B 3D0VB 5HYJB 2VKXA 1HHGB 2R69L 3VI3F 2FZ3B 3K8LA 4CADA 5ITFA 5BRZD 3SE9L 1MUJA 2O5ZL 3KLAB 3IDMA 2FIRT 4PFEA 4EQ3A 1H5BA 4OIIH 4P2OA 5GGUA 2R2EB 5GGRB 2YMXH 3BSZL 1MAMH 2BC4B 3KS0H 4NHUE 1ORQA 1G6RH 5IVXE 2BXZA 2Y36L 1TPXC 4P3WA 2IADA 3X17A 2ESVB 4YHYC 4ODHL 2YEZA 1P1ZB 1RZ8A 4HC1A 4YDKH 4KDTA 4XPTL 3PV6A 4POYA 3AY4A 2W9EL 5MENB 3HI6H 1AP2B 5ISZB 2VLRE 4DKEH 3EYQD 1TETL 2GAZA 4GMTH 4GAGL 3QFDB 5AG9A 1GXEA 3P0YL 1YZZA 4KI5C 4M6OH 2ICWB 4K8RD 1T6WA 2NX5A 1PZ5A 4G8GD 1A7PH 3HI1B 3J8F7 4HPOL 4H5SB 4GKOA 4BK4A 5T33H 1BGXH 4NNPL 5T3XE 2FX9H 1OT1A 1OP3K 5ID1B 4KI5E 2YEZB 5D9SA 5ICYA 4G9FE 3OV6A 4HJ0C 5F1SA 3GJFH 2V2WB 1CDHA 1Y18B 3O11A 4FXKB 4CU7A 4M61A 1W72H 3MJ9H 1BREA 2VABB 5E6ID 1KBGL 3DVGA 1DBKH 4DCQA 3TF7A 2VXTH 1QBBA 2ZOKB 4M7JH 4HMDA 3UYRL 1NANH 1P4IH 1JTOA 3ULUL 1A9EB 2EE9A 3EOAA 4R97B 3KDMA 3TH2T 1UADC 5CJQH 1F4YL 5H8DA 25C8L 4PRIA 4WTZG 3UJTL 4ZG1A 1H3TA 3T0ED 4K8RL 5D7IA 3UC0L <