2IA1A

Crystal structure of protein bh3703 from bacillus halodurans, pfam duf600
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
169
Chain Sequence
b'SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPDSFYKETLNEYLEEKAQGKRYPFLEPLHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3703 protein
publication title Structure of hypothetical protein BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 58
structure length 169
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia1A02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 2ia1A01
2KKOA 2RQPA 3HSRA 3IWFA 2LNBA 1JGSA 2EFPA 1DDNA 1RIOH 4OIPF 4UVCA 1SD4A 1WWXA 4KMFA 2FU4A 3FXRA 4L9JA 4IRGA 3FHZA 3SZTA 4RB3C 3WTWC 3FMSA 4LLNA 4LFUA 2UZKA 4Q4ZF 4EM1A 3KEOA 3QRFF 3GZ6A 2P7CB 4I01A 1QZZA 5A2QK 3BJ6A 1I5ZA 3ECHA 2GXBA 4LK1F 5LHIA 1S29A 4EGYA 4BYYA 2CSOA 3R6SA 1EV7A 3H3ZA 2UWMA 3KZYA 3ML6A 3F8BA 5HS8A 2QQBA 2QUFA 1HKSA 3FM5A 1TQIA 4MGRA 5DD8A 4U0YA 4ASNA 1GHCA 1EH8A 4U0VA 5D5UB 5DCMB 2DAOA 1UHWA 5JI6A 1O57A 5CLSA 4ZH4F 2NYXA 3FWEA 3WGHA 2PFBA 2M87A 2OD5A 4IJAA 1CF7B 2DK8A 3F21A 4EV0A 4EVIA 4EQQA 1FYMA 5FO5A 3WU1B 2W24A 3NEUA 2BBYA 2HGCA 1EH6A 2STWA 2L02A 2A5YB 1KU2A 4M71A 1ON1A 3HTUA 2G9WA 2DQRA 4U7DA 3VFZA 4FX4A 2ZMEB 1KQ0A 2O8XA 4A5NA 4CZZA 3DP7A 4RB1A 2HYFA 5K5OA 1J7KA 4HLXA 2ZXJA 1ZRFA 2K4JA 2K7LA 5E1WA 4WXHA 2OAZA 2YX4A 3WE2A 2H6BA 1XMKA 3K1PA 2F5FA 3LWFA 2IVMA 3ABUA 4XBFA 5CVUA 3R0JA 3TO9A 2HQRA 1USTA 1LVAA 4Q5SF 4M6XA 4ENKA 2CW0F 4MQ9F 3PFIA 4NB5A 5BPIA 1PDNC 1IF1A 2Y75A 3I71A 3F8FA 2LDUA 1R22A 5BPDA 1FBUA 2JPBA 4JQFA 1U2WA 1YYVA 2YX7A 3EQLF 4PCQA 3HSFA 1FBSA 1J9IA 3KP3A 3LA2A 1AOYA 1R5HA 2A6EF 1XB4A 3SZPA 1ZARA 4HDUA 2J5OA 4XLPF 4S04A 4N9IA 3CUQA 2XKOA 3N97A 3VODA 2HEOA 4ZYGA 4HOBA 4OOIA 3W6KB 1VTNC 2P7VB 3V7CA 2ELHA 3IRQA 1DP7P 3EUHA 3TDUC 1BI1A 5FB2A 2Z33A 1BOAA 5AIQA 3GX4X 1IN7A 2RVCA 2G7UA 1FWZA 3C18A 4YFKF 1ZH5A 3KLOA 3AAFA 4IRHA 2P5VA 1J5YA 1LDDA 3R60A 3IKVA 4D0PA 1R1VA 4WCGA 2MC3A 5D5VB 1D5VA 2VONA 1FYKA 3I64A 3TOBA 3ZMSA 4OIQF 2VBZA 3ZMVA 5LHHA 3LSTA 5DUKA 1YW7A 4XSZF 2EA2A 3R4KA 5KK1A 2J5PA 5KVRA 3BP8A 2JZYA 4S05A 3WGGA 2OZUA 3EETA 2M8EA 3CUQC 2COMA 1Z91A 3I59A 1F5TA 1QGPA 1WKMA 4L9NA 1QPMA 1YS6A 3K9TA 2D1HA 3WTUC 2K02A 1H9TA 5E1ZB 1O7FA 2DW4A 3IWZA 3I5UA 1BI3A 3GO5A 1Z05A 3J81K 5H6RA 1QNTA 4FHTA 3KFWX 2PMUA 4EM0B 4HX7A 2MH9A 3MCZA 5D6EA 1HW5A 3V7SA 4IXAA 2W25A 4ZZDA 2A3SA 4CICA 4RB0A 3O6BB 5HS9A 1WSUA 1IRGA 3J7AO 2ZJ2A 2ESNA 3KP2A 2Z99A 2HTJA 2HYGD 1SD5A 3IHUA 3K2ZA 3MEXA 3M8FA 1JE8A 5L3BA 2MBFA 1IXCA 2W85A 5HS7A 2BE5F 1XDSA 4WWCA 1R1UA 1HQCA 5HDGA 1FOKA 2KJCA 2A68F 4GGGA 2D1VA 3BJAA 1J59A 1TNTA 3WG9A 1DPRA 1XN7A 3D0SA 1U5TB 3L7WA 1ZLKA 3KCCA 3WE3A 2EJRA 1F4KA 3Q9SA 4ZZLA 1FY7A 2V79A 2DO7A 1FSEA 2PBIA 3HOSA 2R3SA 2YSRA 2YU3A 1HW2A 2DPUA 2E1CA 2BYVE 2QWWA 1MGTA 2FBIA 1TW2A 3KP7A 1S7OA 1FP2A 2D2WA 2XRNA 5LEKA 3HRSA 1K7AA 4Y15A 1SFUA 1R7JA 1FX7A 4ZYHA 4EJTA 2FMLA 2M45A 4R1HA 3V8LA 2V1XA 3F72A 4HA8A 1YW9A 3GWZA 4UUVA 4OMYA 5HLGA 1NHAA 1P4WA 2B0LA 2HFHA 1Q1HA 2EWNA 4UHTA 2DPDA 3RIRA 5K5QA 3NQOA 1RUOA 5LBQA 1T6SA 1CF7A 1D8JA 2P5KA 1HKTA 3KP4A 4HV5A 4MQVA 4R79A 2QBYB 1W7PB 2VXZA 3JAMZ 1RUNA 4FX0A 1SAXA 1IAWA 2FEZA 1KQ9A 2DU9A 2OA4A 1K78B 3IRRA 2DFIA 1TLHB 3ECOA 2O6GE 5D8KB 4I02A 3T8RA 2EV6A 2ZMEA 3V7RA 1GXPA 1IXSB 1ZHFA 4IVNA 3ZMDA 2X4HA 3ZN0A 1LQ1A 1S3JA 1OYWA 1YQAA 1R5GA 2IT0A 4XLNF 5D4RA 1IN6A 2V9VA 2IA0A 2HZTA 2EB7A 2RN7A 4KN4X 2K4BA 3CO6C 5A2QZ 2JT1A 4HQMA 1PP8F 2HR3A 3FXUA 3GF2A 2V6CA 4WF2A 4UNOA 1STZA 1QBJA 2HS5A 3BOQA 1R00A 5LEJA 4BNCA 1R58A 4MEYF 2Q0OA 3W6JB 2KIUA 5J8FA 4WXCA 2QQAA 3RTRA 1O3RA 2FXAA 5ICFA 5L3GA 1HBXG 5BS6A 2Y0MA 5DYMA 4CHUA 1TBXA 4L0ZB 2R7DA 3VOEA 2AS5F 1T38A 1ZG5A 2LF8A 2XAFA 5ILUA 5TJJA 4U0WA 4Z2YA 2EFQA 3CO7C 3M7GA 2DBBA 4IHSA 3WTYC 1P2FA 4B09A 4YFNF 5JVTA 4LD5A 2A6HF 1U3EM 1BJAA 5LRSA 2CYYA 5J6XA 2MLGA 2P8TA 2HTSA 2JPCA 3K1NA 3HIFA 1FC3A 2F2EA 2XASA 1JXSA 1B6AA 3U9GA 2Q2EA 1YIOA 4N9HA 3ZMZA 1QO0D 5E20A 3ULQB 4L9VA 1YTYA 1BI0A 3KP6A 1UHMA 1F9NA 1B4AA 1G3TA 5HDNA 2CG4A 1JHFA 3GZ5A 3IKTA 1XCBA 4GXOA 2PJPA 2XAHA 3GVAA 4PZJA 3I58A 3MWMA 1S6LA 3NRVA 2QYOA 3ERED 4MHGA 1GVJA 2ZFWA 2EFNA 4I09A 4HBLA 4ETSA 3WTVC 4L0YB 1J0RA 5DDGA 3E6DA 4HAMA 4O3MA 3PQKA 4MTDA 3T8TA 1ZN2A 1ON2A 4FT8A 4EMSA 1U8RA 5DUIA 3QP5A 5DV5A 4CDGA 4BHPA 4ENMA 2A69F 1BN5A 4P96A 2OQRA 4HYEA 4AIHA 4KIFA 5ED4A 1WQ2A 1UCRA 3HRTA 4I0BA 2VOPA 4L18B 4G7ZF 4F7ZA 1B9MA 1HSTA 4ESJA 3P9IA 3GLXA 5E17F 4EM2A 3WGIA 3FM3A 2BEOA 3FX3A 4OINF 4I2OA 5FLXZ 3FF5A 3C3WA 4M6YA 4H0EA 2C6YA 1R23A 1KU7A 5AONA 5JR3A 3ZP5A 1LDJA 3QP6A 5D5XB 1XD7A 2GZWA 2IP2A 5IT9Z 2RGVA 3P9KA 2EFOA 5CVRA 4KUMA 3JW4A 3V8KA 3E5UA 3GUDA 4RGUA 2HKOA 1J2XA 3G73A 1LDKB 1UFMA 1ZGAA 1SD6A 1HSJA 4HLYA 2IW5A 1U5TA 1U78A 2MA3A 2O61A 1V4RA 3DEUA 1J75A 2VN2A 3SFZA 4I0AA 1XGMA 4RS8A 4WX9A 3ROUA 4DQ2A 1ONVA 3F6VA 2GWRA 4G8XA 2P6TA 4OIOF 2EV5A 2VBWA 5DCFA 1FBQA 2O0YA 2CWEA 3ISPA 3I0TA 1IXRC 4G9YA 2ZO4A 5TRDA 4RAYA 3K69A 3F6OA 3U1DA 3DFGA 2DT5A 2MLKA 1E17A 4KN7X 1H9GA 4RGRA 1ZRCA 4EJUA 1ZLJA 1R36A 4YIIA 3MZYA 3G3ZA 2QBYA 1W7PA 1TTYA 1S7AA 3VEPA 4IRIA 3BJOA 1RI7A 3J80K 1K78A 1C0WA 3R61A 4KIBA 4AIKA 3RPUA 4ZYEA 4ENJA 3JSOA 1Z6TA 1MDMB 1O3QA 1HW1A 4HF1A 2HKXA 1U5TC 2DK5A 2VBXA 5F64A 3P9CA 1BI2A 3I4PA 3GYHX 3LA7A 3FXQA 4UXNA 2AXLA 3QOPA 5E1XA 2ISZA 4ESBA 2MH2A 2D45A 1Z7UA 4I98B 3F8NA 1XSVA 1K6OA 4KYWA 1IUYA 4YIFA 1SFXA 2CGPA 3REOA 4LLGF 3I53A 3RI4A 2VOOA 1JHHA 3LA3A 1XGSA 3L2CA 1SMYF 2W84A 2RNJA 4BHCA 4UVAA 2H94A 3DV8A 4OIRF 1YG2A 2VT3A 2VBYA 2FMYA 3D5LA 2H27A 1XMAA 2M5WA 3FMQA 1ZGJA 2RC4A 3E3VA 4LB5A 5ICGA 5L3EA 3MFKA 2PLYA 3BDDA 4GYGA 1KU3A 5D8LB 3H92A 2CFXA 4A0ZA 2O03A 2KJBA 3VB2A 4GCVA 1KYZA 3JSPA 1XDUA 3SQNA 2FE3A 4KFCA 2XROA 5LRRA 3L09A 4O6JA 3HYIA 2XKPA 3HHHA 4YG2F 3E5QA 1P4XA 3KP5A 4U88A 2E1NA 2PQ8A 2FBHA 3FZVA 2DTRA 4KA4A 1Z9CA 3V8JA 4EJWA 4P55A 3M8EA 3RYPA 2FRHA 4PGHA 1WI9A 4L5IA 2A61A 2XUBA 3DQVC 4XSXF 2K86A 5LLQA 3N4MA 5LGUA 2P5LC 3L00A 2FF4A 1OYYA 4G6DA 1E2XA 3C7JA 4UV9A 4P9UA 1QZYA 2P4WA 1PUEE 2OQGA 2XIGA 2QM3A 2ZKZA 2FNPA 1FLIA 2L4MA 4WXDA 1TNSA 5ERIA 4U7BA 3TKYA 3F3XA 1IN8A 4HF2A 4G7OF 2NNNA 3HOTA 2F5EA 1RZ4A 2ZBKA 4RGSA 4LG0A 3Q5FA 2VODA 2FNAA 4IPAA 4HZFA 1IRFA 5F6FA 5BQTA 1MJ9A 2H09A 3JAMK 1SFEA 2FA5A 5CYVA 3LAJA 2QVOA 3HHGA 3DPTA 4CXFA 5H20A 2DLLA 1AWCA 1BC8C 2M30A 3LQQA 3QU3A 1KA8A 5HDKA 1OKRA 1XSDA 5HLHA 1W5TA 2H6CA 2TDXA 4BQAA 3BROA 3JTGA 2NS0A 4L5JA 3RKXA 2O3FA 4G7HF 3O2PE 3T0YA 1FPQA 3BY6A 3LFKA 2IA2A 2Z5UA 3B02A 2L01A 4BXUA 2Z9OA 1YW8A 1A04A 1I1GA 2VT2A 4GYIA 5J8CA 2IRFG 1B1BA 3MZHA 2G7HA 4BAYA 5FGMA 4MNUA 2L4AA 1T39A 5EEGA 4Q48A 4EJVA 2LSOA 4XRFA 5BMZA 5HOOA 2NRAC 1F1ZA 1X3UA 1OMIA 5CVJA 4IF4A 4P5OA 5ILVA 3QPHA 4MEXF 2P6SA 1T98A 2PMHA 4KT5C 4RB2C 4B8XA 4M72A 1IN5A 1G3YA 3RDIA 4EJOA 5LHGA 1KQ8A 4L9TA 1TQPA 2L3DA 2ADUA 2EV0A 3R0AA 4Q47A 4AVPA 5EEHA 2VC0A 3CTAA 3KEQA 1KGSA 3CJNA 1LJ9A 1D3YA 1EH7A 2ZCWA 5ICCA 1USSA 2UXXA 5E8GA 4HW0A 4LGWA 1Z1DA 2A07F 5BOXA 3O3KA 3TQNA 2XHKA 3DXJF 3GW2A 4DNCA 4A5MA 1KU9A 3H3UA 2JSCA 1RNLA 1FNNA 1XSXA 1I27A 3EYYA 4JK1X 1HKQA 3M9AA 3U2RA 2KIMA 1WRJA 3Q9VA 4CGZA 2FOKA 1XGNA 3GFLA 4LG0B 1B9NA 3GFMA 1U6GA 1YO5C 2EK5A 1G6NA 3B73A 4R8HA 1YS7A 3QPTA 2YPRA 3QU6A 4G6QA 4EGZA 4N0BA 1OPCA 4PDKA 2PG4A 1FSHA 3ZN1A 2IPQX 4YFXF 4ENNA 1OR7A 3E6MA 2V1UA 5L3CA 3QAHA 2VE9A 3TO7A 4BHBA 3K1MA 3TGNA 4ON0A 1W5SA 6PAXA 2VE8A 5FFXA 1ZG3A 1BBYA 5FD6A 1ZREA 4QLCU 2HWVA 3GFIA 1P4AA 1P92A 2KRFA 1W4MA 2IA1A 3HRMA 2VC1A 4K2EA 1FZPB 3S2WA 1IN4A 4M9ZA 2FQ3A 4Y13A 2BGCA 1MDMA 3LAPA 1G4DA 5L3DA 2GA2A 3E5XA 1UB9A 1O3SA 1KYWA 3K0LA 2IJLA 1LNWA 3L9FA 5CVIA 5H6QA 5FFZA 3ZQ7A 4LMYA 2GAUA 5D5WB 3KETA 1GXQA 1BIAA 3KZZA 1W7PD 1DPUA 4TV7A 2NNYA 4LB6B 4PGGA 4M9XA 4KMUX 2X0LA 1BC7C 2XAJA 3RYRA 4A6DA 1FYLA 1HXDA 4M73A 2UXNA 5D6FA 3IL2A 5D4SA 3P7NA 2OZ6A 1LB2A 1MZBA 3EYIA 3TO6A 2KIFA 1T2KA 4JBAA 5K5RA 3BPXA 3T1BA 1S8NA 3WTTC 2CQKA 3F23A 1P6RA 2EA4A 1T0FA 1H0MA 5LGNA 1QQIA 1SD7A 2GXGA 1O7LA 1PP7U 5FLXK 2XV4S 2STTA 2BV6A 3F8MA 3TOAA 5F1RA 3CLOA 2E7WA 3DPLC 5DEQA 4UVBA 3RPQA 2QZ8A 5IT9K 4KICA 4OMZA 4HF0A 4ZYDA 2ACJA 1O3TA 2PN6A 4UV8A 2GIVA 2FSWA 2WWYA 3J81Z 2R7FA 4LK0F 2ZNYA 3FMRA 3HSEA 3DKWA 2GA1A 2Z3YA 3F8CA 1BM9A 4HDVA 2EFWA 3GEZA 2F5DA 2V1DA 3JTHA 3J80Z 4LJZF 5DD4A 5CVVA 4A2UA 1Y0UA 2QLZA 3MAJA 4CO8A 5HVQC 3ZMTA 1TW3A 5E18F 2CO5A 3LQRA 4HV6A 2ISYA 1G3WA 1MKMA 4A12A 1IW7F 4A6EA 1ODDA 1REPC 1L0OC 3HTSB 2JRTA 2QQ9A 2JTVA 4AIJA 3WU0A 5E8IA 4O5VA 2E7XA 2Q8KA 2W57A 1FP1D 1MJAA 1I1SA 4M9SA 2RKHA 2XAQA 3SXYA 5ICEA 4M74A 5CJ9A 2XVCA 2YR2A 3CUQB 4OU0A 1V3FA 4AD9A 3DF8A 3E6BA 5IT3A 1YFHA 2PI0A 3ELKA 4ESFA 1SMTA 1L3LA 4I7HA 5JFRA 4KDPA 4HQEA 2GQQA 2MD5A 3E97A 1D8KA 3RKYA 5K1YA 5FD5A 1ZAOA 5L3FA 5JHUA 1LEBA 1I6XA 2LKPA 3GFJA 4LLLA 3WTXC 2OBPA 4NQWA 4WK8F 3IC7A 2HDCA 5HLIA 3I54A 1ZG1A 3RKWA 4MTEA 2WC2A 4RGXA 4GO1A 4Y17A 1YLFA 3OOPA 2HQNA 3GXOA 3ABTA 2RV8A 3ZPLA 2ZNZA 4KIGA 4G94A 3RJPA 3KLNA 3WODF 3HUGA 2OU2A 1G3SA 2WV0A 1XCVA 1R1TA 4HX8A 4E70A 2LF7A 1B59A 5AIPA 3BWGA 3ZMUA 3BZ6A 4HX4A 1MJBA 3WTSC 1TQMA 5ILSA 3PQJA 3BPVA 2NAZA 1IZ1A 2K27A 3E6CC 2ETHA 3I59B 4CYDA 5DCMA 3M1EA 3F22A 2ESHA 3MQ0A 2RDPA 3TDZC 4AWXB 5LGTA 4P9FA 2FBKA 3WTZA 3HRUA 4RAZA 3C1DA 3CUOA 1XGOA 3OV8A 3COAC 2QENA 3CDHA 3V4GA 1K79A 2HOEA 2XGXA 2PEXA 4A0YA 3SHFA 3EDPA 4IHTA 1Z6RA 2DI3A 1ULYA 2DQLA 2M1BA 4QWQA 2Y48A 1LEAA 1OYIA 4NHJA 2XAGA 2F5CA 1ZRDA 4A0XA 1MD0A 4KNYA 1DUXC 2L54A 1BIBA 1CGPA 2WTEA 3T5XA 1FT9A 1ZYRF 4BH9A 3KE2A
chains in the Genus database with same CATH superfamily
2KKOA 4ZDLA 2RQPA 3HSRA 4QOKA 3IWFA 3QOEA 5E8PA 2JSPA 3ROLA 2LNBA 3PO3J 1JGSA 5B39A 5B66C 2EFPA 1DDNA 4N8VA 1NEZA 1RIOH 4OIPF 2KRHA 1M1EB 1WCMJ 2B7EA 3PNYA 4CCOA 4L4TA 3C9NA 2KL4A 1TVBA 1WGXA 4UVCA 1SVLA 4F93B 1SD4A 3DBLB 4V3EB 5SWQA 1WWXA 1TWFJ 2YS9A 3M3YJ 4KMFA 2FU4A 3FXRA 1SFOJ 2CUFA 4L9JA 5FRMA 4IRGA 3FHZA 3IH2A 4NBQA 3E6HA 3SZTA 4RB3C 4D0BA 2ZC2A 3BTIA 1ZHBA 4BE0A 3WTWC 3FMSA 4PDCE 1PQZA 4PRDA 1GZPA 4LLNA 3A2KA 1W72A 2XF5A 4LFUA 2UZKA 1WBYA 5D7IA 2X48A 4Q4ZF 2X51A 4XRSA 3S1QJ 2IS2A 5INDA 4EM1A 3KEOA 3QRFF 3GZ6A 2P7CB 1RKWA 4I01A 4A3IJ 1QZZA 2ID3A 1T22A 4XRMA 1UMQA 4DW6A 3BJ6A 1I5ZA 5A2QK 3ECHA 1YJ9I 4X6AJ 3ILPA 1RK1A 2GXBA 4LK1F 1MBGA 3F0CA 3ABMH 4MFEA 2LOOA 3CCRI 2EBIA 1S29A 5LHIA 4EGYA 2MYSA 3KYCB 4II2A 4BYYA 2CSOA 3R6SA 1YITI 1EV7A 3K4NA 2LVSA 4QRRA 3H3ZA 2RAEA 4PUSA 2DMTA 2UWMA 3KZYA 3ML6A 4NQCA 1TZLA 3F8BA 4RAFA 5HS8A 2QQBA 1LQVA 1GUUA 3OIPA 1JUSA 5SWSA 1UG2A 3VWJA 3BO8A 5D7LA 2QUFA 1HKSA 4JQXA 4PV9A 2BY2A 3TJHA 3FM5A 3KWWA 1TQIA 4ZUSA 4G8GA 4MGRA 3VFRA 5DD8A 4U0YA 5HHPA 4ASNA 2XAUA 1EH8A 1GHCA 3H9SA 3PWUA 4U0VA 5D5UB 3O3AA 2P5WA 3TVMA 5DCMB 1MWAH 2DAOA 1UHWA 5JI6A 5TISC 5GPAA 2W00A 3OYAA 2PJRB 2VJ4A 2L9SA 1O57A 2ZXIA 1PYVA 5CLSA 1MBFA 4ZH4F 2NYXA 2MC4A 4E7LA 3FWEA 3WGHA 1VQKI 2CH0A 2PFBA 5E9DA 2M87A 2OF7A 4XONA 2OD5A 3TBWA 2VJJA 4IJAA 1APLC 3L3HA 1NAMH 1CF7B 2DK8A 4D0CA 3W39A 3F21A 2Y0SN 5IOYA 4EV0A 4JX5A 4JX4A 4EVIA 5M3MJ 2I8DA 4IHOA 4EQQA 1FYMA 2H26A 5FO5A 3WU1B 1I7TA 5IB3A 1Y8QB 5E3OA 4PRNA 5HGDA 5IOZA 3L2VA 4G6TB 1P7JA 2W24A 2E2JJ 4ZTJA 3NEUA 1MNEA 5KHDA 2BBYA 4IOAF 2HGCA 1EH6A 3U0PA 2STWA 2L02A 2A5YB 4WO4A 1KU2A 1WJEA 4M71A 2CW8A 1ON1A 3HTUA 2UWEA 3MV9A 3GTQJ 2WAQN 3P9MA 3UKGA 1VQPI 4PJ9A 2G9WA 5J4VA 2DQRA 3MR9A 4U7DA 3LNQA 4JRYA 4FFEX 3VFZA 3BR3A 1S7WA 4I76A 2DMPA 3RZDJ 4FX4A 4HV8A 5IPAA 2ZMEB 1KQ0A 2EIKH 2FX0A 3P77A 2VJ5A 2O8XA 4A5NA 4CZZA 1FO0H 3DP7A 4S0HB 3RZCA 4FASD 1V54H 4RB1A 2HYFA 4PRAA 1YPZA 3RUGA 5K5OA 2Z2SB 3FDYA 5J40A 4D1QA 2X1CA 2GTWA 3GSVA 1J7KA 4HLXA 2M9HA 3QYBA 3S3NA 1T95A 3HB9A 2ZXJA 1ZRFA 2K4JA 1H88C 1P7IA 3CF2A 2K7LA 5E1WA 3QULA 2P0WA 1FIPA 4WXHA 2OAZA 3ZQCA 4A3BJ 2YX4A 1E3HA 1QRNA 3G2BA 3WE2A 2H6BA 2XFXA 1XMKA 3K1PA 1LFPA 4IHYA 1MH4A 1DU6A 2F5FA 3LWFA 1R71A 3D18A 2EZHA 5JHDA 3QDGA 5J47A 2BY0A 2IVMA 3ABUA 4XBFA 5CVUA 3MRGA 3R0JA 3TO9A 3QPSA 2CS3A 4LITA 3BG3A 4XLHA 5EGOB 2HQRA 4HX1A 3TW6A 2X4RA 1USTA 2X85A 1LVAA 4XOTA 4Q5SF 4LCYA 4U6XA 5CKTA 4M6XA 1Z3YA 4ENKA 3GMPA 2CW0F 3VPRA 4MQ9F 3H36A 3PFIA 4NB5A 5BPIA 4LCCC 3V5DA 1AGDA 1PDNC 2DDAA 4V2GA 1IF1A 3OXRA 1QVTA 4NQDA 3B6SA 3QZWA 1ETVA 2Y75A 3VXNA 3I71A 4DZJA 3ERYA 4HG2A 2FZ3A 3VYTB 4PSWA 3F8FA 2LDUA 3NFNA 3WHCA 1ZSDA 1R22A 5FKKA 3WS3A 3LOCA 5BPDA 4XKBA 1FBUA 2JPBA 1YN6A 4PGDA 4CVZA 3BTLA 1TWGJ 4JQFA 1XTAA 5IP9J 5E8OA 5F08A 1U2WA 1SFKA 1YYVA 4JO8A 2VLKA 2EZKA 4BEHB 2ZJPF 2G0EA 2YX7A 3EQLF 4PCQA 2F4IA 4CH7A 3HSFA 1BR4A 1FBSA 3MKLA 3LKSA 4Y4RA 3JRHA 1J9IA 1JGDA 3OWTA 4L8SC 4XICA 3DBXA 3KP3A 3LA2A 4ZDPA 3BTJA 4PJ5A 1AOYA 1R5HA 3M1BA 4BDYA 2A6EF 2B63J 1IV8A 1BL0A 2NVYJ 1R3HA 3DXAA 1XB4A 3SZPA 1XMXA 1ZARA 2IXSA 2BVQA 5C0GA 2AV7A 2QKLB 3IXAA 2E1MB 4HDUA 2J5OA 4XLPF 4S04A 3HOUJ 4L3EA 4UB8C 3VFUA 4N9IA 3CUQA 3GSWA 2FO4A 2XKOA 3N97A 3VODA 2HEOA 4ZYGA 2GXAA 1XZ0A 3LN4A 2N8GA 4QTRA 3KPMA 4HOBA 4OOIA 5CPRB 3W6KB 3HG1A 1X1PA 3H35A 1KZHA 1Z0XA 4DYCA 1VQ8I 2QSHX 2BVMA 2OL3H 3H9GA 1JHTA 1VTNC 2P7VB 3V7CA 2ELHA 3IRQA 1DDHA 1LVKA 2JVGA 1DP7P 3EUHA 3OYJA 5FLVA 1AGCA 3QI9A 3TDUC 1BI1A 3MRBA 1Q94A 2YEZA 1H8AC 2MABA 1FZOA 4NNYA 5FB2A 1T8IA 3JTSA 2VE6A 1VF9A 4U1NA 2Z33A 1X3ZB 2RQQA 5BXFA 4J01A 1BOAA 5AIQA 4DOZA 3GX4X 1IN7A 2RVCA 3S3OA 2G7UA 4XLCA 2CQ7A 1FWZA 3VRIA 3C18A 4DGWB 3K70C 3E7LA 4YFKF 2DA4A 2E60A 1AKHA 1ZH5A 3FQRA 1LK2A 3VXUA 3QYFA 1Y8RB 1ZELA 1DP3A 3KLOA 4MXQA 3AAFA 4IRHA 2V9KA 4Y2DA 3VCLA 1A6QA 2P5VA 1K4SA 3MRRA 1DGWY 5IM7A 1T7VA 1J5YA 3HZJA 1LDDA 3R60A 1U9OA 2HYJA 2K9MA 3IKVA 1T7XA 4EI5A 4D0PA 1R1VA 3VSKA 4IHXA 2Q2EB 2VQLA 2ZXWH 4WCGA 5B38A 2MC3A 1BR1A 5D5VB 1D5VA 2VONA 2HJKA 1FYKA 5IB5A 3ZCOA 3I64A 3TOBA 5HGAA 1FZJA 3AU1A 4BL0B 2CMPA 3ZMSA 3T8XA 4OIQF 2VBZA 4BY7J 3ZMVA 5LHHA 3HOVJ 1HHJA 4N0CA 4XKVA 3E6FA 3LSTA 3RGVC 5DUKA 3VFTA 1YW7A 4XSZF 5EU4A 4BKWA 1ACIA 3RWJA 2EA2A 5DM7F 4C30A 3PWPA 3R4KA 2DA3A 5KK1A 4A3JJ 3SKMA 2J5PA 4XRSG 1UZCA 4XLFA 3BP8A 5KVRA 5GAHJ 3X13A 1I3AA 2JZYA 4HNTA 2R0QC 5IB4A 5C0CA 4S05A 1WJFA 3WGGA 2OZUA 3BW9A 4AC0A 2X6XA 3EETA 5KAIC 5FLMJ 1BA5A 1V5EA 1VQLI 2M8EA 3OR1C 5MEPA 2M3AA 3CUQC 3AG2H 2COMA 1MBJA 2JK3A 1U0JA 1ZR4A 5M5YJ 1Z91A 3O8XA 3I59A 4BJ5C 1QGPA 1F5TA 5EUOA 2VJIA 1WKMA 5D2NA 4L9NA 2A05A 2XPWA 1QPMA 2DT7B 4IKFA 1SYSA 1YS6A 3AFHA 3K9TA 2X4UA 3FQUA 2D1HA 3KPPA 3H9HA 2H8WA 3WTUC 2K02A 3GCMA 3BG6A 3LMMA 4A93J 2E5NA 1H9TA 5E1ZB 1OQYA 3FOMA 1O7FA 2DW4A 3FT3A 2L9RA 3IWZA 2K9NA 3I5UA 4ZDOA 1BI3A 5GAGJ 3BH9A 3GO5A 5D9SA 1Z05A 1OCRH 4HKJA 5F9JA 3J81K 3KPSA 2E71A 5H6RA 3ZQLA 1A1MA 1QNTA 4FHTA 2X4OA 1LKXA 3TBTA 2FD5A 2M7AA 2XSDC 1MIJA 3KFWX 2PMUA 3FISA 4C2TA 2QGUA 4EM0B 4HX7A 1FFPA 2GAZA 1T0FC 3MD2A 2YU9J 3OIQA 1P9QC 2MH9A 3MCZA 5D6EA 3W3CA 3EPZA 1HW5A 4BQNA 4NC7A 3WU2C 2XPVA 3LSHA 3V7SA 3SDDA 4OAYA 3TL4X 5IEKA 4IXAA 1XX5A 2W25A 3Q0UA 1T7WA 4ZZDA 2A3SA 4CICA 4HEA2 1GDTA 3D39A 3O8GA 3CP8A 1AU7A 2CIIA 3DBRB 5H94A 3WG7H 4RB0A 3O6BB 5HS9A 1WSUA 2GLOA 1IRGA 3J7AO 1INQA 5JLWA 5C0JA 2X6WA 3HC7A 3BHBA 3K7AJ 2ZJ2A 2ESNA 3KP2A 3KXFA 2Z99A 1LEGA 2HTJA 2HYGD 3HXLA 1SD5A 1UQSA 1G2HA 1QSEA 3IHUA 2VQGA 1Z77A 3K2ZA 2VPRA 3MEXA 4LCWA 2EH3A 3M1CA 3M8FA 1JE8A 1GT0C 4ZYAA 5L3BA 2V4JC 4NO0A 2MBFA 3LSIA 3LKQA 1IXCA 3HG9A 2W85A 5HS7A 3I6KA 1B0GA 3QFDA 1T56A 5FROA 2BE5F 1XDSA 2ZSHB 4CYCA 4WWCA 3GTKJ 1R1UA 4XR6A 2E2HJ 1HQCA 1N75A 5HDGA 3QFJA 3GTOJ 2HN7A 1IG7A 3S6CA 1A1OA 5CQEA 3CH1A 1FOKA 2KJCA 2A68F 4M3FA 4GGGA 4MFDA 2GIZA 2D1VA 1I7RA 3CDGA 2LG4A 2O5RA 3BJAA 1J59A 5L2JA 3G1LA 4JQVA 4F7TA 3S2HJ 1TNTA 3GMQA 1T1ZA 3WG9A 1DPRA 4EEFG 1ETQA 1W0WA 3BP4A 4U1IA 1XN7A 1ZAGA 3CCHA 3D0SA 3UBXA 3MRJA 1QRYA 1U5TB 4PR5A 3TIEA 3VXSA 3L7WA 3MKZA 2DA1A 2NVTJ 2JUCA 5EYRA 4AIDA 1S7VA 1WH5A 2H1LA 1ZLKA 3KCCA 4CUGA 5M5XJ 3WE3A 3U1KA 1RRJA 2BHYA 1UAAA 3TO4A 3AG1H 1BQHA 2EJRA 4E7ZA 1F4KA 3OSFA 3Q9SA 3HEFA 4ZZLA 1FY7A 2BSRA 4E0RA 5ISZA 3ERMA 4X6EA 2V79A 2DO7A 3AKZA 3BWAA 1FSEA 2W7NA 3MGOA 4J00A 2PBIA 1VQOI 2XGEA 2E34A 2Z16A 3S16J 3A4CA 3HOSA 2R3SA 2YSRA 4RMNA 3W2AA 2YU3A 1HW2A 3CCSI 2DPUA 1IUFA 2E1CA 2BYVE 3FTGA 4V3DB 2QWWA 1MGTA 3RKQA 1JJ8C 2OTLI 4L9LC 2WBMA 3ZQIA 2FBIA 1TW2A 3KP7A 1S7OA 3CCMI 1FP2A 5C0IA 2D2WA 4DIQA 4MNGA 2XRNA 3HOWJ 4YEJA 1YX3A 3KPNA 4NO3A 5LEKA 1T1WA 3HRSA 1FZMA 1K7AA 4Y15A 1SFUA 3VFMA 1R7JA 3BCBA 1FX7A 4ZYHA 1DUYA 4PREA 3CMYA 4EJTA 5IYDJ 2FMLA 4PJGA 2M45A 4R1HA 5CQGA 3V8LA 1JGGA 2V1XA 3F72A 3GSQA 5C9JA 3LSRA 4HA8A 3OS2A 1YW9A 2Y30A 3GWZA 1YJWI 4UUVA 4OMYA 5HLGA 2KRCA 4N0FA 5DS9A 1NHAA 4BU2A 5C3EJ 1P4WA 2B0LA 1YJNI 4X6DA 4B44A 4PJ0C 3ZR8X 2X9DA 2HFHA 1WJ5A 1Q1HA 1Z7LA 3DPUA 1JJ6C 2WY3A 4FE7A 2EWNA 4UHTA 2DPDA 3RIRA 3BR1A 1HDDC 5K5QA 4IRJA 3M07A 3NQOA 1XPXA 1RUOA 3VXMA 3HLAA 5LBQA 4QRPA 2VLRA 5DDHA 1T6SA 4LNRA 1CF7A 1D8JA 2HQAA 3JRGA 3DX7A 4A3MJ 4MIMA 2P5KA 2WV1A 1HKTA 3KP4A 3DWLE 4HV5A 4MQVA 4R79A 3G1OA 4BJTA 2QBYB 2IS6A 3TN0A 1W7PB 3U21A 1T0NA 2VXZA 3JAMZ 4BGDA 1RUNA 4JFFA 4FX0A 1SAXA 1IAWA 2MD0A 3QQ4A 5FKMA 1A1NA 4JYKA 2FEZA 2WB1N 2KDZA 4JFQA 1KQ9A 2DU9A 2OA4A 1K78B 4IQJA 5DEGA 2NS8A 3OYFA 3IRRA 2DFIA 4N5EA 2MGQA 1TLHB 3ECOA 1RR8C 2O6GE 2JVHA 5D8KB 2D31A 4Y4HA 3KYOA 5GSRA 4I02A 3T8RA 4XIDA 4D7MA 2EV6A 1VQ5I 3L9RA 3S32A 2R7XA 4BS9A 1ZT4A 2ZMEA 3V7RA 2O9LA 1A35A 1GXPA 1TT5B 1IXSB 4U1MA 1JPGA 5HHQA 3QYEA 1N78A 1BW5A 4PV8A 1AHDP 1G59A 1B8IB 4F3QA 2F6CA 1ZHFA 4IVNA 5FKNA 3ZMDA 3H3VK 2DODA 2X4HA 2OTJI 2GJ6A 3ZN0A 4XK4A 4ZAKA 1EXUA 1B3JA 1LQ1A 1HA8A 1KTLA 3BQZA 2F4OB 1RC9A 3H1CA 3RWHA 2NXNB 1FMWA 5KCMA 1B72B 1S3JA 4LIUA 1OYWA 1GZQA 3JREA 1YQAA 1JKPC 3UTTA 1R5GA 2IT0A 4CYCB 4XLNF 5D4RA 2R92J 1WBXA 3S2DJ 2CUEA 2ME0A 5EZGA 3BZFA 4FTVA 1IN6A 2V9VA 3OV6A 2DA6A 2DMNA 3FXLA 4IRSA 1MHCA 2IA0A 3D3VA 2HZTA 4G9FA 4HUVA 3UR3C 2CLZA 3HAEA 3VYUB 3B3IA 3O3DA 2EB7A 3DTIA 4N4NB 2F74A 2AHQA 2RN7A 4ZFZA 1Z3XA 4KN4X 4CCNA 3MRPA 2K4BA 4Z6YA 5EGOA 3CO6C 2VI6A 5FA3A 5GSVA 5A2QZ 4B4CA 2I10A 2JT1A 2AKRA 2QSFX 2KZVA 4HQMA 1HOMA 4C2MJ 5F04A 1PP8F 1XR8A 2HR3A 1VACA 3P73A 3FXUA 3GF2A 2V6CA 1ZT1A 4FQGA 4WUUA 4Y16A 3CQZJ 2VPLA 4NDLA 3LL7A 1X3WB 4WF2A 4UNOA 1STZA 3MREA 2LC2A 1LFUP 1QBJA 4I4WA 3ESWB 1A5JA 2K3PA 1SANA 4QRSA 2OCEA 2HS5A 4IEJA 3BOQA 4MQ7A 1R00A 1L8JA 2LH9A 5LEJA 3L2RA 4BEHA 1QSFA 2JRMA 1SC7A 4C3JJ 2DYPA 4BNCA 3VWBA 1J09A 1R58A 4MEYF 5E79C 2Q0OA 3W6JB 3K70D 4EN3C 2KIUA 3RL2A 3FIWA 5J8FA 4WXCA 5HNFA 1S5LC 2ME6A 2QQAA 2Y9ZA 4MS8A 3RTRA 3BG9A 1JI8A 3NWSA 1VI0A 4PGBA 2HU9A 4UQ3A 1O3RA 2FXAA 5ICFA 4LOCA 5L3GA 1HBXG 4F92B 3CC7I 1I1FA 2OC6A 5BS6A 3M8JA 2IGMA 4UUSB 2Y0MA 5DYMA 5FKOA 4CHUA 1EFXA 1TBXA 4NSKA 4L0ZB 3VFNA 2R7DA 3VOEA 2AS5F 1XS9A 2BVLA 4DYQA 4WWKC 3CCUI 1T38A 4CCKA 2BXZA 2FJ1A 1X19A 3GJFA 1ZG5A 1ZHNA 2KIQA 2CIKA 2LF8A 2HJLA 2XAFA 5ILUA 5TJJA 4U0WA 5HYJA 2K5CA 3G08A 4Z2YA 2AK4A 1Y39A 5C44J 3ASOH 1I1AA 3GMOA 5IP7J 2EFQA 3CO7C 3FBNB 4Z77A 3BR2A 2ECCA 3M7GA 2GTZA 1WH7A 4BKXA 2DBBA 4IHSA 2ZOLA 3WTYC 1FOXA 1P2FA 3FXOA 3KPHA 4B09A 2TRTA 2X70A 3LSGA 4YFNF 5M5WJ 4QIWN 5JVTA 3S15J 4LD5A 3VXOA 1GV2A 3TBSA 3MN2A 3SDBA 1YHQI 4EATA 3VFSA 2M8GX 2JN6A 1T1YA 3AG4H 2BY1A 1D1BA 2XC7A 1VQ6I 5BNGA 1JT0A 3WL9A 2A6HF 4BQQA 1I1YA 3CZ6A 3MMYB 1BJAA 1U3EM 1E0EA 5LRSA 2KQRA 4DBQA 2CYYA 3FT4A 5J6XA 1KJMA 3VWKA 4CCJA 3DX6A 2LMDA 2MLGA 2P8TA 3HKZA 2JQ7A 1JPFA 2HTSA 2DA7A 4E7JA 2V6EA 2WADA 2DA5A 4BDZA 5J1AA 2JPCA 2P81A 2OCCH 3OL3A 3QUXA 5ENWA 3K1NA 3HIFA 1FC3A 2F2EA 2XASA 2WAFA 1JXSA 3GLLA 3LSJA 5EU6A 2JUGA 1B6AA 3U9GA 2Q2EA 3S3MA 2RFXA 2K40A 1YIOA 4N9HA 3ZMZA 3HCVA 1QO0D 3BR5A 4HNUA 3TMOA 5L2KA 5E20A 1JKRC 3ULQB 1QHHD 2V1NA 3RWFA 4L9VA 1S8DA 4NO5A 5F0FA 2C7UA 3HL2A 1WHUA 1K61A 2HI3A 3DTKA 1WPKA 1YTYA 1BI0A 3E0JB 3I9V2 1FOYA 3KP6A 1UXWA 1UHMA 1MSEC 1B4AA 1F9NA 2EQRA 3ILQC 1G3TA 5HDNA 2CG4A 1ITYA 2LP0A 1KONA 4CSWA 1JHFA 3GZ5A 2W1OA 1W0UA 3VFWA 2E1MC 2EPFA 2JWTA 3IKTA 1XCBA 1ZHKA 2YUSA 4GXOA 2PJPA 1QHGA 2XAHA 3GVAA 4DJAA 1JUPA 4PZJA 3I58A 3MWMA 1S6LA 3NRVA 2QYOA 1IO2A 3ERED 1HDPA 1A9EA 4MHGA 3SPVA 1GVJA 2ZFWA 3B6CA 2EFNA 4I09A 4HBLA 3DCFA 2BHZA 4ETSA 3WTVC 2CUJA 4L0YB 1KCGC 3GSRA 1J0RA 5IB1A 5DDGA 3E6DA 2B9SA 4HAMA 4PJMA 3V42A 4O3MA 2E2IJ 3P9LA 2X6YA 4HRIA 1OCZH 1S7SA 4PP8C 3PQKA 3X11A 3I56I 4MTDA 3DTEA 4PJ7A 2QCOA 3T8TA 2M4GA 3HUJA 1ZN2A 1ON2A 4FT8A 4PJ8A 3A01A 2QKMB 1LE8B 4EMSA 3CJRB 1JKQC 1X7QA 1FTZA 1U8RA 3TP0A 3LV3A 5DUIA 4UB6C 1MW7A 1MMAA 3QP5A 5DV5A 4CDGA 1T1XA 2L7ZA 3CD6I 2F4MB 4Y7NJ 2TCTA 4BHPA 5E3LA 3MYJA 3SDCA 4MLOA 3RWIA 3HKZN 4NC6A 4ENMA 2A69F 1VFCA 2BVOA 1ZVSA 1VGKA 4EUPA 1W36D 2XDVA 2GUOA 5D2LA 1BN5A 3CMMA 1ZTRA 4P96A 3RWCA 2OQRA 4HYEA 4NQVA 4AIHA 4KIFA 4BY1J 5ED4A 2MFZA 1WQ2A 1UCRA 5C07A 3HRTA 4OAZA 4I0BA 2VOPA 4L18B 4JFDA 2XRLA 3MRCA 4G7ZF 3ZOBA 1TMCA 1KBGH 1T7ZA 5E8NA 3SKOA 4F7ZA 2VXDA 1ZKGA 1HHKA 1B9MA 1HSTA 3G6EI 4L3CA 3QEQA 3QUYA 3HPGA 3NARA 3P9IA 3GLXA 4ESJA 5E17F 1CG9A 4EM2A 4B43A 2V26A 1W1WE 3WGIA 1I3QJ 2CQXA 3FM3A 2QF7A 1P4LA 2BEOA 4V2FA 3GTMJ 4II3A 4RLQA 2FIKA 3O4LA 4HUUA 3FX3A 1Y56A 3BT9A 4OINF 3GTLJ 1AGBA 1HLVA 4I2OA 5FLXZ 4RA2A 1XG1A 3FF5A 3C3WA 2OJED 3HPJA 4M6YA 4H0EA 2R4GA 2EINH 3PUFA 2C6YA 1SVMA 3FQWA 2LYCA 1KPRA 1R23A 2HXIA 1KU7A 3L3DA 2NOGA 5AONA 2VB6A 1O4XA 5JR3A 3ZP5A 1LDJA 2LK2A 2DDBA 3QP6A 5D5XB 3REWA 4FCYA 3CVHA 2HXOA 3MRKA 5INCA 1XD7A 2GZWA 2IP2A 3MKYB 5IT9Z 2ECBA 1HHGA 2RGVA 3BC8A 3P9KA 2HDDA 3RSNA 2J8UA 2EFOA 2IGOA 5CVRA 4D0DA 4Z76A 4KUMA 3RWDA 3JW4A 2XF7A 1QZEA 3CLQA 3V8KA 3E5UA 3J7YJ 2AQFA 1TWAJ 3GUDA 3W2WA 1KPVA 4A3EJ 3MVPA 4RGUA 2HKOA 1S7TA 4PJHA 1J2XA 3G73A 3HPHA 1LDKB 1UFMA 1ZGAA 1SD6A 1UJ8A 1HSJA 4Y52J 4HLYA 1N3NA 2IW5A 1SEUA 1U5TA 3CC5A 3S1RJ 2WA0A 3KIOA 1U78A 4NQXA 3TBIA 1IRZA 2DJIA 1EKEA 2MA3A 2DFEA 1OJLA 5GTHC 2X1DA 3CC4I 1JFMA 3KPRA 1T33A 2O61A 1QVOA 2ZJQF 1E28A 1X2NA 1V4RA 2LKSA 3LKOA 3PWNA 4PGEA 2QQ8A 3DEUA 1J75A 2VN2A 3EUKL 2NVQJ 3SFZA 4I0AA 1XGMA 4RS8A 3ZRGA 4PJNA 3FONA 4WX9A 2MG4A 3ROUA 4DQ2A 3SYTA 1E3PA 1VZ0A 1A31A 1ONVA 3KPOA 4XLAA 3F6VA 2GWRA 3AM8A 3OOUA 4JP0A 4G8XA 1VADA 1QEWA 4KITB 1QA6A 2Q7YA 2P6TA 4OIOF 1TVHA 4AU7A 3Q0VA 4L5EA 2BZTA 2EV5A 2VBWA 2JJ7A 2ICWG 1V55H 4FETA 5DCFA 3CDLA 2E5ZA 2DTZA 2Y69H 3PWJA 5JLXA 1FBQA 2O0YA 2CWEA 1F43A 3GSNH 3ISPA 3I0TA 3MV7A 2V7FA 4KT6A 3OYBA 1IXRC 3ZQFA 4G9YA 4V19K 2BSTA 3FQXA 4MJIA 1D1CA 2ZO4A 3FQTA 3BZCA 3QUKA 2L2OA 1R6RA 5TRDA 3FXKA 4RAYA 5J1UA 3OXSA 3K69A 3F6OA 2DOFA 2W4SA 4G8IA 3U1DA 2CLRA 3A1YA 1A9BA 3DFGA 3PNTA 3BGMA 4K7FA 2DT5A 3Q3SA 2GITA 3KZIC 1HHIA 5AD0A 3QWLA 5C4JJ 2R5ZA 2MLKA 1UELB 1E17A 1S9HA 4KN7X 4ONOA 1H9GA 4RGRA 2MSYA 1ZRCA 3GTPJ 5C0DA 3K4JA 3A02A 3C2HA 4ZUWA 3CCJI 4EJUA 3OYHA 3EUHC 2M0MA 1ZLJA 2JMWA 3HGYA 1EF4A 3VFPA 2XPGA 1R36A 1OF2A 4YIIA 1ETWA 3A01B 1I50J 1SVOA 2DCEA 2WAEA 3M4OJ 4AYBA 3MZYA 3G3ZA 3B6AA 2QBYA 3W2VA 1ED3A 2CV1A 5DEFA 3ABLH 1W7PA 1TTYA 1S7AA 3W6VA 3WS6A 4NHUE 3ZXSA 3VEPA 4PRIA 3PFYA 4GRIA 2JA6J 3TBVA 4IRIA 3MRLA 4O2EA 3MZ8A 2XPUA 3BJOA 1RI7A 3J80K 2QA4I 3BR0A 1BW6A 1K78A 4BQOA 1C0WA 3R61A 1YOVB 4KIBA 4AIKA 2VUMJ 2CRGA 4XMYA 2M0CA 1X1AA 3RPUA 4ZYEA 3JSOA 4ENJA 1Z6TA 1MDMB 3ES6A 3BZEA 4AUXA 3IH4A 1O3QA 1HW1A 4HF1A 2HKXA 1U5TC 3KX2A 2L7MP 2DK5A 2VBXA 5F64A 3OYIA 3P9CA 4YELA 2LBFA 1BI2A 2BW3A 1RKTA 4RM2A 3TEDA 3I4PA 2HOTA 3GYHX 3LA7A 2JA7J 3FXQA 4UXNA 2AXLA 3OL4A 3QOPA 4O2CA 5E1XA 4QRUA 2ISZA 4ESBA 1T80A 2JA2A 4PRBA 3DEEA 3OYLA 2MH2A 1B8IA 3I6GA 1S7QA 1HHHA 2D45A 3HDDA 4YIRX 1Z7UA 1H89C 4I98B 3PJRA 3P5JA 1QO3A 1PJRA 2Q1ZB 2AQEA 1TWCJ 1YE9A 2K9QA 3F8NA 2X4SA 4NNXA 1XSVA 2NS7A 3VH8A 4XN3A 1K6OA 4KYWA 4MNQA 3PIPF 1IUYA 3IV5A 1B72A 3ARDA 2WY7Q 4YIFA 1SFXA 2CGPA 1HYRC 3FRUA 3REOA 1TC3C 4PJDA 5HLTA 1MNDA 1JUMA 4LLGF 3DEWA 4O2FA 3I53A 3VDXA 3RI4A 2VOOA 1JHHA 3LA3A 1S9XA 1XGSA 3K4LA 1TP4A 5EG0A 1WI3A 3L2CA 1IGNA 2NYKA 5F1IA 5BJTA 3K4MA 1W36C 1V5GA 2NOJB 1I6HJ 1VQ9I 5C4XJ 3JRIA 3DLAA 1FG2A 1R49A 3PM1A 1SMYF 2W84A 2OPTA 2RNJA 2AXGA 5SWZA 2FWOA 4BHCA 4UVAA 3CMAI 2H94A 3DV8A 2LTPA 4OIRF 2KMUA 1YG2A 4NT6A 5KNLA 3JTCA 2HDWA 2VT3A 2VBYA 1DU0A 2V2WA 5B5EC 2FMYA 3MRDA 1OCTC 3D5LA 5EJCA 2CV2A 2H27A 1QLFA 2R7QA 4HSRA 1XMAA 2IGNA 2M5WA 1ZGJA 3FMQA 4XKCA 2RC4A 2VLLA 3E3VA 5H2FC 2E1OA 1X1DA 4LB5A 1I7UA 3RZOJ 5ICGA 5L3EA 2A5WA 2X4PA 3MFKA 2PLYA 4A3FJ 3BDDA 1MMDA 3D1NI 5BRZA 1LEKA 4GYGA 1KU3A 5D8LB 3H92A 3RCOA 2CFXA 4PJIA 5HGBA 2KPMA 2VLJA 4A0ZA 5IP6A 2O03A 3AREA 3TBYA 1Y1VJ 2KJBA 2H1KA 3VB2A 5EFIA 4GCVA 1KYZA 3JSPA 1XDUA 4XXCA 4IX7A 5J4YA 3HOYJ 1R4NB 2KP6A 3SQNA 3LKPA 1JE6A 2HPMA 2FE3A 4KFCA 2XROA 5LRRA 4D9JA 3L09A 5EU5A 5LFAA 5GADJ 1YN7A 4O6JA 3HYIA 3OYGA 4Y4KA 2XKPA 1WJCA 3HHHA 4HNVA 4UUSA 2H8RA 1QU3A 4YG2F 3MKWB 3RQ4A 3E5QA 1P4XA 3KP5A 4U88A 2E1NA 4CCLA 2LY2A 1YIJI 4BXXJ 2PQ8A 1ENHA 2CJJA 3TZVC 2FBHA 3FZVA 2DTRA 3DLLF 4M3DA 4KA4A 5C08A 1Z9CA 3V8JA 3GZNB 2R5ZB 4EJWA 5GP9A 3AG3H 2E7LE 3IH3A 4P55A 2F54A 2HQ5A 2KDOA 3M8EA 3GTJJ 3CCEI 3RYPA 2LD5A 2FRHA 3MRHA 1U58A 4PRHA 4PGHA 2CQNA 1WI9A 4ABZA 4PJXA 4L5IA 2A61A 2IBDA 2XUBA 3GBGA 1BZ9A 5IEHA 1FFOA 3DQVC 4XM3A 4XSXF 2K86A 4OWRB 2QSGX 4L29A 3IT8D 3UNGC 5LLQA 3K2AA 4A3CJ 2PX9A 3OS0A 1OSZA 2VQHA 4CA0A 3N4MA 9ANTA 5LGUA 2P5LC 3KYNA 3L00A 3L1PA 2FF4A 3D5SC 1OYYA 1Q1VA 1FJLA 4G6DA 1E2XA 3C7JA 2L7KA 4UV9A 3MROA 4PJCA 1VQMI 1YI2I 1W0TA 2OI9A 4P9UA 3HOZJ 1R9TJ 1ETOA 1QZYA 3X12A 3N05A 2L0KA 2P4WA 1PUEE 2OQGA 2XIGA 3OYEA 2CUZA 2QM3A 5MEOA 2ZKZA 1JKOC 2FNPA 3DKXA 4NQEA 2CU7A 5E3MA 2KT0A 2MHAA 1FLIA 2L4MA 1OFCX 4WXDA 4K71B 4GDFA 1IM9A 1TNSA 2VKDA 3IP4B 2LBFB 3L3JA 3TO2A 2BW3B 5ERIA 1FZKA 3A0BC 4Y4FA 5IYCJ 5IY5H 2F53A 4U7BA 1EJ9A 3I3LA 3H5NA 2MW8A 3TKYA 5J1RA 3F3XA 3ZQGA 1IN8A 3PWLA 4HF2A 4G7OF 2NNNA 4BACA 2AXFA 1X4PA 3HOTA 3J7ZI 3FK7A 2F5EA 1RZ4A 2WY8Q 1TWHJ 2ZBKA 4NC8A 4RGSA 3UTSA 4LG0A 3Q5FA 1S7UA 1ORKA 4B3XA 1NK2P 2VODA 2FNAA 2PMZA 2XF6A 2XGDA 4HZFA 4IPAA 3BEWA 4JFOA 4E7SA 1E3OC 3RTQA 1IRFA 5F6FA 2GM4A 5BQTA 3L2QA 1BR2A 1AO7A 4NNJA 1ETXA 1MJ9A 2H09A 2Y2ZA 3JAMK 1SFEA 2FA5A 5CYVA 3LAJA 1GVDA 1HOCA 2QVOA 3CDIA 5DM6F 1G6RH 3H0DA 3HHGA 3LKNA 3ASNH 4PSXA 3VRJA 5EG0B 3LSKA 5K7ZA 3DPTA 3IAS2 4CXFA 5HHMA 5H20A 4IL6C 3GMRA 2DLLA 1AWCA 1BC8C 5EZHA 1HCRA 3OIOA 2M30A 3LQQA 4E6KG 3C8KA 2IAIA 4MJ6A 3QU3A 2UUZA 1KA8A 2Y9YA 3BUYA 5HDKA 1OKRA 3L2WA 1XSDA 5HLHA 3D5RC 4HSTA 1W5TA 2A83A 2H6CA 2TDXA 4BQAA 5K7FA 3BROA 4C3HJ 2OUMA 3JTGA 3ECBA 2NS0A 4L5JA 4CVXA 4NQWB 3SJMA 3RKXA 2QEXI 2O3FA 3OYKA 4ZC3A 2V2XA 4G7HF 3O2PE 1KJ3H 3T0YA 5HHOA 1FPQA 3BY6A 3PABA 3W0WA 3LFKA 4XN0A 2IA2A 3S8PA 1IV6A 2Z5UA 3WLBA 2Y0SA 2L01A 3B02A 4BXUA 2Z9OA 1YW8A 1A04A 4Y3OA 1W5CC 4ZUUA 5FRNA 3OR2C 3P4MA 4PRPA 1LE8A 4I99C 1KJVA 1I1GA 1OCOH 5DTDA 2VL8A 2VT2A 3DU6A 4GYIA 4BBRJ 2DJNA 1D0ZA 5J8CA 2L7FP 3CCLI 3I6LD 2IRFG 1B1BA 3P4NA 3AL0B 5EO1A 4G42A 3TFKA 1ONQA 3MZHA 2G7HA 4BAYA 2FUG2 5FGMA 3ONQA 4IOCF 1IDYA 4MNUA 1LD9A 2L4AA 1T39A 5EEGA 4Q48A 2FOWA 1IJWC 3CPLA 2WAQA 4EJVA 2LSOA 4XRFA 5BMZA 5HOOA 2NRAC 1ETKA 3HUGB 4HUWA 2ZSWA 1F1ZA 1LFBA 1X3UA 4N0UA 1OMIA 2RNGA 4IF4A 5CVJA 5F27A 4P5OA 5MERA 1PUFA 1G7QA 1YDPA 1UXSA 5ILVA 3QPHA 1N77A 3ARFA 2F48A 4MEXF 5E00A 2P6SA 1T98A 2PMHA 2ZMEC 4XKWA 4I6ZA 1P7QA 4KT5C 3PO2J 4RB2C 5EO0A 4B8XA 4M72A 1QR1A 5HGHA 5J6HA 1IN5A 2ZFUA 1G3YA 1ZGWA 3RDIA 4EJOA 4IIQC 5HNHA 4NUBA 5LHGA 3CCVI 1NG6A 1KQ8A 1EA3A 2PMZN 2R93J 5BS0A 1S72I 1SAUA 3K4KA 3OYCA 3E1SA 4L9TA 1TQPA 2L3DA 4IQ4A 2ADUA 2EV0A 3R0AA 5B1AH 5IROA 1C16A 4Q47A 4L8CA 3JCUC 4AVPA 5EEHA 3QDJA 2VC0A 4F7EA 3UPRA 1DE4A 4X6FA 2LREA 3K10A 5C0AA 3ROOA 4C2UA 4GKNA 3CTAA 3KEQA 3V5KA 1KGSA 3CJNA 4QPQA 4Z78A 1LJ9A 3SEQA 1D3YA 1EH7A 3V5HA 2ZCWA 1GV5A 4U87A 3OS1A 4UUTA 1FTTA 2GOMA 3PQYA 1OCPA 4DBRA 3PWVA 5ICCA 1USSA 1MHEA 2UXXA 5E8GA 1MBHA 4HW0A 3RQIA 5K7HA 3JRAA 1ZHLA 4LGWA 1Z1DA 2A07F 5BOXA 2HVSA 3O3KA 3TQNA 1WFXA 2XHKA 3DXJF 3GW2A 1AKJA 5J6GA 4DNCA 1MBEA 3C2GA 2R7SA 2NX5A 3BH8A 4A5MA 1KU9A 3GTGJ 1JT6A 3H3UA 4XNFA 5HHNA 2JSCA 1RNLA 3Q0WA 3O3BA 1BOBA 5IVXA 1FNNA 1WJAA 1XSXA 2CW7A 2ZSIB 1I27A 3EYYA 4RLFA 3CP2A 4J19A 1MNMC 3CCYA 4JK1X 1HKQA 3M9AA 4MO7A 4U1KA 3KPLA 3U2RA 5F1JA 2KIMA 1WRJA 3HGGA 1S9YA 4F7PA 3Q9VA 4CGZA 2FOKA 1XGNA 4C3IJ 1NTCA 3GFLA 4FISA 4WDIA 2ZOKA 3A03A 4LG0B 1B9NA 3PSFA 1PVEA 3GFMA 3E3QA 3GMLA 1U6GA 3O8HA 1YO5C 2EK5A 1G6NA 1K83J 3B73A 4R8HA 4B1RA 3WUWA 4IO9F 4M3GA 1D5YA 3SJVA 1YS7A 3FT2A 3QPTA 2YPRA 3GSOA 2LY9A 5F1NA 2R7VA 3QU6A 4G6QA 3F9KA 4EGZA 4N0BA 1N5AA 3BR6A 3HE6A 4ELMA 4UQ2A 1OPCA 4PDKA 2EIJH 2PG4A 1FSHA 3ZN1A 2HVRA 3WHBA 2IPQX 2YPLA 1VNDA 1U9NA 4YFXF 2L9VA 4E7HA 2EILH 4ENNA 1OR7A 2A6TA 5GTIC 2LRDA 3E6MA 2V1UA 4RM3A 5L3CA 3M17A 1CQTA 4RBOA 3QAHA 1X1CA 3ZQHA 1N2RA 4MJ5A 3SDXA 2VE9A 2GBYA 4BBSJ 3TO7A 3OYDA 4BHBA 3K1MA 4WW2C 3TGNA 4LG3A 4ON0A 3I4MJ 3ABKH 1W5SA 6PAXA 2VE8A 2RREA 2R5YA 5FFXA 1N25A 1ZG3A 1HC8A 1BBYA 2NVUB 4XOPA 5FD6A 2ELJA 4I48A 1ZREA 4QLCU 2HWVA 3SDAA 3DKYA 3GFIA 1RETA 3JVGA 1P4AA 1P92A 2KISA 2HPIA 2NW3A 2KRFA 1T7YA 3J7AY 3ARGA 1W4MA 2ESVA 4G12A 3GMNA 1DGRM 4FE4A 3S1MJ 2DXIA 4U1JA 2IA1A 2X1EA 2IS1A 5EU3A 3HRMA 2VC1A 1EEYA 4K2EA 3JTTA 3IAM2 1ZS8A 1FZPB 3H9QA 3S2WA 1IN4A 2I5UA 1LUJB 5J3LA 1T0MA 3HJEA 3VJ6A 3KEYA 2R7TA 4LIVA 1BD2A 2VAAA 1MMSA 4M9ZA 2FQ3A 4PJLA 2XB0X 4Y13A 1PUFB 1T21A 3LKRA 2BGCA 1MDMA 3CC2I 2FQ4A 3HM5A 2W48A 3FBIB 3LAPA 4E7KA 3MRIA 2M34A 3TW7A 5L3DA 1G4DA 3SZGA 2BNRA 1I39A 2GA2A 3E5XA 4B3AA 1UB9A 1O3SA 1KYWA 4U1SA 2L5QA 3K0LA 4PFOA 1P1ZA 3S17J 2IJLA 1LNWA 1MI5A 3L9FA 5CVIA 4M3EA 5FFZA 5H6QA 1F36A 5F0HA 3ZQ7A 2DN0A 1B0RA 4LMYA 2FYYA 3P4OA 2GAUA 5D5WB 2H6PA 1A36A 2LLKA 1MMNA 3KETA 1GXQA 2JA5J 3TP3A 1X1BA 1BIAA 3KZZA 1W7PD 1JGEA 4HUXA 1DPUA 1S9WA 1S7XA 3E2HA 2BSSA 3VFVA 3DTXA 2DOAA 1AGFA 3FOLA 4TV7A 1KJ2H 5E3NA 2NNYA 4LB6B 4PGGA 4M9XA 3PNVA 4KMUX 2X0LA 1BC7C 3OYMA 3RPUD 5IYBJ 2XAJA 3VXPA 3RYRA 4A6DA 3TIDA 1FIAA 1HSAA 1FYLA 4WU7A 1HXDA 4M73A 1CD1A 3FK6A 4AVZA 2UXNA 5D6FA 3ARBA 3IL2A 3KYLA 5D4SA 4MX7A 2E36A 3P7NA 2OZ6A 3G71I 2VABA 2GOXB 4F91B 1LB2A 1MZBA 3EYIA 4IHVA 1OR7C 5FA4A 3TA3A 3TO6A 1ETYA 2KIFA 1T2KA 5TGTA 3PL8A 4F55A 3S93A 4JBAA 2HVQA 5K5RA 3BPXA 1JTYA 3T1BA 3MRQA 1S8NA 3WTTC 2CQKA 3JRFA 1P6RA 3F23A 3BVNA 2EA4A 2KFDA 3L3GA 3DU5A 3O3EA 3QQAA 1T0FA 2VQCA 1H0MA 1MMGA 4RDUA 1NH3A 5LGNA 3VYRB 1QQIA 4QPOA 1SD7A 2NVXJ 2K9LA 3H9JA 2GXGA 1O7LA 1PP7U 4A3KJ 5FLXK 1JUFA 2X4TA 4L8BA 3TPUE 4A3DJ 2XV4S 2STTA 1RR7A 2LKXA 4G59A 3LSMA 3MV8A 1R5ID 1XC5A 1OCCH 2BV6A 3LFUA 3F8MA 3TOAA 5F1RA 3CLOA 2E7WA 3DPLC 4PK4A 5DEQA 1KPUA 3A0HC 4UVBA 3RPQA 1VQ4I 3S14J 2LR8A 4GKSA 3OSGA 2QZ8A 3SFIA 5IT9K 3QODA 4KICA 4OMZA 3S1NJ 4HF0A 4ZYDA 2ACJA 1O3TA 3BQYA 4F7CA 4F52A 4XQFA 2PN6A 4UV8A 2GIVA 2FSWA 2WWYA 4G43A 3J81Z 2OV7A 1JTXA 4IZZA 2R7FA 4E7IA 4A69C 4LK0F 2ZNYA 2CKBH 3H5AA 3FMRA 3HSEA 4IHWA 2XGCA 1RJZA 3DKWA 4QRTA 5EOTA 3BG5A 2O8KA 4QRQA 1Y1WJ 2GA1A 4ZUVA 2Z3YA 4X1EA 3CF5F 1T20A 3F8CA 3QDMA 1MSFC 1BM9A 4HDVA 2EFWA 3GEZA 4X0GA 2JA8J 2F5DA 2V1DA 4HPQA 4M3BA 5MEQA 2D5VA 4AM3A 3JTHA 2IGKA 3J80Z 1IM3A 1WVRA 4LJZF 4XL9A 1ZT7A 1Y6IA 4GFBA 4X6CA 2ID6A 2BVPA 5DD4A 1N59A 5CVVA 1R4MB 4A2UA 4PJJA 4D7NA 2R5YB 1LDPH 1Y0UA 2QLZA 1POGA 3MAJA 2AXTC 4CO8A 4U1LA 1QVUA 4BE2A 2HOAA 2O5NA 3MA7A 3MGTA 3JRDA 5HVQC 3KLAA 2XSJC 3ZMTA 3IUOA 4B48A 4BUPA 2R7ZJ 3QQ3A 4WJ5A 1TW3A 3FKIJ 2VASA 2E35A 5E18F 3MRMA 4PG9A 5C09A 1YRNA 5M3FJ 2CO5A 1RPWA 3LQRA 4HV6A 2ISYA 3G1MA 3X2QH 3ZGKA 4L8DA 4XLEA 3VSLA 1G3WA 2ZXHA 1MKMA 2PO6A 3VXRA 4A12A 1X4OA 1IW7F 1K6YA 1WJDA 4E5XA 1HSBA 3D25A 4A6EA 3RL1A 1X58A 2DFHA 5LD2C 4ZTFA 4DYRA 2EIMH 4W97A 1ODDA 1V5FA 1AGEA 1REPC 1L0OC 1A6ZA 3VFOA 3HTSB 2BNQA 2JRTA 3FKJA 5FKPA 2Z1DA 2QQ9A 1M05A 5IB2A 3KYDB 3VYSB 3PIOF 2JTVA 1ERDA 2DFFA 3GSUA 1MBKA 4AIJA 4L4VA 4PJAA 3FXJA 3MRNA 3PUBA 4P1WA 2PYEA 4BJ6C 3WU0A 4YRVA 4JFEA 4S0UC 1MH3A 3H0GJ 3CCQI 4GUPA 5EDNA 3HE7A 1D0YA 1CE6A 5E8IA 4O5VA 2E7XA 3DX8A 3PSIA 2BOLA 2Q8KA 2W57A 4QSHA 1FP1D 1OLTA 3L3KA 1MJAA 1I1SA 2HOSA 2GT9A 4G59C 2AO9A 4M9SA 4KISA 2P5EA 2RKHA 1X2MA 2XAQA 3SXYA 3CJQB 3CMEI 3GSXA 5ICEA 3NAUA 4M74A 4LHUA 5FDWA 1OISA 1YX5A 2DMQA 5F0CA 5CJ9A 2LY1A 2XVCA 2K9SA 2YR2A 3CUQB 1HF0A 1JF1A 3BG7A 1IDZA 2CFOA 5C0BA 2DYRH 4M6VA 2O7OA 5JHFA 4H4KC 3NWTA 1V3FA 4OU0A 3CJTB 3DF8A 3SDGA 3E6BA 4AD9A 1WZ2A 5IT3A 4FTHA 3K4BA 4Y33A 3ELKA 1YFHA 2PI0A 3TF7A 4ESFA 1SMTA 1L3LA 4I7HA 2X4QA 5F7DA 5JFRA 3SCMA 2BY3A 4KDPA 4HQEA 4PJEA 5C0EA 1SYVA 4RAGA 2X6OA 2CV0A 3I4NJ 2GQQA 2MD5A 4JX6A 4ANJA 3E97A 1NANH 1D8KA 3RKYA 3LSPA 5K1YA 3T1FA 5FD5A 1ZAOA 5KAFC 1S7EA 3OY9A 1OGTA 2UV1A 5GAEJ 4BXFA 1IC8A 5L3FA 5JHUA 1LEBA 5FJ8J 1I6XA 2KHMA 2LKPA 3GFJA 4LLLA 2VKEA 3BZKA 2R7RA 3WTXC 4KJZA 4JFPA 3UTQA 2OBPA 1OGAA 4NQWA 1ZR2A 4WK8F 4AYBN 3IC7A 2HDCA 5HLIA 4HWZA 3FFCA 3I54A 2M7BA 3CZFA 1BJZA 2KZGA 2VKVA 3RKWA 1ZG1A 4MTEA 3O9WA 2VIXA 2WC2A 3JRBA 5HODA 4RGXA 3K4CA 1AKHB 2F5VA 1D0XA 2DYSH 4GO1A 2IS4A 4Y17A 1YLFA 3OOPA 2HQNA 3GXOA 3BXNA 4NO2A 3ABTA 1Z5LA 1DUZA 2RV8A 3ZPLA 2ZNZA 4CW1A 2DA2A 2WB1A 1Z67A 3HBLA 3K6GA 4KIGA 3MRFA 1BIIA 4G94A 3OX8A 3BLYA 3ZQQA 1DQUA 5D5MA 1I4FA 2X4NA 4APQA 2BCKA 3EUAA 3RJPA 3KLNA 2HLAA 3WODF 3HUGA 5B1BH 2OU2A 4BE1A 2R7UA 1G3SA 2ELKA 4MVBA 3C2BA 4C9YA 2WV0A 1XCVA 1R1TA 5D7JC 4U1HA 4PJBA 2VLAA 4HX8A 4E70A 2IEKA 2LF7A 1B59A 3DMMA 5AIPA 3BWGA 5FKLA 3BP7A 2M4KA 3ZMUA 3RWGA 3BZ6A 1ZK8A 1XH3A 4HX4A 3I55I 5JVGF 1MJBA 4G9DA 3WTSC 5MENA 1TQMA 5ILSA 2DMUA 4PGCA 4WU5A 3PQJA 3JR9A 2V9PA 4ZJZA 2HNHA 2K3FA 3BPVA 1QQDA 4PG2A 1K5NA 2K85A 1VQ7I 2M2EA 5E6IC 1QPIA 2LFBA 2NAZA 1IZ1A 4A3LJ 3QUZA 2K27A 2R7OA 3E6CC 1LP9A 2COBA 2ETHA 2E19A 3QPLA 2VKHA 3G4SI 1RESA 1ZQ3P 3I59B 1K8DA 4CYDA 2CQQA 4PFPA 1U8BA 3BTCA 5DCMA 4N4OB 4JRXA 1EEZA 1S7RA 2ZB9A 4HS3A 1YRNB 3RWEA 1GLNA 2PJRA 3M1EA 2L9NA 3F22A 1E27A 1FFNA 4E4HA 2ESHA 4A3GJ 3MQ0A 4CCMA 2RDPA 4B47A 1RJYA 3TDZC 4AWXB 5LGTA 4UY8I 4P9FA 1FEXA 3CESA 1K4TA 1Z21A 2FBKA 3WTZA 2ZSVA 1G7PA 3FQNA 1NG7A 1WJBA 3H7BA 2Y31A 3HOXJ 2R7WA 4ZUTA 3OYNA 2DT6A 3HRUA 4RAZA 2W82A 5J1YA 3BEVA 1NK3P 3C1DA 1TL8A 3CUOA 2BXYA 1XGOA 3OV8A 3GMEA 5EF6A 3COAC 1M6OA 2YPKA 1RK0A 2QENA 3GMMA 1UHSA 3GIVA 3FXMA 3CDHA 3V4GA 3JRCA 1K79A 2HOEA 2XGXA 1FMVA 3H5RA 5B3SH 1LPQA 3OMYA 3L2UA 2PEXA 3SEZA 4A0YA 5GPCA 4DZPA 4ITVA 3SHFA 4CZCA 3EDPA 4IHTA 3D2UA 4D5FA 3LN5A 1Z6RA 2DI3A 1W0VA 1D1AA 1ULYA 1XR9A 2DQLA 2M1BA 1TT0A 2Y48A 4QWQA 3AL0C 1LEAA 1OYIA 2XB5A 3L3IA 4NHJA 2KLOA 2ZJRF 3KPQA 2HZDA 2XAGA 4U6YA 2F5CA 1ZRDA 4A0XA 5C0FA 1MD0A 4PJFA 1AA7A 4KNYA 1WBZA 1DUXC 1T08B 2L54A 1UG0A 1FOWA 3FHNA 4D5CA 3BCAA 2CLVA 1BIBA 2AV1A 4W1UA 4JOMA 1CGPA 1G8XA 2WTEA 5ACZA 3T5XA 2DOEA 1FT9A 1A6IA 1ZYRF 3DBHB 4XORA 2JCCA 1Y0NA 1VQNI 4BH9A 3X14A 2EZIA 4F7MA 2EZLA 5EEAA 1IRXA 3KE2A
chains in the Genus database with same CATH topology
2KKOA 2RQPA 3HSRA 3IWFA 2LNBA 1JGSA 2EFPA 1DDNA 1RIOH 4OIPF 4UVCA 1SD4A 1WWXA 4KMFA 2FU4A 3FXRA 4L9JA 4IRGA 3FHZA 3SZTA 4RB3C 3WTWC 3FMSA 4LLNA 4LFUA 2UZKA 4Q4ZF 4EM1A 3KEOA 3QRFF 3GZ6A 2P7CB 4I01A 1QZZA 5A2QK 3BJ6A 1I5ZA 3ECHA 2GXBA 4LK1F 5LHIA 1S29A 4EGYA 4BYYA 2CSOA 3R6SA 1EV7A 3H3ZA 2UWMA 3KZYA 3ML6A 3F8BA 5HS8A 2QQBA 2QUFA 1HKSA 3FM5A 1TQIA 4MGRA 5DD8A 4U0YA 4ASNA 1GHCA 1EH8A 4U0VA 5D5UB 5DCMB 2DAOA 1UHWA 5JI6A 1O57A 5CLSA 4ZH4F 2NYXA 3FWEA 3WGHA 2PFBA 2M87A 2OD5A 4IJAA 1CF7B 2DK8A 3F21A 4EV0A 4EVIA 4EQQA 1FYMA 5FO5A 3WU1B 2W24A 3NEUA 2BBYA 2HGCA 1EH6A 2STWA 2L02A 2A5YB 1KU2A 4M71A 1ON1A 3HTUA 2G9WA 2DQRA 4U7DA 3VFZA 4FX4A 2ZMEB 1KQ0A 2O8XA 4A5NA 4CZZA 3DP7A 4RB1A 2HYFA 5K5OA 1J7KA 4HLXA 2ZXJA 1ZRFA 2K4JA 2K7LA 5E1WA 4WXHA 2OAZA 2YX4A 3WE2A 2H6BA 1XMKA 3K1PA 2F5FA 3LWFA 2IVMA 3ABUA 4XBFA 5CVUA 3R0JA 3TO9A 2HQRA 1USTA 1LVAA 4Q5SF 4M6XA 4ENKA 2CW0F 4MQ9F 3PFIA 4NB5A 5BPIA 1PDNC 1IF1A 2Y75A 3I71A 3F8FA 2LDUA 1R22A 5BPDA 1FBUA 2JPBA 4JQFA 1U2WA 1YYVA 2YX7A 3EQLF 4PCQA 3HSFA 1FBSA 1J9IA 3KP3A 3LA2A 1AOYA 1R5HA 2A6EF 1XB4A 3SZPA 1ZARA 4HDUA 2J5OA 4XLPF 4S04A 4N9IA 3CUQA 2XKOA 3N97A 3VODA 2HEOA 4ZYGA 4HOBA 4OOIA 3W6KB 1VTNC 2P7VB 3V7CA 2ELHA 3IRQA 1DP7P 3EUHA 3TDUC 1BI1A 5FB2A 2Z33A 1BOAA 5AIQA 3GX4X 1IN7A 2RVCA 2G7UA 1FWZA 3C18A 4YFKF 1ZH5A 3KLOA 3AAFA 4IRHA 2P5VA 1J5YA 1LDDA 3R60A 3IKVA 4D0PA 1R1VA 4WCGA 2MC3A 5D5VB 1D5VA 2VONA 1FYKA 3I64A 3TOBA 3ZMSA 4OIQF 2VBZA 3ZMVA 5LHHA 3LSTA 5DUKA 1YW7A 4XSZF 2EA2A 3R4KA 5KK1A 2J5PA 5KVRA 3BP8A 2JZYA 4S05A 3WGGA 2OZUA 3EETA 2M8EA 3CUQC 2COMA 1Z91A 3I59A 1F5TA 1QGPA 1WKMA 4L9NA 1QPMA 1YS6A 3K9TA 2D1HA 3WTUC 2K02A 1H9TA 5E1ZB 1O7FA 2DW4A 3IWZA 3I5UA 1BI3A 3GO5A 1Z05A 3J81K 5H6RA 1QNTA 4FHTA 3KFWX 2PMUA 4EM0B 4HX7A 2MH9A 3MCZA 5D6EA 1HW5A 3V7SA 4IXAA 2W25A 4ZZDA 2A3SA 4CICA 4RB0A 3O6BB 5HS9A 1WSUA 1IRGA 3J7AO 2ZJ2A 2ESNA 3KP2A 2Z99A 2HTJA 2HYGD 1SD5A 3IHUA 3K2ZA 3MEXA 3M8FA 1JE8A 5L3BA 2MBFA 1IXCA 2W85A 5HS7A 2BE5F 1XDSA 4WWCA 1R1UA 1HQCA 5HDGA 1FOKA 2KJCA 2A68F 4GGGA 2D1VA 3BJAA 1J59A 1TNTA 3WG9A 1DPRA 1XN7A 3D0SA 1U5TB 3L7WA 1ZLKA 3KCCA 3WE3A 2EJRA 1F4KA 3Q9SA 4ZZLA 1FY7A 2V79A 2DO7A 1FSEA 2PBIA 3HOSA 2R3SA 2YSRA 2YU3A 1HW2A 2DPUA 2E1CA 2BYVE 2QWWA 1MGTA 2FBIA 1TW2A 3KP7A 1S7OA 1FP2A 2D2WA 2XRNA 5LEKA 3HRSA 1K7AA 4Y15A 1SFUA 1R7JA 1FX7A 4ZYHA 4EJTA 2FMLA 2M45A 4R1HA 3V8LA 2V1XA 3F72A 4HA8A 1YW9A 3GWZA 4UUVA 4OMYA 5HLGA 1NHAA 1P4WA 2B0LA 2HFHA 1Q1HA 2EWNA 4UHTA 2DPDA 3RIRA 5K5QA 3NQOA 1RUOA 5LBQA 1T6SA 1CF7A 1D8JA 2P5KA 1HKTA 3KP4A 4HV5A 4MQVA 4R79A 2QBYB 1W7PB 2VXZA 3JAMZ 1RUNA 4FX0A 1SAXA 1IAWA 2FEZA 1KQ9A 2DU9A 2OA4A 1K78B 3IRRA 2DFIA 1TLHB 3ECOA 2O6GE 5D8KB 4I02A 3T8RA 2EV6A 2ZMEA 3V7RA 1GXPA 1IXSB 1ZHFA 4IVNA 3ZMDA 2X4HA 3ZN0A 1LQ1A 1S3JA 1OYWA 1YQAA 1R5GA 2IT0A 4XLNF 5D4RA 1IN6A 2V9VA 2IA0A 2HZTA 2EB7A 2RN7A 4KN4X 2K4BA 3CO6C 5A2QZ 2JT1A 4HQMA 1PP8F 2HR3A 3FXUA 3GF2A 2V6CA 4WF2A 4UNOA 1STZA 1QBJA 2HS5A 3BOQA 1R00A 5LEJA 4BNCA 1R58A 4MEYF 2Q0OA 3W6JB 2KIUA 5J8FA 4WXCA 2QQAA 3RTRA 1O3RA 2FXAA 5ICFA 5L3GA 1HBXG 5BS6A 2Y0MA 5DYMA 4CHUA 1TBXA 4L0ZB 2R7DA 3VOEA 2AS5F 1T38A 1ZG5A 2LF8A 2XAFA 5ILUA 5TJJA 4U0WA 4Z2YA 2EFQA 3CO7C 3M7GA 2DBBA 4IHSA 3WTYC 1P2FA 4B09A 4YFNF 5JVTA 4LD5A 2A6HF 1U3EM 1BJAA 5LRSA 2CYYA 5J6XA 2MLGA 2P8TA 2HTSA 2JPCA 3K1NA 3HIFA 1FC3A 2F2EA 2XASA 1JXSA 1B6AA 3U9GA 2Q2EA 1YIOA 4N9HA 3ZMZA 1QO0D 5E20A 3ULQB 4L9VA 1YTYA 1BI0A 3KP6A 1UHMA 1F9NA 1B4AA 1G3TA 5HDNA 2CG4A 1JHFA 3GZ5A 3IKTA 1XCBA 4GXOA 2PJPA 2XAHA 3GVAA 4PZJA 3I58A 3MWMA 1S6LA 3NRVA 2QYOA 3ERED 4MHGA 1GVJA 2ZFWA 2EFNA 4I09A 4HBLA 4ETSA 3WTVC 4L0YB 1J0RA 5DDGA 3E6DA 4HAMA 4O3MA 3PQKA 4MTDA 3T8TA 1ZN2A 1ON2A 4FT8A 4EMSA 1U8RA 5DUIA 3QP5A 5DV5A 4CDGA 4BHPA 4ENMA 2A69F 1BN5A 4P96A 2OQRA 4HYEA 4AIHA 4KIFA 5ED4A 1WQ2A 1UCRA 3HRTA 4I0BA 2VOPA 4L18B 4G7ZF 4F7ZA 1B9MA 1HSTA 4ESJA 3P9IA 3GLXA 5E17F 4EM2A 3WGIA 3FM3A 2BEOA 3FX3A 4OINF 4I2OA 5FLXZ 3FF5A 3C3WA 4M6YA 4H0EA 2C6YA 1R23A 1KU7A 5AONA 5JR3A 3ZP5A 1LDJA 3QP6A 5D5XB 1XD7A 2GZWA 2IP2A 5IT9Z 2RGVA 3P9KA 2EFOA 5CVRA 4KUMA 3JW4A 3V8KA 3E5UA 3GUDA 4RGUA 2HKOA 1J2XA 3G73A 1LDKB 1UFMA 1ZGAA 1SD6A 1HSJA 4HLYA 2IW5A 1U5TA 1U78A 2MA3A 2O61A 1V4RA 3DEUA 1J75A 2VN2A 3SFZA 4I0AA 1XGMA 4RS8A 4WX9A 3ROUA 4DQ2A 1ONVA 3F6VA 2GWRA 4G8XA 2P6TA 4OIOF 2EV5A 2VBWA 5DCFA 1FBQA 2O0YA 2CWEA 3ISPA 3I0TA 1IXRC 4G9YA 2ZO4A 5TRDA 4RAYA 3K69A 3F6OA 3U1DA 3DFGA 2DT5A 2MLKA 1E17A 4KN7X 1H9GA 4RGRA 1ZRCA 4EJUA 1ZLJA 1R36A 4YIIA 3MZYA 3G3ZA 2QBYA 1W7PA 1TTYA 1S7AA 3VEPA 4IRIA 3BJOA 1RI7A 3J80K 1K78A 1C0WA 3R61A 4KIBA 4AIKA 3RPUA 4ZYEA 4ENJA 3JSOA 1Z6TA 1MDMB 1O3QA 1HW1A 4HF1A 2HKXA 1U5TC 2DK5A 2VBXA 5F64A 3P9CA 1BI2A 3I4PA 3GYHX 3LA7A 3FXQA 4UXNA 2AXLA 3QOPA 5E1XA 2ISZA 4ESBA 2MH2A 2D45A 1Z7UA 4I98B 3F8NA 1XSVA 1K6OA 4KYWA 1IUYA 4YIFA 1SFXA 2CGPA 3REOA 4LLGF 3I53A 3RI4A 2VOOA 1JHHA 3LA3A 1XGSA 3L2CA 1SMYF 2W84A 2RNJA 4BHCA 4UVAA 2H94A 3DV8A 4OIRF 1YG2A 2VT3A 2VBYA 2FMYA 3D5LA 2H27A 1XMAA 2M5WA 3FMQA 1ZGJA 2RC4A 3E3VA 4LB5A 5ICGA 5L3EA 3MFKA 2PLYA 3BDDA 4GYGA 1KU3A 5D8LB 3H92A 2CFXA 4A0ZA 2O03A 2KJBA 3VB2A 4GCVA 1KYZA 3JSPA 1XDUA 3SQNA 2FE3A 4KFCA 2XROA 5LRRA 3L09A 4O6JA 3HYIA 2XKPA 3HHHA 4YG2F 3E5QA 1P4XA 3KP5A 4U88A 2E1NA 2PQ8A 2FBHA 3FZVA 2DTRA 4KA4A 1Z9CA 3V8JA 4EJWA 4P55A 3M8EA 3RYPA 2FRHA 4PGHA 1WI9A 4L5IA 2A61A 2XUBA 3DQVC 4XSXF 2K86A 5LLQA 3N4MA 5LGUA 2P5LC 3L00A 2FF4A 1OYYA 4G6DA 1E2XA 3C7JA 4UV9A 4P9UA 1QZYA 2P4WA 1PUEE 2OQGA 2XIGA 2QM3A 2ZKZA 2FNPA 1FLIA 2L4MA 4WXDA 1TNSA 5ERIA 4U7BA 3TKYA 3F3XA 1IN8A 4HF2A 4G7OF 2NNNA 3HOTA 2F5EA 1RZ4A 2ZBKA 4RGSA 4LG0A 3Q5FA 2VODA 2FNAA 4IPAA 4HZFA 1IRFA 5F6FA 5BQTA 1MJ9A 2H09A 3JAMK 1SFEA 2FA5A 5CYVA 3LAJA 2QVOA 3HHGA 3DPTA 4CXFA 5H20A 2DLLA 1AWCA 1BC8C 2M30A 3LQQA 3QU3A 1KA8A 5HDKA 1OKRA 1XSDA 5HLHA 1W5TA 2H6CA 2TDXA 4BQAA 3BROA 3JTGA 2NS0A 4L5JA 3RKXA 2O3FA 4G7HF 3O2PE 3T0YA 1FPQA 3BY6A 3LFKA 2IA2A 2Z5UA 3B02A 2L01A 4BXUA 2Z9OA 1YW8A 1A04A 1I1GA 2VT2A 4GYIA 5J8CA 2IRFG 1B1BA 3MZHA 2G7HA 4BAYA 5FGMA 4MNUA 2L4AA 1T39A 5EEGA 4Q48A 4EJVA 2LSOA 4XRFA 5BMZA 5HOOA 2NRAC 1F1ZA 1X3UA 1OMIA 5CVJA 4IF4A 4P5OA 5ILVA 3QPHA 4MEXF 2P6SA 1T98A 2PMHA 4KT5C 4RB2C 4B8XA 4M72A 1IN5A 1G3YA 3RDIA 4EJOA 5LHGA 1KQ8A 4L9TA 1TQPA 2L3DA 2ADUA 2EV0A 3R0AA 4Q47A 4AVPA 5EEHA 2VC0A 3CTAA 3KEQA 1KGSA 3CJNA 1LJ9A 1D3YA 1EH7A 2ZCWA 5ICCA 1USSA 2UXXA 5E8GA 4HW0A 4LGWA 1Z1DA 2A07F 5BOXA 3O3KA 3TQNA 2XHKA 3DXJF 3GW2A 4DNCA 4A5MA 1KU9A 3H3UA 2JSCA 1RNLA 1FNNA 1XSXA 1I27A 3EYYA 4JK1X 1HKQA 3M9AA 3U2RA 2KIMA 1WRJA 3Q9VA 4CGZA 2FOKA 1XGNA 3GFLA 4LG0B 1B9NA 3GFMA 1U6GA 1YO5C 2EK5A 1G6NA</