2IA1A

Crystal structure of protein bh3703 from bacillus halodurans, pfam duf600
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
169
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords BH3703 protein
publication title Structure of hypothetical protein BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
total genus 58
structure length 169
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia1A02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 2ia1A01
2WV0A 4ZYGA 3KLOA 3GFIA 2PMUA 2B0LA 3R0JA 4FX4A 2XROA 5K1YA 3W6KB 5FGMA 2XKOA 4RS8A 3HTSB 2QWWA 3ZN0A 3HTUA 4UV9A 2K86A 1IUYA 1WRJA 5HS8A 1ZREA 4R79A 1F1ZA 5CLSA 1U5TB 3GFMA 1K7AA 2KKOA 1BOAA 1XCVA 5LRSA 1OPCA 3CUQC 4IVNA 3J81Z 3TO7A 2EFPA 3J7AO 1T39A 4AIJA 1STZA 1OR7A 2QZ8A 1S3JA 3BPXA 1T6SA 3V8KA 3DP7A 4KIGA 5ICFA 2VODA 5DUKA 1FWZA 4EJWA 3K1NA 2NNYA 2P4WA 3WG9A 2HYFA 2MC3A 1YS7A 3KLNA 3WGGA 4MEXF 2PN6A 4I0BA 3O6BB 2QQAA 1U5TC 1BM9A 2ZKZA 1BIAA 4LLGF 2KJCA 1ZARA 2JT1A 3ZP5A 1ZRDA 4A0YA 2ZMEB 4OMZA 2Q8KA 4U0WA 4HLXA 2DBBA 3BJ6A 2HR3A 2MBFA 1TLHB 4G94A 4N9IA 2DPUA 5DCMB 4L5IA 2VBXA 4EVIA 1GXPA 3F21A 2KRFA 2JPBA 4H0EA 4B8XA 3ABTA 2DQRA 2IA0A 1IRGA 1Z1DA 2RVCA 4P5OA 1J2XA 1WSUA 2ZXJA 2ZCWA 3L09A 5CYVA 2O6GE 2A6EF 2RGVA 2RKHA 4EQQA 2CYYA 3VFZA 4L5JA 3GO5A 5E20A 4GO1A 3FMSA 1ZLJA 2ZNYA 3QP6A 1BN5A 3E6CC 2Z33A 2JPCA 1SFUA 2CFXA 4HX8A 4LB5A 2F5CA 5E17F 2O03A 3B02A 2VE9A 3GYHX 2UXNA 1FC3A 4I09A 5DYMA 3IKVA 3ZMTA 2EFWA 4BNCA 3HOTA 1V3FA 4GYGA 2NNNA 4S04A 1SD6A 1WWXA 3ZQ7A 4Z2YA 2E1NA 4M9XA 1J5YA 4XLNF 2E1CA 4MGRA 2HKOA 2MLKA 3DFGA 4M6XA 1IN6A 5HDNA 4Y13A 4ENMA 1JXSA 2FMYA 2PJPA 2HQNA 2LNBA 3GWZA 4MNUA 3CLOA 5FLXZ 3F6OA 1QZYA 3CTAA 4NB5A 5A2QZ 4K2EA 3H3ZA 3N97A 4CHUA 2M5WA 1V4RA 2E7WA 1TQIA 3QPHA 2L4MA 1HXDA 2FF4A 4KN4X 1BBYA 3EDPA 5JHUA 1HSJA 3ELKA 2DK5A 2L3DA 1B9MA 2HWVA 4KFCA 1J0RA 3DPTA 2DT5A 4A6EA 3LWFA 2IA2A 5ERIA 3DKWA 2DK8A 1HBXG 3E97A 3SXYA 1G3SA 1EH8A 2RNJA 4QLCU 1QGPA 4HQEA 5FO5A 3DEUA 2NAZA 2BYVE 4UVBA 1MD0A 2BGCA 5KVRA 2K4JA 4ZYEA 2UXXA 3M9AA 1IN4A 4N9HA 4PCQA 2J5OA 4A0ZA 3J80Z 2KIFA 1L0OC 2HDCA 3HRMA 1SFXA 4PZJA 4ESFA 1O7LA 2OAZA 3I59A 2H27A 2P6TA 1YW9A 4A12A 1XD7A 3KE2A 2Z5UA 1MDMB 4LB6B 4HOBA 3LQRA 5HVQC 1KU7A 2G7HA 2P5VA 3I58A 2RC4A 1ZRFA 1MKMA 3JSOA 4FHTA 3P9CA 2QYOA 1TQMA 1O3TA 1FP1D 2DPDA 4WXCA 2PFBA 4YG2F 2Y75A 3F3XA 2MH2A 1G3TA 3V4GA 4Q5SF 2BBYA 2OQRA 5ICCA 2EFNA 3QPTA 1U6GA 3RTRA 3L00A 5HS9A 3FZVA 2DQLA 1USTA 2XAGA 4ENKA 3RYRA 2EK5A 3QAHA 3BJOA 3E5XA 1MJAA 3WE3A 2HGCA 1DDNA 3HUGA 1ZG5A 4EGZA 3T8TA 3SHFA 4BHBA 5E8IA 1BIBA 1R1UA 3RJPA 4U7DA 1BI0A 1ZAOA 2VC1A 4I7HA 4I0AA 4L18B 2V1UA 1AOYA 2ELHA 1TW2A 4FT8A 1ZLKA 5D4RA 2VBWA 1LDKB 3V7CA 5D8LB 3BY6A 4RGRA 4PGHA 2GQQA 4XSZF 1S29A 1DP7P 2W84A 5L3BA 1IAWA 4OIQF 2XASA 1FBUA 3JAMZ 1RIOH 4U0YA 2PEXA 2J5PA 2ISYA 3QP5A 3RDIA 3TDUC 1IN5A 2BEOA 2O61A 2E7XA 5TRDA 3PFIA 3KZZA 4IPAA 3GF2A 5HLGA 4LG0A 2JTVA 2VC0A 3KP6A 2ZBKA 3QOPA 5HOOA 5L3EA 4WF2A 3R4KA 4LMYA 1U8RA 3C7JA 1ULYA 2K7LA 3U2RA 3L2CA 3E3VA 3EYIA 4KN7X 2XGXA 5F6FA 2WTEA 4HW0A 2EV5A 5L3CA 4ESJA 3S2WA 1FYLA 3K1MA 1P6RA 2EV6A 2RN7A 5LEJA 2EWNA 4L0ZB 1XMKA 3WE2A 2M87A 3RKWA 1R5GA 2HTJA 2L01A 3FWEA 1ON1A 4OIPF 2M45A 2GIVA 3NRVA 5L3FA 2PMHA 1UCRA 5ED4A 1KQ0A 3O3KA 3FM5A 5J8CA 2W24A 1DUXC 3R60A 2FQ3A 4HLYA 1H9GA 1KYZA 2HS5A 2QENA 1XN7A 2Q0OA 2G7UA 4RB2C 2FBIA 1O3QA 2VN2A 3I59B 4EJTA 1SD7A 4WK8F 1R1VA 2O3FA 3L7WA 1FYMA 3ZPLA 2VOPA 5CVVA 2BV6A 3KFWX 2IP2A 3M7GA 3Q5FA 5FLXK 1T2KA 4O5VA 3RPUA 3T5XA 1YW7A 3T0YA 3I64A 4EJOA 2NS0A 3NEUA 3F8CA 3K9TA 2L02A 4LD5A 3O2PE 3TO9A 5D5WB 2LSOA 1KGSA 4YIIA 1ZYRF 2CW0F 4BHCA 1I5ZA 2HEOA 1S6LA 2MH9A 3WTUC 3KETA 2ACJA 1RNLA 5D8KB 4MEYF 3I4PA 1PDNC 3E5QA 3ECOA 5D5VB 5HDGA 3FMQA 3TO6A 4UV8A 4U7BA 1K79A 3GFJA 3V8LA 4HZFA 4XBFA 2RQPA 1XDUA 4EM0B 1ZRCA 4KT5C 3FXQA 4L9JA 5E8GA 2X0LA 2P5LC 1JHHA 4KMUX 3J80K 5LBQA 1E2XA 3LAPA 1YQAA 4BQAA 4IF4A 2DFIA 5LHGA 4GGGA 1RZ4A 4L9VA 4P55A 4OIRF 1LB2A 2QBYB 3E5UA 4Q4ZF 1USSA 3IL2A 1G4DA 5D5XB 4EJUA 5D4SA 3HRUA 3BJAA 2UWMA 3G3ZA 3SZTA 4KUMA 2W57A 4KYWA 4G7HF 1F9NA 4M71A 1J7KA 3RPQA 1IXRC 2VE8A 1B1BA 2KJBA 2PG4A 4A6DA 5HDKA 4LG0B 4G6DA 4MQVA 1E17A 3BPVA 2XAJA 3CO7C 1OYIA 3HRSA 1PP8F 2ZO4A 4CYDA 4AD9A 4RB3C 1W7PA 1Z91A 2HOEA 4JQFA 4EMSA 4UUVA 3VEPA 3B73A 2HZTA 3K0LA 1R1TA 2UZKA 2VXZA 1DPUA 5E1XA 1FZPB 2FSWA 1MZBA 4GXOA 5LGTA 1W4MA 2Z99A 1HKQA 5HLHA 4AWXB 1SFEA 4U88A 2STWA 1DPRA 4Q48A 4M73A 1WQ2A 2F2EA 1KQ9A 5LHIA 3ZMDA 2V1DA 2XUBA 2JZYA 1J9IA 3RKXA 4P9FA 2XHKA 1CF7A 3L9FA 3JAMK 4HDUA 1YIOA 3VB2A 1FLIA 3JTHA 3WTSC 1ZGJA 1Z9CA 2ZJ2A 2EB7A 2PQ8A 3WTYC 1REPC 2EJRA 4BH9A 3OV8A 4MTEA 1EH7A 4MHGA 3V8JA 5FFXA 1I1SA 2GA2A 4G8XA 4HF0A 3IHUA 5JR3A 5HLIA 1LVAA 2QUFA 1UB9A 3P7NA 5LRRA 5TJJA 4O3MA 2EFOA 1XGNA 1QQIA 1EV7A 1FT9A 5IT3A 2IW5A 1IXCA 1BC8C 1GXQA 1KA8A 4OMYA 1OYWA 3GLXA 3KZYA 2Y48A 3MFKA 2OBPA 4L9NA 3HOSA 2ISZA 4ZZDA 4R8HA 1HW2A 3ZN1A 2GWRA 4JBAA 1W5SA 5FD6A 3FX3A 2QVOA 1PP7U 1S7AA 4OU0A 4A2UA 5BQTA 1L3LA 1B9NA 2CGPA 1GHCA 5JVTA 5H6RA 3EQLF 4KICA 1TTYA 1UFMA 1K78A 4BYYA 3IC7A 5K5OA 1IRFA 3K2ZA 2YR2A 1JHFA 2L54A 4YIFA 5LGUA 1XDSA 1HSTA 2H6CA 3CUOA 2EV0A 2M30A 2D2WA 4RAYA 2A61A 3FHZA 5BMZA 3WGHA 2DAOA 1B6AA 1YS6A 2VT2A 2QQ9A 3F8NA 3ULQB 2VBYA 4A0XA 4UVAA 3AAFA 1R5HA 1IN8A 5DD4A 2A5YB 4BHPA 3IKTA 3R6SA 5BPIA 1KU9A 1D8JA 5CVJA 3M1EA 3RYPA 2XV4S 2CQKA 3IRQA 2FMLA 4RGUA 2C6YA 4MTDA 4WWCA 2O8XA 3J81K 3T1BA 3KP5A 1LDJA 2NRAC 4MQ9F 3FXUA 2LKPA 3Q9SA 1W5TA 3C1DA 3WODF 1BC7C 3ZMSA 2ETHA 2EFQA 1XCBA 5IT9Z 3WU1B 5LGNA 3IWZA 1S8NA 1AWCA 2A69F 1FY7A 4TV7A 2LF7A 1Z05A 3FF5A 4DNCA 2W85A 1U3EM 2XIGA 2FU4A 1BI1A 4KIFA 4HAMA 3R61A 3I54A 2OZUA 1C0WA 4ZYDA 1XSVA 2GAUA 3ZMZA 4GYIA 3JSPA 1XMAA 2JRTA 2M1BA 1FSHA 1ZN2A 3PQJA 5EEGA 3OOPA 5CVIA 4L9TA 4RB1A 1RUOA 3TOAA 2RV8A 1BI3A 4KMFA 1XGMA 3HSFA 5DEQA 4EGYA 4PGGA 2LF8A 3GX4X 3U9GA 5FD5A 3RKYA 1P4XA 4HV5A 4CGZA 4FX0A 3MEXA 1LEAA 4DQ2A 3IRRA 1IW7F 5F64A 5ICEA 1MJBA 4ZH4F 2AS5F 2VONA 2V79A 1ZH5A 1TNTA 5FB2A 2WWYA 1ZG1A 4AVPA 1O7FA 1KYWA 4CDGA 1I27A 3F72A 1O3SA 3HIFA 3F8BA 3BP8A 3ML6A 4HF2A 4IRHA 1F5TA 1B4AA 4IXAA 4HYEA 3SQNA 3P9KA 1QZZA 4IRGA 2Z3YA 1TQPA 3GW2A 2WC2A 2L4AA 3KEOA 3F23A 4YFXF 2XAFA 1T38A 2R7DA 1OYYA 4M9ZA 1R36A 3EYYA 1O57A 2XVCA 2H6BA 3GXOA 2A68F 3ISPA 2HYGD 4CICA 3I53A 3QU6A 5D6FA 4WXHA 1H9TA 5DCFA 3TOBA 2D45A 4ETSA 4LLLA 1RI7A 5AIQA 2FRHA 1ZHFA 3E6MA 3Q9VA 1B59A 3HSRA 5E1ZB 3WU0A 1MJ9A 2P6SA 4E70A 2V9VA 2H94A 2FNAA 5A2QK 2OQGA 2QM3A 3D0SA 4I01A 2DO7A 3F8MA 2DTRA 5KK1A 4ESBA 2G9WA 2FA5A 3LA3A 2MA3A 2MD5A 1LJ9A 3DF8A 4G9YA 5DDGA 4OIOF 1QPMA 1HW1A 4G7ZF 2F5EA 4LK1F 4LGWA 1P2FA 3MAJA 5D6EA 2ADUA 3GVAA 1LEBA 2M8EA 5L3GA 2RDPA 3GFLA 1EH6A 2XAHA 3D5LA 4YFKF 5D5UB 3RIRA 4RGXA 1LDDA 3ZMUA 1F4KA 3ECHA 2ESHA 2XRNA 2F5DA 3KEQA 3C3WA 1SD4A 3COAC 3CJNA 4LFUA 4Y15A 4L0YB 3GUDA 4EM2A 6PAXA 2CWEA 2OU2A 3E6DA 1J75A 2GZWA 1YLFA 3JTGA 4HQMA 1T0FA 2KIUA 2ZFWA 1QO0D 1D3YA 1R7JA 4NQWA 4F7ZA 2EA2A 4Q47A 4LLNA 1Z6TA 3REOA 2W25A 1HKSA 4ENJA 2V6CA 5BPDA 3BDDA 4Y17A 2XKPA 2D1HA 2IA1A 2DW4A 3DXJF 2EA4A 1UHWA 1MDMA 1OKRA 2BE5F 1H0MA 5JFRA 2YX7A 2HKXA 4A5MA 1FYKA 4XLPF 3BZ6A 4UVCA 3M8EA 1ODDA 3GEZA 4P9UA 3MZHA 2IVMA 2H09A 2QLZA 2VBZA 3KP7A 4G6QA 4OOIA 5ILUA 4P96A 2P7CB 4EM1A 2PLYA 4OINF 4HBLA 1HQCA 2YPRA 5IT9K 2GXGA 4WCGA 2GXBA 2HQRA 2VOOA 4IRIA 3MCZA 3HSEA 2STTA 4G7OF 2LDUA 3MQ0A 3V7RA 1FX7A 5H20A 1TW3A 2PI0A 2NYXA 4AIKA 1LNWA 3HHHA 1Z6RA 4PDKA 4HV6A 2Q2EA 2YSRA 4HA8A 1YYVA 3MZYA 2FXAA 2JSCA 2AXLA 2K02A 3CO6C 5LLQA 1T98A 2A6HF 3NQOA 2O0YA 2ESNA 2K27A 4GCVA 1K6OA 1XGOA 1FNNA 3WTXC 3I71A 2FE3A 2VT3A 2OA4A 1Y0UA 4M9SA 1U78A 2FOKA 4O6JA 5JI6A 2A3SA 1P92A 5E1WA 1VTNC 1W7PD 5FFZA 3IWFA 1SMTA 3FXRA 5CJ9A 4ZZLA 1YFHA 1YO5C 3FMRA 2ZNZA 2P7VB 3I5UA 3LA2A 3VOEA 2IJLA 3HRTA 3DQVC 3ERED 3V7SA 4KIBA 4D0PA 2FBKA 4CZZA 1RUNA 3KCCA 1YG2A 3WTVC 3K69A 1FBSA 3GZ5A 2OZ6A 1G3WA 3K1PA 3ZMVA 4I2OA 1P4WA 1BI2A 4R1HA 2QQBA 1Z7UA 1X3UA 1FBQA 4AIHA 3WTWC 5EEHA 2P5KA 5K5RA 1ZG3A 1KQ8A 1U2WA 4HDVA 5J6XA 3KP4A 4A5NA 1D8KA 2P8TA 3WTTC 2COMA 3QRFF 2YX4A 1P4AA 1I6XA 3SFZA 1G6NA 1A04A 3BWGA 5ICGA 3CUQA 1WI9A 5ILSA 3MWMA 4CO8A 4LJZF 3BROA 4IHTA 3R0AA 4M6YA 4ZYHA 3H92A 2R7FA 3LSTA 4EJVA 1CGPA 1ON2A 3F8FA 3HHGA 4HX7A 2HFHA 1OMIA 3RI4A 2XAQA 1GVJA 3BOQA 1MGTA 4ENNA 1JE8A 1R22A 2TDXA 4RGSA 3G73A 4XRFA 2Y0MA 4ASNA 3N4MA 3U1DA 3LFKA 1I1GA 1W7PB 4U0VA 4QWQA 3C18A 2F5FA 2OD5A 1U5TA 4I02A 3DPLC 4JK1X 3QU3A 5F1RA 3HYIA 4M72A 4WXDA 2D1VA 5LEKA 3VODA 4EV0A 1NHAA 2R3SA 2CG4A 2DI3A 5AONA 3F22A 1KU2A 3WGIA 3LAJA 1R23A 4CXFA 3DV8A 2YU3A 1J59A 2MLGA 4WX9A 3EUHA 1FP2A 1QBJA 1TNSA 3PQKA 4N0BA 3H3UA 1UHMA 4KNYA 2IT0A 4ON0A 3ABUA 4I98B 5CVRA 3TKYA 1S7OA 4XSXF 1R58A 5AIPA 1TBXA 2X4HA 1WKMA 3WTZA 1CF7B 4YFNF 1PUEE 3GZ6A 5LHHA 1YTYA 4HF1A 2FEZA 4KDPA 1IN7A 1SD5A 4S05A 2Z9OA 5H6QA 1O3RA 1D5VA 2QBYA 4UNOA 1LQ1A 3FM3A 1IZ1A 5BS6A 2A07F 3JW4A 2ZMEA 4B09A 1SMYF 3LA7A 2V1XA 5BOXA 3I0TA 2KIMA 1R00A 2CO5A 4NHJA 5DCMA 2GA1A 1JGSA 5DD8A 3T8RA 2IRFG 1ONVA 5J8FA 3F6VA 1YW8A 3KP2A 5DV5A 1Q1HA 2IPQX 3ROUA 2DU9A 4IJAA 4BAYA 1QNTA 2FBHA 3SZPA 5ILVA 5DUIA 3TDZC 4HX4A 1IF1A 2K4BA 1XB4A 4IHSA 4UHTA 3CDHA 3W6JB 4UXNA 2CSOA 2FNPA 2DLLA 1FOKA 5L3DA 5K5QA 1K78B 1FSEA 3E6BA 3M8FA 2PBIA 1XGSA 1HW5A 3TGNA 3P9IA 5CVUA 1XSXA 4BXUA 5E18F 4LK0F 1BJAA 4RB0A 3CUQB 1XSDA 1ZGAA 4KA4A 1SAXA 1KU3A 4M74A 2HTSA 3EETA 1FPQA 5HS7A 3LQQA 1G3YA 3TQNA 1HKTA 1IXSB 4RAZA 3KP3A
chains in the Genus database with same CATH superfamily
1UG0A 2CLRA 2WV0A 4ZYGA 3KLOA 3HOZJ 2EPFA 1S7UA 3A03A 2WA0A 1T20A 3OYIA 3GFIA 3I6LD 2PMUA 5J1AA 2B0LA 3R0JA 4FX4A 2XROA 4RLQA 5K1YA 3RQIA 4MLOA 3V5DA 2VASA 3W6KB 5FGMA 2XKOA 4RS8A 2DT7B 3HTSB 3CP8A 3L2VA 4PGEA 3TBTA 2KP6A 2QWWA 3HTUA 3ZN0A 2R5YB 4UV9A 1W36D 1WJEA 3JVGA 4HWZA 2K86A 1IUYA 2Y9ZA 5FKNA 1MNMC 2CUEA 4XLHA 4PG2A 1WRJA 5HS8A 3TO4A 1ZREA 1OFCX 4R79A 1T0MA 4CYCA 4LNRA 1TT0A 3JRDA 1F1ZA 4XN3A 3AG3H 3UTSA 5CLSA 4N4NB 2GJ6A 1QHHD 1U5TB 4RAGA 3GFMA 1K7AA 2BOLA 3VFUA 1DP3A 2KKOA 4HNVA 5C0IA 3ECBA 1BOAA 3QQ4A 1XCVA 5LRSA 1OPCA 3ZRGA 2L5QA 2UV1A 2VE6A 1F36A 3NWTA 4A3KJ 3SFIA 3OMYA 4J01A 3KZIC 3CUQC 2BVPA 1YX3A 3BG9A 2N8GA 1ZR4A 4IVNA 1ZTRA 5F04A 5F9JA 3J81Z 3TO7A 2EFPA 5F0HA 1R71A 3J7AO 3G6EI 2L7MP 2ZSVA 1ETWA 2CV0A 1T39A 5MEOA 3N05A 5E3LA 1D0XA 1SYSA 4AIJA 1STZA 2DMPA 1OR7A 4DZPA 2QZ8A 1VQ6I 1S3JA 1ED3A 2JRMA 2LR8A 1FFPA 4U1HA 3W2AA 3BPXA 3RSNA 4F91B 5E9DA 1T6SA 1RKWA 3V8KA 5K7ZA 4GUPA 3DP7A 3MROA 2QQ8A 3VFSA 4KIGA 4Z78A 3DBHB 2EZKA 3KPSA 2KRCA 5ICFA 3HM5A 3MKYB 2VODA 4A93J 1IG7A 5DUKA 2DA7A 2Z1DA 1VZ0A 2DA3A 1TVHA 1FWZA 4EJWA 1ZR2A 3AM8A 3KLAA 5IB2A 4NDLA 3M07A 3K1NA 3KYCB 1LP9A 1KPRA 2NNYA 1NK2P 2P4WA 3WG9A 2HYFA 2MC3A 1YS7A 3E7LA 3TEDA 5K7HA 2HN7A 4PJLA 2IGKA 3KLNA 3WGGA 4MEXF 1S7WA 2PN6A 3HKZN 3HL2A 1ZHBA 3P4MA 5C44J 4Y3OA 1IGNA 4I0BA 3O6BB 2QQAA 5KCMA 1U5TC 1BM9A 4IKFA 4A3LJ 2EILH 2ZKZA 4AU7A 1BIAA 4LLGF 4O2CA 1LEGA 2GTWA 2KJCA 2ZXIA 3ONQA 5FA4A 1ZARA 2JT1A 4CH7A 3ZP5A 2FIKA 1ZRDA 4A0YA 3OSGA 3FQRA 4C2UA 1S7TA 3OYBA 1XMXA 4NO5A 1BA5A 2ZMEB 3CF2A 4JYKA 4OMZA 3CC4I 5IYCJ 2Q8KA 1FZOA 4ZDPA 4U0WA 3BHBA 4HLXA 3ABLH 3BLYA 1DU0A 2DBBA 3LSKA 1IDYA 3BJ6A 3T1FA 3V5KA 2HR3A 3H35A 1Y56A 2MBFA 4C30A 2CW8A 1MW7A 2CRGA 1TLHB 4G94A 3H7BA 2B9SA 3PIPF 3KPLA 4G42A 3I4MJ 1A9EA 4N9IA 5KAFC 2DPUA 5HYJA 5DCMB 4X6EA 4PJEA 3EUHC 5IYDJ 2JN6A 3LSJA 4XRMA 4L5IA 2GM4A 2VBXA 4EVIA 3G08A 3L2WA 4PRBA 4FISA 4P1WA 3F21A 1LFUP 1GXPA 2IGOA 2KRFA 2AV1A 2JPBA 1Z3YA 4H0EA 4L3EA 1MMGA 2KPMA 4B8XA 3ABTA 3OYFA 1I6HJ 4A3JJ 1MBGA 2DQRA 5C0JA 1WBYA 2DFEA 1OCOH 2IA0A 2IS1A 1IRGA 1Z1DA 2W1OA 2MG4A 1IUFA 2RVCA 1LE8A 4P5OA 1J2XA 5GAGJ 4QSHA 2VXDA 1JT6A 1WSUA 2ZXJA 4XXCA 1FTTA 2ZCWA 3FKJA 3VYUB 2DFHA 2M7AA 3L09A 3JRCA 3KPOA 1WJAA 2BHZA 3VYSB 2X4RA 5CYVA 1BZ9A 2O6GE 1XH3A 5J6HA 2A6EF 2RGVA 4XONA 2RKHA 4PRDA 5C07A 1MBFA 2EINH 1DUYA 4EQQA 3J7ZI 2BNQA 1JKPC 4Z77A 1HSBA 4NSKA 3M4OJ 2CYYA 3VFZA 4L5JA 1T1ZA 2R7SA 3VJ6A 3GO5A 2XRLA 3FXJA 2HNHA 4GO1A 5E20A 2E36A 1N78A 3FMSA 3RZDJ 1ZLJA 4UY8I 5IEKA 2ZNYA 3U21A 3ILPA 1TP4A 3QP6A 4M3BA 2ZMEC 1BN5A 3JCUC 2QKMB 3E6CC 2Z33A 2JPCA 3BEWA 1SFKA 4G8GA 1SFUA 2CFXA 3ZQLA 5EZHA 4HX8A 5GP9A 4LB5A 5E8PA 4Z76A 2F5CA 1R9TJ 3X13A 5E17F 3L3IA 2O03A 3B02A 2VE9A 2UXNA 1FC3A 4I09A 5DYMA 3GYHX 3IKVA 3ZMTA 3BO8A 2L9NA 2EFWA 1VNDA 4BNCA 2K85A 3BR5A 5ACZA 2YUSA 3HOTA 1IM9A 4NBQA 4IZZA 1KTLA 1RETA 3OR1C 4BE0A 2K5CA 1V3FA 1FOWA 4GYGA 2NNNA 4G6TB 1SD6A 3W3CA 4S04A 3ZR8X 1WWXA 3ZQ7A 2GAZA 4BBSJ 4Z2YA 5E3OA 2E1NA 4M9XA 1J5YA 3VXPA 3QODA 4G43A 4XLNF 2E1CA 1KPVA 4MGRA 2HKOA 2MLKA 3HOUJ 1T7ZA 3DFGA 4JP0A 4CCMA 4XL9A 3VFPA 2GOXB 3MA7A 3TO2A 2VPRA 2K9SA 4M6XA 3RL2A 1NG6A 2F54A 1IN6A 5HDNA 4Y13A 4ENMA 3GSUA 2JA5J 3SDAA 3F9KA 1Z0XA 1JXSA 1U9OA 2F4MB 2FMYA 5JVGF 3IH4A 2HQNA 2LNBA 2PJPA 1O4XA 3HOWJ 1VF9A 2X1DA 2KFDA 3GWZA 4MNUA 2CKBH 1RESA 4ZTFA 5LD2C 3CLOA 5FLXZ 2BVMA 3F6OA 1QZYA 4J00A 5B5EC 4PJFA 3LNQA 1X1DA 2YS9A 3CTAA 4NB5A 1T7YA 5A2QZ 1EA3A 4IX7A 2KQRA 1T1XA 2GIZA 4K2EA 3H3ZA 2ID3A 4HG2A 3N97A 4CHUA 2M5WA 1V4RA 4YEJA 2E7WA 4BJ6C 1TQIA 3QPHA 2L4MA 5IB5A 3HC7A 2ZXHA 5J47A 4GKNA 4CYCB 1TT5B 1HXDA 2FF4A 4KN4X 3VSKA 4G12A 1BBYA 3EDPA 4U6YA 2X1CA 1TZLA 5JHUA 1GLNA 1HSJA 3MKLA 3PM1A 2VQCA 3ELKA 2DK5A 4N5EA 2L3DA 3G1LA 1B9MA 1AGFA 3JRFA 1MBEA 2HWVA 4DYCA 2W7NA 4KFCA 1J0RA 3DPTA 2DT5A 5TISC 3FT4A 3MRJA 5EZGA 4BS9A 3TBSA 1HHGA 1V5EA 4A6EA 5GTHC 1YDPA 3FQWA 5FKPA 3VXMA 3LWFA 2IA2A 2KISA 2X4OA 5ERIA 5GTIC 3DKWA 5C4JJ 4II2A 1W5CC 2DK8A 1QZEA 1UAAA 2O7OA 4C3HJ 1HBXG 1XX5A 3E97A 4QRUA 3QQAA 5E3NA 5D7JC 3SXYA 1Z5LA 1G3SA 5DM7F 1EH8A 2RNJA 2JUGA 4QLCU 1PUFA 1QGPA 4IHYA 1R5ID 3OYHA 4HQEA 4QRPA 3PNVA 5FO5A 3U1KA 1OSZA 3DEUA 3GMQA 1SVLA 1AU7A 3HOVJ 2ZC2A 1JHTA 2NAZA 2BYVE 4UVBA 1MD0A 2BGCA 1V5FA 1VQKI 5M3MJ 4XRSG 1E3OC 2CQ7A 2V6EA 3FT3A 2ZSIB 5KVRA 2K4JA 1ZVSA 4ZYEA 3D25A 4K71B 4L8DA 2UXXA 2L9SA 3M9AA 4FCYA 5MEPA 1IN4A 2XGEA 2QKLB 1QLFA 1IV6A 5IP6A 1INQA 4N9HA 4OAZA 2NVYJ 4PCQA 3PQYA 2J5OA 4A0ZA 3MV9A 5J6GA 3GLLA 3J80Z 4O2EA 3D39A 1LFBA 1B3JA 2KIFA 1T21A 1L0OC 4EUPA 2HDCA 3K6GA 5DM6F 3HRMA 2CW7A 3NARA 3Q0WA 1X1AA 5HHNA 1SFXA 4PZJA 4ESFA 1O7LA 2OAZA 3I59A 2VLRA 2H27A 2VJ5A 2P6TA 1YW9A 2M3AA 4A12A 4AM3A 1XD7A 3I56I 3KE2A 3CH1A 2Z5UA 1MDMB 4LB6B 2VLKA 1SANA 4KISA 2VQHA 4ZDOA 4HOBA 3LQRA 4PFOA 4ZFZA 1DE4A 3E6HA 2NW3A 5HVQC 1I1FA 1T22A 3KEYA 5INDA 4E0RA 1VADA 1S5LC 4NQVA 1KU7A 3VFWA 3HEFA 3L9RA 4NC7A 2G7HA 2P5VA 2PX9A 3I58A 3HG1A 2RC4A 4IL6C 1ZRFA 1Z7LA 4B3AA 1MKMA 3L3DA 4PJBA 3JSOA 4FHTA 3P9CA 3H5NA 2HZDA 1OR7C 1JT0A 2QYOA 1NG7A 1TQMA 2IXSA 3UKGA 1FP1D 2CQXA 1SEUA 1O3TA 2DPDA 1LQVA 4PG9A 1S7RA 4WXCA 1X4OA 1XR9A 3FOMA 2F4IA 1RC9A 2ZOLA 4XKWA 2FWOA 2PFBA 4YG2F 3S3OA 4CVZA 2Y75A 4W97A 5E00A 5SWSA 3F3XA 1FZMA 3K4NA 5C0FA 2MH2A 4M3EA 1G3TA 2OV7A 3SDCA 3ABMH 3V4GA 1LFPA 4Q5SF 4Y4RA 1LPQA 3VXSA 2BBYA 5IY5H 2OCCH 5FKOA 2OQRA 2R92J 5ICCA 4JX6A 4PRPA 2DDBA 2EFNA 2OCEA 3QPTA 4E7IA 1U6GA 4BXFA 1WJBA 2FYYA 4F55A 3RTRA 3L00A 3GZNB 5HS9A 3FZVA 2DQLA 4N0CA 1USTA 4F7TA 1QVOA 4NNJA 2XAGA 4ENKA 3RYRA 5J1UA 3QI9A 5H94A 2IGMA 2LLKA 2MC4A 3GMLA 2EK5A 4PP8C 3QAHA 3BJOA 3E5XA 1WCMJ 3GSVA 1MJAA 2JQ7A 3PUBA 2HGCA 3WE3A 4WUUA 1B0GA 1JPGA 2CIIA 1DDNA 3HUGA 1UMQA 3GMPA 1ZG5A 4EGZA 3OR2C 4IEJA 3T8TA 1A31A 4EI5A 1MNDA 3SHFA 4XLCA 4BHBA 5E8IA 3QUKA 3VFOA 1BIBA 1R1UA 2CMPA 3RJPA 4CZCA 4U7DA 3S1NJ 2CUZA 4WWKC 4Y33A 4QRRA 1BI0A 1V55H 1ZAOA 2E35A 2VC1A 2ID6A 2ME0A 4I7HA 3MN2A 4C3JJ 4I0AA 4L18B 2V1UA 2VLLA 2VKVA 3MRCA 3DLLF 1LK2A 1AOYA 2ELHA 3CMYA 3RTQA 3ZXSA 2B7EA 1D1AA 1TW2A 3PNTA 4FT8A 2OJED 4BQQA 4PDCE 3KYOA 2X4NA 1ZLKA 5D4RA 4MVBA 4HRIA 2X1EA 1TVBA 2VBWA 3PO2J 1N25A 2XF5A 4PJDA 1LDKB 4WW2C 1Y0NA 3V7CA 5D8LB 2NVTJ 3BY6A 3KX2A 4RAFA 1XTAA 4PGHA 4RGRA 5E79C 4AUXA 4Y2DA 4FASD 5MEQA 1M1EB 2GQQA 3JR9A 4XN0A 4XSZF 5IPAA 3WS6A 2QSFX 1S29A 2XF7A 3QULA 3JTSA 2TRTA 2W84A 1DP7P 5L3BA 2XSJC 2RREA 3PFYA 4E5XA 2DOEA 2FOWA 1IAWA 1VQOI 2IGNA 4OIQF 2XASA 1PYVA 1FBUA 5GPAA 1A6QA 2XDVA 2R7TA 3JAMZ 1RIOH 1UQSA 4C9YA 2RQQA 4U0YA 5J3LA 3J7AY 2PEXA 2J5PA 4E7SA 3DTXA 1HHJA 1JPFA 2YPLA 3GSNH 2ISYA 3QP5A 2HPMA 3RDIA 3TDUC 1IN5A 2BEOA 2O61A 3L3JA 2E7XA 5TRDA 1MH3A 2ZFUA 2O5RA 3PFIA 3KZZA 4V3DB 4IPAA 4M3FA 3VDXA 3GF2A 5HLGA 1R6RA 3HB9A 3GTQJ 1JE6A 4LG0A 3O9WA 2JTVA 5FA3A 3O3BA 2L9RA 2VC0A 3CP2A 3PSFA 4PRNA 3KP6A 2ZBKA 1EEZA 3QOPA 4B44A 3BXNA 5HOOA 1W0UA 5HNFA 2VLAA 3LSIA 5L3EA 5BJTA 4WF2A 3R4KA 4F7MA 3C9NA 3HG9A 4LMYA 1U8RA 4F92B 2HDDA 2PMZN 3O8XA 3TN0A 3C7JA 2OUMA 1ULYA 4DGWB 4KT6A 2K7LA 3CCJI 4FFEX 4O2FA 1IC8A 3U2RA 3L2CA 3E3VA 3EYIA 1AKHA 5EU3A 4QIWN 1BR4A 4KN7X 2XGXA 2IS2A 5F6FA 2WTEA 4HW0A 2EV5A 3BC8A 5L3CA 3IXAA 4ESJA 3S2WA 1FYLA 3K1MA 1P6RA 2EV6A 2RN7A 3I6GA 3AREA 3FT2A 5LEJA 2EWNA 1PUFB 1TC3C 1RR8C 4L0ZB 1XZ0A 4V2FA 1XMKA 5IB1A 2FJ1A 1GV2A 3WE2A 5FLMJ 2M87A 1HYRC 3JREA 4HPQA 3RKWA 5HHQA 4CUGA 1R5GA 2HTJA 2L01A 2X9DA 3EPZA 1ON1A 3FWEA 2I8DA 4OIPF 2M45A 1ZHNA 2GIVA 4FETA 3ARBA 3TBVA 5BS0A 3NRVA 5L3FA 2PMHA 1EJ9A 4IQJA 4X6AJ 4GKSA 3DBLB 2WY7Q 4XLEA 4CW1A 4CCJA 1UCRA 1KQ0A 3O3KA 5ED4A 3FM5A 5J8CA 2W24A 3ZQGA 1DUXC 3W2WA 1JKQC 1S8DA 4Z6YA 4W1UA 2X51A 3R60A 3LMMA 2K9LA 1BIIA 2FQ3A 2OI9A 3A01B 3HGYA 2HQ5A 5HGHA 4HLYA 1WGXA 5M5WJ 1MIJA 1H9GA 2K9NA 4AIDA 3SYTA 3WLBA 1KYZA 1YPZA 1W1WE 2HS5A 2QENA 1XN7A 1X7QA 2Q0OA 3MRKA 2G7UA 3SEQA 2DMUA 4RB2C 3REWA 2FBIA 2GITA 1O3QA 1KCGC 2LFBA 2OF7A 2VN2A 2VKEA 3CMMA 3I59B 3JRGA 4EJTA 2R7XA 1SD7A 5CKTA 4WK8F 4X0GA 1R1VA 1VQ9I 2F48A 2O3FA 3DXAA 4HV8A 4PJ9A 3W2VA 1X3WB 4PR5A 3L7WA 1FYMA 1NEZA 2X48A 5IVXA 3ZPLA 3RKQA 1IO2A 2VOPA 2X4SA 4D5FA 2WAQN 2X6WA 3DU5A 5CVVA 3EUKL 1Z67A 1T56A 2HVSA 4NNYA 2P0WA 2M9HA 3P73A 5J4VA 1QSFA 2V4JC 2BV6A 3KFWX 5HLTA 1VQ8I 2IP2A 2DYRH 3M7GA 3Q5FA 5FLXK 1Q94A 4JFFA 2LC2A 2EZHA 3DEEA 1T2KA 4O5VA 3RPUA 2LD5A 4L8SC 4MX7A 3T5XA 1B8IA 5C0EA 1YW7A 3T0YA 3I64A 4XR6A 2DOFA 1JTYA 5C3EJ 2O8KA 3OXSA 4EJOA 2NS0A 2F74A 4IRJA 3M8JA 2GXAA 3WL9A 5EUOA 3NEUA 2MGQA 3F8CA 3K9TA 1B0RA 3VFTA 4BE2A 2L02A 3DTEA 1FIPA 3ERMA 1ETYA 4LD5A 3O2PE 3TO9A 5D5WB 2LSOA 2W00A 4OAYA 2HPIA 1KGSA 4XQFA 5J4YA 1K61A 1BW6A 2HOSA 3AU1A 4YIIA 3QDMA 4O3MA 1ZYRF 2CW0F 2D31A 2WAFA 1KJMA 4BHCA 3ASOH 1I5ZA 4AVZA 5GAEJ 4V19K 3RWHA 4RA2A 2GOMA 1ETKA 2HLAA 2HEOA 5JLWA 3TIEA 1S6LA 4RM2A 2MH9A 3PUFA 2FUG2 4BJ5C 1RKTA 3EUAA 1ETVA 2HXOA 2JJ7A 1IV8A 3WTUC 3RWJA 2R93J 3KETA 3OS2A 2ACJA 1RNLA 1OCPA 3OYDA 1VQNI 5D8KB 4MEYF 3I4PA 1Y1VJ 2W82A 4AYBA 1PDNC 3E5QA 2FD5A 3ARFA 3DMMA 1WHUA 3BZKA 3ECOA 1IRZA 1G59A 1POGA 1QA6A 2HU9A 1U0JA 5D5VB 5HDGA 5C4XJ 1HHHA 3FMQA 3TO6A 3VFVA 4UV8A 2CLVA 2NX5A 3BQYA 4U7BA 3OYKA 3GFJA 1K79A 3V8LA 2X70A 4HZFA 4XBFA 3TW7A 3BP4A 3I9V2 2RQPA 1XDUA 4EM0B 1ZRCA 3CMAI 2M8GX 2WB1N 4KT5C 2EIMH 3FXQA 4L9JA 5E8GA 3BR6A 2V1NA 3VWJA 2X0LA 2P5LC 1JHHA 5IM7A 4KMUX 3J80K 3PIOF 1X2NA 5LBQA 1E2XA 3LAPA 5D7LA 3L2QA 1YN6A 3OIOA 1YQAA 4BQAA 4U1KA 4HUVA 4IF4A 1KPUA 2DFIA 3I55I 1OGAA 5LHGA 4GGGA 3H36A 2R7VA 3MRIA 1RZ4A 4L9VA 3P9MA 2CFOA 4P55A 4OIRF 1LB2A 3QYBA 5M5YJ 3CPLA 2QBYB 3E5UA 4RMNA 4Q4ZF 1USSA 3ZCOA 3CC2I 2P81A 3IL2A 1G4DA 2ECCA 5D5XB 4D7NA 4EJUA 2F4OB 2IAIA 3GTOJ 1X1BA 3OYJA 5D4SA 3HRUA 3BJAA 2UWMA 3G3ZA 5GSRA 2EZLA 5HHMA 1Y6IA 1WJFA 3RWGA 1A6ZA 4BY7J 3SZTA 2E71A 3SDDA 3D18A 4JFDA 2BY3A 4UUSA 4KUMA 3L1PA 2VUMJ 3ERYA 2W57A 5C0GA 3HPGA 4KYWA 1FJLA 4PJ8A 2MYSA 4G7HF 1WVRA 2XAUA 1F9NA 4UB8C 2RNGA 1MBJA 2EH3A 4RM3A 1HLVA 2JWTA 4M71A 3KYLA 3ARDA 1J7KA 4L29A 4F7EA 5DTDA 5J1YA 3RPQA 1S9XA 4IQ4A 1IXRC 3BR3A 1VFCA 4LOCA 2DDAA 2VE8A 3SJMA 1TWGJ 1B1BA 3FXLA 5E3MA 3CCQI 2KJBA 2PG4A 4PJCA 1JKOC 4A6DA 3VFMA 5HDKA 4LG0B 2FX0A 3CCLI 4G6DA 4MQVA 2M0CA 3VFRA 1AO7A 1ACIA 1E17A 3BPVA 4MJIA 1MSFC 5M3FJ 3X2QH 3A4CA 4RDUA 2XAJA 3CO7C 1OYIA 3V42A 4B4CA 4IIQC 1BJZA 3HRSA 3SKMA 1PP8F 4U1SA 3FRUA 1KONA 2ZO4A 4XKVA 1R4NB 4AD9A 4CYDA 4RB3C 1SYVA 4PJXA 4QOKA 1W7PA 2BVOA 4G8IA 1Z91A 1AKHB 2CUJA 4XNFA 1Y39A 3HE6A 2HOEA 4L8BA 2ELJA 2E7LE 4PREA 2BVLA 4JQFA 2ZJQF 3C2BA 2MSYA 1T7VA 4L4TA 1YOVB 3ILQC 4EMSA 3VYTB 4UUVA 3VEPA 1X3ZB 2V9PA 3B73A 3RCOA 4DIQA 2HZTA 3K0LA 1R1TA 2UZKA 1BOBA 4C2MJ 3MD2A 4E4HA 2VXZA 1DPUA 1NTCA 5E1XA 2WY3A 3W39A 4A3IJ 3WG7H 4B43A 2VPLA 2P5WA 1FZPB 2FSWA 5E8NA 1MZBA 2H8WA 4GXOA 4NC8A 5LGTA 3TP3A 1W4MA 2X4QA 2Z99A 1HKQA 1FFOA 1WFXA 2AHQA 1FO0H 3LKNA 2BHYA 2H1LA 5HLHA 5IB3A 4AWXB 1RPWA 2J8UA 4PJHA 4QRQA 1SFEA 3HJEA 2VI6A 1BR1A 1K4TA 3SDXA 4U88A 2BSSA 3HUJA 5ENWA 1S7QA 4PV8A 1X2MA 2STWA 1DPRA 4Q48A 3ZQCA 4M73A 1WQ2A 1YITI 3S17J 3I6KA 2F2EA 3BG3A 4N0UA 4C3IJ 3V5HA 1KQ9A 4XOPA 3ZMDA 2V1DA 5LHIA 3KPRA 2XPVA 1S7EA 2JZYA 2XUBA 4A3FJ 3FBNB 1HOCA 1J9IA 4ZJZA 4MNGA 3RKXA 3S1RJ 1ETOA 4P9FA 2JA7J 3LKOA 3BTCA 2XHKA 2E2IJ 3GTLJ 2VKDA 1TWFJ 2K3FA 2LK2A 3FKIJ 3L9FA 1CF7A 1QRYA 1B72A 1VACA 3MRNA 3JAMK 4HDUA 1YIOA 3LSRA 2B63J 3S93A 3PWLA 1GT0C 2E1MB 4WO4A 1D0ZA 2CV2A 3VB2A 3CDIA 4Y16A 1TWHJ 1FLIA 3JTHA 3WTSC 3JRHA 3L3HA 5C0DA 1H88C 5FRMA 5FDWA 1ZGJA 3TF7A 2VL8A 1Z9CA 2ZJ2A 3BG6A 2EB7A 1CQTA 2PQ8A 2R7UA 1I4FA 5C9JA 1MH4A 3WTYC 2XF6A 2DMNA 1REPC 3CJQB 2A5WA 2EJRA 4BH9A 1HC8A 2CUFA 2EBIA 4PRAA 2HVRA 1N75A 3OV8A 4MTEA 1EH7A 4MHGA 5JHFA 1EEYA 4WU5A 3V8JA 4K7FA 5FFXA 3CJTB 4JRYA 1I1SA 1K8DA 2KDOA 3HXLA 2WADA 3M1CA 1T7WA 3SEZA 2GA2A 4G8XA 2NS8A 1G7QA 4HF0A 3CZFA 4U1NA 4II3A 3IHUA 1ITYA 2VJIA 5JR3A 3MRHA 1XS9A 5K7FA 5HLIA 1ERDA 4E7KA 3O3DA 5IP7J 2OL3H 1LVAA 1MNEA 1UB9A 2QUFA 1R4MB 3P7NA 4D0CA 3KYNA 5LRRA 5TJJA 4ONOA 1MMDA 2NOJB 2EFOA 1XGNA 1QQIA 2Y0SA 1EV7A 1FT9A 5M5XJ 5IT3A 2KLOA 1JGDA 2E19A 1X19A 1LDPH 2IW5A 3MGTA 1MSEC 3QQ3A 5C0CA 5IP9J 1RK0A 1M6OA 1IXCA 1A1MA 5F27A 1BC8C 3GSRA 3JRBA 1GXQA 3KPQA 4FTVA 4N0FA 1D1CA 1KA8A 3CJRB 4OMYA 4PJIA 2P5EA 1OYWA 3GLXA 4LCWA 4PV9A 4GRIA 4Y4HA 3KZYA 2NYKA 2Y48A 3MFKA 2OBPA 5EU6A 4L9NA 3MV7A 2XGCA 3G1MA 3HOSA 4I6ZA 2ISZA 2LYCA 3QPSA 3DEWA 4ZZDA 4CCKA 4ITVA 4R8HA 4L3CA 3MRMA 1HW2A 3ZN1A 2GWRA 4JBAA 1W5SA 2E1MC 3LSMA 2R7RA 3HAEA 5E8OA 3ASNH 5BRZA 3D3VA 5FD6A 3FX3A 2QVOA 4V2GA 1LKXA 1RJYA 4MJ5A 1PP7U 3ESWB 2L0KA 1S7AA 1KJ2H 3M17A 1I7RA 2XB0X 2KZGA 4OU0A 4MJ6A 4A2UA 3H0DA 1JGEA 2DA5A 5BQTA 2JA8J 4FE4A 9ANTA 4F7CA 1L3LA 3S32A 1B9NA 3CF5F 2NOGA 2CGPA 1GHCA 5JVTA 5H6RA 3EQLF 3WHCA 1S9YA 1Y1WJ 4KICA 1TTYA 1UFMA 4JOMA 1K78A 3B6SA 4ZUTA 3C2GA 4EN3C 2M4KA 5GADJ 4Y4FA 4BYYA 1VQ5I 1ZT7A 3IC7A 4ZUUA 5K5OA 2I10A 3FQXA 1IRFA 4RBOA 3K2ZA 2YR2A 2R7WA 1JHFA 2GUOA 2L54A 4YIFA 5LGUA 4V3EB 1XDSA 1HSTA 1MMAA 2H6CA 3ZOBA 3CUOA 1BD2A 3NAUA 1WBXA 1ORKA 2EV0A 2JVHA 2HOTA 3RGVC 2XGDA 2M30A 2D2WA 4RAYA 2A61A 3IP4B 3FHZA 5BMZA 1DDHA 4MXQA 4DBQA 3WGHA 2JA6J 2DAOA 1AKJA 2DJNA 1B6AA 1YS6A 1YX5A 2CS3A 4UUSB 2QGUA 2VT2A 3O3EA 2DA1A 1HHIA 3K4BA 2QQ9A 1OCZH 3F8NA 4HSRA 3ULQB 2VBYA 4DBRA 1NANH 4PGBA 3DX7A 4A0XA 3C2HA 2EIKH 4D9JA 4UVAA 3AAFA 3QYFA 1R5HA 2A05A 1IN8A 5F0CA 5DD4A 2A5YB 4BHPA 3FK6A 3R6SA 3IKTA 1YJWI 2AQEA 1KU9A 5BPIA 2ESVA 1D8JA 3GIVA 3OWTA 5EO1A 5CVJA 3M1EA 4QTRA 5B39A 3RYPA 4ANJA 3GTKJ 3QPLA 3CCEI 2XV4S 3BG5A 1IJWC 3HGGA 2CQKA 3BP7A 1ZSDA 2PYEA 1OJLA 3DBRB 3O3AA 1ETXA 3IRQA 2FMLA 4APQA 4RGUA 2C6YA 3K2AA 3CCHA 4MTDA 4BL0B 3CQZJ 3S8PA 1LE8B 4WWCA 3BH8A 1DGRM 3TZVC 4FTHA 2O8XA 3J81K 3UBXA 2X4TA 2A83A 3T1BA 1ZK8A 3O4LA 3VXUA 2OTLI 3KP5A 5D7IA 5FKKA 4Y52J 1LDJA 3ZQIA 2NRAC 5AD0A 4MQ9F 2X4PA 3FXUA 2LKPA 3IV5A 4ELMA 2CQNA 4CSWA 3FBIB 3A0BC 2BY1A 3Q9SA 4NUBA 3A02A 1OCCH 4UQ2A 4A3DJ 1E3HA 1W5TA 3C1DA 4ZAKA 3WODF 1BC7C 3ZMSA 2OC6A 3WUWA 1WH5A 2E60A 2ETHA 2MW8A 1AGEA 2Z16A 1M05A 1TMCA 2EFQA 1W0WA 5D5MA 2LY9A 3MV8A 1GZPA 1XCBA 3S1MJ 5IT9Z 2QSGX 1K6YA 2L9VA 3WU1B 3LN5A 5LGNA 1WJCA 3IWZA 2IBDA 3L2RA 5J40A 1S8NA 1AWCA 2V7FA 1P7QA 2A69F 2V26A 1RK1A 1FY7A 4TV7A 4BEHA 2LF7A 1HF0A 4X6DA 3TIDA 4PGDA 3FXOA 1Z05A 3FF5A 2EQRA 1XG1A 4DNCA 3LOCA 4A69C 2W85A 1U3EM 1S9HA 2XIGA 1T1YA 3X14A 1WPKA 1BI1A 2FU4A 4KIFA 5DDHA 1IRXA 3SDBA 4HAMA 1EXUA 5GPCA 3R61A 1H89C 3H5AA 3PSIA 3I54A 2OZUA 1G8XA 1ZS8A 2CJJA 1C0WA 4ZYDA 3FDYA 1XSVA 1HSAA 3BZFA 2GAUA 3TL4X 3ZMZA 4GYIA 3BTLA 3JSPA 1XMAA 1H8AC 3HOYJ 2AXTC 3TA3A 2JRTA 3FHNA 2YPKA 1XC5A 3RWEA 1JUMA 3CDGA 3FK7A 5BXFA 3CCSI 3GSQA 2HQAA 2M1BA 1FSHA 5HODA 1S7VA 4JRXA 3VXRA 3OYEA 1ZN2A 3PQJA 5EEGA 3OOPA 3AFHA 2R7QA 1I7TA 4XICA 5CVIA 4L9TA 4RB1A 1MWAH 4RLFA 2NS7A 3LFUA 1RUOA 2L7FP 1G2HA 3TOAA 2RV8A 3DX8A 4G59A 1BI3A 3H1CA 2RAEA 4KMFA 1UJ8A 3P5JA 1XGMA 3CCRI 1E0EA 1C16A 1P7IA 3L3KA 2ECBA 4JX4A 1LD9A 2LP0A 1D0YA 4BGDA 5L2KA 2NXNB 3HSFA 1APLC 2H26A 5DEQA 2X6YA 3DCFA 4EGYA 2LKXA 4PGGA 2K9MA 2LF8A 3GX4X 4LITA 1MMNA 3LKQA 3U9GA 1LUJB 4PFPA 4BKWA 5FD5A 1QO3A 3Q3SA 2E5NA 4IOCF 4HX1A 1UZCA 3B6CA 3Q0UA 3RKYA 1P4XA 4H4KC 4HV5A 4CGZA 3LKRA 4FX0A 4YIRX 5B38A 4WJ5A 3MEXA 3VPRA 3RWFA 4IHXA 3MRFA 3W6VA 5SWQA 1LEAA 4DQ2A 3IRRA 1HHKA 4Y7NJ 4BDZA 1IW7F 1I1AA 3MRPA 2H6PA 4MQ7A 4D5CA 1I7UA 3X11A 5F64A 2LBFA 1MJBA 5ICEA 4F7PA 2NVUB 4ZH4F 3FONA 2AS5F 2VONA 2V79A 1ZH5A 1TNTA 3HZJA 4JQXA 1VI0A 5FB2A 2BVQA 3VRJA 5HGBA 3GCMA 2WWYA 1ZG1A 3PO3J 2GTZA 1I3AA 1OGTA 4AVPA 1O7FA 1KYWA 2E5ZA 3GSWA 4NC6A 3RQ4A 4JFQA 4CDGA 1I27A 3F72A 4PJ5A 1D5YA 1O3SA 1SAUA 3HIFA 5TGTA 3F8BA 4MFEA 3BP8A 3ML6A 4HF2A 1I3QJ 4IRHA 1F5TA 3FISA 1B4AA 4XLFA 4IXAA 3FQUA 5C08A 2ZSHB 4HYEA 3P9KA 3SQNA 1QZZA 2D5VA 1JI8A 2EIJH 4IRGA 3BCBA 2LRDA 2Z3YA 1TQPA 3DU6A 3GW2A 2WC2A 2FZ3A 2L4AA 3AG1H 3KEOA 3CZ6A 3MMYB 5EGOA 3QDJA 3F23A 4NHUE 2KL4A 5FKMA 2Y2ZA 2AV7A 3O8HA 1P7JA 2Y0SN 4A3EJ 4WU7A 4YFXF 1UXSA 2XAFA 2IEKA 1T38A 3OV6A 5HNHA 3QZWA 1SVOA 1Z3XA 2R7DA 5B1BH 4CCLA 1OYYA 2ZB9A 4M9ZA 1YRNA 3BEVA 4ZTJA 4PRIA 5B66C 4PJJA 1X1PA 3HE7A 1R36A 3EYYA 3G4SI 3J7YJ 1O57A 3D5SC 2XVCA 2H6BA 3GXOA 2A68F 3ISPA 4QPOA 2O9LA 2HYGD 4CICA 3BTJA 3I53A 3QU6A 5D6FA 3RL1A 2R4GA 4WXHA 4XKBA 5JLXA 3UR3C 1T8IA 4NQEA 1H9TA 1AA7A 2V2XA 3RWIA 1ZKGA 5DCFA 3TOBA 3KYDB 2D45A 3PWNA 4YRVA 1BL0A 4BY1J 3OYCA 4ETSA 4LLLA 1RI7A 3H5RA 5AIQA 4ZUSA 1ZAGA 2DOAA 1A5JA 2FRHA 1ZHFA 2DFFA 3E6MA 3Q9VA 3FTGA 1B59A 3OYMA 3HSRA 1MMSA 4JFPA 2HVQA 5E1ZB 1U9NA 3WU0A 1MJ9A 2P6SA 4ABZA 4E70A 5IOZA 2V9VA 2H94A 3SZGA 2FNAA 4D1QA 1UELB 3BTIA 5A2QK 3MZ8A 2OQGA 2QM3A 4EATA 3D0SA 1YHQI 4I01A 2DO7A 3M3YJ 1VQ4I 3GTPJ 3NFNA 1G7PA 3F8MA 3QOEA 2DTRA 1MBHA 2ZJRF 3WS3A 5KK1A 4DYQA 4HSTA 3LL7A 4ESBA 3KWWA 2G9WA 2FA5A 3ARGA 3LA3A 3MREA 2MA3A 2MD5A 1ZT4A 1UG2A 2E2HJ 1LJ9A 2Z2SB 3DF8A 3IAM2 4G9YA 2PJRA 1EFXA 5EO0A 4BKXA 3GSXA 5DDGA 5EEAA 2X6OA 4NQCA 3OS0A 3S1QJ 4OIOF 4PUSA 1QPMA 1JJ8C 1HW1A 3K10A 5J1RA 3O8GA 2NVXJ 4G7ZF 2F5EA 4LK1F 4LGWA 1F43A 5FJ8J 1JUSA 1P2FA 3MAJA 5D6EA 4E7ZA 3UPRA 1S9WA 2ADUA 3GVAA 1LEBA 2LMDA 3GMNA 1IDZA 2M8EA 1RR7A 5L3GA 1TL8A 2CQQA 3B6AA 2RDPA 5FLVA 1PQZA 4PGCA 3GFLA 2E34A 1EH6A 5EFIA 3SDGA 2Y69H 2XAHA 2M34A 3D5LA 4YFKF 3K7AJ 5D5UB 3AG4H 4XOTA 2HOAA 4M3GA 2OTJI 3RIRA 4RGXA 1LDDA 3G71I 3HUGB 3ZMUA 1HDDC 1J09A 1F4KA 3ECHA 1JUFA 3ES6A 2X6XA 2VJ4A 2M0MA 2ME6A 2M2EA 3IAS2 4U6XA 1MHCA 3K4LA 2ESHA 3BZCA 4M3DA 3SPVA 2JVGA 2XRNA 1EF4A 1N5AA 4ZDLA 2HJLA 2L7KA 4BEHB 4DJAA 3RZOJ 5EU5A 3H9GA 2F5DA 3DWLE 3DPUA 1LVKA 3MKWB 2K40A 1WI3A 3KEQA 2YU9J 3C3WA 2F6CA 1SD4A 3COAC 3CJNA 5F08A 3I3LA 4LFUA 4Y15A 1KJ3H 4L0YB 1JUPA 3GUDA 4EM2A 1T7XA 2DA6A 2CWEA 6PAXA 3PWJA 1JF1A 1QEWA 3BR2A 1ETQA 1VQMI 2OU2A 3E6DA 1J75A 2ZXWH 4F3QA 3DKXA 3IH3A 2XPGA 3S2DJ 2GZWA 1YLFA 3JTGA 3GBGA 1NK3P 4HQMA 4HNTA 1T0FA 4F52A 3RPUD 2HYJA 2KIUA 2W48A 2ZFWA 3FXKA 4M6VA 1QO0D 1D3YA 1R7JA 4HNUA 4LG3A 3LN4A 2KIQA 4NQWA 2XFXA 3IH2A 3TP0A 4AC0A 4F7ZA 3VXOA 1WZ2A 3JRAA 5HHPA 2EA2A 3QWLA 4Q47A 4LLNA 3DBXA 3P77A 5ISZA 1HCRA 3L3GA 1Z6TA 4NQXA 2JCCA 3REOA 2H1KA 2W25A 1X4PA 1HKSA 4XORA 3G1OA 4ENJA 1XR8A 2HDWA 2V6CA 5BPDA 3I4NJ 3BDDA 2FO4A 3ZGKA 4L9LC 4Y17A 2XKPA 2D1HA 3MRLA 2IA1A 1FZKA 2DW4A 3DXJF 4U1JA 2EA4A 4JFEA 1UHWA 1KZHA 1MDMA 1OKRA 2BE5F 3HCVA 2JMWA 1HA8A 3U0PA 1H0MA 1ZHKA 2W4SA 4XRSA 4E7JA 3LKPA 4DW6A 1OCTC 5JFRA 2YX7A 2CIKA 2QEXI 4KJZA 2HKXA 1L8JA 1U58A 3T8XA 4X6CA 3OX8A 3TW6A 1E28A 4A5MA 1FYKA 3ZQHA 3HLAA 3B3IA 3FFCA 4XLPF 3H9JA 3PWUA 3BZ6A 2YEZA 4UVCA 3M8EA 2MFZA 5INCA 4N8VA 1ODDA 4BU2A 1ENHA 3BH9A 3H9QA 3GEZA 4BACA 4P9UA 1MHEA 3DX6A 3AG2H 2L2OA 3FOLA 2Q7YA 3MZHA 1MI5A 3E0JB 2IVMA 3FQNA 2H09A 1ZQ3P 3RZCA 2QLZA 2LBFB 2F53A 2VBZA 3KP7A 4G6QA 2X85A 4OOIA 5ILUA 4P96A 5EG0A 2P7CB 4U1LA 4EM1A 2PLYA 4OINF 2WBMA 2RFXA 2BSRA 4HBLA 3KPMA 2DYPA 1HQCA 2YPRA 2KZVA 5IT9K 2COBA 2GXGA 4WCGA 2GXBA 2BY2A 2HQRA 2XC7A 1PJRA 4ZUWA 2VOOA 4IRIA 3MCZA 3HSEA 3CC5A 2DYSH 2HXIA 2STTA 1Z21A 3RWDA 3DTKA 3LSGA 3TBWA 4IHVA 3VCLA 4G7OF 2LDUA 2R5ZA 1JKRC 1E3PA 4G59C 3OL3A 3WHBA 3MQ0A 1FIAA 1NH3A 2CU7A 1WJDA 2BXYA 3V7RA 3VH8A 1YN7A 4IHOA 1FX7A 5H20A 4BQNA 3VWKA 5EGOB 3ZQFA 5FROA 1T33A 1TW3A 2PI0A 1ZT1A 2NYXA 4AIKA 1LNWA 3HHHA 1R49A 1QVTA 1Z6RA 2DN0A 4PDKA 4HV6A 1FFNA 2Q2EA 2DMTA 4PJMA 1YRNB 2YSRA 3MRDA 4HA8A 2BCKA 3TFKA 1YYVA 2TCTA 3BGMA 4HUWA 3MZYA 4HEA2 2FXAA 3OS1A 2JSCA 2AXLA 3OYNA 2K02A 5GSVA 1IM3A 3CO6C 5FKLA 5LLQA 1EKEA 2DTZA 1T98A 2A6HF 1SFOJ 1QVUA 4B1RA 5D2LA 3PWPA 3NQOA 3S3MA 3GMOA 1SC7A 2O0YA 4BE1A 2ESNA 1WJ5A 2LY2A 1FEXA 3RWCA 3MGOA 2VIXA 1YJNI 4XIDA 1RJZA 2IS6A 3MR9A 4ZYAA 2VQGA 2K27A 1DU6A 4GCVA 1K6OA 1XGOA 1FNNA 5H2FC 1YE9A 2ICWG 1QQDA 3P4OA 1X58A 3WTXC 3OYAA 3I71A 2LY1A 3UNGC 3QUYA 5JHDA 3QYEA 1U8BA 2FE3A 4U87A 3S14J 4IHWA 4FQGA 1S72I 3OOUA 4JFOA 4UB6C 2VT3A 2OA4A 1Y0UA 4B47A 1ONQA 5C09A 4X1EA 3VXNA 5EDNA 4M9SA 3TJHA 3HBLA 4GDFA 2ZOKA 5MERA 5DEGA 1U78A 2FOKA 2DA4A 3BQZA 4O6JA 1A35A 1A36A 2UWEA 4YELA 2MABA 5JI6A 1QPIA 1G6RH 3E2HA 5HHOA 1W0TA 2A3SA 1P92A 5E1WA 4A3MJ 1QHGA 1OISA 3MKZA 1AHDP 1VTNC 5E6IC 1B8IB 1Y8RB 3GTMJ 4NO2A 1W7PD 3OIQA 2DT6A 3H3VK 3JRIA 5F1IA 1GDTA 2PMZA 5FFZA 3IWFA 1SMTA 3FXRA 5CJ9A 2BW3A 1HDPA 4ZZLA 1YFHA 1YO5C 1W36C 5HGAA 3FMRA 4L5EA 3HPHA 2ZNZA 4A3BJ 1GVDA 1AGDA 3S15J 3L2UA 4L8CA 3LV3A 2P7VB 3I5UA 4JO8A 2PJRB 3LA2A 3DKYA 3CC7I 1OCRH 2QCOA 3E3QA 3MRBA 1YIJI 3D1NI 3VOEA 3K70D 3NWSA 4PJGA 1FOXA 2IJLA 3UTTA 3HRTA 2G0EA 3DQVC 4GFBA 3C8KA 5BNGA 3ERED 2KDZA 1QSEA 2R7OA 3V7SA 5EF6A 4KIBA 4G9FA 3A1YA 2FBKA 4D0PA 4CZZA 1RUNA 2GT9A 2O5NA 4PRHA 3PABA 4ZUVA 3KCCA 3QEQA 3BW9A 1YG2A 3WTVC 3P9LA 1CE6A 3K69A 4E7LA 1FBSA 4HUXA 1AGCA 1W0VA 5C0AA 3GZ5A 2OZ6A 4D7MA 3OYGA 1G3WA 1MBKA 3K1PA 3ZMVA 2AO9A 3BVNA 4I2OA 1P4WA 1BI2A 3F0CA 2LREA 4R1HA 1GV5A 2QQBA 3MRQA 3D5RC 2KT0A 3OL4A 3GMEA 1Z7UA 3PNYA 1ZGWA 4Y4KA 3CDLA 3AKZA 2WAEA 3OXRA 1X3UA 2BXZA 1FBQA 2LG4A 1BR2A 2DA2A 4PJ7A 4DOZA 4HKJA 4AIHA 3KPHA 3LKSA 4LCCC 3WTWC 5EEHA 3AL0B 2P5KA 3LSHA 3D2UA 1V5GA 4KITB 3CVHA 3IUOA 2CV1A 5K5RA 1ZG3A 4QRSA 1KQ8A 1FMVA 3QUZA 1WH7A 1TWCJ 4HUUA 4BXXJ 2M7BA 3GTGJ 4UQ3A 1U2WA 4HDVA 4U1IA 5J6XA 1YJ9I 2HI3A 2L7ZA 3KP4A 4A5NA 1BW5A 2LTPA 3PL8A 5EYRA 1D8KA 1N59A 3GJFA 1QR1A 2P8TA 3WTTC 2WAQA 2JSPA 4AYBN 2COMA 3QRFF 4XM3A 3M1BA 3VSLA 3CD6I 2YX4A 1P4AA 4DZJA 1I6XA 4JX5A 3S16J 1HOMA 2LKSA 4NQWB 3MRRA 2M4GA 3SFZA 1G6NA 3SKOA 1A04A 2IS4A 3BWGA 4I76A 3A01A 5ICGA 3S2HJ 4XMYA 3CUQA 2X4UA 2FQ4A 1FMWA 1WI9A 5ILSA 2LVSA 3TVMA 4CCOA 2V9KA 4PSXA 3MWMA 1A6IA 1JFMA 5EJCA 1ZELA 2XPWA 4CO8A 4LJZF 5IB4A 2Q1ZB 4A3CJ 2AQFA 4CVXA 3BROA 5GAHJ 5C0BA 4IHTA 3R0AA 4M6YA 3HDDA 4D0BA 4ZYHA 3H92A 3MYJA 4E7HA 2R7FA 3LSTA 4EJVA 1CGPA 1S7SA 2AK4A 2BNRA 1ON2A 2KHMA 3F8FA 3HHGA 2ZJPF 2CH0A 4DYRA 4EEFG 2PO6A 1BQHA 3H9SA 4HX7A 2HFHA 4XLAA 2BSTA 2Y31A 2Y9YA 4IRSA 3K4CA 1N77A 1K5NA 1OMIA 3RI4A 3TBIA 2XAQA 1GVJA 3AL0C 4QPQA 4B48A 3BOQA 4B3XA 4LHUA 1MGTA 1V54H 4ENNA 1R22A 1JE8A 1Z77A 1UXWA 3PWVA 3TMOA 2TDXA 4RGSA 1T1WA 4F93B 3G2BA 3G73A 4HS3A 5D9SA 3FIWA 4XRFA 2R5YA 2Y0MA 4ASNA 1N2RA 3N4MA 3U1DA 2UUZA 1I1GA 3LFKA 1RRJA 2AKRA 2VAAA 5IOYA 1W7PB 3OY9A 4U0VA 4QWQA 4ZC3A 4S0UC 1FZJA 3C18A 2F5FA 4I99C 4IOAF 5EG0B 2KRHA 1T0FC 2OD5A 1U5TA 4XK4A 4I02A 1P4LA 3DPLC 4JK1X 4LIVA 2AXGA 3QU3A 5F1RA 3BZEA 2WB1A 1Y8QB 3HYIA 4M72A 2H8RA 4WXDA 2D1VA 5LEKA 1OF2A 4NQDA 4U1MA 4PK4A 3VODA 1A9BA 5F7DA 4CCNA 1R3HA 4EV0A 3GTJJ 1NHAA 2R3SA 2HJKA 1AGBA 2CG4A 2F5VA 1K83J 2WY8Q 1OLTA 2R5ZB 2ZSWA 3X12A 2DI3A 5AONA 3F22A 3E1SA 4G9DA 1KU2A 5F0FA 3WGIA 2K3PA 1QRNA 3HKZA 3LAJA 4NO3A 1R23A 1JTXA 4CXFA 3DV8A 5F1NA 2YU3A 4XKCA 1J59A 2XPUA 2MLGA 3HOXJ 2K9QA 2R0QC 3CCYA 4WX9A 3EUHA 1FP2A 1QBJA 1TNSA 5MENA 3PQKA 5DEFA 4N0BA 3H3UA 2Q2EB 3QUXA 1YI2I 2MHAA 1UHMA 4KNYA 2IT0A 3QFDA 3H9HA 2DODA 3SCMA 4ON0A 1CG9A 2I5UA 2XB5A 3ABUA 1N3NA 1Q1VA 4I98B 5CVRA 1I1YA 4CA0A 4MIMA 3VFNA 3SJVA 3KPPA 3DTIA 3TKYA 3ROLA 5F1JA 1S7OA 1GUUA 2ELKA 2KMUA 4XSXF 3BR1A 1JJ6C 1UHSA 4L4VA 4PJNA 1R58A 5AIPA 4X6FA 1TBXA 5L2JA 2JUCA 1ZHLA 2X4HA 2EZIA 4PJAA 1WKMA 2LH9A 3WTZA 2JK3A 1B72B 4YFNF 1CF7B 3OIPA 3GZ6A 1PUEE 4A3GJ 5LHHA 1YTYA 3VRIA 4HF1A 2FEZA 4KDPA 1IN7A 1SD5A 4S05A 2Z9OA 4C2TA 5CPRB 5H6QA 4NO0A 1O3RA 1A1OA 1KJVA 4I4WA 2WV1A 1FTZA 1D5VA 2QBYA 4UNOA 2VQLA 2GBYA 3W0WA 1LQ1A 3FM3A 1IZ1A 3CCVI 4N4OB 5BS6A 3BR0A 3CESA 4NT6A 2A07F 5B1AH 3ABKH 4OWRB 3S3NA 1GZQA 3ROOA 3K70C 5SWZA 3JW4A 2ZMEA 3IT8D 4B09A 3ZQQA 2BW3B 2VB6A 3JTCA 3JTTA 1CD1A 3HPJA 3QFJA 3CLQA 3P4NA 1SMYF 3BT9A 3LA7A 2V1XA 5BOXA 3I0TA 1FOYA 2KIMA 3VWBA 1R00A 1FG2A 2CO5A 1A1NA 2LOOA 4NHJA 4D0DA 5FRNA 1T95A 1VGKA 3GSOA 3K4KA 5DCMA 2GA1A 2BY0A 1JGSA 1K4SA 5DD8A 3KPNA 3T8RA 2R7ZJ 3BUYA 4QRTA 3MVPA 2GLOA 1LEKA 5D2NA 2IRFG 1JGGA 4E6KG 4BQOA 4MO7A 3K4MA 4MS8A 1ONVA 5J8FA 3KIOA 1WBZA 2XSDC 5IEHA 3F6VA 2QA4I 1YW8A 1VQLI 5DS9A 3KP2A 4UUTA 4NNXA 1DQUA 5DV5A 1T08B 3DLAA 3FXMA 3KXFA 2AXFA 4BJTA 4IO9F 2A6TA 4BUPA 2QSHX 4I48A 2QF7A 5CQEA 3Q0VA 5KAIC 1Q1HA 2V2WA 3LSPA 5LFAA 2IPQX 5KHDA 1D1BA 2E2JJ 3ROUA 2DU9A 4IJAA 4BAYA 1P9QC 4J19A 1QNTA 2FBHA 3CCUI 5HGDA 3SZPA 5ILVA 5DUIA 4FE7A 1PVEA 3TDZC 3QDGA 3WU2C 1KBGH 1NAMH 1W72A 2DJIA 4HX4A 1S7XA 2Y30A 1IF1A 3S6CA 5EOTA 2E1OA 3K4JA 2C7UA 3TPUE 5KNLA 5EU4A 1E27A 2K4BA 1X1CA 1XB4A 2JA2A 4IHSA 4UHTA 3E6FA 3CDHA 3W6JB 4S0HB 2VABA 4UXNA 4MNQA 1I50J 2CSOA 3MRGA 3GMRA 2FNPA 2DLLA 4PJ0C 2CLZA 1FOKA 5L3DA 5B3SH 3BWAA 5K5QA 1DUZA 5IYBJ 5IROA 1P1ZA 1K78B 2DXIA 1XPXA 3UTQA 1FSEA 3E6BA 2VLJA 3M8FA 2PBIA 1OQYA 3H0GJ 1XGSA 5CQGA 1HW5A 2NVQJ 3TGNA 3CCMI 3P9IA 3A0HC 3TBYA 5CVUA 1XSXA 4BXUA 5E18F 2BZTA 4LK0F 1VQ7I 1TWAJ 2MD0A 4LIUA 3VYRB 1BJAA 4RB0A 3CUQB 4PSWA 4BDYA 1XSDA 3PJRA 1I39A 3FQTA 4MFDA 3RUGA 3GMMA 3BG7A 4WDIA 1T0NA 1ZGAA 4KA4A 2VKHA 3A2KA 1SAXA 1KU3A 3OYLA 4LCYA 4JQVA 1T80A 4M74A 1VQPI 2HTSA 2DMQA 3EETA 1FPQA 1SVMA 5HS7A 1QU3A 2OPTA 2DCEA 3LQQA 3CMEI 1G3YA 2VJJA 4BBRJ 3OSFA 3TQNA 3BCAA 1DGWY 1HKTA 1IXSB 4RAZA 3KP3A
chains in the Genus database with same CATH topology
2WV0A 4ZYGA 3KLOA 3GFIA 2PMUA 2B0LA 3R0JA 4FX4A 2XROA 5K1YA 3W6KB 5FGMA 2XKOA 4RS8A 3HTSB 2QWWA 3ZN0A 3HTUA 4UV9A 2K86A 1IUYA 1WRJA 5HS8A 1ZREA 4R79A 1F1ZA 5CLSA 1U5TB 3GFMA 1K7AA 2KKOA 1BOAA 1XCVA 5LRSA 1OPCA 3CUQC 4IVNA 3J81Z 3TO7A 2EFPA 3J7AO 1T39A 4AIJA 1STZA 1OR7A 2QZ8A 1S3JA 3BPXA 1T6SA 3V8KA 3DP7A 4KIGA 5ICFA 2VODA 5DUKA 1FWZA 4EJWA 3K1NA 2NNYA 2P4WA 3WG9A 2HYFA 2MC3A 1YS7A 3KLNA 3WGGA 4MEXF 2PN6A 4I0BA 3O6BB 2QQAA 1U5TC 1BM9A 2ZKZA 1BIAA 4LLGF 2KJCA 1ZARA 2JT1A 3ZP5A 1ZRDA 4A0YA 2ZMEB 4OMZA 2Q8KA 4U0WA 4HLXA 2DBBA 3BJ6A 2HR3A 2MBFA 1TLHB 4G94A 4N9IA 2DPUA 5DCMB 4L5IA 2VBXA 4EVIA 1GXPA 3F21A 2KRFA 2JPBA 4H0EA 4B8XA 3ABTA 2DQRA 2IA0A 1IRGA 1Z1DA 2RVCA 4P5OA 1J2XA 1WSUA 2ZXJA 2ZCWA 3L09A 5CYVA 2O6GE 2A6EF 2RGVA 2RKHA 4EQQA 2CYYA 3VFZA 4L5JA 3GO5A 5E20A 4GO1A 3FMSA 1ZLJA 2ZNYA 3QP6A 1BN5A 3E6CC 2Z33A 2JPCA 1SFUA 2CFXA 4HX8A 4LB5A 2F5CA 5E17F 2O03A 3B02A 2VE9A 3GYHX 2UXNA 1FC3A 4I09A 5DYMA 3IKVA 3ZMTA 2EFWA 4BNCA 3HOTA 1V3FA 4GYGA 2NNNA 4S04A 1SD6A 1WWXA 3ZQ7A 4Z2YA 2E1NA 4M9XA 1J5YA 4XLNF 2E1CA 4MGRA 2HKOA 2MLKA 3DFGA 4M6XA 1IN6A 5HDNA 4Y13A 4ENMA 1JXSA 2FMYA 2PJPA 2HQNA 2LNBA 3GWZA 4MNUA 3CLOA 5FLXZ 3F6OA 1QZYA 3CTAA 4NB5A 5A2QZ 4K2EA 3H3ZA 3N97A 4CHUA 2M5WA 1V4RA 2E7WA 1TQIA 3QPHA 2L4MA 1HXDA 2FF4A 4KN4X 1BBYA 3EDPA 5JHUA 1HSJA 3ELKA 2DK5A 2L3DA 1B9MA 2HWVA 4KFCA 1J0RA 3DPTA 2DT5A 4A6EA 3LWFA 2IA2A 5ERIA 3DKWA 2DK8A 1HBXG 3E97A 3SXYA 1G3SA 1EH8A 2RNJA 4QLCU 1QGPA 4HQEA 5FO5A 3DEUA 2NAZA 2BYVE 4UVBA 1MD0A 2BGCA 5KVRA 2K4JA 4ZYEA 2UXXA 3M9AA 1IN4A 4N9HA 4PCQA 2J5OA 4A0ZA 3J80Z 2KIFA 1L0OC 2HDCA 3HRMA 1SFXA 4PZJA 4ESFA 1O7LA 2OAZA 3I59A 2H27A 2P6TA 1YW9A 4A12A 1XD7A 3KE2A 2Z5UA 1MDMB 4LB6B 4HOBA 3LQRA 5HVQC 1KU7A 2G7HA 2P5VA 3I58A 2RC4A 1ZRFA 1MKMA 3JSOA 4FHTA 3P9CA 2QYOA 1TQMA 1O3TA 1FP1D 2DPDA 4WXCA 2PFBA 4YG2F 2Y75A 3F3XA 2MH2A 1G3TA 3V4GA 4Q5SF 2BBYA 2OQRA 5ICCA 2EFNA 3QPTA 1U6GA 3RTRA 3L00A 5HS9A 3FZVA 2DQLA 1USTA 2XAGA 4ENKA 3RYRA 2EK5A 3QAHA 3BJOA 3E5XA 1MJAA 3WE3A 2HGCA 1DDNA 3HUGA 1ZG5A 4EGZA 3T8TA 3SHFA 4BHBA 5E8IA 1BIBA 1R1UA 3RJPA 4U7DA 1BI0A 1ZAOA 2VC1A 4I7HA 4I0AA 4L18B 2V1UA 1AOYA 2ELHA 1TW2A 4FT8A 1ZLKA 5D4RA 2VBWA 1LDKB 3V7CA 5D8LB 3BY6A 4RGRA 4PGHA 2GQQA 4XSZF 1S29A 1DP7P 2W84A 5L3BA 1IAWA 4OIQF 2XASA 1FBUA 3JAMZ 1RIOH 4U0YA 2PEXA 2J5PA 2ISYA 3QP5A 3RDIA 3TDUC 1IN5A 2BEOA 2O61A 2E7XA 5TRDA 3PFIA 3KZZA 4IPAA 3GF2A 5HLGA 4LG0A 2JTVA 2VC0A 3KP6A 2ZBKA 3QOPA 5HOOA 5L3EA 4WF2A 3R4KA 4LMYA 1U8RA 3C7JA 1ULYA 2K7LA 3U2RA 3L2CA 3E3VA 3EYIA 4KN7X 2XGXA 5F6FA 2WTEA 4HW0A 2EV5A 5L3CA 4ESJA 3S2WA 1FYLA 3K1MA 1P6RA 2EV6A 2RN7A 5LEJA 2EWNA 4L0ZB 1XMKA 3WE2A 2M87A 3RKWA 1R5GA 2HTJA 2L01A 3FWEA 1ON1A 4OIPF 2M45A 2GIVA 3NRVA 5L3FA 2PMHA 1UCRA 5ED4A 1KQ0A 3O3KA 3FM5A 5J8CA 2W24A 1DUXC 3R60A 2FQ3A 4HLYA 1H9GA 1KYZA 2HS5A 2QENA 1XN7A 2Q0OA 2G7UA 4RB2C 2FBIA 1O3QA 2VN2A 3I59B 4EJTA 1SD7A 4WK8F 1R1VA 2O3FA 3L7WA 1FYMA 3ZPLA 2VOPA 5CVVA 2BV6A 3KFWX 2IP2A 3M7GA 3Q5FA 5FLXK 1T2KA 4O5VA 3RPUA 3T5XA 1YW7A 3T0YA 3I64A 4EJOA 2NS0A 3NEUA 3F8CA 3K9TA 2L02A 4LD5A 3O2PE 3TO9A 5D5WB 2LSOA 1KGSA 4YIIA 1ZYRF 2CW0F 4BHCA 1I5ZA 2HEOA 1S6LA 2MH9A 3WTUC 3KETA 2ACJA 1RNLA 5D8KB 4MEYF 3I4PA 1PDNC 3E5QA 3ECOA 5D5VB 5HDGA 3FMQA 3TO6A 4UV8A 4U7BA 1K79A 3GFJA 3V8LA 4HZFA 4XBFA 2RQPA 1XDUA 4EM0B 1ZRCA 4KT5C 3FXQA 4L9JA 5E8GA 2X0LA 2P5LC 1JHHA 4KMUX 3J80K 5LBQA 1E2XA 3LAPA 1YQAA 4BQAA 4IF4A 2DFIA 5LHGA 4GGGA 1RZ4A 4L9VA 4P55A 4OIRF 1LB2A 2QBYB 3E5UA 4Q4ZF 1USSA 3IL2A 1G4DA 5D5XB 4EJUA 5D4SA 3HRUA 3BJAA 2UWMA 3G3ZA 3SZTA 4KUMA 2W57A 4KYWA 4G7HF 1F9NA 4M71A 1J7KA 3RPQA 1IXRC 2VE8A 1B1BA 2KJBA 2PG4A 4A6DA 5HDKA 4LG0B 4G6DA 4MQVA 1E17A 3BPVA 2XAJA 3CO7C 1OYIA 3HRSA 1PP8F 2ZO4A 4CYDA 4AD9A 4RB3C 1W7PA 1Z91A 2HOEA 4JQFA 4EMSA 4UUVA 3VEPA 3B73A 2HZTA 3K0LA 1R1TA 2UZKA 2VXZA 1DPUA 5E1XA 1FZPB 2FSWA 1MZBA 4GXOA 5LGTA 1W4MA 2Z99A 1HKQA 5HLHA 4AWXB 1SFEA 4U88A 2STWA 1DPRA 4Q48A 4M73A 1WQ2A 2F2EA 1KQ9A 5LHIA 3ZMDA 2V1DA 2XUBA 2JZYA 1J9IA 3RKXA 4P9FA 2XHKA 1CF7A 3L9FA 3JAMK 4HDUA 1YIOA 3VB2A 1FLIA 3JTHA 3WTSC 1ZGJA 1Z9CA 2ZJ2A 2EB7A 2PQ8A 3WTYC 1REPC 2EJRA 4BH9A 3OV8A 4MTEA 1EH7A 4MHGA 3V8JA 5FFXA 1I1SA 2GA2A 4G8XA 4HF0A 3IHUA 5JR3A 5HLIA 1LVAA 2QUFA 1UB9A 3P7NA 5LRRA 5TJJA 4O3MA 2EFOA 1XGNA 1QQIA 1EV7A 1FT9A 5IT3A 2IW5A 1IXCA 1BC8C 1GXQA 1KA8A 4OMYA 1OYWA 3GLXA 3KZYA 2Y48A 3MFKA 2OBPA 4L9NA 3HOSA 2ISZA 4ZZDA 4R8HA 1HW2A 3ZN1A 2GWRA 4JBAA 1W5SA 5FD6A 3FX3A 2QVOA 1PP7U 1S7AA 4OU0A 4A2UA 5BQTA 1L3LA 1B9NA 2CGPA 1GHCA 5JVTA 5H6RA 3EQLF 4KICA 1TTYA 1UFMA 1K78A 4BYYA 3IC7A 5K5OA 1IRFA 3K2ZA 2YR2A 1JHFA 2L54A 4YIFA 5LGUA 1XDSA 1HSTA 2H6CA 3CUOA 2EV0A 2M30A 2D2WA 4RAYA 2A61A 3FHZA 5BMZA 3WGHA 2DAOA 1B6AA 1YS6A 2VT2A 2QQ9A 3F8NA 3ULQB 2VBYA 4A0XA 4UVAA 3AAFA 1R5HA 1IN8A 5DD4A 2A5YB 4BHPA 3IKTA 3R6SA 5BPIA 1KU9A 1D8JA 5CVJA 3M1EA 3RYPA 2XV4S 2CQKA 3IRQA 2FMLA 4RGUA 2C6YA 4MTDA 4WWCA 2O8XA 3J81K 3T1BA 3KP5A 1LDJA 2NRAC 4MQ9F 3FXUA 2LKPA 3Q9SA 1W5TA 3C1DA 3WODF 1BC7C 3ZMSA 2ETHA 2EFQA 1XCBA 5IT9Z 3WU1B 5LGNA 3IWZA 1S8NA 1AWCA 2A69F 1FY7A 4TV7A 2LF7A 1Z05A 3FF5A 4DNCA 2W85A 1U3EM 2XIGA 2FU4A 1BI1A 4KIFA 4HAMA 3R61A 3I54A 2OZUA 1C0WA 4ZYDA 1XSVA 2GAUA 3ZMZA 4GYIA 3JSPA 1XMAA 2JRTA 2M1BA 1FSHA 1ZN2A 3PQJA 5EEGA 3OOPA 5CVIA 4L9TA 4RB1A 1RUOA 3TOAA 2RV8A 1BI3A 4KMFA 1XGMA 3HSFA 5DEQA 4EGYA 4PGGA 2LF8A 3GX4X 3U9GA 5FD5A 3RKYA 1P4XA 4HV5A 4CGZA 4FX0A 3MEXA 1LEAA 4DQ2A 3IRRA 1IW7F 5F64A 5ICEA 1MJBA 4ZH4F 2AS5F 2VONA 2V79A 1ZH5A 1TNTA 5FB2A 2WWYA 1ZG1A 4AVPA 1O7FA 1KYWA 4CDGA 1I27A 3F72A 1O3SA 3HIFA 3F8BA 3BP8A 3ML6A 4HF2A 4IRHA 1F5TA 1B4AA 4IXAA 4HYEA 3SQNA 3P9KA 1QZZA 4IRGA 2Z3YA 1TQPA 3GW2A 2WC2A 2L4AA 3KEOA 3F23A 4YFXF 2XAFA 1T38A 2R7DA 1OYYA 4M9ZA 1R36A 3EYYA 1O57A 2XVCA 2H6BA 3GXOA 2A68F 3ISPA 2HYGD 4CICA 3I53A 3QU6A 5D6FA 4WXHA 1H9TA 5DCFA 3TOBA 2D45A 4ETSA 4LLLA 1RI7A 5AIQA 2FRHA 1ZHFA 3E6MA 3Q9VA 1B59A 3HSRA 5E1ZB 3WU0A 1MJ9A 2P6SA 4E70A 2V9VA 2H94A 2FNAA 5A2QK 2OQGA 2QM3A 3D0SA 4I01A 2DO7A 3F8MA 2DTRA 5KK1A 4ESBA 2G9WA 2FA5A 3LA3A 2MA3A 2MD5A 1LJ9A 3DF8A 4G9YA 5DDGA 4OIOF 1QPMA 1HW1A 4G7ZF 2F5EA 4LK1F 4LGWA 1P2FA 3MAJA 5D6EA 2ADUA 3GVAA 1LEBA 2M8EA 5L3GA 2RDPA 3GFLA 1EH6A 2XAHA 3D5LA 4YFKF 5D5UB 3RIRA 4RGXA 1LDDA 3ZMUA 1F4KA 3ECHA 2ESHA 2XRNA 2F5DA 3KEQA 3C3WA 1SD4A 3COAC 3CJNA 4LFUA 4Y15A 4L0YB 3GUDA 4EM2A 6PAXA 2CWEA 2OU2A 3E6DA 1J75A 2GZWA 1YLFA 3JTGA 4HQMA 1T0FA 2KIUA 2ZFWA 1QO0D 1D3YA 1R7JA 4NQWA 4F7ZA 2EA2A 4Q47A 4LLNA 1Z6TA 3REOA 2W25A 1HKSA 4ENJA 2V6CA 5BPDA 3BDDA 4Y17A 2XKPA 2D1HA 2IA1A 2DW4A 3DXJF 2EA4A 1UHWA 1MDMA 1OKRA 2BE5F 1H0MA 5JFRA 2YX7A 2HKXA 4A5MA 1FYK