2IA1A

Crystal structure of protein bh3703 from bacillus halodurans, pfam duf600
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
169
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3703 protein
publication title Structure of hypothetical protein BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 58
structure length 169
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia1A02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 2ia1A01
3C1DA 3MCZA 1K79A 3RI4A 4G7HF 2F5CA 1F5TA 1JGSA 1IRFA 1R00A 2HTJA 5L3GA 2G7UA 5BMZA 1XSDA 1YIOA 4IVNA 2Y48A 2D1VA 3EQLF 5HLIA 2OBPA 1SMYF 5E1WA 1Z91A 1LQ1A 1G4DA 1D8JA 5FFZA 3JW4A 3MAJA 1J2XA 2J5OA 1TNSA 2M30A 1YW8A 2FA5A 4EGZA 1ZHFA 4OINF 2KKOA 3G73A 1HW2A 3W6KB 4A2UA 4IF4A 4KMFA 4TV7A 2D1HA 5JI6A 4OMZA 4EJTA 2UZKA 4IRIA 1IN6A 2ISZA 4CXFA 5IT3A 5CVRA 4LG0A 4LLLA 1T2KA 1S3JA 1ZG5A 3GXOA 2DPUA 1FY7A 1FP2A 4WXHA 2FSWA 1KU3A 4LK1F 1L3LA 1FSHA 1E2XA 1GHCA 3KLOA 1PUEE 5HLHA 1NHAA 3J81K 2NS0A 1RI7A 3EETA 2DPDA 1J0RA 2DFIA 1SFEA 3PQKA 2PG4A 5L3FA 3LAJA 2K7LA 2GQQA 3O2PE 5DDGA 2GWRA 1LDDA 1I1SA 2DO7A 3NEUA 4Y17A 5DD4A 4UV9A 2V9VA 1FT9A 1ZLJA 4O5VA 3B02A 2PJPA 2W84A 2EV0A 2CYYA 4RGUA 4AIJA 1KGSA 4AIKA 1AWCA 4YFXF 4HF2A 3F8BA 2MLKA 5ICFA 1BI2A 3DQVC 1PP7U 1BC8C 2KRFA 4U0VA 4EM2A 5IT9Z 2W25A 2EFWA 4ZH4F 1ZGAA 3ZMUA 4ZYGA 3EYIA 3I5UA 2EB7A 1U3EM 4CO8A 1X3UA 2DTRA 4M9ZA 3HOSA 1U78A 2HYFA 3QP6A 4BHBA 1QQIA 4LMYA 3ULQB 4U0WA 3TGNA 3HYIA 2LF7A 3R4KA 3IRQA 4R79A 1FZPB 3CUQB 1I6XA 5LGNA 4GYGA 2R7FA 1SAXA 5AIPA 1EH7A 2WV0A 3SZPA 1WKMA 1W5TA 1SD6A 1FOKA 2XGXA 4MEYF 1LNWA 3KP4A 3GZ5A 3I0TA 5FFXA 1ZREA 3RDIA 2F5FA 3LA3A 4L5JA 4I0AA 1QNTA 2F5DA 1IXSB 3RJPA 5LBQA 3GO5A 3M9AA 2DQRA 3D0SA 3I54A 4R1HA 5F64A 5FGMA 3NRVA 3ZQ7A 5FLXK 2E7WA 1B1BA 1MKMA 4AIHA 3SHFA 1S7AA 3R6SA 4KFCA 4RGSA 5LEKA 4Q47A 2EA4A 2IRFG 3GX4X 5D4RA 2FBKA 1DUXC 2IW5A 1XDUA 1H9TA 2CWEA 3L09A 2K4BA 2EK5A 1TW2A 4FX0A 1TQPA 2FBIA 2QQBA 3N97A 2ESNA 2FOKA 2EFQA 5HOOA 2DT5A 2F2EA 4L0YB 1OMIA 1RNLA 3BPVA 5CYVA 4A5NA 1PP8F 1IRGA 2MLGA 3E5QA 1IN8A 4RB1A 1IAWA 4LJZF 5BOXA 4HF1A 4HV6A 3JAMZ 1ON2A 2PN6A 2VXZA 4CZZA 4HQEA 1STZA 3KZZA 1BJAA 1OPCA 1E17A 2DK5A 2VT3A 1R5HA 4ZZDA 3GVAA 1BI0A 4XSZF 2HGCA 3R0JA 1DP7P 3J7AO 5DUIA 4B8XA 3IKTA 2QM3A 4U7BA 5ERIA 1YS6A 3GFLA 2ZO4A 1P4XA 3V7RA 1F4KA 2V1DA 3N4MA 4HAMA 5LHHA 1KU9A 1TQIA 4D0PA 3KP7A 1D8KA 1RZ4A 1W5SA 1TNTA 2XKPA 2YU3A 1U8RA 5D4SA 2Z9OA 3V8KA 1FPQA 4HV5A 1ZRDA 3ZMTA 4LGWA 5JFRA 4UXNA 3SQNA 1MZBA 2XUBA 1HKSA 1FBSA 1LDKB 2PLYA 2FU4A 4ENJA 3I59A 3FHZA 4EMSA 2QYOA 3GLXA 2FBHA 5AONA 4KYWA 2G7HA 3GFJA 3LA2A 1UHMA 3BJ6A 4RAZA 1ZN2A 1K78B 4GYIA 3RIRA 4XSXF 5E8IA 5A2QZ 3ZPLA 2L3DA 2CW0F 3LWFA 3CLOA 2NYXA 2XIGA 4EQQA 4A0YA 2QBYA 2HZTA 5AIQA 1OYWA 4IPAA 1GXQA 3RKYA 2P5VA 3F8CA 3TDUC 1S29A 3F8MA 4ENMA 1YW9A 1BI3A 1PDNC 4O3MA 1F1ZA 5HDGA 1OR7A 2V1UA 3ABTA 1EV7A 2H27A 5J8FA 2MBFA 3HTUA 2H09A 3FM3A 4YIFA 3C3WA 1RUNA 1TQMA 1XCBA 2DQLA 3WGIA 3DF8A 4F7ZA 1SD4A 5D6EA 3ECOA 1ZYRF 3ABUA 2KJCA 1RUOA 1FYLA 1B6AA 1TLHB 3AAFA 2ZJ2A 3ERED 2PMUA 4M73A 4KT5C 4I01A 1BBYA 1O3SA 1Q1HA 1J7KA 4WCGA 3EUHA 2VC0A 1GVJA 2WTEA 1OYIA 2OQGA 2BGCA 3SXYA 1FYMA 3ZN1A 2X4HA 4KUMA 1I27A 3M1EA 3U1DA 3GWZA 5DYMA 1W4MA 1MJAA 1YTYA 2DK8A 1O57A 1UHWA 4RB3C 1B59A 2QENA 2CO5A 3F23A 4XLNF 3E5UA 3FZVA 1J75A 2LSOA 2Z3YA 2WC2A 2P8TA 2XKOA 2ADUA 2GA2A 2MH9A 2A68F 3J80Z 3DV8A 4EJVA 1P4WA 1V3FA 2HQRA 4RAYA 1EH6A 2L02A 3FM5A 2L4AA 3DFGA 2QZ8A 4RB0A 1LDJA 1KYZA 4P96A 1SD5A 1Z6RA 4RGRA 4EM1A 4BHCA 2GXGA 1YW7A 2ZXJA 3WE3A 2OA4A 1DPUA 2D2WA 2LKPA 3L2CA 1YFHA 3QRFF 4WF2A 2QVOA 2XRNA 5E1ZB 3FF5A 2ZFWA 2VC1A 5DV5A 2DU9A 3GZ6A 2MH2A 1WWXA 4G6DA 1QGPA 2HEOA 2HDCA 4G6QA 3WTUC 5K5QA 3GFIA 3BZ6A 2GZWA 1XGOA 2MD5A 1IN4A 4IHTA 3FX3A 4Y13A 3QU3A 1XN7A 4UVAA 2P7VB 2ZNYA 2PMHA 1IZ1A 1U6GA 1UCRA 4S04A 4UUVA 1HXDA 4ZYDA 3TO9A 2OZUA 3M7GA 4CHUA 3M8EA 3RKWA 1ON1A 2FXAA 2IA2A 4L9TA 2HWVA 1VTNC 2DW4A 1REPC 4M6XA 4LLGF 2JT1A 1Z6TA 4G7ZF 2YX7A 2W85A 3NQOA 4L5IA 1UFMA 4WXDA 5HS7A 2Z33A 3HRMA 4L0ZB 4ZZLA 2ESHA 4EVIA 1FLIA 4ESJA 3I71A 2IA0A 2M8EA 1LEAA 3K0LA 1KU2A 2Z99A 1BI1A 3F21A 2CFXA 4Y15A 1XB4A 4BQAA 2YR2A 4MTEA 1EH8A 1YLFA 5E1XA 4MEXF 4IXAA 1MGTA 3WE2A 2FMLA 1XMAA 2E1NA 5L3EA 2BYVE 1KQ8A 4OU0A 4H0EA 2A6HF 2KIMA 2COMA 3FWEA 1Z1DA 5DD8A 3I64A 1QZYA 4L18B 1U5TB 1ZGJA 3VODA 5D5WB 3J81Z 4M71A 3E5XA 5DCFA 5ICEA 2GIVA 2DAOA 2DI3A 4LG0B 3LQRA 3LAPA 1T39A 3GW2A 5H20A 2FE3A 4KA4A 1G3YA 3KZYA 1KQ0A 4N9HA 3QPHA 3TDZC 1C0WA 1BM9A 3IRRA 4HLYA 2BEOA 3D5LA 4E70A 1LEBA 4KIGA 4GGGA 2CG4A 2R3SA 4ESFA 2EFPA 1CF7A 2IP2A 2TDXA 4BYYA 2RGVA 3C7JA 2M1BA 5HDNA 4M72A 2P4WA 5DCMB 2JPBA 4AVPA 5L3DA 2IJLA 1G3SA 1D5VA 1QPMA 1R1TA 3K1MA 3V7SA 5JVTA 3DEUA 3HTSB 3L00A 2STTA 1B9MA 3O3KA 3U9GA 1KA8A 3O6BB 5HLGA 2KIFA 3BWGA 2MC3A 3K69A 4CYDA 3KETA 5FD5A 2P5KA 3GEZA 3MFKA 2JRTA 4HX8A 1R1VA 4UVCA 4EM0B 1W7PD 3KLNA 3P7NA 2XHKA 2A5YB 5K5RA 2DLLA 3WODF 1TW3A 3K1PA 3V7CA 3KCCA 3Q9SA 1T0FA 4BHPA 2JTVA 4MHGA 2VONA 1JXSA 1IXCA 4PZJA 4EGYA 1FX7A 5FB2A 1R22A 2BV6A 3LFKA 1USSA 1L0OC 2UXXA 4M74A 4A12A 4ENKA 2K27A 2OU2A 3F22A 2Y0MA 3E6CC 3RYPA 5DEQA 4LD5A 3C18A 2L01A 2BBYA 5FLXZ 4G94A 2O8XA 4N0BA 1ZARA 2O03A 3DKWA 3OV8A 2B0LA 2DBBA 3V4GA 5F1RA 3B73A 5E20A 3ZMVA 2VOOA 2ZMEA 4KICA 1G3WA 3HOTA 4RGXA 1UB9A 3WU0A 3BJOA 3FXQA 2E1CA 3F6OA 4QLCU 1BC7C 4I09A 4HDUA 1SD7A 3BJAA 5D5XB 4MNUA 5LHGA 2ETHA 4L9JA 3BPXA 5D5VB 3T1BA 1Z05A 1Z7UA 3ELKA 4FX4A 5K1YA 4NQWA 2CSOA 4WX9A 4PDKA 4MTDA 1FBUA 2O0YA 2IPQX 2Z5UA 3ML6A 1O7FA 2XVCA 1P92A 1ZG1A 3F6VA 2HS5A 2ZKZA 1WQ2A 3KP5A 4N9IA 5L3BA 1IXRC 2RC4A 4U0YA 3LA7A 2PFBA 3TOAA 4AWXB 4OIOF 2FNPA 3KEQA 3CDHA 4AD9A 4WK8F 3TO6A 3IL2A 3H92A 5CVVA 2R7DA 3DXJF 4OOIA 5K5OA 3ZP5A 2JSCA 4U7DA 4EJUA 4LB5A 5D5UB 1BIAA 1K6OA 2XROA 1WI9A 5BPDA 3Q5FA 3RPUA 3BDDA 3REOA 5EEGA 2HOEA 3WGHA 1XSXA 1U2WA 3FXRA 3GYHX 1YO5C 2EFNA 5D8LB 5H6RA 4ZYEA 5J6XA 3HHHA 2A07F 1MJ9A 2V79A 2FEZA 2C6YA 1YG2A 1HQCA 2VBWA 2QQAA 3FMSA 3F8NA 1R58A 5LRRA 1FSEA 1J9IA 3K9TA 4OIQF 2K02A 1J59A 4ON0A 2A6EF 3CUQC 2EJRA 3WTSC 1S7OA 3H3UA 3CO7C 5FD6A 2E7XA 2GAUA 3BOQA 5JR3A 1A04A 3I59B 3QOPA 3ZMDA 3TKYA 2ISYA 2XAGA 1T98A 4UNOA 4O6JA 4YIIA 2LF8A 2Q8KA 3QU6A 2J5PA 4HLXA 3P9KA 2RV8A 1YQAA 4HF0A 1J5YA 2XV4S 4GCVA 2VE8A 3EYYA 2HFHA 4YG2F 1O7LA 1R23A 2QBYB 2AS5F 3E6BA 3GUDA 1R7JA 2P5LC 2OAZA 4ASNA 3IHUA 3Q9VA 3VOEA 2F5EA 3HRUA 2XAQA 3H3ZA 3ZMZA 1HKTA 2VT2A 4BH9A 4PCQA 1ULYA 3I53A 4HYEA 4PGGA 4KN4X 2HKXA 1T6SA 5CVJA 5LGTA 4HZFA 3RTRA 3E6MA 2VOPA 4XBFA 5IT9K 2UXNA 3CUQA 1FP1D 3SZTA 5BS6A 2LNBA 3WU1B 5ED4A 1MDMB 5J8CA 3BROA 2NRAC 2KJBA 1U5TA 4IJAA 2ELHA 1P6RA 3U2RA 3CJNA 1HW1A 4RB2C 2NNYA 3JSOA 3DPLC 2A61A 3WTWC 3WTZA 1MD0A 1WRJA 3R61A 1DPRA 5JHUA 2PI0A 5ILUA 4FHTA 5LRSA 4ETSA 4HX4A 4S05A 2G9WA 2QLZA 4LB6B 5HVQC 3ROUA 4KNYA 4M9XA 4Q4ZF 1LB2A 4G7OF 1W7PB 3OOPA 4PGHA 2EV6A 4HX7A 4EJOA 2YX4A 2VE9A 3E3VA 1JHFA 1OYYA 5EEHA 2AXLA 5F6FA 4UVBA 2NNNA 4GO1A 3F8FA 2RN7A 3T8RA 5DCMA 3JTHA 3HIFA 1KYWA 2H94A 4IHSA 4A6DA 3SFZA 2V1XA 2IVMA 3K1NA 1FNNA 3KFWX 3ECHA 1I1GA 1R5GA 1QZZA 1D3YA 2XAHA 4XRFA 1QO0D 2ACJA 1S8NA 1DDNA 4I2OA 3FXUA 1B4AA 4EJWA 1KU7A 5ILVA 3HSEA 1IUYA 4HDVA 4FT8A 3ZMSA 5L3CA 2YSRA 1TTYA 4LLNA 4WXCA 5LGUA 2P7CB 1ZRCA 5BPIA 3JTGA 2D45A 3WTYC 4G9YA 3T8TA 2W24A 4ESBA 3JAMK 2IA1A 2RKHA 2M45A 4P9FA 5HS9A 4MGRA 4OIRF 3WTTC 5FO5A 1MJBA 3BY6A 4CICA 2Q0OA 2YPRA 1G3TA 4XLPF 5H6QA 1JHHA 2X0LA 4A5MA 1XCVA 3PFIA 1JE8A 3V8JA 2EFOA 3BP8A 4OMYA 2P6SA 3MZYA 1ZLKA 1AOYA 3HRTA 4JQFA 2RDPA 2RQPA 3HHGA 4R8HA 4Q5SF 4LK0F 1XSVA 3K2ZA 1O3TA 4ENNA 2HKOA 2ZNZA 2BE5F 4L9VA 2MA3A 5ICCA 4BXUA 1K78A 1RIOH 2Y75A 5CLSA 1SMTA 3MQ0A 1ONVA 3I4PA 1HKQA 1IW7F 1BN5A 5HS8A 4HOBA 1HSTA 2VN2A 4HW0A 4DNCA 2H6BA 1O3QA 3DPTA 2ZBKA 2EV5A 1OKRA 1Y0UA 4M9SA 1SFXA 2O3FA 1KQ9A 3R0AA 1SFUA 1H9GA 3FMRA 5E8GA 1LVAA 2FMYA 1ZH5A 4ZYHA 2O61A 5A2QK 3E97A 4JK1X 1I5ZA 3PQJA 1FWZA 4G8XA 4A0XA 1HBXG 1USTA 3KP3A 4K2EA 3T5XA 1XDSA 2L54A 3HSRA 1GXPA 4CGZA 3W6JB 5D8KB 3RYRA 2OZ6A 4KN7X 4CDGA 3GF2A 4Q48A 4U88A 2HR3A 1ZG3A 5TJJA 1BIBA 1IF1A 2QQ9A 3S2WA 2HYGD 2FNAA 1HW5A 2GXBA 1LJ9A 3QP5A 3COAC 3KEOA 5ICGA 4RS8A 4JBAA 1G6NA 2OQRA 2K4JA 1S6LA 4IRGA 4YFNF 2PQ8A 1V4RA 4YFKF 3FMQA 3JSPA 3HUGA 1XD7A 2VBYA 4BAYA 2H6CA 1FC3A 3CTAA 2M87A 3TOBA 1Z9CA 3G3ZA 1H0MA 4MQ9F 4P9UA 2FRHA 5DUKA 3L9FA 2W57A 4KIFA 6PAXA 1YS7A 1IN5A 4HBLA 3VEPA 1XGNA 4A6EA 2VBZA 4Z2YA 3CUOA 4LFUA 5LLQA 3VB2A 4KIBA 3WTXC 2EWNA 1XMKA 4IRHA 2NAZA 3RPQA 3IWFA 4NB5A 4I0BA 3KP2A 5TRDA 3GFMA 4I7HA 1WSUA 1R1UA 5E17F 2QUFA 2PEXA 2HQNA 1CF7B 2IT0A 2HTSA 3F72A 4DQ2A 2FQ3A 3VFZA 2A3SA 2OD5A 4QWQA 3IC7A 3IWZA 1HSJA 3QPTA 2L4MA 2O6GE 3TQNA 4P55A 1IN7A 5LEJA 5CJ9A 3J80K 3M8FA 1T38A 5LHIA 4B09A 4KMUX 4HQMA 3QAHA 1FYKA 1XGSA 1ZRFA 4P5OA 4NHJA 2ZCWA 2Q2EA 2JPCA 1MDMA 2CGPA 2EA2A 3ZN0A 5BQTA 3WTVC 5HDKA 4I02A 3IKVA 3P9IA 5CVIA 1BOAA 1FBQA 1CGPA 2QWWA 1XGMA 4HA8A 3HRSA 2KIUA 2XAJA 4M6YA 4WWCA 5KVRA 2JZYA 3HSFA 4GXOA 4L9NA 4UHTA 5D6FA 3MZHA 4KDPA 3KP6A 3WG9A 1K7AA 1W7PA 3TO7A 3EDPA 2UWMA 4UV8A 5CVUA 1QBJA 1O3RA 5KK1A 1B9NA 4MQVA 3T0YA 2STWA 1TBXA 3F3XA 2RNJA 3E6DA 3R60A 3LSTA 5ILSA 2GA1A 3DP7A 2XASA 3V8LA 1P4AA 1ODDA 3KE2A 3P9CA 1P2FA 2M5WA 2FF4A 1U5TC 2K86A 1R36A 2WWYA 3I58A 4I98B 3ISPA 4EV0A 2V6CA 2A69F 2PBIA 4OIPF 2XAFA 5E18F 1ZAOA 3MEXA 2CQKA 3RKXA 3WGGA 2RVCA 2ZMEB 4BNCA 2P6TA 1YYVA 4A0ZA 2VBXA 3LQQA 3MWMA 2VODA 2LDUA 3L7WA 3CO6C 1F9NA
chains in the Genus database with same CATH superfamily
3CCUI 1LFPA 3C1DA 3MCZA 2V6EA 1JE6A 2R7TA 1K79A 1JT6A 3RI4A 4G7HF 2X51A 1ORKA 2R5YA 3S1RJ 1YHQI 2NYKA 2XPUA 2GITA 1G7PA 3HCVA 3FTGA 2F5CA 1F5TA 5J40A 1JGSA 1R4MB 1IRFA 1R00A 1IGNA 2HTJA 4RMNA 5L3GA 1S7WA 4NO2A 2G7UA 5BMZA 5M5YJ 1XSDA 1YIOA 4IVNA 3VFVA 3I9V2 2Y48A 4Y4RA 2D1VA 2R4GA 4JQXA 3EQLF 3TN0A 3E6HA 1UJ8A 5HLIA 2JA8J 1NEZA 4BY1J 1SYSA 3S3OA 2OBPA 5BRZA 3E2HA 1SMYF 5E1WA 1Z91A 1C16A 4DJAA 3BXNA 1OCCH 1LQ1A 1S7XA 2XGEA 4PK4A 1G4DA 1D8JA 4JFEA 2G0EA 3BG5A 3F9KA 5FFZA 3JW4A 1D0ZA 3ZCOA 4RBOA 1CQTA 2X4QA 3MAJA 4E7ZA 3O4LA 1J2XA 2J5OA 1TNSA 2M30A 1T56A 1YW8A 2HPIA 2FA5A 3FHNA 4EGZA 2HDDA 2LKXA 3UTSA 2E5ZA 3QPLA 1BL0A 1ZHFA 2DOAA 4IL6C 4OINF 2KKOA 3G73A 4BU2A 1HW2A 3VFPA 3L3DA 3W6KB 2IAIA 4F7TA 2LD5A 4A2UA 4IF4A 4KMFA 1VQNI 4AUXA 4XXCA 4TV7A 3ARGA 4ZYAA 2D1HA 5JI6A 4OMZA 4EJTA 4PJNA 2UZKA 2UWEA 2AQEA 1ETKA 5IPAA 4IRIA 3QEQA 3O3EA 3A01B 1IN6A 2ISZA 3FOLA 1KPRA 1FOXA 3OR2C 3CMMA 4CXFA 3PQYA 5TISC 5FDWA 2B9SA 1APLC 1FZMA 3CMEI 5IT3A 1JGEA 3HC7A 4FE4A 5CVRA 4LG0A 4A3LJ 2JVHA 4LLLA 3C9NA 2VUMJ 1T2KA 1S3JA 1ZG5A 3GXOA 2DPUA 5B3SH 2XB5A 2KRCA 1FY7A 2ESVA 1FP2A 4Y2DA 3A03A 2OTJI 3ZQQA 2DMUA 1HLVA 3MROA 1LUJB 4WXHA 2BXYA 1FOWA 2FSWA 1KU3A 4LK1F 4B44A 1L3LA 4WO4A 4JP0A 1RJYA 3BUYA 1FSHA 1YJWI 3LKQA 1E2XA 1GHCA 1HOCA 2BHYA 2IXSA 5FKPA 3KLOA 1PUEE 2J8UA 5HLHA 3M17A 1A1NA 1T95A 3GTMJ 3E7LA 1ZHLA 1VADA 3AL0B 2R7SA 1NHAA 3J81K 1DE4A 2R7RA 2NS0A 4IHOA 2ZJPF 1RI7A 3ABKH 3EETA 4XLCA 3GTJJ 1B0GA 4NO0A 2DPDA 4E5XA 4UB6C 3ZOBA 1TMCA 5KHDA 1JJ6C 3MRPA 2JSPA 4UQ2A 1Z21A 4BEHA 3FDYA 1J0RA 1X19A 3BH9A 2DFIA 2ME6A 4ZAKA 4BY7J 1SFEA 3PQKA 2PG4A 4LOCA 5L3FA 1K83J 3LAJA 1W1WE 2K7LA 1OQYA 1ZK8A 2GQQA 3O2PE 2XFXA 3W39A 3PIOF 3SJMA 3H5AA 3KWWA 1L8JA 2GBYA 1ETQA 5IOYA 5C0FA 1TZLA 5DDGA 1MI5A 4XKCA 2GWRA 1LDDA 2M7AA 3NARA 4PJ7A 3SPVA 5BS0A 1I1SA 3KPOA 1P7JA 3TP0A 2DO7A 3NEUA 3G4SI 3MRFA 1QVTA 4PV8A 1WGXA 4Y17A 3GMOA 2P81A 4LIVA 5DD4A 4UV9A 2V9VA 4IQ4A 1FT9A 1ZLJA 5E3MA 4E7SA 4O5VA 3B02A 2PJPA 2JVGA 3BP7A 1TWCJ 2BY0A 2L7ZA 2W84A 1FFNA 1U58A 2EV0A 2CYYA 3O3BA 2E7LE 4RGUA 1MMAA 4AIJA 2DCEA 5C0JA 1KGSA 4AIKA 2Y30A 3C2BA 1I1AA 1AWCA 4YFXF 4HF2A 4I48A 5HHNA 3F8BA 2MLKA 3MN2A 5ICFA 2V7FA 5E9DA 4QRSA 1BI2A 3KEYA 3DQVC 2PJRA 4UUSA 4BL0B 1PP7U 4A3FJ 2DT6A 2KRFA 2ZB9A 3H5RA 3EUKL 4U0VA 4EM2A 1S9HA 4J00A 5IT9Z 2K3PA 3G71I 2W25A 3K2AA 3OSFA 2L9SA 3PABA 2CV1A 2EFWA 3GLLA 3K10A 4G42A 4ZH4F 3MD2A 4DYRA 3W6VA 1ZGAA 4FETA 3ZMUA 3BGMA 1FZOA 4ZYGA 4XNFA 3EYIA 3S3MA 3TBTA 4PJ5A 3MGTA 3I5UA 2EB7A 1U3EM 4CO8A 1X3UA 3CMYA 1D5YA 3PNYA 1GZPA 3H7BA 2CQXA 2DTRA 4M9ZA 1E0EA 3WU2C 4GKNA 2AXTC 3L2WA 3HOSA 4L8SC 4XN0A 1U78A 2BY2A 3AG3H 2HYFA 3QP6A 4BHBA 2X4TA 1QQIA 4LMYA 3JRIA 1I6HJ 4KT6A 3QUKA 2VJ4A 3LKSA 3RWHA 2GT9A 1WBYA 3ULQB 3O8HA 1N2RA 4U0WA 2Y31A 4QRRA 3RQIA 2DDAA 3TGNA 1MNEA 3HYIA 4BS9A 3I4MJ 2LF7A 3R4KA 3IRQA 2MHAA 3HLAA 4WW2C 1T0MA 4C3HJ 4R79A 1AA7A 1FZPB 2CJJA 3CUQB 2XPGA 4Z77A 1T20A 3H3VK 3VYUB 4HUXA 3L3GA 1I6XA 3H1CA 4HSRA 1FG2A 5LGNA 3UTTA 4GYGA 5IEHA 4PJEA 3RSNA 4YIRX 2R7FA 1SAXA 1CD1A 4L29A 5AIPA 3PSIA 1NANH 2F5VA 1EH7A 1YRNB 2WV0A 3M1CA 3SZPA 3DTXA 2XF7A 1WKMA 1W5TA 4HNTA 1SD6A 1FOKA 3TBSA 2L7MP 2XGXA 4XRSG 4MEYF 4C2TA 3MRJA 4ONOA 1S7UA 4F7EA 2KLOA 5GAGJ 4NO3A 3VFSA 2KHMA 5KNLA 1LNWA 2LK2A 3KP4A 3GZ5A 3I0TA 5FFXA 1ZREA 3BH8A 3KPPA 3RDIA 2LFBA 1S72I 1S7EA 2ZSWA 2F5FA 4M3BA 3LA3A 4L5JA 3KZIC 1OISA 1U0JA 4I0AA 1FZKA 1QNTA 2E60A 2F5DA 1DGRM 2FQ4A 1E3OC 3LMMA 4PJ9A 1IXSB 3RJPA 2E1MB 2F74A 4NBQA 1NAMH 3GJFA 2VAAA 1Z5LA 4PJXA 4PGEA 4AC0A 5LBQA 3OY9A 5HLTA 1KZHA 3GO5A 3M9AA 2DQRA 3D0SA 4BE2A 3I54A 1HOMA 4B1RA 4CYCB 4R1HA 5F64A 5FGMA 2QSHX 1T7ZA 4PRAA 3NRVA 3ZQ7A 3MKZA 5FLXK 3V5HA 2E7WA 1B1BA 4C2UA 1MKMA 4AIHA 4IHYA 3KX2A 1YI2I 3I4NJ 3VXSA 3SHFA 1S7AA 1X1AA 4PUSA 2EZLA 2H1LA 2EIKH 3R6SA 4DOZA 4KFCA 4RGSA 5LEKA 1F36A 3QQAA 1SFOJ 4Q47A 2EA4A 2IRFG 3GX4X 3OYIA 5D4RA 2FBKA 1MMSA 1DUXC 2IW5A 3VWKA 1XDUA 3LSJA 3BG7A 1H9TA 1IC8A 5FKOA 2CWEA 1RK0A 3L09A 3CESA 2K4BA 2EK5A 2WY7Q 1TW2A 1BIIA 4FX0A 1TQPA 3RPUD 4Y52J 3CMAI 2XC7A 3GMPA 4PG2A 3S1NJ 5FLMJ 2FBIA 2NS7A 4PJIA 2QQBA 4IRJA 2A6TA 3N97A 3D18A 2ESNA 4BGDA 5GPAA 2FOKA 4WU5A 3OS1A 2EFQA 5HOOA 2DT5A 2F2EA 2DA4A 4L0YB 1OMIA 1RNLA 3BPVA 5CYVA 4GKSA 4A5NA 2R93J 3AG4H 3H5NA 1PP8F 4NT6A 1TT0A 2CUJA 4MLOA 1IRGA 2MLGA 3E5QA 1IN8A 4RB1A 1IAWA 4ZUTA 4LJZF 2W7NA 4PP8C 5BOXA 4HF1A 2IS1A 4HV6A 2O5RA 1ON2A 3JAMZ 2L2OA 1ZHBA 2PN6A 3DU5A 1LP9A 4XIDA 5MERA 2V4JC 4E7IA 2VXZA 4CZZA 2YPKA 3QDMA 4QTRA 2WAEA 4II3A 2EH3A 1STZA 3KZZA 1POGA 2ME0A 4II2A 5JHFA 4HQEA 2L5QA 2A83A 1BJAA 3FKIJ 3BQZA 1OPCA 1X3WB 3GMEA 3GSQA 3CCHA 3CJTB 4MJ6A 1Z77A 1E17A 2VKEA 3RWFA 1K4TA 1SVMA 2DK5A 5BJTA 1XPXA 2VT3A 1R5HA 1OCZH 1KJMA 4ZZDA 4ZJZA 3GVAA 1BI0A 4XSZF 1IV6A 2HGCA 2CKBH 5GP9A 5SWSA 3S6CA 5HGBA 3FRUA 3R0JA 1K4SA 1DP7P 3ZQHA 3J7AO 3AG1H 4B8XA 5DUIA 3IKTA 2BXZA 5IY5H 2VJIA 2QM3A 5C0IA 2K5CA 3HGYA 4U7BA 1MW7A 5ERIA 4G59A 3E1SA 1YS6A 3GFLA 4NDLA 1TWHJ 2ZSHB 2BSTA 3ERMA 2WADA 3TMOA 3S32A 2ZO4A 3QYEA 2K9SA 3MKWB 1P4XA 3OL3A 2GJ6A 3V7RA 1F4KA 3ECBA 1PYVA 2V1DA 4Y3OA 1X1BA 3N4MA 3DTEA 2DA2A 1VQMI 4HAMA 1M05A 5IB1A 3OMYA 2XAUA 1WHUA 5J1RA 4XLFA 5LHHA 3VRJA 3VXPA 1KU9A 1TQIA 4D0PA 2OUMA 3KP7A 1OLTA 1K8DA 1D8KA 1RZ4A 1W5SA 1TNTA 3B3IA 3I6GA 3JR9A 2XKPA 2YU3A 3OYFA 2BW3A 1U8RA 5D4SA 2DMTA 5H2FC 2Z9OA 1HC8A 3KPQA 2E35A 5FKLA 3V8KA 3SJVA 1WZ2A 1FPQA 3FKJA 3S93A 4HV5A 1ZRDA 3ZMTA 3LNQA 1W36D 1GT0C 1YJ9I 4LGWA 2BCKA 4CCLA 3OYMA 4W1UA 4UXNA 3SQNA 5JFRA 1MZBA 2H6PA 3AU1A 2XUBA 3REWA 1HKSA 5B1BH 4IHVA 1TWAJ 2BVPA 1FBSA 1LDKB 2PLYA 4WUUA 2FU4A 4XLHA 4ENJA 3I59A 4MVBA 3FHZA 3OYAA 4EMSA 3I56I 2NVXJ 1WJAA 2CW7A 4FASD 4PR5A 2QYOA 3GLXA 3GSXA 1ZT4A 3JREA 1JUMA 4B4CA 3OYNA 2FBHA 5AONA 4ZTJA 1QSFA 4F93B 3CQZJ 1D0XA 1WJCA 2G7HA 3GFJA 4KYWA 3LA2A 4CW1A 3Q0UA 1UHMA 3BJ6A 4RAZA 1WFXA 3TBIA 2V26A 2Q1ZB 2X6OA 1ZN2A 1K78B 4GYIA 3RIRA 4XSXF 5E8IA 5A2QZ 4O2FA 3ZPLA 4XMYA 2L3DA 5EO1A 2V1NA 2CW0F 3LWFA 3FONA 3CLOA 4QSHA 4GUPA 2NYXA 4BJ5C 4U1SA 1GVDA 2XIGA 4EQQA 2HOSA 3TO4A 4A0YA 2QBYA 3S1QJ 2XPWA 1QU3A 2HZTA 5AIQA 4NNXA 1OYWA 4IPAA 4LNRA 4XKBA 3EUHC 1GXQA 3RKYA 5FKKA 2P5VA 3FT3A 4L4VA 3F8CA 1WPKA 3TDUC 1BW5A 4Z6YA 2R7WA 3FIWA 3FXLA 5F0CA 3CCLI 1S29A 4LCYA 3TBYA 4G43A 3F8MA 3S2HJ 4V3EB 4ENMA 3T8XA 1VQOI 2K3FA 3AREA 1YW9A 2WB1A 2MD0A 3GSOA 2W00A 1H89C 1BI3A 5HNFA 3VSLA 1PDNC 4ZUUA 4O3MA 2HVRA 1F1ZA 1VQ5I 2ZXHA 2K9LA 3DX7A 5HDGA 1IV8A 1OR7A 3PJRA 4U6YA 4Y16A 2Y0SA 5HHPA 2O5NA 3OXRA 4AIDA 2V1UA 3ABTA 1LE8B 1BR1A 1EV7A 2H27A 3IXAA 5J8FA 2MBFA 5K7ZA 4XICA 4HNUA 3HTUA 2H09A 3FM3A 2XF5A 3PFYA 1RRJA 3HOVJ 4FISA 4IO9F 2EZIA 4YIFA 3C3WA 1RUNA 4U1LA 3DX8A 1TQMA 4G8IA 4FQGA 1XCBA 1BJZA 2DQLA 3BR2A 3WGIA 3A01A 2OCCH 4DW6A 4A93J 3ZGKA 3DKYA 5F7DA 3GTLJ 3DF8A 1E28A 4F7ZA 4JFOA 2KZGA 1SD4A 1LEKA 3MV9A 5D6EA 1X58A 1VACA 5HNHA 3ECOA 1Z0XA 3KYLA 4JX4A 1ZYRF 2Y9YA 2EQRA 2BY1A 3OYDA 4OAZA 2D31A 3ABUA 4C30A 2KJCA 5EGOB 1FYLA 1RUOA 2PX9A 2AXFA 1B6AA 1YDPA 1TLHB 3AAFA 2GTZA 2VQHA 4Y4HA 5D9SA 2ZJ2A 3ERED 4U6XA 5KCMA 3JTTA 2PMUA 4M73A 2AHQA 4RDUA 1JFMA 4KT5C 4I01A 1MBHA 2M4KA 3MKLA 1SEUA 1BBYA 1O3SA 1B8IA 3EUAA 3BO8A 1Q1HA 2OI9A 3LKNA 4Z76A 1J7KA 4WCGA 3HOUJ 3EUHA 2HVQA 2VC0A 1GVJA 2WTEA 4HNVA 4JRXA 3WG7H 1QR1A 5B38A 4JFFA 1OYIA 4MXQA 2OQGA 4PJGA 5DDHA 3HUGB 2BGCA 3SXYA 2IEKA 2R5ZB 1I39A 5KAFC 2KDOA 1S9YA 3TIEA 2VASA 1P1ZA 1FYMA 1TWGJ 1U8BA 1RETA 3O9WA 3VFMA 3ZN1A 2X4HA 3OYCA 2CIIA 4KUMA 1BZ9A 1I27A 4PFOA 2F54A 2BOLA 3H0DA 2O9LA 3M1EA 3U1DA 2X1CA 3TJHA 2ID6A 3GWZA 1GV2A 2MW8A 1X7QA 2AV1A 5DYMA 3K4BA 3W2WA 4KITB 3A02A 5CPRB 3MR9A 2DOFA 3A0HC 1W4MA 2XDVA 1HHGA 3A0BC 2QEXI 1MJAA 4XONA 2I8DA 1BQHA 1SAUA 1S7SA 1YTYA 5ENWA 3SEQA 1HDPA 3VFTA 2IS6A 2XRLA 2DK8A 3CF2A 4FFEX 1O57A 1UHWA 3H0GJ 4RB3C 1HHIA 2HVSA 4GFBA 1B59A 4WDIA 1LVKA 1U9OA 2QENA 2B7EA 1X1DA 2CO5A 3DU6A 5IYBJ 1VNDA 3F23A 1AGEA 4XLNF 3E5UA 2F6CA 3VFUA 3FZVA 4A3MJ 2H26A 1J75A 2LSOA 2E2IJ 1XC5A 2Z3YA 2IGKA 2WC2A 3LFUA 2P8TA 2ECCA 2XKOA 3CJQB 1IO2A 2ADUA 2EPFA 4XN3A 2GA2A 2MH9A 1RC9A 3ZXSA 2A68F 5DS9A 3J80Z 4QRTA 4WWKC 2R7QA 3P9MA 1FO0H 3DV8A 3DBXA 3O8XA 4F7CA 1BR2A 4EJVA 1UELB 2GLOA 3KYCB 4U1NA 1P4WA 1YOVB 1V3FA 2BHZA 3VWBA 3QUYA 2E36A 1QVUA 5D2NA 3D1NI 2QQ8A 3OS0A 1LPQA 1XH3A 5HHOA 1K6YA 2HQRA 3MREA 4RA2A 4NHUE 4RAYA 4NQWB 2A5WA 1W0UA 2HDWA 2IBDA 1EH6A 2LY9A 4CSWA 3OR1C 4EATA 4IOCF 2L02A 3FM5A 2L4AA 3DFGA 3BG9A 2QZ8A 1LFUP 4RB0A 1LDJA 1KYZA 3TW6A 3VXMA 3RWCA 2VIXA 3ARDA 1FTZA 5EZHA 3L3IA 4PJCA 1A6ZA 4P96A 1SD5A 4XKWA 1Z6RA 3QDGA 4RGRA 3WLBA 1FMWA 2WY8Q 3B6SA 2DXIA 1N3NA 1OCRH 5FKNA 1G2HA 4EM1A 4BHCA 3MRDA 4JYKA 4XOPA 1IG7A 3GTPJ 3GTOJ 2ZFUA 2Z16A 2GXGA 3BR1A 1YW7A 2RREA 2ZXJA 3WE3A 4N4NB 2OA4A 3MMYB 1B0RA 1DPUA 2D2WA 4IKFA 1N78A 1EEYA 2QA4I 2LKPA 3QQ4A 3MRRA 2R0QC 3L2CA 3BP4A 3G6EI 1YFHA 2DMNA 1TWFJ 2RAEA 3QRFF 3MRGA 4WF2A 4QRUA 1AGCA 1R4NB 1FIPA 5FJ8J 3BZEA 2KZVA 2QVOA 3D5SC 2XRNA 3OS2A 1VGKA 1T1WA 5E1ZB 3FF5A 2ZFWA 2VC1A 5DV5A 2KDZA 1T7WA 2DU9A 3GZ6A 3T1FA 3GZNB 3H9JA 1MWAH 4WJ5A 5EDNA 2MH2A 1WWXA 4G6DA 2LBFB 1QGPA 2HEOA 4IOAF 3G1LA 4JFQA 4OWRB 2YUSA 3C2HA 4W97A 1YRNA 1FOYA 3GTKJ 2HDCA 4G6QA 1NK3P 2VLKA 2CUFA 3WTUC 1ZAGA 4LITA 2QKMB 5K5QA 3GFIA 3BZ6A 2R7UA 1TP4A 2E1OA 2GZWA 1XGOA 3CCRI 3PWNA 2MD5A 1IN4A 4M3FA 4IHTA 2X4UA 3D2UA 3K70C 3FX3A 2CQQA 4Y13A 1QRYA 2LH9A 5M3FJ 2X4RA 3QU3A 1XN7A 4UVAA 5EZGA 1AGFA 4PJDA 1YN6A 2DT7B 4X1EA 4Y33A 1FZJA 2P7VB 2ZNYA 4X6DA 3FXMA 4AM3A 3ZQGA 4ZFZA 1IM9A 3U0PA 1I1YA 3HAEA 5F9JA 4A3CJ 2PMHA 4L3EA 2JWTA 3DKXA 4XLAA 1IZ1A 1BW6A 1UCRA 1U6GA 2M4GA 4HPQA 3DMMA 2BZTA 4D5FA 2DYPA 4CYCA 1BC8C 2ECBA 5IYDJ 2JUCA 4S04A 4UUVA 2E2HJ 2CLVA 1HXDA 5EYRA 3Q0VA 3QOEA 5IB5A 1IM3A 4ZYDA 4N5EA 3TO9A 1T1XA 3GMQA 1HDDC 4MFDA 3DTIA 2OZUA 3M7GA 2Y9ZA 4CHUA 1DU6A 3M8EA 3RKWA 3CZ6A 3B6AA 4PRBA 1ON1A 4IHXA 1EFXA 2FXAA 2IA2A 4L9TA 2HWVA 1A9BA 4QOKA 4C9YA 4U1JA 1VTNC 2L9NA 2DW4A 2QSFX 1REPC 4FTVA 4M6XA 1Y8RB 4LLGF 1A35A 3KPSA 3J7AY 2ICWG 2F48A 2JT1A 1Z6TA 4G7ZF 2YX7A 2W85A 5FRMA 3NQOA 4L5IA 1UFMA 1MHEA 4WXDA 1W0WA 5D7IA 5HS7A 2Z33A 3HRMA 4XRMA 2KL4A 3J7ZI 3JRHA 2LVSA 3CCMI 4L0ZB 5D7LA 3QFJA 4XL9A 4FCYA 1Y6IA 4ZZLA 2ESHA 1X1CA 4EVIA 2IS2A 3L2QA 1FLIA 2HQAA 4ESJA 1SVOA 2EINH 1UQSA 1ZHKA 3I71A 2IA0A 2M8EA 1R71A 1LEAA 3K0LA 1S5LC 2PMZN 3FT4A 1KU2A 2Z99A 2DODA 5C9JA 4E0RA 1BI1A 1JUSA 2X6YA 4YELA 3BEWA 3GSVA 4YRVA 1V5GA 1W0VA 1DQUA 4BJ6C 3PWLA 1H88C 2DA1A 2YU9J 2A05A 3F21A 2I5UA 1KJ3H 1QZEA 2JQ7A 1A31A 2CFXA 4Y15A 3SDGA 4PV9A 1XB4A 4BQAA 4QRPA 4DBQA 1KTLA 3EPZA 3G2BA 2OV7A 2Y69H 2YR2A 2DTZA 3IP4B 1R49A 2EILH 1WI3A 3A1YA 4MTEA 2FZ3A 1EH8A 2R7XA 1KBGH 1YLFA 2VQCA 2FWOA 5E1XA 4MEXF 2E5NA 4IXAA 1MGTA 3WE2A 5LD2C 2FMLA 1XMAA 4MQ7A 2E1NA 1ETWA 5L3EA 2BYVE 4PRPA 3BR5A 3BQYA 4OU0A 4DIQA 1KQ8A 4H0EA 1I3AA 2K9QA 2IGMA 1HF0A 5EEAA 2F53A 2A6HF 3BZCA 1NG7A 2KIMA 2COMA 3HEFA 3FWEA 3OYJA 4X6CA 3V5KA 1Z1DA 5DD8A 3HBLA 3I64A 2YPLA 2BVLA 2F4OB 3E3QA 1RKTA 3TF7A 5J3LA 1QZYA 3VSKA 1B3JA 1Y1WJ 4L18B 1JUFA 2VXDA 1U5TB 1FMVA 1ZGJA 2VL8A 3HOXJ 3ZQLA 2HJKA 5ISZA 3VODA 5D5WB 4I99C 2CQNA 3J81Z 4XQFA 3BVNA 5DM6F 3RZDJ 1HHKA 4M71A 3O3AA 3H9SA 3X12A 3E5XA 5DCFA 5ICEA 1A1OA 3S14J 2CV2A 4HKJA 2GIVA 2AQFA 3H36A 2DAOA 3ABLH 1T7YA 4IZZA 1YX5A 3CC7I 2DI3A 5EU3A 3GSWA 2XSJC 2NOGA 4CA0A 2UUZA 4F3QA 2AV7A 3X11A 4KJZA 2WB1N 2YEZA 2W4SA 4LG0B 3LQRA 3LAPA 2E71A 1T39A 3GW2A 5H20A 2FE3A 4M6VA 1G3YA 4KA4A 2ZOKA 2KISA 3KZYA 3ILQC 5F0HA 4B47A 3S3NA 1KQ0A 2L9VA 3LSIA 4N9HA 4D7MA 3L2RA 3QPHA 1G8XA 2Y0SN 3TDZC 1S8DA 4U1KA 1LFBA 1C0WA 2AK4A 2JUGA 4X6EA 1BM9A 3IRRA 4HLYA 4PJFA 2LR8A 2BEOA 3D5LA 3MYJA 3HE6A 3I55I 4E70A 2XF6A 4KIGA 4GGGA 1LEBA 1OJLA 1JT0A 5B5EC 1BA5A 2CG4A 2R3SA 2QSGX 3BWAA 3KXFA 4ESFA 2EFPA 4QPOA 1CF7A 2IP2A 3L3KA 2KT0A 3VWJA 1DDHA 2TDXA 4G59C 4EI5A 2OJED 2RGVA 4BYYA 2X70A 1Y39A 3D3VA 3KYOA 4U87A 1Z67A 3C7JA 3BC8A 1X4PA 2M1BA 5GTHC 5HDNA 4M72A 4DZPA 3ARFA 2P4WA 5DCMB 2JPBA 2M7BA 5L3DA 2ZXIA 4AVPA 2ZC2A 2IJLA 1G3SA 1D5VA 3JRAA 5HHMA 1YX3A 5M3MJ 2V9PA 2X4SA 1QPMA 1R1TA 3K1MA 5AD0A 4AYBA 3QWLA 3QZWA 5JHDA 3V7SA 5JVTA 3M1BA 4QRQA 3DEUA 3HTSB 3ZQCA 5B1AH 2BY3A 3L00A 2ZJRF 1B9MA 3O3KA 1JKRC 2STTA 5C08A 1V55H 2BSRA 3VCLA 5E8NA 5FRNA 5GAHJ 1Y0NA 2DMPA 2VJ5A 3IH4A 1G59A 3U9GA 1KA8A 3O6BB 3HG9A 3HKZA 2HQ5A 5HLGA 1UMQA 2EZKA 2KIFA 5EJCA 4DZJA 1FFPA 3BWGA 3LN5A 5GPCA 2MC3A 1RESA 3K69A 4CYDA 4CUGA 3N05A 4XLEA 2H8WA 3KETA 5FD5A 2K40A 2P5KA 3GEZA 3MFKA 2JRTA 4HX8A 3J7YJ 3P73A 1R1VA 1LE8A 5CQEA 4UVCA 3RUGA 2CRGA 4X6AJ 4BACA 1ETVA 2LP0A 2TCTA 3HOWJ 5JLWA 4EM0B 1MHCA 2V9KA 1W7PD 2X6XA 3ZQIA 4LCWA 3KLNA 3HXLA 2VLJA 2LYCA 4HEA2 1MSEC 2PJRB 3P7NA 2XHKA 3L9RA 2A5YB 3K7AJ 5K5RA 2DLLA 2ZMEC 3WODF 2IS4A 1TW3A 3K1PA 3AFHA 3V7CA 1W5CC 4HV8A 3KCCA 3HUJA 3Q9SA 1T0FA 2CS3A 1EA3A 4BHPA 2JTVA 4MHGA 2VONA 1JXSA 3LN4A 1YITI 3TVMA 1IXCA 2LLKA 4PZJA 4CH7A 1MBFA 4EGYA 4CVXA 1VQ9I 3ROOA 1FX7A 4F55A 5FB2A 1INQA 4D7NA 2CLZA 3KPLA 1R22A 2BV6A 3LFKA 4NNJA 4PRNA 5EG0B 4A3DJ 1USSA 2LMDA 4HWZA 3JCUC 1L0OC 2UXXA 4DYCA 1CG9A 1A9EA 4M74A 4A12A 4ENKA 1ETOA 1OF2A 3G08A 2K27A 2W1OA 4V3DB 3PO3J 4A69C 1QPIA 3ZQFA 1QA6A 2OU2A 3K6GA 3F22A 4JRYA 2Y0MA 3E6CC 2B63J 2COBA 2HNHA 3OYGA 1HCRA 4PJMA 1T7VA 2ZSVA 5GTIC 1EEZA 3GMNA 1ERDA 1WJFA 4L8BA 3RYPA 2R5ZA 4B3XA 3GTGJ 5DEQA 4LD5A 4MJIA 3C18A 2BVQA 2CV0A 5IB4A 3SKMA 2CUEA 5GSRA 1MH4A 1TVBA 1MMGA 4GDFA 1DUZA 3QFDA 4ELMA 1UG2A 2DA3A 2L01A 2BBYA 1OR7C 2E19A 4HX1A 2FD5A 4E4HA 3FBNB 2ZOLA 4PJ8A 4JQVA 5FLXZ 3DXAA 4G94A 4ZDPA 1KPUA 1VQ4I 1DGWY 1UZCA 4A3BJ 2O8XA 5J6GA 1T33A 4N0BA 1YN7A 3QQ3A 5H94A 1MMNA 1ZARA 2O03A 4IRSA 3DKWA 1LD9A 3DEWA 3OSGA 3DX6A 2GOMA 3OV8A 3HDDA 2B0LA 5MEPA 2DBBA 3V4GA 5F1RA 2EZHA 3B73A 3BTJA 2NVQJ 5E20A 1CE6A 3ZMVA 3LSHA 4UQ3A 4XORA 3SZGA 4A3JJ 2VOOA 4E7JA 2ZMEA 4KICA 1G3WA 2IGOA 3HOTA 3WHBA 4RGXA 4PRIA 1UB9A 1FJLA 3P5JA 3QPSA 2BVOA 3WU0A 2VKHA 3BJOA 3FXQA 3L2UA 1TVHA 3MV8A 4K7FA 3QUXA 2TRTA 2E1CA 4U1HA 4D0CA 3P4OA 1XG1A 3F6OA 2WBMA 3OYHA 3DEEA 4QLCU 1IJWC 1BC7C 1OCPA 4I09A 5J47A 4NQCA 3OIQA 4EN3C 4PJBA 4HDUA 1SD7A 3BJAA 3BEVA 1N75A 5D5XB 5GSVA 5IB3A 4MNUA 4HSTA 4XK4A 4MNQA 5LHGA 3GMLA 2ETHA 3W2VA 4L9JA 3BPXA 5D5VB 3T1BA 1Z05A 3DPUA 3AL0C 5E00A 1Z7UA 3ELKA 4FX4A 5K1YA 3IAM2 1PQZA 4NQWA 2CSOA 4WX9A 1ZTRA 1RKWA 2HXOA 4PDKA 2FX0A 2LY1A 4BXFA 4MTDA 1FBUA 2O0YA 2IPQX 2Z5UA 3ML6A 1O7FA 2XVCA 1JJ8C 1P92A 3DWLE 1ZG1A 1VQ6I 3F6VA 3SYTA 5HGAA 2HS5A 2KIQA 2ZKZA 3WL9A 1A1MA 1WQ2A 4PJLA 2RNGA 4PRDA 3O3DA 5F1NA 3KP5A 4N9IA 5L3BA 1IXRC 3I6KA 5FKMA 3HG1A 2RC4A 3TPUE 4V2GA 4U0YA 3LA7A 2PFBA 3TOAA 3GIVA 4AWXB 3FXOA 4OIOF 2FNPA 3KEQA 3RWIA 3RZOJ 3CDHA 3DBLB 4AD9A 2Q7YA 3VJ6A 4WK8F 3TO6A 5JVGF 3IL2A 1HHHA 3H92A 4BDZA 2DYSH 5CVVA 2R7DA 3DXJF 2DFEA 4MJ5A 5D7JC 5DEGA 3QODA 4S0HB 4OOIA 3HE7A 5K5OA 1N59A 4ZUWA 3ZP5A 5L2JA 1B72B 2JSCA 3U21A 4U7DA 3GSNH 3TO2A 1QVOA 4EJUA 4DYQA 2R7VA 2BNQA 2OF7A 2E2JJ 3W2AA 4LB5A 5EU5A 4QIWN 2OC6A 5D5UB 1QLFA 3E6FA 3B6CA 3GBGA 1BIAA 4HRIA 1K6OA 1RR7A 3SFIA 3X14A 2XROA 4L8DA 3TBWA 3OYBA 1WI9A 3MV7A 2LBFA 1GUUA 3G1OA 3I3LA 3SEZA 1P7QA 3FBIB 4M3DA 5BPDA 3Q5FA 3RPUA 1K61A 2GXAA 2FIKA 5E79C 5D2LA 4JFDA 3BDDA 3VXUA 3REOA 5EEGA 2HOEA 1JUPA 3IAS2 3WGHA 2VLLA 5SWQA 3JRFA 3FQUA 1XSXA 2M9HA 1DP3A 2QGUA 1M1EB 3RCOA 4IEJA 4HUWA 4A3EJ 1U2WA 3WS6A 3FXRA 1IRZA 1NTCA 3CCSI 3GYHX 1YO5C 2EFNA 5D8LB 1SFKA 5H6RA 4PRHA 5EU4A 1A6QA 3D5RC 4ZYEA 2CIKA 5J6XA 3HHHA 1VZ0A 3HOZJ 2A07F 3CDGA 3P77A 4BE0A 1MJ9A 2V79A 4Z78A 2FEZA 4BBRJ 1WH7A 1V5FA 5E6IC 2C6YA 1YG2A 3RKQA 4F7MA 1HQCA 1VF9A 2VBWA 2QQAA 3FMSA 3F8NA 1R58A 3LSKA 5LRRA 3IUOA 3PUFA 4ZTFA 1FEXA 4D1QA 1FSEA 2DYRH 3SDAA 4PJJA 1J9IA 3K9TA 1VQKI 3VXOA 4OIQF 3MVPA 1D1CA 2K02A 4UUTA 1J59A 3VYRB 4ON0A 2A6EF 3CUQC 4XRSA 2EJRA 5E3OA 1S7OA 3WTSC 4NUBA 4U1IA 3H9HA 3H3UA 3H9GA 4RM2A 4EEFG 2W48A 3HJEA 3CO7C 3OOUA 4KISA 1BD2A 2X4PA 3K70D 5FA3A 2RQQA 5FD6A 4NC8A 2E7XA 4JFPA 2GAUA 1PUFB 3BOQA 4BQNA 5JR3A 1A04A 2KFDA 3I59B 3QOPA 5C4JJ 3ZMDA 1T7XA 4NQEA 3TKYA 5FA4A 2ISYA 2XAGA 1T98A 4UNOA 4O6JA 2VJJA 5MEQA 1JTYA 3TW7A 4YIIA 1SANA 1X2NA 1ACIA 1SYVA 3FFCA 5IP7J 2LF8A 2DA6A 4I6ZA 3ES6A 3UPRA 1EF4A 4YEJA 2Q8KA 5GADJ 4K71B 3TA3A 3OL4A 4HUUA 3GTQJ 1W72A 2IGNA 3QU6A 4LCCC 3QUZA 1K5NA 2J5PA 2X1EA 4HLXA 1UHSA 3P9KA 1R6RA 2RV8A 1EKEA 1WJDA 1YQAA 1J5YA 2XV4S 2FJ1A 3HPGA 3HB9A 4HF0A 2VQLA 4U1MA 2MG4A 4GCVA 5HODA 2E1MC 1QO3A 4V2FA 4H4KC 2VE8A 4BUPA 1KJ2H 3EYYA 3ERYA 2HFHA 4RAFA 1S7QA 3NAUA 4YG2F 1O7LA 1R23A 3BZKA 2QBYB 2AS5F 1G7QA 3E6BA 3GUDA 1R7JA 4LIUA 1I7UA 2CLRA 2P5LC 1A36A 1OGAA 2OAZA 4ASNA 3DTKA 1JKOC 3IHUA 3K4JA 3Q9VA 3VOEA 2F5EA 3NWTA 2V2XA 3BW9A 3HRUA 3MRLA 2DA5A 2XAQA 3H3ZA 3W3CA 2VE6A 4CVZA 3FQXA 2WY3A 3SDBA 3ZMZA 1HKTA 1TC3C 3FQTA 2VT2A 4BH9A 3PL8A 4PCQA 1ULYA 3I53A 4HYEA 5IVXA 4PGGA 1XS9A 2Y2ZA 4KN4X 3VFRA 2HKXA 1LQVA 1T6SA 5CVJA 4XKVA 4E7HA 5LGTA 1AKHB 4HZFA 4N0UA 3RTRA 3HZJA 3LL7A 3E6MA 2VOPA 3KPRA 4XBFA 4X6FA 5B39A 1I4FA 1T22A 4N0CA 5IT9K 2UXNA 4IX7A 3CUQA 1FP1D 3SZTA 3ARBA 3DLAA 1R3HA 3I6LD 5BS6A 3CD6I 2LNBA 3WU1B 1ENHA 3CLQA 2Q2EB 5ED4A 3BG3A 1MDMB 4MS8A 5J8CA 3BROA 5FLVA 2NRAC 3MRNA 2KJBA 1U5TA 2NX5A 1IRXA 4IJAA 3VXRA 2WV1A 2ELHA 3VYSB 3K4NA 3FK6A 1JHTA 4PSWA 1P6RA 3OWTA 3Q3SA 3U2RA 3CJNA 2WAFA 4AYBN 5C3EJ 1S7TA 3AKZA 2EIJH 5C0BA 2ZJQF 4J19A 1QRNA 2C7UA 1MH3A 3CCJI 4IHWA 5TGTA 1HW1A 1M6OA 2PYEA 2M0CA 1UG0A 3CPLA 4D5CA 4RB2C 5D5MA 5EF6A 2NNYA 3CC2I 3JSOA 5C0DA 3DPLC 3OYEA 4BXXJ 4ZUSA 2A61A 3WTWC 2WAQA 1F43A 3WTZA 3DLLF 3QULA 1VQLI 4IIQC 1P9QC 3HKZN 1MD0A 3QI9A 1WRJA 3R61A 5J4YA 5JLXA 2L7KA 4ZC3A 1RJZA 5IEKA 1DPRA 3RQ4A 5JHUA 2PI0A 1WH5A 5ILUA 4F52A 4UY8I 3LV3A 3NWSA 1D1BA 1MBJA 4FHTA 3ROLA 2X4OA 3OIOA 4ITVA 3D39A 5LRSA 4ETSA 4L9LC 3JRBA 4HX4A 2X1DA 2G9WA 4LB6B 2QLZA 4S05A 5BNGA 3ROUA 5HVQC 4M9XA 1SC7A 4KNYA 1X1PA 4Q4ZF 1LB2A 4G7OF 3KPMA 1W7PB 3OOPA 1B8IB 3IT8D 4G8GA 4PGHA 1BOBA 2EV6A 2LG4A 4HX7A 4EJOA 3RZCA 5DM7F 2MSYA 2YX4A 5CKTA 3WUWA 2VE9A 2HLAA 4HS3A 3OXSA 3HL2A 1DU0A 5IM7A 3E3VA 1I7RA 1JHFA 1OYYA 1ZQ3P 2CFOA 5INCA 5EEHA 1I7TA 2AXLA 3DBRB 1KJVA 5F6FA 4APQA 2KP6A 4UVBA 2NNNA 4GO1A 1JTXA 5DTDA 1NK2P 3OX8A 3CCQI 3F8FA 2RN7A 3T8RA 4ANJA 2AXGA 1EXUA 1E3PA 1V54H 5DCMA 4BE1A 1HHJA 2XB0X 3JTHA 3HIFA 4BDYA 4CCKA 1JF1A 1KYWA 3CP2A 2H94A 2LY2A 4A6DA 4IHSA 3SFZA 3RGVC 5BXFA 2F4MB 1JPFA 2O8KA 2V1XA 2JA6J 2IVMA 3L3HA 3K1NA 1FNNA 1ZELA 4PJAA 3KFWX 4DGWB 1HYRC 3ECHA 1I1GA 1JGDA 2EIMH 3K4CA 3CH1A 2F4IA 3TZVC 1X3ZB 1R5GA 1HA8A 3SKOA 2HXIA 1BR4A 2Z2SB 3VH8A 2EBIA 1QZZA 3CF5F 4B48A 1D3YA 2XAHA 4JX6A 4RM3A 4XRFA 3TP3A 3QYFA 1QO0D 2JA2A 2JCCA 2ACJA 1S8NA 3CC5A 3RWGA 1DDNA 2H1KA 3G1MA 5C0AA 3LSPA 4I2OA 3FXUA 3FQWA 3WS3A 4BJTA 1VFCA 2JJ7A 3TIDA 1B4AA 4E6KG 4C3JJ 5C44J 1XMXA 3PWVA 4EJWA 1Z3YA 2DJIA 3BTCA 2QKLB 1KU7A 3S17J 1FTTA 2W82A 5ILVA 1QSEA 3HSEA 3O8GA 1IUYA 2ELJA 4HDVA 3L3JA 2MFZA 2CH0A 2R5YB 3X13A 1T08B 4BKWA 4FT8A 4CCNA 3ZMSA 3PWUA 3FOMA 5L3CA 4Y4KA 1DUYA 2YSRA 1TTYA 1MBKA 3IV5A 2M2EA 2HOTA 4LLNA 1KPVA 5FROA 4WXCA 4PREA 2BNRA 3MRHA 1XX5A 3SDDA 2NS8A 4PG9A 2CMPA 1AGDA 2NW3A 1GZQA 5LGUA 3SCMA 5MENA 3ZRGA 2P7CB 1ZRCA 2DMQA 1YIJI 4OAYA 5BPIA 3JTGA 2VKDA 2ZXWH 2D45A 2HN7A 3VFWA 3CDIA 3P4NA 4AVZA 3WTYC 3VYTB 4NQDA 1OFCX 4G9YA 3CVHA 3T8TA 5EG0A 4N4OB 3MRMA 1WVRA 2W24A 3PSFA 4F92B 5IOZA 3MRBA 2L7FP 3CC4I 4ESBA 5MEOA 2CQ7A 4V19K 2M3AA 1Y1VJ 3JAMK 1OCTC 2IA1A 1LEGA 5F1IA 4O2EA 5C07A 4D9JA 2RKHA 3L1PA 1ITYA 2M45A 2X6WA 2NVTJ 3HM5A 3KPHA 1T8IA 2MGQA 4P9FA 5HS9A 3OIPA 1J09A 1ZR4A 4UB8C 4NNYA 1X2MA 2XPVA 4MGRA 4OIRF 2V2WA 2HU9A 3WTTC 4PJ0C 5FO5A 3BTIA 1MJBA 1OSZA 4L4TA 1MIJA 3GMRA 3BY6A 4MO7A 5HGHA 4CICA 2Q0OA 1IDYA 2YPRA 3K4KA 1FFOA 3S16J 3ILPA 1G3TA 4XLPF 1T80A 1EJ9A 3X2QH 5H6QA 1JHHA 3ZR8X 2VPRA 2X0LA 2Z1DA 3VFOA 1MMDA 4A5MA 3GSRA 1XCVA 4A3IJ 3PFIA 4RAGA 1JE8A 1H8AC 2DN0A 2K9NA 3V8JA 3KLAA 2K85A 4HG2A 5F27A 1WJBA 4PGDA 3ASOH 2CW8A 2DA7A 2EFOA 3E0JB 3BP8A 4C3IJ 3CCVI 2P6SA 4X0GA 4OMYA 3AM8A 3MZYA 1ZLKA 5EO0A 1UAAA 2KPMA 1AOYA 1D0YA 3HRTA 2GIZA 4JQFA 1UXWA 3RTQA 2VI6A 3Q0WA 3PUBA 3S2DJ 3GSUA 1U9NA 2RDPA 1T0FC 2RQPA 3HHGA 4FE7A 4LK0F 4R8HA 4Q5SF 4L3CA 1XSVA 3K2ZA 4B43A 3VFNA 4L5EA 3H9QA 2OTLI 1O3TA 4NQVA 4ENNA 2HKOA 2ZNZA 3PO2J 2BE5F 4L9VA 2HI3A 2MA3A 5ICCA 4LG3A 1IDZA 2NVYJ 4PSXA 3MRCA 2OL3H 4BXUA 1K78A 1A6IA 2HYJA 2ID3A 5C0GA 2FOWA 5J1YA 1RIOH 5HHQA 2P0WA 3BTLA 2Y75A 2VABA 2DFHA 5CLSA 5C0CA 1SMTA 2X4NA 3MQ0A 4BEHB 1ONVA 3BR3A 3I4PA 1Y8QB 1HKQA 2KMUA 4BQQA 1IW7F 1BN5A 3MRQA 1ZT7A 5HS8A 4HOBA 1HSTA 1NH3A 3VRIA 3OYKA 2XGDA 1ZS8A 2VN2A 4HW0A 3PWPA 5IYCJ 4DNCA 4NSKA 3QDJA 2H6BA 3MA7A 2QCOA 1O3QA 3DPTA 3JTCA 2ZBKA 2VKVA 2EV5A 3C2GA 1OKRA 1ZHNA 1Y0UA 3CCEI 4M9SA 1SFXA 2YS9A 2R7ZJ 3QYBA 3BZFA 2O3FA 5IP9J 1KQ9A 3VXNA 3R0AA 1RR8C 3HGGA 2R92J 1SVLA 2NXNB 1SFUA 1H9GA 5INDA 3FMRA 5E8GA 1LVAA 2FMYA 1GDTA 1ZH5A 1I1FA 2ZSIB 4ZYHA 1E27A 2O61A 4G6TB 5LFAA 3F0CA 4CCMA 5A2QK 4MFEA 4WU7A 3E97A 4PFPA 2LRDA 2HZDA 2M0MA 4JK1X 1I5ZA 3PQJA 9ANTA 1MSFC 3TEDA 4XR6A 1FWZA 4G9DA 2OPTA 2X48A 3FXKA 4G8XA 3FK7A 3CJRB 1USTA 3KP3A 4A0XA 1MNDA 5K7HA 1HBXG 1B72A 1T1ZA 4UUSB 1P4LA 4K2EA 5E3NA 4CCJA 3JRCA 2D5VA 1RPWA 4PGBA 5E3LA 3T5XA 1HSBA 4B3AA 4AU7A 1FIAA 1XDSA 2L54A 3HSRA 3WHCA 1PJRA 1GXPA 4CGZA 3SDXA 3W6JB 5D8KB 3RYRA 3IH3A 3M4OJ 2OZ6A 3M8JA 4KN7X 4CDGA 3LKRA 1UXSA 3GF2A 4Q48A 4U88A 2HR3A 1ZG3A 5F08A 1BIBA 5TJJA 1AHDP 2QQ9A 3S2WA 1IF1A 2HYGD 2FNAA 1JKQC 5EOTA 1HW5A 2GAZA 2I10A 5J6HA 2CUZA 3PM1A 5EGOA 2GXBA 4Y4FA 1LJ9A 2FUG2 3QP5A 3MRKA 5M5WJ 3COAC 1Y56A 3KEOA 1OCOH 1S9XA 2FYYA 3JTSA 3SDCA 2WA0A 5ICGA 2XSDC 4RS8A 5DEFA 1N5AA 1QQDA 5F0FA 4JBAA 2DOEA 1JPGA 2R7OA 1G6NA 4BKXA 5J4VA 2LTPA 5M5XJ 2OQRA 4CCOA 2K4JA 3BCBA 3RL2A 3ABMH 3PNTA 4F91B 1P7IA 4JOMA 1S6LA 4IRGA 3A4CA 4YFNF 2PQ8A 1X4OA 3C8KA 1LK2A 1NG6A 5J1UA 1LKXA 1WBXA 1V4RA 1TL8A 4YFKF 3FMQA 3JSPA 3HUGA 4MNGA 4M3GA 3JRGA 3HPJA 3K4LA 1XD7A 3LKPA 2VBYA 2DDBA 4BAYA 3D25A 3MRIA 2H6CA 1VQ7I 1FC3A 2JA5J 3CTAA 2VLRA 1GLNA 3GCMA 2HOAA 1MBGA 2M87A 3TBVA 2X85A 3TOBA 4D0DA 1JKPC 1Z9CA 1MNMC 4E7KA 3G3ZA 2DJNA 1ZR2A 2JRMA 1N25A 1H0MA 4N8VA 4MIMA 1VI0A 4MQ9F 4P9UA 2FRHA 5DUKA 2FO4A 3P4MA 2JN6A 3L9FA 2L0KA 1Z3XA 2W57A 4KIFA 4O2CA 3M07A 2PMZA 1YS7A 1IN5A 6PAXA 1G6RH 2P5EA 3KYNA 4HBLA 2L9RA 3VEPA 1XGNA 3L2VA 4S0UC 3W0WA 4A6EA 5K7FA 2BSSA 2VBZA 4P1WA 3ESWB 4Z2YA 3CUOA 4D0BA 3MGOA 4LFUA 5LLQA 2LOOA 3VB2A 1ZT1A 3AG2H 4KIBA 3WTXC 4A3GJ 4NC7A 1PUFA 2EWNA 1XMKA 4IRHA 4NQXA 2NAZA 3BLYA 3BCAA 3LSMA 2VQGA 3RPQA 3IWFA 5J1AA 3V42A 4NB5A 4I4WA 4L8CA 1Q1VA 2GTWA 3MKYB 4I0BA 2QF7A 3KP2A 1WJ5A 5TRDA 3GFMA 2XGCA 4I7HA 2X9DA 1QHGA 2OCEA 3DCFA 1WSUA 3FXJA 4Y7NJ 5HYJA 1VQPI 2VB6A 3VDXA 1N77A 1R1UA 2MC4A 4XM3A 4BQOA 2HPMA 5E17F 2QUFA 3FISA 3FQNA 2PEXA 2HQNA 1CF7B 2IT0A 2MYSA 2HTSA 3PNVA 3F72A 1KONA 1S7RA 4DQ2A 3TFKA 1I50J 2FQ3A 5IROA 2ELKA 1D1AA 3VFZA 2A3SA 1PVEA 2HJLA 2OD5A 4PDCE 4QWQA 2WAQN 3IC7A 3IWZA 1HSJA 4JO8A 5L2KA 3QPTA 1ETXA 2N8GA 4RLQA 2L4MA 4J01A 4PGCA 2E34A 3FT2A 2H8RA 2O6GE 3TQNA 3GMMA 4MX7A 3LOCA 3CDLA 2VLAA 3PWJA 1ZGWA 1GV5A 3CCYA 5IP6A 1I3QJ 1AO7A 5E8PA 4P55A 1IN7A 2CU7A 4G12A 1KCGC 5LEJA 5CJ9A 1YPZA 5E8OA 4N0FA 4A3KJ 5KAIC 3J80K 3UTQA 3M8FA 3CZFA 1Z7LA 1T38A 2LC2A 1AKHA 2O7OA 2UV1A 5LHIA 4B09A 4KMUX 4PJHA 4HQMA 3QAHA 5HGDA 2M34A 1FYKA 1XGSA 1ZRFA 4P5OA 4NHJA 1ONQA 2GUOA 5F1JA 4E7LA 3KPNA 4HUVA 3BR6A 2ZCWA 2Q2EA 2JPCA 1MDMA 2CGPA 2MABA 2EA2A 1XTAA 3ZN0A 5BQTA 4XOTA 3WTVC 5HDKA 4I02A 3S1MJ 3IH2A 3IKVA 3P9IA 2AO9A 3CP8A 5CVIA 5CQGA 1A5JA 1RK1A 1BOAA 1S9WA 5EUOA 4C2MJ 4GRIA 4RLFA 1FBQA 1CGPA 2AKRA 3BHBA 1HSAA 1QHHD 2QWWA 1S7VA 1JGGA 3HOYJ 2GOXB 1ZVSA 1XGMA 3RWDA 4HA8A 5C0EA 4CZCA 1T0NA 1ZKGA 3HRSA 2KIUA 2M8GX 2GM4A 1W36C 1T1YA 5F04A 1IUFA 1TT5B 1WCMJ 2XAJA 5ACZA 4M6YA 4WWCA 5KVRA 2DFFA 3OYLA 2JZYA 3HSFA 4GXOA 4L9NA 4UHTA 5D6FA 3JVGA 5SWZA 5EU6A 4JX5A 1AKJA 1AGBA 5B66C 4ZDOA 3LKOA 3MZHA 3LSGA 4KDPA 2KRHA 3KP6A 3WG9A 1JI8A 1K7AA 3BR0A 1R9TJ 1W7PA 3TO7A 2KQRA 3S15J 2JMWA 3EDPA 1O4XA 3K4MA 2UWMA 4UV8A 3UR3C 5CVUA 1QBJA 1O3RA 5KK1A 1B9NA 4MQVA 1WBZA 3BT9A 3NFNA 3UNGC 1V5EA 3T0YA 2STWA 4ZDLA 3DBHB 1TBXA 2BW3B 3ASNH 3F3XA 2RNJA 3E6DA 3R60A 1AU7A 1WJEA 1R5ID 3KIOA 3LSTA 5ILSA 3U1KA 3HPHA 3OV6A 2GA1A 3DP7A 5EFIA 3ONQA 2NOJB 2JK3A 4G9FA 2XASA 3VPRA 2K9MA 4M3EA 2VPLA 3V8LA 3LSRA 1YE9A 1ZSDA 1P4AA 1Q94A 2BVMA 1ODDA 3KE2A 3P9CA 1P2FA 2M5WA 4IQJA 2FF4A 1YJNI 1E3HA 3V5DA 3RL1A 1U5TC 4I76A 3RWJA 4LHUA 2K86A 1R36A 4NC6A 1W0TA 3RWEA 4F7PA 3FQRA 1VQ8I 2WWYA 3I58A 3KYDB 3S8PA 4I98B 3MZ8A 2P5WA 4BBSJ 3ISPA 4EV0A 5GAEJ 4NO5A 2V6CA 2A69F 3TL4X 1ED3A 2PBIA 3M3YJ 1LDPH 1ETYA 2PO6A 2JA7J 4OIPF 2XAFA 3H35A 4DBRA 1ZAOA 2LKSA 3MEXA 2CQKA 5E18F 3PIPF 1XZ0A 3RKXA 4ZUVA 1MBEA 3WGGA 5C09A 2RVCA 2ZMEB 2LREA 4BNCA 1T21A 2NVUB 4FTHA 1XR9A 5IB2A 2P6TA 1YYVA 4EUPA 1XR8A 3BG6A 5C4XJ 3JRDA 4ABZA 4A0ZA 3UKGA 2VBXA 3LQQA 3A2KA 1QEWA 2RFXA 3MWMA 3P9LA 2VODA 3UBXA 1OGTA 2LDUA 4QPQA 3L7WA 3CO6C 1F9NA
chains in the Genus database with same CATH topology
3C1DA 3MCZA 1K79A 3RI4A 4G7HF 2F5CA 1F5TA 1JGSA 1IRFA 1R00A 2HTJA 5L3GA 2G7UA 5BMZA 1XSDA 1YIOA 4IVNA 2Y48A 2D1VA 3EQLF 5HLIA 2OBPA 1SMYF 5E1WA 1Z91A 1LQ1A 1G4DA 1D8JA 5FFZA 3JW4A 3MAJA 1J2XA 2J5OA 1TNSA 2M30A 1YW8A 2FA5A 4EGZA 1ZHFA 4OINF 2KKOA 3G73A 1HW2A 3W6KB 4A2UA 4IF4A 4KMFA 4TV7A 2D1HA 5JI6A 4OMZA 4EJTA 2UZKA 4IRIA 1IN6A 2ISZA 4CXFA 5IT3A 5CVRA 4LG0A 4LLLA 1T2KA 1S3JA 1ZG5A 3GXOA 2DPUA 1FY7A 1FP2A 4WXHA 2FSWA 1KU3A 4LK1F 1L3LA 1FSHA 1E2XA 1GHCA 3KLOA 1PUEE 5HLHA 1NHAA 3J81K 2NS0A 1RI7A 3EETA 2DPDA 1J0RA 2DFIA 1SFEA 3PQKA 2PG4A 5L3FA 3LAJA 2K7LA 2GQQA 3O2PE 5DDGA 2GWRA 1LDDA 1I1SA 2DO7A 3NEUA 4Y17A 5DD4A 4UV9A 2V9VA 1FT9A 1ZLJA 4O5VA 3B02A 2PJPA 2W84A 2EV0A 2CYYA 4RGUA 4AIJA 1KGSA 4AIKA 1AWCA 4YFXF 4HF2A 3F8BA 2MLKA 5ICFA 1BI2A 3DQVC 1PP7U 1BC8C 2KRFA 4U0VA 4EM2A 5IT9Z 2W25A 2EFWA 4ZH4F 1ZGAA 3ZMUA 4ZYGA 3EYIA 3I5UA 2EB7A 1U3EM 4CO8A 1X3UA 2DTRA 4M9ZA 3HOSA 1U78A 2HYFA 3QP6A 4BHBA 1QQIA 4LMYA 3ULQB 4U0WA 3TGNA 3HYIA 2LF7A 3R4KA 3IRQA 4R79A 1FZPB 3CUQB 1I6XA 5LGNA 4GYGA 2R7FA 1SAXA 5AIPA 1EH7A 2WV0A 3SZPA 1WKMA 1W5TA 1SD6A 1FOKA 2XGXA 4MEYF 1LNWA 3KP4A 3GZ5A 3I0TA 5FFXA 1ZREA 3RDIA 2F5FA 3LA3A 4L5JA 4I0AA 1QNTA 2F5DA 1IXSB 3RJPA 5LBQA 3GO5A 3M9AA 2DQRA 3D0SA 3I54A 4R1HA 5F64A 5FGMA 3NRVA 3ZQ7A 5FLXK 2E7WA 1B1BA 1MKMA 4AIHA 3SHFA 1S7AA 3R6SA 4KFCA 4RGSA 5LEKA 4Q47A 2EA4A 2IRFG 3GX4X 5D4RA 2FBKA 1DUXC 2IW5A 1XDUA 1H9TA 2CWEA 3L09A 2K4BA 2EK5A 1TW2A 4FX0A 1TQPA 2FBIA 2QQBA 3N97A 2ESNA 2FOKA 2EFQA 5HOOA 2DT5A 2F2EA 4L0YB 1OMIA 1RNLA 3BPVA 5CYVA 4A5NA 1PP8F 1IRGA 2MLGA 3E5QA 1IN8A 4RB1A 1IAWA 4LJZF 5BOXA 4HF1A 4HV6A 3JAMZ 1ON2A 2PN6A 2VXZA 4CZZA 4HQEA 1STZA 3KZZA 1BJAA 1OPCA 1E17A 2DK5A 2VT3A 1R5HA 4ZZDA 3GVAA 1BI0A 4XSZF 2HGCA 3R0JA 1DP7P 3J7AO 5DUIA 4B8XA 3IKTA 2QM3A 4U7BA 5ERIA 1YS6A 3GFLA 2ZO4A 1P4XA 3V7RA 1F4KA 2V1DA 3N4MA 4HAMA 5LHHA 1KU9A 1TQIA 4D0PA 3KP7A 1D8KA 1RZ4A 1W5SA 1TNTA 2XKPA 2YU3A 1U8RA 5D4SA 2Z9OA 3V8KA 1FPQA 4HV5A 1ZRDA 3ZMTA 4LGWA 5JFRA 4UXNA 3SQNA 1MZBA 2XUBA 1HKSA 1FBSA 1LDKB 2PLYA 2FU4A 4ENJA 3I59A 3FHZA 4EMSA 2QYOA 3GLXA 2FBHA 5AONA 4KYWA 2G7HA 3GFJA 3LA2A 1UHMA 3BJ6A 4RAZA 1ZN2A 1K78B 4GYIA 3RIRA 4XSXF 5E8IA 5A2QZ 3ZPLA 2L3DA 2CW0F 3LWFA 3CLOA 2NYXA 2XIGA 4EQQA 4A0YA 2QBYA 2HZTA 5AIQA 1OYWA 4IPAA 1GXQA 3RKYA 2P5VA 3F8CA 3TDUC 1S29A 3F8MA 4ENMA 1YW9A 1BI3A 1PDNC 4O3MA 1F1ZA 5HDGA 1OR7A 2V1UA 3ABTA 1EV7A 2H27A 5J8FA 2MBFA 3HTUA 2H09A 3FM3A 4YIFA 3C3WA 1RUNA 1TQMA 1XCBA 2DQLA 3WGIA 3DF8A 4F7ZA 1SD4A 5D6EA 3ECOA 1ZYRF 3ABUA 2KJCA 1RUOA 1FYLA 1B6AA 1TLHB 3AAFA 2ZJ2A 3ERED 2PMUA 4M73A 4KT5C 4I01A 1BBYA 1O3SA 1Q1HA 1J7KA 4WCGA 3EUHA 2VC0A 1GVJA 2WTEA 1OYIA 2OQGA 2BGCA 3SXYA 1FYMA 3ZN1A 2X4HA 4KUMA 1I27A 3M1EA 3U1DA 3GWZA 5DYMA 1W4MA 1MJAA 1YTYA 2DK8A 1O57A 1UHWA 4RB3C 1B59A 2QENA 2CO5A 3F23A 4XLNF 3E5UA 3FZVA 1J75A 2LSOA 2Z3YA 2WC2A 2P8TA 2XKOA 2ADUA 2GA2A 2MH9A 2A68F 3J80Z 3DV8A 4EJVA 1P4WA 1V3FA 2HQRA 4RAYA 1EH6A 2L02A 3FM5A 2L4AA 3DFGA 2QZ8A 4RB0A 1LDJA 1KYZA 4P96A 1SD5A 1Z6RA 4RGRA 4EM1A 4BHCA 2GXGA 1YW7A 2ZXJA 3WE3A 2OA4A 1DPUA 2D2WA 2LKPA 3L2CA 1YFHA 3QRFF 4WF2A 2QVOA 2XRNA 5E1ZB 3FF5A 2ZFWA 2VC1A 5DV5A 2DU9A 3GZ6A 2MH2A 1WWXA 4G6DA 1QGPA 2HEOA 2HDCA 4G6QA 3WTUC 5K5QA 3GFIA 3BZ6A 2GZWA 1XGOA 2MD5A 1IN4A 4IHTA 3FX3A 4Y13A 3QU3A 1XN7A 4UVAA 2P7VB 2ZNYA 2PMHA 1IZ1A 1U6GA 1UCRA 4S04A 4UUVA 1HXDA 4ZYDA 3TO9A 2OZUA 3M7GA 4CHUA 3M8EA 3RKWA 1ON1A 2FXAA 2IA2A 4L9TA 2HWVA 1VTNC 2DW4A 1REPC 4M6XA 4LLGF 2JT1A 1Z6TA 4G7ZF 2YX7A 2W85A 3NQOA 4L5IA 1UFMA 4WXDA 5HS7A 2Z33A 3HRMA 4L0ZB 4ZZLA 2ESHA 4EVIA 1FLIA 4ESJA 3I71A 2IA0A 2M8EA 1LEAA 3K0LA 1KU2A 2Z99A 1BI1A 3F21A 2CFXA 4Y15A 1XB4A 4BQAA 2YR2A 4MTEA 1EH8A 1YLFA 5E1XA 4MEXF 4IXAA 1MGTA 3WE2A 2FMLA 1XMAA 2E1NA 5L3EA 2BYVE 1KQ8A 4OU0A 4H0EA 2A6HF 2KIMA 2COMA 3FWEA 1Z1DA 5DD8A 3I64A 1QZYA 4L18B 1U5TB 1ZGJA 3VODA 5D5WB 3J81Z 4M71A 3E5XA 5DCFA 5ICEA 2GIVA 2DAOA 2DI3A 4LG0B 3LQRA 3LAPA 1T39A 3GW2A 5H20A 2FE3A 4KA4A 1G3YA 3KZYA 1KQ0A 4N9HA 3QPHA 3TDZC 1C0WA 1BM9A 3IRRA 4HLYA 2BEOA 3D5LA 4E70A 1LEBA 4KIGA 4GGGA 2CG4A 2R3SA 4ESFA 2EFPA 1CF7A 2IP2A 2TDXA 4BYYA 2RGVA 3C7JA 2M1BA 5HDNA 4M72A 2P4WA 5DCMB 2JPBA 4AVPA 5L3DA 2IJLA 1G3SA 1D5VA 1QPMA 1R1TA 3K1MA 3V7SA 5JVTA 3DEUA 3HTSB 3L00A 2STTA 1B9MA 3O3KA 3U9GA 1KA8A 3O6BB 5HLGA 2KIFA 3BWGA 2MC3A 3K69A 4CYDA 3KETA 5FD5A 2P5KA 3GEZA 3MFKA 2JRTA 4HX8A 1R1VA 4UVCA 4EM0B 1W7PD 3KLNA 3P7NA 2XHKA 2A5YB 5K5RA 2DLLA 3WODF 1TW3A 3K1PA 3V7CA 3KCCA 3Q9SA 1T0FA 4BHPA 2JTVA 4MHGA 2VONA 1JXSA 1IXCA 4PZJA 4EGYA 1FX7A 5FB2A 1R22A 2BV6A 3LFKA 1USSA 1L0OC 2UXXA 4M74A 4A12A 4ENKA 2K27A 2OU2A 3F22A 2Y0MA 3E6CC 3RYPA 5DEQA 4LD5A 3C18A 2L01A 2BBYA 5FLXZ 4G94A 2O8XA 4N0BA 1ZARA 2O03A 3DKWA 3OV8A 2B0LA 2DBBA 3V4GA 5F1RA 3B73A 5E20A 3ZMVA 2VOOA 2ZMEA 4KICA 1G3WA 3HOTA 4RGXA 1UB9A 3WU0A 3BJOA 3FXQA 2E1CA 3F6OA 4QLCU 1BC7C 4I09A 4HDUA 1SD7A 3BJAA 5D5XB 4MNUA 5LHGA 2ETHA 4L9JA 3BPXA 5D5VB 3T1BA 1Z05A 1Z7UA 3ELKA 4FX4A 5K1YA 4NQWA 2CSOA 4WX9A 4PDKA 4MTDA 1FBUA 2O0YA 2IPQX 2Z5UA 3ML6A 1O7FA 2XVCA 1P92A 1ZG1A 3F6VA 2HS5A 2ZKZA 1WQ2A 3KP5A 4N9IA 5L3BA 1IXRC 2RC4A 4U0YA 3LA7A 2PFBA 3TOAA 4AWXB 4OIOF 2FNPA 3KEQA 3CDHA 4AD9A 4WK8F 3TO6A 3IL2A 3H92A 5CVVA 2R7DA 3DXJF 4OOIA 5K5OA 3ZP5A 2JSCA 4U7DA 4EJUA 4LB5A 5D5UB 1BIAA 1K6OA 2XROA 1WI9A 5BPDA 3Q5FA 3RPUA 3BDDA 3REOA 5EEGA 2HOEA 3WGHA 1XSXA 1U2WA 3FXRA 3GYHX 1YO5C 2EFNA 5D8LB 5H6RA 4ZYEA 5J6XA 3HHHA 2A07F 1MJ9A 2V79A 2FEZA 2C6YA 1YG2A 1HQCA 2VBWA 2QQAA 3FMSA 3F8NA 1R58A 5LRRA 1FSEA 1J9IA 3K9TA 4OIQF 2K02A 1J59A 4ON0A 2A6EF 3CUQC 2EJRA 3WTSC 1S7OA 3H3UA 3CO7C 5FD6A 2E7XA 2GAUA 3BOQA 5JR3A 1A04A 3I59B 3QOPA 3ZMDA 3TKYA 2ISYA 2XAGA 1T98A 4UNOA 4O6JA 4YIIA 2LF8A 2Q8KA 3QU6A 2J5PA 4HLXA 3P9KA 2RV8A 1YQAA 4HF0A 1J5YA 2XV4S 4GCVA 2VE8A 3EYYA 2HFHA 4YG2F 1O7LA 1R23A 2QBYB 2AS5F 3E6BA 3GUDA 1R7JA 2P5LC 2OAZA 4ASNA 3IHUA 3Q9VA 3VOEA 2F5EA 3HRUA 2XAQA 3H3ZA 3ZMZA 1HKTA 2VT2A 4BH9A 4PCQA 1ULYA 3I53A 4HYEA 4PGGA 4KN4X 2HKXA 1T6SA 5CVJA 5LGTA 4HZFA 3RTRA 3E6MA 2VOPA 4XBFA 5IT9K 2UXNA 3CUQA 1FP1D 3SZTA 5BS6A 2LNBA 3WU1B 5ED4A 1MDMB 5J8CA 3BROA 2NRAC 2KJBA 1U5TA 4IJAA 2ELHA 1P6RA 3U2RA 3CJNA 1HW1A 4RB2C 2NNYA 3JSOA 3DPLC 2A61A 3WTWC 3WTZA 1MD0A 1WRJA 3R61A 1DPRA 5JHUA 2PI0A 5ILUA 4FHTA 5LRSA 4ETSA 4HX4A 4S05A 2G9WA 2QLZA 4LB6B 5HVQC 3ROUA 4KNYA 4M9XA 4Q4ZF 1LB2A 4G7OF 1W7PB 3OOPA 4PGHA 2EV6A 4HX7A 4EJOA 2YX4A 2VE9A 3E3VA 1JHFA 1OYYA 5EEHA 2AXLA 5F6FA 4UVBA 2NNNA 4GO1A 3F8FA 2RN7A 3T8RA 5DCMA 3JTHA 3HIFA 1KYWA 2H94A 4IHSA 4A6DA 3SFZA 2V1XA 2IVMA 3K1NA 1FNNA 3KFWX 3ECHA 1I1GA 1R5GA 1QZZA 1D3YA 2XAHA 4XRFA 1QO0D 2ACJA 1S8NA 1DDNA