2IA1A

Crystal structure of protein bh3703 from bacillus halodurans, pfam duf600
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
169
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords BH3703 protein
total genus 58
structure length 169
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia1A02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 2ia1A01
2DTRA 1U5TC 1J75A 4RGSA 3WTXC 1ODDA 1R1TA 4KN7X 2DQRA 5HS7A 2CSOA 2VC1A 3QP6A 4JQFA 5HLIA 1IZ1A 4L9TA 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3PQKA 1FBSA 4WF2A 1YIOA 2X4HA 3MZYA 2JZYA 4ENKA 2A07F 3W6KB 4ZZDA 1K79A 3L9FA 1MJBA 5DD8A 3D5LA 3L09A 1USTA 1EH8A 2XHKA 1CGPA 2QWWA 2STTA 3SXYA 4JK1X 2NNYA 1XGNA 3LWFA 3HRMA 3TOBA 3J81Z 3TKYA 2FMLA 5J8FA 1ZLKA 2VT2A 1RZ4A 1GXQA 2D45A 3MCZA 1QQIA 1SD7A 1W5TA 1IN4A 1TNTA 3ZMTA 3DQVC 1PP8F 4YFXF 2BBYA 3HOTA 5E1WA 4PGHA 4G6QA 1O7FA 3DFGA 3ZMUA 5D6FA 2BEOA 2FE3A 5LLQA 3S2WA 1I1GA 2GQQA 5KVRA 5TJJA 3F22A 2HQNA 1T2KA 1MJ9A 2Q2EA 3V4GA 4WXHA 5DCFA 3FX3A 3ZQ7A 4GYIA 1P6RA 4IRIA 3Q9VA 2XUBA 2M8EA 2DW4A 4F7ZA 4M73A 2BGCA 2QYOA 1QO0D 2ACJA 4A0ZA 1UCRA 3QPHA 3EQLF 1LJ9A 2F5DA 4MNUA 3KZYA 4JBAA 1F9NA 3M8EA 5EEGA 3ECHA 1G3TA 4LD5A 4ZYDA 4RGRA 1YO5C 3BJAA 2G7UA 5BS6A 3U2RA 5CVJA 3LA7A 1TNSA 1VTNC 2QENA 3JTHA 1Y0UA 4IRHA 3T0YA 4IRGA 4EGYA 4LK1F 2OAZA 4YIIA 1I5ZA 3V7SA 1HKTA 5IT3A 3M7GA 3WE3A 2EB7A 2OD5A 4WX9A 2UXXA 1O57A 5JFRA 5L3FA 1IUYA 1DPRA 3WE2A 1IXRC 4CGZA 4BHPA 2H94A 1O3TA 2UXNA 3J80Z 3KEOA 2KJCA 2RVCA 1R7JA 3COAC 2Y75A 2K02A 3KP3A 2GWRA 1GHCA 4OMYA 3D0SA 4CICA 2LSOA 4EM0B 3I59B 4G9YA 2DT5A 2E7XA 3P9CA 1P92A 1FSEA 4PGGA 2VN2A 2EFWA 3C3WA 4BNCA 3E5UA 1IF1A 1ZG5A 2VOPA 5HS9A 3E6MA 3CUQA 5LBQA 3LAJA 3K69A 1QGPA 4PDKA 4RB0A 2D1HA 3TDUC 1W7PB 4HQMA 1ZYRF 4WXCA 1ZREA 3I64A 1E2XA 5ERIA 4AVPA 4EGZA 3HRSA 4CDGA 2KRFA 3I59A 4A6DA 5FB2A 1IN7A 4IJAA 3CLOA 3F8NA 4EM2A 5LGUA 4CYDA 3H3ZA 2HS5A 3E5QA 3ML6A 4N9IA 3TO7A 4I2OA 4FT8A 2EV0A 1ZGAA 5DUKA 1T6SA 3TDZC 2A5YB 1B1BA 2A3SA 3F8BA 2PQ8A 5HDKA 2QQAA 1W7PA 2ZFWA 1STZA 2UWMA 1XSDA 4MHGA 1EH6A 2P5VA 5E1XA 4RS8A 3OOPA 2DFIA 2FNPA 2HTSA 1UFMA 1O3RA 5F64A 2EFQA 2JPCA 1R23A 3JW4A 3VEPA 2K86A 3WTZA 3J80K 1DPUA 3BDDA 4XBFA 4AD9A 5KK1A 1F1ZA 2K4JA 3L00A 1YFHA 3QOPA 4IXAA 4OINF 2HGCA 4EVIA 3GZ5A 1G3SA 2F5FA 4MQVA 1YLFA 1FNNA 1IRFA 3ELKA 2GAUA 4XLNF 4HZFA 2VOOA 5BOXA 3DPLC 1WQ2A 2QM3A 5E1ZB 2CW0F 1O3QA 1IRGA 2BYVE 1U5TB 4YG2F 4L9VA 4ESBA 5D5WB 4M74A 2DQLA 3RKXA 1I1SA 4UVAA 2H6CA 1H0MA 4U7DA 5J8CA 3JTGA 3WTWC 1TQMA 2V6CA 2OA4A 2BV6A 2WTEA 5LRSA 4ON0A 4KA4A 4UV9A 2Z33A 2JPBA 1KA8A 2XAGA 2LNBA 2VBYA 4OMZA 2F5CA 4Y13A 1W4MA 1Z9CA 5ED4A 5DEQA 2M45A 3KP5A 1OR7A 1K7AA 1ZG1A 1BIAA 2ETHA 2MLGA 3KP7A 2ESNA 4PCQA 5DUIA 1WI9A 3BY6A 2GA1A 5DYMA 4HF1A 2J5PA 1C0WA 2ZNZA 1MZBA 3IC7A 2RQPA 1IN5A 5IT9K 4A6EA 4G7ZF 4KNYA 3L7WA 1FZPB 3EUHA 3IWZA 5DCMA 2CFXA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 4HYEA 4CXFA 4XLPF 3LQQA 3GW2A 2L02A 4GO1A 3TO6A 1OYIA 2L54A 4B09A 2ESHA 1FLIA 2Z9OA 2ISZA 2YR2A 4UNOA 3HTSB 4NB5A 1LQ1A 3E5XA 3WTUC 1QBJA 1XGSA 3V8LA 1YW7A 4HX7A 1G4DA 1RI7A 4LLLA 3T5XA 4KIGA 5FD5A 2GXGA 3VOEA 3KP6A 2IRFG 2V1DA 3HSEA 2FU4A 2MC3A 5FLXZ 3MZHA 4U0YA 2HZTA 2JSCA 5ICFA 4CHUA 1FYLA 1YQAA 2DLLA 4YFNF 2TDXA 5E8GA 3ZP5A 3CUOA 5D6EA 4RAZA 4R1HA 2RC4A 4HX4A 5A2QZ 3GFIA 1LEBA 1P4XA 1FP1D 1OKRA 2VBXA 3WTSC 3ZPLA 5FFXA 3IL2A 3CO7C 4KYWA 3HSRA 3NQOA 4Y17A 4M72A 2E1CA 1LEAA 4MTDA 4Q48A 3U1DA 1KYZA 1BI3A 1KGSA 2A6HF 2HQRA 3E6DA 3P7NA 3I4PA 5FO5A 2KIMA 4HW0A 3DKWA 1UB9A 5L3BA 1HSJA 3BZ6A 3GLXA 5ICEA 1FSHA 1JHFA 2EFOA 3QRFF 4H0EA 3EDPA 1G6NA 5CJ9A 5K5QA 4GYGA 1W5SA 2RV8A 2XVCA 3HRTA 5ILUA 2EK5A 2VBZA 2HYFA 4G94A 2MH2A 2J5OA 2VE9A 6PAXA 5D8KB 2EA4A 3IRRA 3FXUA 4L5JA 4IHSA 1S7AA 3R4KA 2XKOA 5HDGA 2VONA 2P5KA 2RNJA 3BOQA 2WWYA 1WRJA 2K4BA 3I71A 3HHGA 4GCVA 1B6AA 1YS6A 4RB1A 3E6BA 2NNNA 3GWZA 1SD6A 5E20A 2AXLA 5D5UB 5L3DA 3RYRA 4Z2YA 3SZPA 4D0PA 2W25A 3F8MA 1R22A 4ENMA 4ASNA 4KIBA 1EV7A 1PDNC 2HTJA 4UVBA 3VB2A 2VBWA 1IW7F 3WGGA 1XCVA 3GO5A 1QPMA 3GZ6A 1E17A 2PLYA 2LDUA 5ICGA 4EM1A 5CVUA 2ZMEA 2Z99A 3GUDA 3T8RA 3REOA 1BI1A 2YU3A 5A2QK 2ZO4A 3E3VA 3H92A 1TQPA 1QZZA 5K1YA 3ISPA 2O6GE 2VODA 2XAFA 2IJLA 1FWZA 1OYWA 2P8TA 1MDMB 4PZJA 3T8TA 3HIFA 2Q0OA 1I27A 1ZRDA 2HEOA 3HHHA 3LQRA 2XASA 2PN6A 2XIGA 3RYPA 3FMQA 3FMRA 1J2XA 2KJBA 4A5NA 4UXNA 4KUMA 2O61A 1D8KA 4BYYA 5LEJA 2BE5F 2IPQX 4G6DA 5CYVA 4MEXF 2DPDA 2OBPA 2NYXA 3KCCA 3BJ6A 3ERED 4R79A 1FC3A 4ZZLA 3GEZA 4I98B 2D1VA 3WTYC 1WSUA 5BPIA 4Y15A 1YW9A 2PG4A 3DF8A 2EV6A 4EJWA 2QQ9A 2PBIA 4WXDA 1F4KA 1D3YA 3DXJF 5CVRA 5HLHA 1S3JA 4AIKA 3K1PA 3Q9SA 3EETA 3GVAA 1R58A 3TO9A 4ZYGA 2NAZA 2OQGA 1A04A 4DQ2A 3ULQB 5HVQC 2QQBA 4LFUA 3G3ZA 3RKWA 2O03A 5LEKA 3N97A 4KDPA 4K2EA 4I7HA 3GF2A 4N0BA 3J81K 3F3XA 1H9GA 1R00A 2XGXA 3QU3A 1KU2A 4BHBA 4HDUA 4HX8A 1HXDA 4TV7A 1B4AA 3WTVC 3HRUA 1Z6RA 1B9NA 3DEUA 4HV5A 3M9AA 3WGIA 4A5MA 2LF8A 1KU3A 2F5EA 1SFXA 1B9MA 1TTYA 2FRHA 4LB5A 1MDMA 5E17F 4L9JA 1V3FA 4FX0A 1IXCA 3F72A 3O3KA 2A69F 1UHWA 1BI0A 2YX4A 2R3SA 4L9NA 1TLHB 3RDIA 2FF4A 3AAFA 4MEYF 4Q47A 3MWMA 3JAMZ 4ZYHA 2R7DA 1JXSA 2FMYA 4XSXF 1TW2A 2GA2A 3SFZA 4HAMA 1R1VA 1ULYA 3RJPA 4RB2C 5FLXK 4M9SA 4O6JA 1CF7B 5JI6A 1BI2A 1U3EM 1EH7A 1K78A 2CO5A 1YYVA 5F1RA 2Y48A 3N4MA 4GXOA 3FHZA 1RIOH 3ZMZA 1SFUA 2ELHA 1R5HA 1JGSA 2WV0A 4OIOF 1XSXA 1ON1A 3HYIA 1XDSA 4HV6A 3F8FA 1R5GA 5L3GA 2A61A 4HOBA 4OIPF 2ZBKA 3TGNA 4LMYA 2FOKA 2HFHA 3SHFA 2QBYB 2KIUA 2ZKZA 2P6SA 1SD4A 3L2CA 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4L18B 4P9FA 2L01A 4XRFA 3R0AA 4LLGF 4HA8A 4HLYA 2D2WA 3K1MA 5ILVA 2FBKA 2GXBA 2UZKA 4EV0A 4HF0A 3IKTA 4M6XA 3WTTC 5FD6A 3RKYA 3HUGA 3C18A 1R1UA 1BN5A 2DO7A 2KIFA 3GX4X 2RN7A 3PFIA 4G8XA 2KKOA 1ZN2A 2M5WA 2P5LC 1T38A 3K2ZA 3I5UA 4A2UA 3R60A 1AWCA 2IA1A 3LSTA 3ABTA 2DBBA 1WWXA 2QVOA 3ZMVA 3KEQA 1FYMA 1O3SA 1TQIA 2VXZA 3CTAA 1MD0A 2CYYA 3W6JB 3RPUA 3I53A 1L3LA 4S05A 3DPTA 3F21A 2PEXA 2OU2A 5HLGA 2PI0A 4EJTA 2H27A 2FBHA 2NRAC 5E18F 1HQCA 1LVAA 3M8FA 2E7WA 2ZJ2A 5TRDA 2E1NA 2PMUA 2CGPA 3GFMA 5L3CA 1SAXA 3VFZA 3CUQC 5AIQA 4KFCA 1OMIA 2W84A 3TOAA 3CDHA 2FBIA 2DAOA 1J9IA 2H6BA 2F2EA 5E8IA 2STWA 1LDKB 1B59A 1XDUA 2NS0A 4EJVA 1J5YA 5LHGA 4CO8A 3KLNA 2O0YA 2VT3A 4MTEA 4U88A 1SMTA 1BBYA 2AS5F 2CQKA 4KIFA 4KT5C 4NQWA 4WCGA 3V7CA 3V8JA 3I54A 4P55A 2XAJA 2XRNA 4A12A 1BM9A 2K7LA 2MA3A 4MQ9F 2MD5A 2DK5A 5CLSA 2L3DA 1XGOA 1H9TA 2IA2A 1J0RA 3FF5A 2VE8A 4EMSA 4I0AA 1TBXA 2W85A 1DDNA 1XB4A 4UHTA 1RUOA 5D4RA 3KETA 1USSA 3P9KA 2FNAA 5IT9Z 3OV8A 2P4WA 1KQ9A 3KZZA 3MFKA 5HDNA 2QUFA 3BPVA 2A68F 1ZRFA 3ABUA 3IRQA 3EYYA 1DUXC 3O6BB 3QAHA 2V1UA 2RDPA 4P5OA 2K27A 1S8NA 1Z91A 3CUQB 4AIJA 1XD7A 4O3MA 3HSFA 3KP2A 4ETSA 4OOIA 3KP4A 4AWXB 1LNWA 2OZUA 3F23A 2IA0A 2ZXJA 4U7BA 3SZTA 4DNCA 4M9ZA 3BWGA 5LRRA 1T0FA 2MBFA 1G3WA 2R7FA 3C7JA 3R61A 5DD4A 3G73A 1XGMA 2EA2A 1AOYA 2IW5A 1XSVA 2IP2A 5K5RA 1ZG3A 4A0XA 4HDVA 3FM5A 1LB2A 1TW3A 4S04A 4KMUX 1ONVA 1MGTA 4M71A 4HQEA 4KN4X 1HKQA 4R8HA 5HS8A 2L4AA 5D5XB 3U9GA 1Z05A 4LG0B 1IAWA 3ZMSA 1I6XA 1LDJA 4KMFA 1W7PD 1QNTA 3RPQA 3DV8A 2CWEA 2FEZA 3KFWX 5DDGA 1LDDA 1U2WA 3E6CC 4ZH4F 4G7OF 1ZHFA 4RGXA 4M9XA 5DV5A 5BPDA 3FM3A 1XMAA 3F8CA 5FFZA 1G3YA 4LG0A 2PFBA 2JT1A 4U0WA 3PQJA 1JHHA 5K5OA 1WKMA 2PMHA 4OIQF 5LHIA 3FXRA 3ZN1A 2MLKA 5LHHA 5ICCA 3IKVA 2XAQA 5FGMA 3MAJA 1DP7P 2XROA 4LK0F 2M30A 3E97A 4BAYA 2P7VB 2V9VA 3HOSA 2EFPA 1X3UA 5F6FA 1FYKA 4L0YB 4RB3C 5L3EA 2P7CB 1IXSB 1SD5A 4BXUA 2VC0A 5D8LB 4IPAA 4M6YA 5LGTA 5LGNA 2B0LA 3T1BA 4ESJA 1PP7U 2PJPA 1HW5A 2ZNYA 2L4MA 3FWEA 5CVIA 3EYIA 3KE2A 2G9WA 2XKPA 4OIRF 1YW8A 4ESFA 2DPUA 3SQNA 1QZYA 1Z6TA 3O2PE 4O5VA 4LJZF 1O7LA 3FZVA 5D4SA 1MJAA 1Z1DA 5EEHA 2Z3YA 2C6YA 1SFEA 4GGGA 1FBUA 1R36A 2V1XA 2YSRA 2ISYA 1ZARA 4I0BA 1Q1HA 2EV5A 2HYGD 4I01A 5J6XA 1BJAA 2JRTA 3TQNA 2DI3A 2OQRA 3BJOA 1SMYF 4ENJA 1RUNA 2O3FA 1FP2A 3WU1B 4UVCA 1K6OA 2LKPA 3BPXA 3WODF 1FT9A 2RKHA 1FOKA 4LB6B 5AIPA 1KU9A 5JVTA 1U8RA 2Y0MA 3B02A 2ZMEB 1ON2A 4MGRA 2IVMA 5H20A 2OZ6A 3ECOA 1FBQA 5H6RA 4UUVA 1KQ8A 2XAHA 1Z7UA 1OYYA 2A6EF 1YG2A 5AONA 4EJOA 2DK8A 1J59A 3V7RA 3MQ0A 3QPTA 5H6QA 3GXOA 3Q5FA 3IHUA 1YS7A 4EQQA 3CJNA 2W24A 3RI4A 4FHTA 3WU0A 1ZGJA 2DU9A 2Z5UA 4Q4ZF 2EWNA 3LFKA 3GFLA 1BIBA 1T98A 3VODA 4YIFA 1BOAA 5BMZA 2WC2A 1J7KA 4NHJA 1ZH5A 3JAMK 1UHMA 3R0JA 3RIRA 3V8KA 3HTUA 4RGUA 1K78B 4ENNA 1XN7A 2FA5A 3RTRA 1HSTA 3BP8A 4EJUA 2X0LA 1XCBA 1KU7A 3M1EA 4CZZA 2HWVA 3DP7A 3CO6C 3KLOA 2RGVA 3JSPA 3J7AO 4FX4A 3NRVA 3LA2A 4G7HF 2P6TA 4QLCU 4YFKF 4B8XA 2EJRA 1HKSA 2LF7A 4P96A 1D8JA 3WGHA 1L0OC 2HOEA 2QZ8A 1P2FA 4I09A 2ADUA 1GXPA 3ZN0A 5HOOA 1U6GA 1BC7C 2O8XA 2V79A 3C1DA 1IN6A 1OPCA 2MH9A 1YTYA 4E70A 4Q5SF 1V4RA 4IVNA 2H09A 3H3UA 1U5TA 3K1NA 3B73A 1KYWA 2HR3A 4BQAA 2XV4S 4LLNA 2GIVA 2W57A 3QU6A 4HF2A 3LAPA 2ZCWA 4L0ZB 1FPQA 1HBXG 1F5TA 4OU0A 1NHAA 2JTVA 5BQTA 1CF7A 3GFJA 2COMA 3BROA 3FXQA 4BHCA 4A0YA 4U0VA 3P9IA 4XSZF 4LGWA 4UV8A 1HW2A 3K0LA 1HW1A 2G7HA 4L5IA 1S7OA 1ZRCA 4P9UA 5JHUA 4AIHA 3ZMDA 3WG9A 1XMKA 1ZAOA 3GYHX 4N9HA 3MEXA 3I0TA 2QLZA 2EFNA 1GVJA 1S29A 4HBLA 5CVVA 2HKOA 1D5VA 1P4AA 3NEUA 2M1BA 4WWCA 4HLXA 1FY7A 4KICA 3ROUA 4ZYEA 4IHTA 1MKMA 3K9TA 1REPC 2IT0A 4BH9A 5DCMB 1ZLJA 1PUEE 2YX7A 4QWQA 2FXAA 5D5VB 3R6SA 2GZWA 1JE8A 1S6LA 4RAYA 1RNLA 4IF4A 2HKXA 2QBYA 1KQ0A 5ILSA 1IN8A 3F6VA 3FMSA 3F6OA 3LA3A 4I02A 5JR3A 2M87A 3QP5A
chains in the Genus database with same CATH superfamily
2DTRA 2MFZA 1U5TC 5HLTA 3D1NI 4RGSA 1J75A 4AM3A 1BW5A 3WTXC 1ODDA 1R1TA 1RRJA 5ENWA 4QRSA 3P9LA 4KN7X 3PO2J 2EZIA 2DQRA 5HS7A 4V3EB 2CSOA 1V54H 2VC1A 3QP6A 4JQFA 5HLIA 4BDZA 1IZ1A 2E1MB 2X6XA 4LOCA 4L9TA 1C16A 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3NWTA 2RFXA 3MGOA 4ZUTA 3CCEI 3PQKA 4NO2A 1FBSA 3Q0WA 1YIOA 2X4HA 4WF2A 3MZYA 4CA0A 2JZYA 2V4JC 1B72A 4ENKA 4MNQA 2A07F 3QQAA 3W6KB 1V5EA 3O4LA 5GPCA 3TBSA 4CYCB 4ZZDA 4IIQC 4L9LC 1AGEA 3LSGA 1RR7A 1K79A 3L9FA 4ONOA 1MJBA 2PJRB 5DD8A 1JI8A 3D5LA 2WB1N 1R71A 2GITA 3L09A 5DM7F 2IAIA 3AG2H 1USTA 5IP9J 1IDZA 1EH8A 2XHKA 1CGPA 3S2HJ 2QWWA 5HHMA 3FRUA 1OGAA 2STTA 1T21A 3SXYA 2EPFA 4B47A 4JK1X 3WUWA 1CQTA 2R5YA 2NNYA 3EUKL 1XGNA 2CW7A 3LWFA 3HRMA 4MNGA 3TOBA 1E0EA 1T80A 3VFTA 3J81Z 1G7QA 3TKYA 2EZLA 2FMLA 1K6YA 2R93J 5DEFA 5J8FA 1MMGA 3X14A 5E3NA 4JQVA 5HHPA 3DX6A 3CC7I 3RWCA 2LG4A 1ZLKA 1RK0A 2VT2A 1RZ4A 1GXQA 1SVOA 2D45A 3MCZA 1QQIA 1SD7A 1P1ZA 5J6HA 3OIPA 4BDYA 1JF1A 4D1QA 2ESVA 3DLAA 4XN3A 3LMMA 1W5TA 1IN4A 4JFOA 1TNTA 2DJIA 4NQVA 3ZMTA 3DQVC 1HOMA 3WU2C 1PP8F 3HAEA 1X58A 3FXJA 4JFEA 3ARDA 1MH4A 4YFXF 4M3FA 1HSAA 3NFNA 2BBYA 3HOTA 5E1WA 3MR9A 4PGHA 3GMEA 4G6QA 1O7FA 3DFGA 3ZMUA 2AV7A 5D2LA 1LFPA 3MRKA 3QPSA 1WGXA 3H9SA 2LOOA 5DTDA 5D6FA 2BEOA 3S16J 1T7YA 2FE3A 2M4KA 5LLQA 3S2WA 4I48A 3FBIB 4E4HA 5IB3A 1I1GA 1PVEA 2GQQA 4CCNA 5L2JA 5KVRA 2E19A 3CMMA 1Z7LA 5TJJA 3F22A 2HQNA 4E6KG 1TT0A 5F04A 3B6CA 5IM7A 1ONQA 3LSKA 1WJBA 1T2KA 4JRYA 1MJ9A 3H9GA 4AC0A 2Q2EA 3V4GA 3VPRA 4BS9A 3D25A 4WXHA 4PR5A 1N77A 2RQQA 5DCFA 3FX3A 2L7MP 1S7EA 3ZQ7A 1LKXA 4GYIA 1P6RA 4IRIA 1R5ID 4JO8A 3Q9VA 2XUBA 3OXRA 4PGDA 2M8EA 4B44A 3TN0A 4E0RA 2DW4A 2ZJRF 4HSRA 3QEQA 4F7ZA 3OIOA 3MKLA 1GZPA 3O9WA 4M73A 2BGCA 2QYOA 3RZDJ 1QO0D 1TWFJ 2ACJA 3HG1A 3KZIC 5D7LA 4A0ZA 1UCRA 9ANTA 4PSWA 3QPHA 4A3DJ 2AK4A 2Z1DA 4U1LA 5IY5H 2LKXA 2XPGA 3EQLF 1KTLA 3MRBA 1LJ9A 1BIIA 2F5DA 4MNUA 5EF6A 3KZYA 1FMWA 4JBAA 1F9NA 2HJKA 3M8EA 5EEGA 2R4GA 4U1SA 2NS8A 3ECHA 2LK2A 1YITI 3O3BA 1FOYA 4NQDA 4ITVA 1G3TA 4LD5A 4ZYDA 2BHYA 4RGRA 2K9QA 1YO5C 3D3VA 3RL1A 2KT0A 2PMZN 2HOTA 1YJ9I 2A83A 3BJAA 2G7UA 5BS6A 3MMYB 3U2RA 3PQYA 2JA5J 5FJ8J 1LK2A 2JVHA 4QRRA 3BTLA 3SYTA 5CVJA 3LA7A 5C0GA 1TNSA 3H5NA 5F1JA 3A4CA 2DA6A 4ZYAA 4PJEA 1VTNC 2QENA 3JTHA 1Z3XA 3ZQGA 1IV6A 1T0MA 1T22A 1Y0UA 4IRHA 3T0YA 1Y1VJ 5EO1A 4PJMA 1VQMI 4IRGA 4WU5A 4D7NA 1T33A 4EGYA 1FIPA 2VI6A 4BBSJ 1UJ8A 3TO4A 1VQOI 3X12A 3SEQA 4LK1F 3FBNB 2OAZA 4YIIA 1I5ZA 3V7SA 3HB9A 1HKTA 2DFFA 5IT3A 3LN5A 1RK1A 3GZNB 3M7GA 3WE3A 4PK4A 1A6QA 2EB7A 2OI9A 1GUUA 1P7QA 3PJRA 3RWDA 2OD5A 4WX9A 2UXXA 1GV2A 1ETWA 1O57A 3DKYA 4BGDA 3BT9A 5JFRA 5L3FA 1FZJA 1IUYA 1DPRA 2DMQA 3DU5A 1IXRC 2XRLA 2LBFB 3WE2A 1NK3P 4CGZA 3QFDA 4U1NA 4BHPA 2H94A 2M7BA 2Y30A 1O3TA 3E6HA 5BJTA 2UXNA 3J80Z 3KEOA 2KJCA 4XORA 3RUGA 3TZVC 2RVCA 3ZQHA 1L8JA 2LRDA 1R7JA 3CVHA 2M9HA 3OX8A 3COAC 1BR1A 2Y75A 2HQ5A 4X0GA 2K02A 3MKYB 1FMVA 4U1IA 2FIKA 3PL8A 4NQCA 3KP3A 2GWRA 3MD2A 1GHCA 4PRDA 4OMYA 3D0SA 5FRMA 4CICA 2LSOA 4EM0B 3I59B 3PFYA 4G9YA 2DT5A 2E7XA 3P9CA 1P92A 1V55H 1FSEA 2GUOA 1FFNA 4EUPA 4PGGA 4E7LA 2VN2A 3OYLA 3C3WA 2R7RA 2EFWA 4BNCA 3E5UA 1IF1A 2B9SA 1JPFA 3FT3A 3BG9A 1ZG5A 2VOPA 5HS9A 4MQ7A 3K2AA 1LD9A 2XF6A 3RSNA 4BEHA 1I6HJ 3E6MA 3CUQA 3DTEA 1WJCA 5LBQA 1LPQA 3FQXA 3O3AA 2QQ8A 2KZVA 3PO3J 4RAGA 3KLAA 2OC6A 3LAJA 3TBIA 1BZ9A 4QOKA 3K4JA 1G59A 3W0WA 3K69A 1QGPA 1A35A 2R7SA 3VFVA 4PDKA 1PQZA 4RB0A 1BA5A 2D1HA 3TDUC 1FOWA 1W7PB 4HQMA 1ZYRF 4WXCA 4XLEA 1ZREA 2VXDA 3I64A 1E2XA 5ERIA 4AVPA 4EGZA 3MYJA 3LFUA 2M3AA 3NWSA 3HRSA 4CDGA 2KRFA 3I59A 4PJLA 4A6DA 4HUUA 4PP8C 3WS3A 5FB2A 4ZDOA 1IN7A 1AGCA 3M17A 2ME0A 4IJAA 3CLOA 4S0HB 2JUGA 4NC8A 3W2VA 3F8NA 4EM2A 2XF5A 2O5NA 4U1MA 5LGUA 2ID3A 4CYDA 4E7SA 1A5JA 3H3ZA 3QULA 5JHFA 4XNFA 4C2TA 2VKHA 3VFUA 4NQWB 2HS5A 3E5QA 3ML6A 4N9IA 1R9TJ 2CLZA 3TO7A 4I2OA 2E1OA 3DBXA 4V3DB 2Q1ZB 2EV0A 4FT8A 1T7ZA 1ZGAA 3FXLA 5DUKA 1T6SA 3KYLA 3D18A 3FQWA 4NQEA 3KX2A 3DBRB 3TDZC 2A5YB 3GTGJ 3K4KA 2R7ZJ 4DZPA 4JFDA 3RTQA 3GMQA 1B1BA 3HKZA 2XSDC 1AHDP 1Y6IA 1H8AC 1HA8A 2A3SA 2K5CA 3F8BA 2IBDA 2PQ8A 3OYGA 1FJLA 1TVHA 5HDKA 3L1PA 2X9DA 2QQAA 1UHSA 1W7PA 1OCRH 2ZFWA 1STZA 2UWMA 4ZTJA 1XSDA 4MHGA 1EH6A 2P5VA 1WI3A 5E1XA 4RS8A 3OOPA 2DFIA 3GJFA 2VLAA 2FNPA 2HTSA 1UFMA 1O3RA 1JUPA 5F64A 2E2HJ 2EFQA 3H36A 2JPCA 2R0QC 4J19A 1R23A 3JW4A 3VEPA 2K86A 3WTZA 3J80K 4IO9F 1DPUA 3HOYJ 4G59A 4UQ2A 4PV8A 1EKEA 3M1BA 3BDDA 4B1RA 4XBFA 4AD9A 3KPMA 5KK1A 1MIJA 1F1ZA 1T7WA 1I7RA 2K4JA 3L00A 1YFHA 4X6AJ 3QOPA 2DOFA 3QZWA 2DYSH 1OGTA 4IXAA 4OINF 1OCPA 2HGCA 3FISA 4O2CA 1RETA 5FKLA 5M5YJ 4BACA 1Z21A 1SAUA 2C7UA 4EVIA 1H88C 3GZ5A 3CPLA 5EUOA 3VXRA 1G3SA 2F5FA 4F92B 2RAEA 4MQVA 3Q0UA 1YLFA 3VSKA 1FNNA 1IRFA 5J3LA 2GXAA 4WU7A 3ELKA 2GAUA 1JKPC 3ILPA 4FE7A 3LKNA 3MRRA 3BTJA 3PUFA 4XLNF 5EG0A 4HZFA 4J01A 1YN6A 2VOOA 5BOXA 3PWVA 2HPMA 1IG7A 4ZC3A 3DPLC 1UZCA 1WQ2A 2QM3A 1W0WA 2ZXHA 5E1ZB 1B0RA 2XPWA 2CW0F 1O3QA 1N5AA 2F74A 5GADJ 1QSFA 1IRGA 3CC5A 2BYVE 1SYSA 2MABA 1U5TB 2VL8A 3DEWA 1HHIA 1HHGA 4XLHA 4X6FA 4YG2F 1ZTRA 3KPQA 1IO2A 3HOZJ 5IYBJ 4BKXA 1AKJA 3PSIA 3QODA 4L9VA 4ESBA 1CE6A 2DXIA 4AVZA 5D5WB 4M74A 2DQLA 1OCZH 3KEYA 2VASA 3ASNH 3ZQFA 2QCOA 3RKXA 1I1SA 5IROA 1T1ZA 2KQRA 3K70C 3RCOA 2WADA 4NHUE 4UVAA 4N4NB 5INCA 3QQ3A 2H6CA 2LYCA 4L4TA 3W2AA 1H0MA 4U7DA 2VABA 5J8CA 1X3WB 4CYCA 3JRFA 5C09A 3JTGA 3WTWC 2VAAA 4MX7A 1TQMA 2V6CA 2FYYA 2OA4A 4ZUSA 4KITB 3MN2A 1EFXA 2BV6A 1XMXA 3CDGA 2WTEA 1S7VA 2QSFX 5LRSA 4ON0A 4KA4A 2F4MB 1WVRA 2GJ6A 4NNYA 4UV9A 1S7QA 3G71I 2Z33A 3OYCA 4ELMA 3CF5F 1E3HA 2L5QA 4RBOA 3VFOA 4IL6C 2JPBA 3K6GA 5K7ZA 1KA8A 2R7VA 3L3IA 2E7LE 2XAGA 2LNBA 4GUPA 2VBYA 4OMZA 2F5CA 3EUAA 4Y13A 1W4MA 2LREA 3BEWA 4G6TB 1Z9CA 5ED4A 5DEQA 1JKOC 2M45A 3SJVA 3CCJI 3BQYA 2ZB9A 3KP5A 1OR7A 1NH3A 2WB1A 3E6FA 1BR2A 4Y7NJ 4XM3A 1ZG1A 1K7AA 3GTKJ 1BIAA 3HG9A 2ETHA 2MLGA 3KP7A 4XMYA 2ESNA 3ABMH 4PCQA 3TBYA 2X51A 4X6EA 2QGUA 5F27A 5DUIA 1RJYA 1WI9A 3BY6A 1VQNI 2GA1A 5DYMA 3CCSI 4HF1A 2J5PA 2ZNZA 1C0WA 3VFSA 3CMEI 1MZBA 1Y1WJ 3CC2I 4APQA 3IC7A 2RQPA 4DYCA 1IN5A 4IHVA 2DYRH 5IT9K 4ANJA 4A6EA 2V2XA 4G7ZF 2CLRA 4PREA 2IGKA 1S8DA 1JE6A 4FE4A 2N8GA 3LL7A 4EN3C 4KNYA 3L7WA 3VXNA 4PFOA 1Y56A 1FZPB 4QRTA 4XR6A 3I6LD 3EUHA 2EIMH 3ESWB 3IWZA 3MKZA 1QU3A 3GSWA 3V5DA 1LP9A 1K8DA 3D39A 2E71A 5DCMA 2LH9A 3ZGKA 2CFXA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 2BVQA 4AIDA 4HYEA 4CXFA 5J1YA 1HCRA 1S7SA 4XLPF 5MENA 3LQQA 3GW2A 2L02A 3VRIA 3VYUB 1EXUA 4GO1A 5LD2C 3TO6A 2K9MA 1OYIA 2L54A 1JJ6C 2LKSA 2OCCH 2ESHA 2ZXIA 4B09A 1FLIA 3MRJA 1ACIA 1ZT7A 2Z9OA 2ISZA 2YR2A 3TA3A 1T08B 4UNOA 2LFBA 2WAQN 3OWTA 2ID6A 4CCJA 4A3EJ 4IOAF 3IT8D 2HXIA 2EZKA 1MBJA 4NB5A 3HTSB 1YRNA 1WJDA 3LNQA 1MHEA 3F0CA 3SCMA 1LQ1A 2F53A 3E5XA 3WL9A 2COBA 4Z6YA 3QUZA 5J1AA 5KAIC 3WTUC 5E3OA 1NEZA 1M1EB 2ECCA 2IGMA 1QBJA 1XGSA 3RWGA 3V8LA 2ZJQF 1XC5A 2WY3A 1YW7A 5J47A 2LVSA 3GBGA 3SDDA 4HX7A 4C9YA 4ZDLA 1G4DA 4CW1A 3VWKA 1APLC 1RI7A 2CUJA 3M07A 4PGBA 4LLLA 4HUXA 3T5XA 3U0PA 2F6CA 5JLWA 4KIGA 3GSVA 5FD5A 5FKOA 4NO5A 2GXGA 3VOEA 5D9SA 3KP6A 5GAGJ 3WHCA 4L8CA 2IRFG 4PDCE 2BVMA 2V1DA 4UUTA 1DU6A 3ES6A 3P4NA 2WV1A 2DODA 3P77A 3HSEA 2FU4A 2MC3A 5FLXZ 3MZHA 4U0YA 2HZTA 2JSCA 1MBHA 5ICFA 3CCQI 2UWEA 4U6YA 3VFRA 4CHUA 5HGBA 1W36C 1FYLA 2Q7YA 1YQAA 4IQ4A 4YELA 1ZSDA 3S6CA 2DLLA 1T0FC 4YFNF 2IGNA 2TDXA 1QRNA 5E8GA 1MHCA 1QVOA 3VCLA 2M8GX 2FWOA 2YPKA 3ZP5A 5BS0A 3CUOA 4XKVA 5D6EA 5DM6F 3OMYA 4RAZA 4R1HA 2RC4A 1S5LC 4HX4A 3W3CA 5A2QZ 1K83J 4UUSB 1VI0A 3GFIA 3RWJA 2DOAA 1LEBA 2K9SA 1XPXA 1P4XA 1FP1D 2CV2A 2GT9A 1OKRA 2VBXA 3I4MJ 3H5AA 3OV6A 3WTSC 3ZPLA 3O8HA 2F4IA 5FFXA 3G2BA 3IL2A 3CO7C 1I1FA 4KYWA 2E34A 1ZHNA 3ZOBA 2B63J 3OL3A 3BZFA 3HSRA 3NQOA 4Y17A 2D5VA 3ARGA 4M72A 3FKJA 2W48A 2JVGA 4ZTFA 2E1CA 1LEAA 4XXCA 3QDJA 4MTDA 4Q48A 1JKQC 1ZVSA 2KIQA 3UTQA 3U1DA 1KYZA 4Y52J 1BI3A 3GMPA 1KGSA 3SJMA 2A6HF 3BR0A 1JT6A 2HQRA 3E6DA 3P7NA 3I4PA 1QLFA 3HOXJ 2E2JJ 2JUCA 2VLJA 5HHOA 2KIMA 2WY7Q 5FO5A 3QUXA 4HW0A 2K85A 2A6TA 3DKWA 1UB9A 2M4GA 3HPGA 3K7AJ 5L3BA 5B38A 1HSJA 3OYDA 3BZ6A 3GLXA 5ICEA 1FSHA 5EU3A 1JHFA 1ZK8A 3JRBA 2EFOA 5ACZA 1INQA 2OL3H 3QRFF 4H0EA 1X1DA 1G6NA 3EDPA 2DN0A 5CJ9A 5K5QA 4GYGA 2JRMA 1W5SA 2RV8A 4II3A 2MC4A 2L9SA 4A3BJ 2XVCA 3HRTA 2NVQJ 1MNMC 2CJJA 5ILUA 2EK5A 3MV7A 2CQ7A 5B5EC 1D1AA 4NC6A 2BY3A 2VBZA 4D0BA 3PWJA 2HYFA 2HXOA 1OCCH 3LOCA 5EU5A 4G94A 2MH2A 2J5OA 2VE9A 4CSWA 2DMPA 6PAXA 1VQPI 3SDBA 1BD2A 3VXPA 5D8KB 1IM9A 3VXSA 2AV1A 3B6SA 1EJ9A 2CV0A 2EA4A 3GMRA 4F7MA 3LSIA 3FXUA 3IRRA 3TJHA 4L5JA 4PJ5A 1MNDA 4D5FA 4IHSA 2CFOA 3FOLA 1S7AA 3LKPA 4Y4HA 3R4KA 2XKOA 1N78A 3UKGA 1O4XA 4AYBN 4CUGA 1ZQ3P 1KJVA 5D7IA 5IB5A 1MBGA 5HDGA 2VONA 4U6XA 2P5KA 2Y2ZA 3RWHA 2RNJA 2KRHA 3BOQA 3DBLB 3UTTA 1KPVA 2VJJA 2WWYA 3KYCB 3VWJA 1LE8A 3F9KA 1WRJA 3K4MA 2BNQA 2K4BA 3I71A 3HHGA 2BVLA 4W97A 2V2WA 4GCVA 1B6AA 1IRXA 1YS6A 2A05A 3LSPA 2JJ7A 4Y16A 4RB1A 1WH5A 3O8GA 3ROLA 4X6CA 3E6BA 4G43A 2E5ZA 3HUJA 2NNNA 3GWZA 4MXQA 4E7KA 3VXUA 1RKWA 1SD6A 2CMPA 1DDHA 4LIVA 3OSGA 5E20A 5CPRB 2AXLA 5HNFA 5D5UB 5H2FC 1U8BA 5L3DA 1V5GA 1YX3A 2HPIA 3RYRA 2L9RA 4Z2YA 1Y8RB 2W1OA 1HHJA 3SZPA 2HLAA 2TRTA 3QUYA 1Y0NA 3S14J 3T8XA 4D0PA 2X85A 2W25A 2OJED 3N05A 3F8MA 1R22A 1JFMA 4NDLA 3AREA 4ENMA 2LC2A 3LV3A 4A93J 4ASNA 1VQ7I 3MRLA 4KIBA 2FZ3A 1G8XA 1QR1A 1EV7A 1PDNC 3AG1H 1N3NA 1X3ZB 3L2QA 2HTJA 4UVBA 5IB4A 3KPHA 3OYMA 4L8BA 3VB2A 2VBWA 1ZGWA 4Y4FA 3VFPA 3CJQB 4PJAA 5F9JA 1IW7F 2E36A 2OTLI 4BUPA 2CIKA 3WGGA 3I56I 3M3YJ 1XCVA 4PJ0C 2XSJC 3GO5A 1QPMA 3EPZA 3GZ6A 4PRNA 4ZFZA 3BQZA 3BZEA 1E17A 5GTHC 3EUHC 2PLYA 2LDUA 4DIQA 5ICGA 4I4WA 4EM1A 5CVUA 2ZMEA 5K7HA 4XONA 1TL8A 3RQ4A 2Z99A 3GUDA 1I50J 2HVQA 5EU6A 1SVLA 2BZTA 3T8RA 1FO0H 1POGA 5BRZA 2HU9A 3FDYA 3REOA 3SKMA 4E5XA 1W72A 1BI1A 3TVMA 2YU3A 5A2QK 2ZO4A 3E3VA 2CU7A 3H92A 3CMYA 1WHUA 4OAYA 1TQPA 3FXKA 2FO4A 4JQXA 1QZZA 5K1YA 1JGDA 3ISPA 4JYKA 2O6GE 2X6WA 2VODA 2XAFA 1TMCA 5E6IC 2IJLA 1FWZA 2DYPA 1OYWA 4DGWB 3GLLA 2MGQA 2W7NA 3OSFA 2MG4A 2P8TA 2ME6A 3VYSB 2OPTA 1MDMB 3FXOA 4PZJA 3T8TA 1JJ8C 1G7PA 2LY1A 3KXFA 3HIFA 2Q0OA 2HOAA 1I27A 5CQGA 1Z67A 1ZRDA 2TCTA 1KZHA 5HHQA 2HEOA 4MS8A 5EOTA 3IP4B 3HHHA 2EBIA 1DGRM 3LQRA 3AG4H 4HNUA 4X6DA 2LLKA 1D1CA 3GTJJ 5FKPA 2OF7A 2NVXJ 2P0WA 3WG7H 5C08A 3LKOA 3S93A 2XASA 2PN6A 2XIGA 3GTMJ 2AHQA 2DT7B 3RYPA 1WJFA 4XOTA 4JX6A 3FMQA 2X4TA 3FMRA 1IRZA 3HBLA 1J2XA 2R5ZA 2KJBA 1YIJI 2F48A 4A5NA 4UXNA 4X1EA 4KUMA 2DDBA 4CCLA 2HI3A 2PO6A 2O61A 1S7WA 1D8KA 4N8VA 4BYYA 5LEJA 2BE5F 1UG2A 2LTPA 2IPQX 2EQRA 2HJLA 4G6DA 3A01A 2EINH 1S7UA 5CYVA 4MEXF 2DPDA 2OBPA 1DUZA 3E3QA 1UQSA 2NYXA 2CS3A 4IKFA 1M6OA 3KCCA 5B1BH 3BJ6A 3ERED 1WH7A 1XH3A 4R79A 1FC3A 4N0CA 4ZZLA 4A3GJ 3GEZA 4I98B 2D1VA 3WTYC 1WSUA 5F7DA 3DTKA 5BPIA 4Y15A 5C0DA 1VNDA 1YW9A 3K4CA 4DYQA 5FKKA 3ECBA 5DDHA 2PG4A 3DF8A 2WAFA 2EV6A 4EJWA 3CCUI 4F93B 5D2NA 3B6AA 2QQ9A 3FKIJ 4WDIA 3SDGA 2PBIA 2A5WA 1QEWA 4WXDA 1F4KA 1XR8A 1D3YA 3AFHA 4JX4A 4CVXA 3DXJF 1KBGH 4QRQA 3W39A 1MH3A 3QYFA 5CVRA 5HLHA 2BVOA 1S3JA 1Q94A 1GVDA 1YRNB 1PJRA 2DCEA 4BU2A 1VGKA 1YPZA 4ZUVA 4AIKA 1JPGA 3K1PA 2LP0A 1ZS8A 3Q9SA 3QUKA 3BR3A 2GBYA 2KPMA 2WAQA 3EETA 3FQUA 4NO0A 3GVAA 4GFBA 3JVGA 3ERYA 1R58A 3UR3C 3TO9A 3FT4A 3WLBA 1J09A 4ZYGA 2NAZA 2OQGA 2DA4A 2CQXA 1A36A 1A04A 1UG0A 4DOZA 3OYNA 4KT6A 4DQ2A 2E5NA 3ULQB 5HVQC 5K7FA 2QQBA 2L9VA 2QKLB 3CZ6A 3D5RC 4LFUA 3G3ZA 3RKWA 1ZHBA 5C0BA 4IHWA 4L3CA 2EIKH 3QYBA 2O03A 5LEKA 1WBXA 1XR9A 3N97A 4KDPA 2HDWA 1CG9A 4K2EA 4I7HA 5GSVA 2DFEA 2V26A 3GF2A 4N0BA 2GM4A 3BCAA 2K9NA 1T1YA 1A1MA 3JRDA 3J81K 3F3XA 3HCVA 2VPRA 3FQNA 3C2BA 5EEAA 1H9GA 1R00A 3S8PA 3JRIA 2BY2A 3CP2A 2XGXA 2HQAA 2JA8J 3GTOJ 1YX5A 1W1WE 1DGWY 3QU3A 1KU2A 4BHBA 4HDUA 4HX8A 3BG3A 3SDCA 1HXDA 1NAMH 1OF2A 4TV7A 2DMTA 4F55A 4WO4A 2OCEA 1X4OA 1DU0A 1VQLI 1B4AA 3WTVC 1E27A 3HRUA 1Z6RA 1JGGA 3RZOJ 1B9NA 4V19K 3IH4A 4M3GA 3S1RJ 1HDDC 4DJAA 3DEUA 3UPRA 1HHKA 2K3PA 4HV5A 3M9AA 3WGIA 3E7LA 4A5MA 1TVBA 1SFKA 1H89C 2LF8A 4HS3A 3OYAA 2CQNA 2HDDA 4GKNA 1KU3A 5C4XJ 3CH1A 2F5EA 2P81A 4Y33A 1SFXA 1B9MA 3PSFA 4E7IA 1TTYA 1IC8A 2FRHA 3GSNH 3DKXA 4LB5A 1MDMA 1VQKI 5EZHA 5E17F 4L9JA 5EFIA 2YEZA 4Z76A 1IUFA 2FX0A 1A1OA 3BR6A 1GT0C 1V3FA 2ZOKA 2Y9ZA 4FX0A 4E7ZA 1IXCA 3FFCA 4JX5A 3TP3A 3F72A 3O3KA 2PYEA 1XTAA 4NBQA 2A69F 2BSTA 4MJ6A 1UHWA 2VLLA 4BQNA 1BI0A 4L3EA 2QF7A 2YX4A 3OS2A 2R3SA 4RM2A 1QA6A 5EGOB 2GAZA 3MREA 3HE7A 1MNEA 1QPIA 3HXLA 4L9NA 1TLHB 1R4MB 3RDIA 4RLQA 3CDLA 2FF4A 4ZAKA 1ZELA 3AAFA 3BR1A 4XQFA 4MEYF 4Q47A 3MWMA 2XFXA 4JFQA 3UTSA 5FROA 3JAMZ 4F91B 4IOCF 3ERMA 2R7QA 3HZJA 4ZYHA 3CMAI 3U21A 2R7DA 4B43A 1JXSA 2H8RA 2FMYA 3AL0B 2IS2A 4BL0B 4XSXF 4CH7A 1TW2A 2GA2A 3BVNA 3LN4A 4CCOA 2ZSWA 4QRUA 3V42A 3SFZA 4Y2DA 4HAMA 4PRIA 4RM3A 1T7VA 5MEOA 1R1VA 1ULYA 3BTIA 4XKBA 2VQHA 2VQLA 3RJPA 3CCVI 4RB2C 5FLXK 4M9SA 3A0HC 2JK3A 1R4NB 4O6JA 1WBZA 4PJBA 1CF7B 1RPWA 1UMQA 3ZQCA 5JI6A 1BI2A 3TP0A 2VB6A 5B3SH 1U3EM 1EH7A 1K78A 2CO5A 3D5SC 3TW6A 2JSPA 4OWRB 1YYVA 5F1RA 1PYVA 2Y48A 4PJ7A 3N4MA 4GXOA 3FHZA 3GMOA 3JAMK 3ZMZA 1RIOH 1K4SA 4NUBA 1SFUA 2ELHA 1JUSA 1R5HA 3SEZA 1EEYA 1JGSA 3BW9A 1Z3YA 2WV0A 4OIOF 3TBTA 2ELJA 4HRIA 1XSXA 1ON1A 3A02A 1XDSA 3HYIA 4HV6A 4XLAA 4EEFG 3HUGB 3BCBA 4M6VA 3F8FA 1R5GA 1RR8C 2MW8A 5L3GA 2A61A 4HOBA 1MBKA 4OIPF 2VJ4A 2ZBKA 3TGNA 5J1RA 2GTWA 5FDWA 2AQEA 2KLOA 4LMYA 2X4QA 3HLAA 5IEHA 3X2QH 1AGDA 4JP0A 2FOKA 2NVYJ 2XC7A 3OR1C 2HFHA 3SHFA 5E3MA 2HVSA 1UXWA 4WW2C 3PWPA 2QBYB 2QEXI 1KONA 2KIUA 2ZSIB 4D0CA 3VFMA 2ZKZA 1MMAA 1G6RH 4M3DA 5J40A 5EDNA 2P6SA 2XB5A 4PRBA 1SD4A 3UBXA 3OYKA 5FLVA 3MGTA 3ZQQA 1QVUA 4G59C 1NTCA 3S1MJ 5IYDJ 3L2CA 4IX7A 2ZSVA 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4P9FA 1JUMA 4L18B 3P5JA 3MKWB 1I3QJ 2L01A 4XRFA 2VPLA 3R0AA 5EJCA 3FOMA 3SPVA 4I76A 1B3JA 4LLGF 3I6GA 3OOUA 4XIDA 3BHBA 3P4OA 3HOUJ 4HA8A 3MZ8A 4HLYA 3C2HA 2D2WA 3K1MA 1BJZA 3CCLI 5ILVA 2FBKA 2GXBA 2UZKA 3NAUA 1AGBA 5C9JA 1BL0A 4EV0A 4HF0A 4CZCA 2Y0SA 5J4YA 3IKTA 4XRSA 4PJFA 4M6XA 3HPJA 1RJZA 3WTTC 2KHMA 5FD6A 3RKYA 3BP4A 3G08A 1MWAH 2D31A 3HUGA 4PV9A 2AXFA 3C18A 3JCUC 4Y4RA 3MA7A 5L2KA 1R1UA 1XS9A 1D0ZA 2CQQA 4RAFA 3DMMA 3JRCA 3NARA 3ZXSA 1BN5A 4UB6C 2X1CA 2DO7A 2KIFA 3GX4X 4D5CA 2RN7A 2H8WA 3PFIA 3UNGC 2W00A 2KKOA 4G8XA 5F1NA 3ZQLA 2VQGA 2AQFA 1ZN2A 1U58A 3BTCA 3RGVC 2M5WA 2P5LC 1DQUA 1X2MA 1ZT1A 2OTJI 1VFCA 5J4VA 4BE2A 1T38A 1PUFA 3KWWA 1QSEA 3D2UA 4F7PA 3QI9A 3S3NA 3K2ZA 1IDYA 4FCYA 1FZMA 3VXOA 1K61A 3I5UA 1NANH 4A2UA 2KP6A 3R60A 4C3IJ 5HODA 5TISC 3HPHA 1AWCA 4QPQA 3H9QA 1HSBA 2IA1A 1FZOA 3LSTA 3ABTA 2DBBA 3FQTA 1Y8QB 4IHOA 1MW7A 1WWXA 1YOVB 2QVOA 3ZMVA 2R7XA 3OL4A 3KEQA 2P5EA 1FYMA 4I6ZA 3KPNA 1O3SA 4MJIA 1A9BA 3OS0A 4MLOA 5FLMJ 1TQIA 3AL0C 4P1WA 2VXZA 3CTAA 1MD0A 4A3IJ 2CYYA 4PJNA 3W6JB 3RPUA 4DBRA 1I39A 2G0EA 3DCFA 3I53A 1L3LA 4S05A 1IV8A 3DPTA 5TGTA 3F21A 5E79C 2PEXA 3JREA 2OU2A 4H4KC 1WZ2A 5HLGA 5CKTA 1F36A 3CJRB 1VZ0A 2FUG2 2PI0A 4EJTA 2XPUA 2H27A 3MRIA 5C07A 3SDXA 2FBHA 2NRAC 2CRGA 3HL2A 1SYVA 5E18F 3BG6A 1JHTA 1FZKA 2X4PA 1T20A 1HQCA 2HYJA 1LVAA 3M8FA 5EG0B 2E7WA 5IPAA 2ZJ2A 5TRDA 2L7KA 2ZFUA 4XLCA 2X70A 1T0NA 2E1NA 3BGMA 3BH8A 2UV1A 3HGGA 1ITYA 2HN7A 2PMUA 3A01B 3ARFA 3LSJA 2CGPA 3BC8A 1MBEA 3P9MA 4UQ3A 3GFMA 5L3CA 1G2HA 3OYHA 3MV9A 4AUXA 2MYSA 1UAAA 1VQ9I 1SAXA 2DA1A 3VFZA 3K4LA 3CUQC 5AIQA 3MRCA 3JR9A 5C0FA 4PJHA 4KFCA 1OMIA 2W84A 3TOAA 1VQ6I 3DTIA 4NSKA 3CDHA 4ZDPA 2FBIA 3QQ4A 1QQDA 4G9FA 2DAOA 1J9IA 2H6BA 1IJWC 2LR8A 5FA4A 2AO9A 2XGCA 3TF7A 1ENHA 3BR5A 3MRHA 4D7MA 1MSEC 5KHDA 3RZCA 2F2EA 2DA5A 5E8IA 2DFHA 4U1HA 2STWA 4XKCA 1LDKB 4HNTA 1B59A 1EEZA 1XDUA 1HOCA 2XGEA 4KJZA 5JVGF 1UXSA 2O8KA 5J6GA 2NS0A 4EJVA 1J5YA 1OCOH 5LHGA 2GOMA 4CO8A 4DZJA 3LKQA 2DMUA 1W5CC 1ED3A 3J7YJ 3OYEA 4IRJA 4MO7A 3KLNA 4XN0A 1ETOA 4Y3OA 4N0UA 3I55I 4WUUA 3LSMA 3G4SI 3PUBA 2O0YA 1S9XA 1T1WA 4GRIA 1HC8A 2VT3A 4MTEA 1VQ8I 4IRSA 4U88A 1SMTA 1BBYA 1ETYA 4FQGA 2BHZA 1GLNA 4XLFA 2BXYA 2CQKA 1S72I 2AS5F 4KIFA 2CV1A 4JFPA 2X4RA 4OAZA 4KT5C 4NQWA 1ZT4A 4DW6A 1GV5A 2L0KA 3IH3A 4WCGA 4XOPA 3V7CA 3V8JA 5SWSA 3VFNA 2BW3B 2KDZA 4NQXA 1AO7A 3H1CA 3I54A 4P55A 3S3OA 2XAJA 2XRNA 1MSFC 5IB2A 1BR4A 2LY9A 4A12A 1N59A 4L4VA 1BM9A 1HDPA 2DJNA 1I3AA 2K7LA 4BE1A 1YJNI 2MA3A 1EF4A 3IXAA 3TFKA 5GP9A 1YJWI 1BOBA 2GIZA 2MD5A 2WAEA 2DK5A 4MQ9F 2L3DA 5CLSA 5GPAA 1B8IA 5MEPA 4A3KJ 2XAUA 1XGOA 1H9TA 4A3CJ 1X4PA 1TWCJ 2O5RA 3CD6I 2IA2A 2H1LA 1IGNA 1J0RA 1LVKA 3FF5A 1HLVA 3CCMI 2VE8A 4EMSA 5HGAA 1NG6A 4N5EA 4I0AA 1TBXA 2E2IJ 2W85A 2WA0A 1OR7C 2VIXA 4KISA 1YDPA 1DDNA 1XB4A 3PWNA 4B3XA 1I1YA 3X13A 3H7BA 3ASOH 3C9NA 3RWIA 4UHTA 4BJ5C 1RUOA 1GDTA 1ZKGA 5D4RA 3KETA 1FTTA 2X4NA 1USSA 3P9KA 2FNAA 5IT9Z 5J1UA 3OV8A 4A69C 2P4WA 1VACA 1N75A 4BXFA 5C4JJ 1RKTA 1KQ9A 3KZZA 4NNJA 1N25A 2DDAA 2NS7A 3MFKA 1A1NA 3DXAA 4DBQA 5HDNA 2MHAA 2QUFA 3H3VK 3BPVA 3QDMA 2Y9YA 4MJ5A 1V5FA 2DTZA 3DBHB 1T56A 2A68F 2WBMA 3K10A 1FOXA 1ZRFA 3CZFA 3ABUA 1PUFB 3IRQA 1MMSA 4PFPA 3EYYA 3HDDA 4HSTA 3PABA 1DUXC 3O6BB 3ILQC 4LCWA 3QAHA 2V1UA 3I6KA 3MRFA 1KPRA 2RDPA 2GOXB 2R7OA 3HGYA 4P5OA 2K27A 1S8NA 5GTIC 3BP7A 4NNXA 4S0UC 1K4TA 4AU7A 4Z78A 1Z91A 3CUQB 4AIJA 2L2OA 1XD7A 5D5MA 3VJ6A 3T1FA 4O3MA 3TIEA 2E60A 4XKWA 5MERA 3PWUA 3DPUA 4O2EA 3HSFA 5M5WJ 1XG1A 2BVPA 4U87A 3BO8A 3TPUE 3H9JA 4BXXJ 3H35A 3KP2A 4ETSA 4BKWA 4BJTA 4A3MJ 4OOIA 2I8DA 2F5VA 2OV7A 3KP4A 2HZDA 4AWXB 3IV5A 4WWKC 1OFCX 5JHDA 4RA2A 4UB8C 4PGEA 1LNWA 2OZUA 3F23A 1UELB 2IA0A 2ZXJA 4U7BA 3GSOA 3SZTA 4DNCA 2IS4A 4BEHB 1AA7A 3BWGA 4M9ZA 4A3LJ 5LRRA 1T0FA 4AYBA 2MBFA 5C3EJ 3GTLJ 1G3WA 2R7FA 3QWLA 2NVUB 3GMMA 3C7JA 3R61A 3LKSA 3V5HA 5DD4A 2H6PA 2JCCA 3G73A 1LEKA 4PJCA 1XGMA 2EA2A 2Z2SB 1AOYA 4K7FA 3ONQA 3KPRA 1XX5A 3A1YA 3H0GJ 2IW5A 2HOSA 3GIVA 1XSVA 2IP2A 2W4SA 3E1SA 5K5RA 3DWLE 1S7RA 5EYRA 1SANA 3QOEA 4QTRA 3GSUA 1HHHA 1ZG3A 4A0XA 2E1MC 4HDVA 3FM5A 4LCCC 1LB2A 1TW3A 2X6OA 1AKHB 4K71B 4S04A 4KMUX 5IYCJ 3REWA 1ONVA 3G1OA 1VF9A 4CVZA 3QFJA 1MGTA 3FIWA 1ZAGA 4M71A 4HQEA 1Z5LA 2O7OA 3AM8A 2VE6A 4PGCA 2X4OA 3VRJA 3QPLA 4C3HJ 1QVTA 3RKQA 4KN4X 5F0HA 2VUMJ 1HKQA 1MMNA 4R8HA 4IHXA 3DX7A 5HS8A 3KPLA 2L4AA 4C2UA 5D5XB 1A31A 3U9GA 2LD5A 2X1DA 4B3AA 1WJAA 2XF7A 3HE6A 1BW6A 1I4FA 1Z05A 2LMDA 4LG0B 2YS9A 3O3EA 1JKRC 3X11A 1IAWA 1I7UA 4QIWN 3MRDA 2LBFA 4PRAA 3ZMSA 1LEGA 1I6XA 2R7UA 3JRAA 1JGEA 1LDJA 2IS6A 4LHUA 5EU4A 3A0BC 3OXSA 5HYJA 1X19A 1NK2P 3DEEA 2ZOLA 4HWZA 4KMFA 1W7PD 1QNTA 2EILH 3RPQA 3DV8A 2CWEA 3PNYA 2FEZA 4M3BA 4FASD 3KFWX 2R5YB 2JQ7A 5M5XJ 3B3IA 4PJIA 5DDGA 4YIRX 5C0EA 1AKHA 3FK7A 1X1CA 1LDDA 1S7TA 3SZGA 2XPVA 3L2UA 3G6EI 4RMNA 4D9JA 4F7EA 3FONA 1U2WA 1OSZA 4ZH4F 1A6IA 3E6CC 2KISA 4G7OF 2AXGA 1ZHFA 4M3EA 2R7WA 4RGXA 2QKMB 5SWQA 5H94A 2JA2A 4M9XA 4NC7A 5DV5A 2UUZA 2NXNB 5BPDA 2J8UA 5E00A 5KAFC 1QHHD 1U9OA 3HOWJ 1ETXA 3BZCA 3BH9A 3FM3A 2DA7A 5HHNA 5INDA 2MSYA 1FG2A 2V1NA 1XMAA 2XB0X 1Q1VA 3F8CA 3JTSA 5FFZA 3CC4I 1JUFA 1G3YA 4LG0A 2PFBA 2BXZA 4A3FJ 4WJ5A 1OJLA 2BY1A 2JT1A 3L2WA 4U0WA 1BQHA 4MFDA 3PQJA 1JHHA 5K5OA 3DLLF 3RPUD 1WKMA 2PMHA 2QSHX 4HKJA 5E8OA 4ZJZA 1MBFA 4OIQF 5LHIA 2VKVA 3FXRA 3ZN1A 2MLKA 5LHHA 4NO3A 5ICCA 2V9PA 3IKVA 2XAQA 2R92J 4MVBA 4E7JA 5FGMA 2GLOA 3FHNA 3MAJA 4J00A 1JTYA 3ABKH 1X1AA 2Z16A 3BWAA 1DP7P 3I3LA 4PRPA 2KMUA 4Y4KA 1I1AA 2XROA 2OUMA 4LK0F 2KZGA 4U1KA 2M30A 3E97A 4BAYA 3CP8A 2GTZA 4G8IA 3SDAA 2P7VB 5D7JC 1VADA 1DUYA 2V9VA 3HOSA 2EFPA 1AU7A 1X3UA 3GTQJ 5F6FA 3BZKA 1FYKA 4L0YB 3GTPJ 4QPOA 3JTCA 2W82A 1T7XA 4RB3C 5B39A 1TC3C 5L3EA 2P7CB 1IXSB 1SD5A 4BXUA 5IVXA 1QZEA 2VC0A 1QRYA 2EIJH 1TWHJ 4PSXA 3RQIA 5D8LB 4UUSA 3E0JB 5M3FJ 4IPAA 1X7QA 4N0FA 2O9LA 5FKNA 1W0TA 1KPUA 1S9WA 3FT2A 4M6YA 1U0JA 3PWLA 5LGTA 4FETA 3KYNA 1DP3A 5LGNA 2B0LA 3T1BA 2KFDA 4ABZA 4ESJA 1D1BA 2NX5A 1PP7U 5DEGA 3OIQA 2PJPA 1N2RA 1HW5A 2ZNYA 2L4MA 3TBWA 2VJIA 3FWEA 5CVIA 3KE2A 3EYIA 3GMNA 2PMZA 2G9WA 5E3LA 1YI2I 3ABLH 3OS1A 3OR2C 2XKPA 4HPQA 4OIRF 4F3QA 1OCTC 3TO2A 2WY8Q 1YW8A 2VJ5A 4ESFA 2DPUA 3ZCOA 3SQNA 2KL4A 3E2HA 1QZYA 1S9HA 1Z6TA 3DU6A 3O2PE 4O5VA 2CW8A 4LJZF 4EI5A 1O7LA 3FZVA 2L7ZA 5D4SA 2V6EA 3ZR8X 1MJAA 1Z1DA 2VQCA 5EEHA 3GMLA 4G12A 4QSHA 4II2A 2Z3YA 2C6YA 3OYFA 3TL4X 1SFEA 4GGGA 2ZSHB 1FBUA 1R36A 2E35A 2V1XA 2YSRA 1FIAA 4C30A 1ZHKA 3S1NJ 3TIDA 2ISYA 4V2GA 1ZARA 4PJGA 3A03A 1DE4A 5CQEA 1KJ2H 4I0BA 1XZ0A 1Q1HA 1I7TA 2CUFA 3L2RA 2EV5A 2HYGD 3BG7A 4I01A 5J6XA 2AKRA 5KCMA 1BJAA 2JRTA 1LQVA 3TQNA 3SKOA 2DI3A 2YUSA 2OQRA 3HOVJ 3BJOA 1CD1A 3CESA 1SMYF 4L5EA 4ENJA 1RUNA 2CKBH 3ZQIA 5F1IA 2O3FA 4PJDA 1FP2A 3S3MA 4NT6A 1LDPH 3WU1B 3L3KA 3HC7A 1K5NA 4JRXA 1YE9A 4F7CA 1P7JA 4UVCA 1K6OA 2F54A 2ICWG 2LKPA 1ETQA 3BPXA 3WODF 1FT9A 2V9KA 5IP6A 3HJEA 1F43A 5C0CA 3JTTA 2RKHA 1FOKA 4JFFA 3J7ZI 4CCKA 3CQZJ 4LB6B 2PX9A 5AIPA 1D5YA 5IB1A 1OQYA 1KU9A 2VLKA 5JVTA 1U8RA 4LCYA 1WPKA 3P73A 3ROOA 2Y0MA 2F4OB 3B02A 1MI5A 2ZMEB 1ON2A 5AD0A 5M3MJ 3OY9A 4MGRA 3TEDA 5E8PA 3BUYA 2IVMA 4HG2A 1KJ3H 5H20A 2L7FP 1WFXA 2OZ6A 3ECOA 3MV8A 3WS6A 1FBQA 5H6RA 4C3JJ 5GSRA 1Z0XA 4E7HA 4UUVA 1KQ8A 1X2NA 2XAHA 1Z7UA 1OYYA 4FISA 2A6EF 1B0GA 1VQ5I 1YG2A 5AONA 4IQJA 3CCYA 4B4CA 2JWTA 4LG3A 2K3FA 1HYRC 2RREA 1ETVA 3FQRA 2KRCA 4EJOA 2DK8A 2KDOA 1QHGA 5EGOA 3OYIA 1J59A 5FA3A 4PUSA 3V7RA 3KPPA 3CDIA 5C44J 3MQ0A 2BOLA 3QPTA 5H6QA 4FFEX 3VSLA 5GAHJ 3GXOA 3JRHA 2V7FA 5IOYA 3M1CA 3Q5FA 3IHUA 3L3DA 1YS7A 2NOJB 3IH2A 4EQQA 3CJNA 3PNTA 2W24A 4HEA2 3RI4A 4FHTA 4XK4A 1ZGJA 3WU0A 4G42A 3RWFA 1ZR2A 3C2GA 3KYDB 4PJJA 5F0FA 1SEUA 1YN7A 2DU9A 2K40A 2VLRA 2ZC2A 3GSQA 4QRPA 2Z5UA 3G1MA 4Z77A 1SVMA 3C8KA 4Q4ZF 2EWNA 3LFKA 3GFLA 1BIBA 3I9V2 3K4BA 3K70D 1TWGJ 3L2VA 4G8GA 3BEVA 3O8XA 3H9HA 1T98A 4PRHA 3VODA 3TMOA 4YIFA 4BY7J 1BOAA 2CUZA 5BMZA 4ZUWA 1ETKA 3VWBA 2WC2A 1J7KA 5E9DA 4F7TA 1NG7A 3PIOF 4NHJA 1ZH5A 2HNHA 1D0YA 2CIIA 2I10A 4XRSG 1UHMA 2BW3A 3LSHA 3R0JA 3RIRA 3HTUA 4RGUA 1E3PA 3V8KA 1K78B 3O3DA 2JA6J 3MRQA 4ENNA 1XN7A 5SWZA 2FA5A 1EA3A 3RTRA 1LFUP 4RDUA 1A6ZA 1FTZA 1HSTA 3BP8A 3KPOA 3JRGA 2B7EA 4EJUA 2VKEA 4B48A 2X0LA 1XCBA 1QO3A 5B1AH 2RNGA 3WHBA 1KU7A 3M1EA 5B66C 4IEJA 4LNRA 5C0IA 1ZR4A 4CZZA 2EZHA 1HF0A 4G9DA 3OYBA 2HWVA 3DP7A 5FRNA 1R6RA 3TW7A 3S32A 3CO6C 3KLOA 2RGVA 2I5UA 2Y69H 3TBVA 3JSPA 3AKZA 3J7AO 3H5RA 1S7XA 4V2FA 4FX4A 3NRVA 3LA2A 4G7HF 2P6TA 4IZZA 3J7AY 4L8SC 2CUEA 4QLCU 2BNRA 4GKSA 4HUWA 4YFKF 4B8XA 2M7AA 2EJRA 2JN6A 4N4OB 2EH3A 1HKSA 4UY8I 2LF7A 3L3HA 4P96A 1D8JA 4YEJA 3WGHA 1TT5B 3GCMA 1L0OC 3VXMA 2HOEA 4DYRA 2IS1A 5DS9A 2QZ8A 3CLQA 4HUVA 3S15J 1P2FA 3VDXA 4I09A 3W6VA 2FD5A 4MFEA 2P5WA 3MRGA 3HM5A 2NW3A 3MRPA 3FXMA 2ADUA 2ECBA 1GXPA 3ZN0A 5HOOA 3PIPF 3MROA 2XGDA 1T95A 1U6GA 1BC7C 2YU9J 2O8XA 2DT6A 4BQOA 2IXSA 2V79A 1Z77A 5IOZA 5C0AA 5IEKA 2M0CA 2FJ1A 1IN6A 3C1DA 5EZGA 5KNLA 1OPCA 1TZLA 3KYOA 2MH9A 1GZQA 4A3JJ 4L8DA 4L29A 2BSSA 1YTYA 1SC7A 4E70A 4XRMA 1VQ4I 1IM3A 4Q5SF 1V4RA 3L9RA 3IAS2 4IVNA 3BR2A 3Q0VA 2H09A 4C2MJ 4MIMA 3ARBA 5JLXA 4BBRJ 3H3UA 3KIOA 4W1UA 3KPSA 3A2KA 4PJXA 4XL9A 2ZJPF 3FTGA 4IHYA 2XDVA 5C0JA 4BJ6C 1U5TA 3K1NA 1A9EA 1FFPA 1LFBA 3L3JA 3MRNA 3B73A 2CLVA 1KYWA 2NYKA 4BE0A 2HR3A 4BQAA 2XV4S 1TWAJ 1B8IB 2L9NA 3DTXA 4D0DA 1RC9A 3VYTB 3S2DJ 2Y31A 3BG5A 1LE8B 2ZMEC 5F08A 2GIVA 2W57A 4LLNA 3CCHA 4HX1A 3BLYA 4FTHA 4O2FA 3QDGA 4RLFA 5LFAA 1M05A 4FTVA 1ERDA 3MVPA 3QU6A 2NOGA 1ORKA 2H26A 3PNVA 2R5ZB 2K9LA 3LKRA 2LY2A 1P7IA 4HF2A 1FEXA 3HKZN 3LAPA 4CCMA 1W36D 2ZCWA 4L0ZB 1FPQA 1MMDA 2JMWA 1HBXG 4U1JA 1F5TA 1U9NA 4BY1J 4OU0A 4PG2A 3AU1A 2X48A 1AGFA 1NHAA 3BXNA 2JTVA 5BQTA 3W2WA 1SFOJ 1CF7A 1ZHLA 3GFJA 2COMA 3BROA 1P9QC 3FXQA 4BHCA 2ELKA 4A0YA 3FK6A 4U0VA 3M4OJ 4LIUA 5BNGA 1KJMA 3P9IA 3V5KA 5HGDA 2BY0A 4I99C 1R3HA 4XSZF 4LGWA 4UV8A 1HW2A 3ZRGA 3K0LA 3LSRA 2QSGX 1HW1A 1OLTA 2DA3A 1D0XA 2G7HA 2BCKA 5ISZA 2IGOA 2FOWA 4L5IA 1S7OA 4LITA 1YHQI 2YPLA 3RWEA 4HV8A 1ZRCA 1RESA 3Q3SA 4P9UA 5E8NA 3VFWA 2AXTC 2DA2A 5JHUA 2PJRA 4AIHA 3CJTB 3WG9A 3ZMDA 3CCRI 1XMKA 1ZAOA 4PG9A 3VH8A 3GYHX 5FKMA 3M8JA 3L3GA 2BSRA 4N9HA 3MEXA 3U1KA 2JA7J 3GSXA 5HGHA 5MEQA 3I0TA 1P4LA 5GAEJ 3H0DA 4HNVA 2QLZA 1T1XA 3S17J 4BQQA 2EFNA 1GVJA 1S29A 2Q2EB 2VKDA 3S1QJ 1R49A 5EO0A 2Y0SN 4HBLA 2IEKA 3P4MA 5CVVA 2CH0A 2NVTJ 1WJ5A 3I4NJ 2R7TA 2HKOA 1D5VA 1P4AA 3NEUA 2M1BA 2FQ4A 4WWCA 2HVRA 1T8IA 5BXFA 4HLXA 3DX8A 1FY7A 3OYJA 2M0MA 2H1KA 1W0VA 4KICA 2QA4I 3ROUA 2X6YA 4ZYEA 5IP7J 3GSRA 4IHTA 2DMNA 3PM1A 4ZUUA 4GDFA 1KCGC 1TP4A 1MKMA 1JTXA 3K9TA 5F0CA 3SFIA 3K4NA 1REPC 2IT0A 1B72B 4BH9A 3CF2A 4XICA 3HEFA 1WJEA 5DCMB 3RL2A 3G1LA 1ZLJA 2M2EA 2X1EA 2YX7A 1PUEE 1WBYA 4F52A 1W0UA 4QWQA 1FFOA 1E3OC 2FXAA 2X4SA 5D5VB 3QYEA 1X1BA 2M34A 3R6SA 2GZWA 1E28A 4PJ9A 1JE8A 5HNHA 1S6LA 3IUOA 4RAYA 2DOEA 1RNLA 2MD0A 3AG3H 2HKXA 4IF4A 4YRVA 2QBYA 1S9YA 2X4UA 4PJ8A 2ZXWH 1KQ0A 4JOMA 5ILSA 3MRMA 1IN8A 3IAM2 1OISA 1X1PA 1JT0A 3F6VA 3FMSA 3F6OA 3LA3A 1Y39A 1LUJB 4EATA 4I02A 5JR3A 2M87A 1WCMJ 3VYRB 3QP5A
chains in the Genus database with same CATH topology
2DTRA 1U5TC 1J75A 4RGSA 3WTXC 1ODDA 1R1TA 4KN7X 2DQRA 5HS7A 2CSOA 2VC1A 3QP6A 4JQFA 5HLIA 1IZ1A 4L9TA 1FX7A 2Q8KA 1P4WA 1U78A 2CG4A 3PQKA 1FBSA 4WF2A 1YIOA 2X4HA 3MZYA 2JZYA 4ENKA 2A07F 3W6KB 4ZZDA 1K79A 3L9FA 1MJBA 5DD8A 3D5LA 3L09A 1USTA 1EH8A 2XHKA 1CGPA 2QWWA 2STTA 3SXYA 4JK1X 2NNYA 1XGNA 3LWFA 3HRMA 3TOBA 3J81Z 3TKYA 2FMLA 5J8FA 1ZLKA 2VT2A 1RZ4A 1GXQA 2D45A 3MCZA 1QQIA 1SD7A 1W5TA 1IN4A 1TNTA 3ZMTA 3DQVC 1PP8F 4YFXF 2BBYA 3HOTA 5E1WA 4PGHA 4G6QA 1O7FA 3DFGA 3ZMUA 5D6FA 2BEOA 2FE3A 5LLQA 3S2WA 1I1GA 2GQQA 5KVRA 5TJJA 3F22A 2HQNA 1T2KA 1MJ9A 2Q2EA 3V4GA 4WXHA 5DCFA 3FX3A 3ZQ7A 4GYIA 1P6RA 4IRIA 3Q9VA 2XUBA 2M8EA 2DW4A 4F7ZA 4M73A 2BGCA 2QYOA 1QO0D 2ACJA 4A0ZA 1UCRA 3QPHA 3EQLF 1LJ9A 2F5DA 4MNUA 3KZYA 4JBAA 1F9NA 3M8EA 5EEGA 3ECHA 1G3TA 4LD5A 4ZYDA 4RGRA 1YO5C 3BJAA 2G7UA 5BS6A 3U2RA 5CVJA 3LA7A 1TNSA 1VTNC 2QENA 3JTHA 1Y0UA 4IRHA 3T0YA 4IRGA 4EGYA 4LK1F 2OAZA 4YIIA 1I5ZA 3V7SA 1HKTA 5IT3A 3M7GA 3WE3A 2EB7A 2OD5A 4WX9A 2UXXA 1O57A 5JFRA 5L3FA 1IUYA 1DPRA 3WE2A 1IXRC 4CGZA 4BHPA 2H94A 1O3TA 2UXNA 3J80Z 3KEOA 2KJCA 2RVCA 1R7JA 3COAC 2Y75A 2K02A 3KP3A 2GWRA 1GHCA 4OMYA 3D0SA 4CICA 2LSOA 4EM0B 3I59B 4G9YA 2DT5A 2E7XA 3P9CA 1P92A 1FSEA 4PGGA 2VN2A 2EFWA 3C3WA 4BNCA 3E5UA 1IF1A 1ZG5A 2VOPA 5HS9A 3E6MA 3CUQA 5LBQA 3LAJA 3K69A 1QGPA 4PDKA 4RB0A 2D1HA 3TDUC 1W7PB 4HQMA 1ZYRF 4WXCA 1ZREA 3I64A 1E2XA 5ERIA 4AVPA 4EGZA 3HRSA 4CDGA 2KRFA 3I59A 4A6DA 5FB2A 1IN7A 4IJAA 3CLOA 3F8NA 4EM2A 5LGUA 4CYDA 3H3ZA 2HS5A 3E5QA 3ML6A 4N9IA 3TO7A 4I2OA 4FT8A 2EV0A 1ZGAA 5DUKA 1T6SA 3TDZC 2A5YB 1B1BA 2A3SA 3F8BA 2PQ8A 5HDKA 2QQAA 1W7PA 2ZFWA 1STZA 2UWMA 1XSDA 4MHGA 1EH6A 2P5VA 5E1XA 4RS8A 3OOPA 2DFIA 2FNPA 2HTSA 1UFMA 1O3RA 5F64A 2EFQA 2JPCA 1R23A 3JW4A 3VEPA 2K86A 3WTZA 3J80K 1DPUA 3BDDA 4XBFA 4AD9A 5KK1A 1F1ZA 2K4JA 3L00A 1YFHA 3QOPA 4IXAA 4OINF 2HGCA 4EVIA 3GZ5A 1G3SA 2F5FA 4MQVA 1YLFA 1FNNA 1IRFA 3ELKA 2GAUA 4XLNF 4HZFA 2VOOA 5BOXA 3DPLC 1WQ2A 2QM3A 5E1ZB 2CW0F 1O3QA 1IRGA 2BYVE 1U5TB 4YG2F 4L9VA 4ESBA 5D5WB 4M74A 2DQLA 3RKXA 1I1SA 4UVAA 2H6CA 1H0MA 4U7DA 5J8CA 3JTGA 3WTWC 1TQMA 2V6CA 2OA4A 2BV6A 2WTEA 5LRSA 4ON0A 4KA4A 4UV9A 2Z33A 2JPBA 1KA8A 2XAGA 2LNBA 2VBYA 4OMZA 2F5CA 4Y13A 1W4MA 1Z9CA 5ED4A 5DEQA 2M45A 3KP5A 1OR7A 1K7AA 1ZG1A 1BIAA 2ETHA 2MLGA 3KP7A 2ESNA 4PCQA 5DUIA 1WI9A 3BY6A 2GA1A 5DYMA 4HF1A 2J5PA 1C0WA 2ZNZA 1MZBA 3IC7A 2RQPA 1IN5A 5IT9K 4A6EA 4G7ZF 4KNYA 3L7WA 1FZPB 3EUHA 3IWZA 5DCMA 2CFXA 3I58A 2FQ3A 2YPRA 3IWFA 1T39A 4HYEA 4CXFA 4XLPF 3LQQA 3GW2A 2L02A 4GO1A 3TO6A 1OYIA 2L54A 4B09A 2ESHA 1FLIA 2Z9OA 2ISZA 2YR2A 4UNOA 3HTSB 4NB5A 1LQ1A 3E5XA 3WTUC 1QBJA 1XGSA 3V8LA 1YW7A 4HX7A 1G4DA 1RI7A 4LLLA 3T5XA 4KIGA 5FD5A 2GXGA 3VOEA 3KP6A 2IRFG 2V1DA 3HSEA 2FU4A 2MC3A 5FLXZ 3MZHA 4U0YA 2HZTA 2JSCA 5ICFA 4CHUA 1FYLA 1YQAA 2DLLA 4YFNF 2TDXA 5E8GA 3ZP5A 3CUOA 5D6EA 4RAZA 4R1HA 2RC4A 4HX4A 5A2QZ 3GFIA 1LEBA 1P4XA 1FP1D 1OKRA 2VBXA 3WTSC 3ZPLA 5FFXA 3IL2A 3CO7C 4KYWA 3HSRA 3NQOA 4Y17A 4M72A 2E1CA 1LEAA 4MTDA 4Q48A 3U1DA 1KYZA 1BI3A 1KGSA 2A6HF 2HQRA 3E6DA 3P7NA 3I4PA 5FO5A 2KIMA 4HW0A 3DKWA 1UB9A 5L3BA 1HSJA 3BZ6A 3GLXA 5ICEA 1FSHA 1JHFA 2EFOA 3QRFF 4H0EA 3EDPA 1G6NA 5CJ9A 5K5QA 4GYGA 1W5SA 2RV8A 2XVCA 3HRTA 5ILUA 2EK5A 2VBZA 2HYFA 4G94A 2MH2A 2J5OA 2VE9A 6PAXA 5D8KB 2EA4A 3IRRA 3FXUA 4L5JA 4IHSA 1S7AA 3R4KA 2XKOA 5HDGA 2VONA 2P5KA 2RNJA 3BOQA 2WWYA 1WRJA 2K4BA 3I71A 3HHGA 4GCVA 1B6AA 1YS6A 4RB1A 3E6BA 2NNNA 3GWZA 1SD6A 5E20A 2AXLA 5D5UB 5L3DA 3RYRA 4Z2YA 3SZPA 4D0PA 2W25A 3F8MA 1R22A 4ENMA 4ASNA 4KIBA 1EV7A 1PDNC 2HTJA 4UVBA 3VB2A 2VBWA 1IW7F 3WGGA 1XCVA 3GO5A 1QPMA 3GZ6A 1E17A 2PLYA 2LDUA 5ICGA 4EM1A 5CVUA 2ZMEA 2Z99A 3GUDA 3T8RA 3REOA 1BI1A 2YU3A 5A2QK 2ZO4A 3E3VA 3H92A 1TQPA 1QZZA 5K1YA 3ISPA 2O6GE 2VODA 2XAFA 2IJLA 1FWZA 1OYWA 2P8TA 1MDMB 4PZJA 3T8TA 3HIFA 2Q0OA 1I27A 1ZRDA 2HEOA 3HHHA 3LQRA 2XASA 2PN6A 2XIGA 3RYPA 3FMQA 3FMRA 1J2XA 2KJBA 4A5NA 4UXNA 4KUMA 2O61A 1D8KA 4BYYA 5LEJA 2BE5F 2IPQX 4G6DA 5CYVA 4MEXF 2DPDA 2OBPA 2NYXA 3KCCA 3BJ6A 3ERED 4R79A 1FC3A 4ZZLA 3GEZA 4I98B 2D1VA 3WTYC 1WSUA 5BPIA 4Y15A 1YW9A 2PG4A 3DF8A 2EV6A 4EJWA 2QQ9A 2PBIA 4WXDA 1F4KA 1D3YA 3DXJF 5CVRA 5HLHA 1S3JA 4AIKA 3K1PA 3Q9SA 3EETA 3GVAA 1R58A 3TO9A 4ZYGA 2NAZA 2OQGA 1A04A 4DQ2A 3ULQB 5HVQC 2QQBA 4LFUA 3G3ZA 3RKWA 2O03A 5LEKA 3N97A 4KDPA 4K2EA 4I7HA 3GF2A 4N0BA 3J81K 3F3XA 1H9GA 1R00A 2XGXA 3QU3A 1KU2A 4BHBA 4HDUA 4HX8A 1HXDA 4TV7A 1B4AA 3WTVC 3HRUA 1Z6RA 1B9NA 3DEUA 4HV5A 3M9AA 3WGIA 4A5MA 2LF8A 1KU3A 2F5EA 1SFXA 1B9MA 1TTYA 2FRHA 4LB5A 1MDMA 5E17F 4L9JA 1V3FA 4FX0A 1IXCA 3F72A 3O3KA 2A69F 1UHWA 1BI0A 2YX4A 2R3SA 4L9NA 1TLHB 3RDIA 2FF4A 3AAFA 4MEYF 4Q47A 3MWMA 3JAMZ 4ZYHA 2R7DA 1JXSA 2FMYA 4XSXF 1TW2A 2GA2A 3SFZA 4HAMA 1R1VA 1ULYA 3RJPA 4RB2C 5FLXK 4M9SA 4O6JA 1CF7B 5JI6A 1BI2A 1U3EM 1EH7A 1K78A 2CO5A 1YYVA 5F1RA 2Y48A 3N4MA 4GXOA 3FHZA 1RIOH 3ZMZA 1SFUA 2ELHA 1R5HA 1JGSA 2WV0A 4OIOF 1XSXA 1ON1A 3HYIA 1XDSA 4HV6A 3F8FA 1R5GA 5L3GA 2A61A 4HOBA 4OIPF 2ZBKA 3TGNA 4LMYA 2FOKA 2HFHA 3SHFA 2QBYB 2KIUA 2ZKZA 2P6SA 1SD4A 3L2CA 4WK8F 1BC8C 3JSOA 2FSWA 2HDCA 4L18B 4P9FA 2L01A 4XRFA 3R0AA 4LLGF 4HA8A 4HLYA 2D2WA 3K1MA 5ILVA 2FBKA 2GXBA 2UZKA 4EV0A 4HF0A 3IKTA 4M6XA 3WTTC 5FD6A 3RKYA 3HUGA 3C18A 1R1UA 1BN5A 2DO7A 2KIFA 3GX4X 2RN7A 3PFIA 4G8XA 2KKOA 1ZN2A 2M5WA 2P5LC 1T38A 3K2ZA 3I5UA 4A2UA 3R60A 1AWCA 2IA1A 3LSTA 3ABTA 2DBBA 1WWXA 2QVOA 3ZMVA 3KEQA 1FYMA 1O3SA 1TQIA 2VXZA 3CTAA 1MD0A 2CYYA 3W6JB 3RPUA 3I53A 1L3LA 4S05A 3DPTA 3F21A 2PEXA 2OU2A 5HLGA 2PI0A 4EJTA 2H27A 2FBHA 2NRAC 5E18F 1HQCA 1LVAA 3M8FA 2E7WA 2ZJ2A 5TRDA 2E1NA 2PMUA 2CGPA 3GFMA 5L3CA 1SAXA 3VFZA 3CUQC 5AIQA 4KFCA 1OMIA 2W84A 3TOAA 3CDHA 2FBIA 2DAOA 1J9IA 2H6BA 2F2EA 5E8IA 2STWA 1LDKB 1B59A 1XDUA 2NS0A 4EJVA 1J5YA 5LHGA 4CO8A 3KLNA 2O0YA 2VT3A 4MTEA 4U88A 1SMTA 1BBYA 2AS5F 2CQKA 4KIFA 4KT5C 4NQWA 4WCGA 3V7CA 3V8JA 3I54A 4P55A 2XAJA 2XRNA 4A12A 1BM9A 2K7LA 2MA3A 4MQ9F 2MD5A 2DK5A 5CLSA 2L3DA 1XGOA 1H9TA 2IA2A 1J0RA 3FF5A 2VE8A 4EMSA 4I0AA 1TBXA 2W85A 1DDNA 1XB4A 4UHTA 1RUOA 5D4RA 3KETA 1USSA 3P9KA 2FNAA 5IT9Z 3OV8A 2P4WA 1KQ9A 3KZZA 3MFKA 5HDNA 2QUFA 3BPVA 2A68F 1ZRFA 3ABUA 3IRQA 3EYYA 1DUXC 3O6BB 3QAHA 2V1UA 2RDPA 4P5OA 2K27A 1S8NA 1Z91A 3CUQB 4AIJA 1XD7A 4O3MA 3HSFA 3KP2A 4ETSA 4OOIA 3KP4A 4AWXB 1LNWA 2OZUA 3F23A 2IA0A 2ZXJA 4U7BA 3SZTA 4DNCA 4M9ZA 3BWGA 5LRRA 1T0FA 2MBFA 1G3WA 2R7FA 3C7JA 3R61A 5DD4A 3G73A 1XGMA 2EA2A 1AOYA 2IW5A 1XSVA 2IP2A 5K5RA 1ZG3A 4A0XA 4HDVA 3FM5A 1LB2A 1TW3A 4S04A 4KMUX 1ONVA 1MGTA 4M71A 4HQEA 4KN4X 1HKQA 4R8HA 5HS8A 2L4AA 5D5XB 3U9GA 1Z05A 4LG0B 1IAWA 3ZMSA 1I6XA 1LDJA 4KMFA 1W7PD