2IA1A

Crystal structure of protein bh3703 from bacillus halodurans, pfam duf600
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
169
Chain Sequence
SLEKQIESYYQEIAQLIIDMIPEEWAEVRFYAQEDHDGWKIFFFHYLSASSDEWTKDIDIRDVIKVPQDEFMEKYNELSFCISDFRKDYAEAFGEPWMSFQMTFYASGKFNIDFYYDKNPFDTFLTRLAWQYEHFGTIPDSFYKETLNEYLEEKAQGKRYPFLEPLHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein BH3703 from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords BH3703 protein
total genus 58
structure length 169
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04634 DUF600 Protein of unknown function, DUF600
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ia1A02
3.30.500.20 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 BH3703-like domains 2ia1A01
4FX0A 2IA1A 2PLYA 1F4KA 2TDXA 4TV7A 3N97A 3VEPA 2GA2A 2WTEA 5ERIA 4OIPF 5BQTA 1MDMB 2NNYA 2ZMEB 3FX3A 5F6FA 1F9NA 2DU9A 4JK1X 5D6EA 2M1BA 1SFUA 2DQRA 4HX7A 3VFZA 5BMZA 2K86A 4Q5SF 3JAMK 2VT2A 1FYLA 4ESBA 2CSOA 5L3DA 2JZYA 4P9UA 2J5OA 4A2UA 1U3EM 1B59A 1Z6RA 4LG0A 1IN8A 3U9GA 5ICEA 1FY7A 2PI0A 2YR2A 5CLSA 1GHCA 5H20A 2ZKZA 2Z3YA 3IC7A 4PGHA 3ZQ7A 3M9AA 1MJAA 1D8KA 2F5DA 2UZKA 3V7SA 1U5TB 2QYOA 2IJLA 4L9JA 3Q5FA 3KZYA 1MDMA 5E1ZB 3HHHA 1GXPA 3U2RA 2GQQA 3QU6A 4EVIA 4HLXA 1KYWA 1P4XA 2P4WA 4HYEA 3ZMUA 2R7DA 1YLFA 4EMSA 4KUMA 3P9IA 2XROA 2QZ8A 3I4PA 2GXBA 3L09A 3BOQA 3HOTA 2VBWA 5E1XA 3RI4A 2Y48A 1R5HA 3LA7A 3EYYA 4KDPA 2XAJA 2IA2A 3NEUA 4I01A 5ICCA 2Y75A 1CGPA 4F7ZA 3DF8A 2FMLA 4ZZDA 4YG2F 1IN6A 2VODA 2L3DA 5H6QA 4EQQA 2ESHA 2MD5A 5HDGA 3M8FA 2VE8A 3GF2A 3E3VA 4KA4A 4AIKA 1SMTA 2L4MA 2IVMA 1PP8F 2A6EF 4UNOA 2IPQX 2MLKA 1E2XA 1I6XA 5LRSA 1ONVA 4G7HF 4CHUA 4M72A 3RJPA 1R1UA 1KQ8A 5LBQA 1FLIA 4UV9A 3BZ6A 5K5OA 4AIHA 1B9NA 2H09A 4UVCA 1T98A 2Q0OA 1Z9CA 3KZZA 2KJBA 1ZYRF 5JI6A 1BIAA 3J81K 4HW0A 4IRIA 2ZFWA 3DFGA 1I5ZA 1U5TC 4AIJA 2FA5A 4U7DA 4EM1A 5DD8A 2BV6A 1JE8A 2ZJ2A 3SQNA 1UHMA 3T1BA 4EJWA 2LF8A 2EJRA 3BP8A 1R00A 4RGSA 2J5PA 4U0WA 4H0EA 3I59B 4BHPA 4YIIA 1F1ZA 2AXLA 2HTSA 1P92A 2G7HA 2HKXA 3GYHX 5FB2A 1I27A 3CLOA 5LGTA 3V8JA 3MZHA 4P9FA 4OIOF 3TDZC 3WTYC 2ZXJA 4UXNA 2O0YA 3WE2A 3KP4A 3QPTA 1ZRCA 4LK0F 1R7JA 5ILSA 4Z2YA 4OOIA 3JSOA 2P7VB 1MGTA 2QBYB 3T0YA 3WG9A 3MCZA 3IL2A 3H3UA 4RS8A 2D45A 3R0AA 3E5XA 3FM3A 4EJVA 3V7RA 3I53A 1AOYA 4MQVA 4A6EA 1XCBA 2NAZA 3LAPA 4G6QA 4ZZLA 1KU7A 4CO8A 5F1RA 3MQ0A 4RB3C 4BXUA 3GZ6A 1EH8A 2HYGD 4I2OA 1XSDA 3SHFA 4MGRA 3C3WA 3KP3A 3E97A 4YFKF 4L5IA 2YX4A 2P8TA 1H9TA 1TQIA 4B09A 2H94A 3KCCA 3QPHA 3M7GA 2PEXA 4KYWA 2EFQA 3BY6A 3WU0A 2OZ6A 1AWCA 1B4AA 5K5QA 3ABTA 5A2QZ 4IPAA 5CVIA 2QQ9A 2IW5A 1T39A 1G3WA 3EYIA 2STWA 4S05A 2W85A 1IN4A 1WQ2A 4R79A 1QGPA 4EGZA 1U78A 1KA8A 3DEUA 1ZN2A 4OINF 1BC7C 2V9VA 2RGVA 3O3KA 2V1DA 1FP1D 1FT9A 1U6GA 4IRGA 3HRTA 1FOKA 3F6OA 2VOPA 2K02A 4HX8A 2ZNZA 4HV5A 5FD5A 3Q9VA 2STTA 3LQRA 2OD5A 4CDGA 3JTHA 4AWXB 2DQLA 1RIOH 2FOKA 2PN6A 4RAYA 2FSWA 1UB9A 3ZN1A 5LHIA 1FBQA 2CG4A 2GWRA 4Y15A 4HLYA 4RGXA 4BHBA 4O3MA 1YS7A 3KP7A 3ZMVA 1V3FA 1D3YA 3TKYA 2A69F 4UVBA 1OYIA 1IZ1A 3FMRA 5LEKA 3EQLF 4A6DA 1GXQA 4EJOA 3LQQA 1KU2A 2F2EA 1HXDA 3HUGA 3BJOA 4U0VA 3LAJA 3RKYA 5D8KB 4WWCA 4L18B 4XBFA 3KEQA 2QBYA 3I64A 1W5TA 4LLGF 2W24A 1R5GA 1S7OA 3KLNA 2H27A 3W6KB 3QU3A 4KNYA 5DDGA 3Q9SA 3DQVC 4Q4ZF 2ELHA 1ON2A 2L4AA 5JVTA 2K7LA 3E6MA 3U1DA 2XV4S 2UXXA 3LFKA 4EJUA 2HS5A 2HKOA 4Q48A 2DFIA 4L9TA 5DCFA 1U8RA 1HSJA 3VOEA 1SD5A 1IAWA 4E70A 1MJ9A 5HLHA 4IHTA 4A5MA 3R60A 3F6VA 1C0WA 2IT0A 4M6XA 1W7PD 3BWGA 4ASNA 1TNTA 1WWXA 1I1SA 1P4WA 2QWWA 1YYVA 5CVVA 2DBBA 3ELKA 3HTUA 1KU3A 3TOAA 3HTSB 1HQCA 3MEXA 2ZNYA 1XMKA 3T8TA 1H9GA 1GVJA 1RZ4A 2NYXA 3B02A 2VN2A 1XGSA 1YO5C 1O7FA 1TW2A 4FT8A 3H3ZA 3IRQA 2CWEA 3HRMA 1LDKB 2EFNA 3ZPLA 3QP5A 1IN5A 5DEQA 1LB2A 2V6CA 3FXQA 5TRDA 2RNJA 2O61A 3FXUA 2B0LA 5ICFA 5CVUA 5H6RA 3F23A 2O3FA 1XN7A 3OV8A 1BIBA 4Q47A 4RB0A 2F5FA 5D5WB 2MLGA 3CUQA 2EWNA 2YPRA 3I5UA 1Z6TA 4IJAA 4EM2A 1OPCA 4GCVA 4HV6A 3ROUA 4MEYF 2K27A 4G9YA 4L9NA 1O3RA 1B6AA 1SFXA 3GVAA 2WWYA 1STZA 4BNCA 1X3UA 3PFIA 3MFKA 1QNTA 1QZZA 1JXSA 5JR3A 2JT1A 1NHAA 3IRRA 1LQ1A 1U5TA 4P96A 4OMZA 3F22A 1BJAA 4WK8F 1FBSA 4RB1A 2LKPA 3GFJA 2QUFA 2X0LA 5HLIA 3F8CA 3MAJA 5FLXK 1DDNA 2XIGA 3I59A 1KYZA 1BBYA 4MHGA 5ED4A 1RNLA 1KGSA 3L7WA 1XCVA 1QZYA 1USTA 1XDUA 5EEGA 4LLNA 3J81Z 1BOAA 2QQBA 3FHZA 2P5KA 5D5XB 2L02A 1V4RA 3V4GA 1J0RA 5L3EA 4DQ2A 3BJ6A 3KLOA 4CICA 5HLGA 2D1HA 1LEAA 4WXDA 4B8XA 3DPTA 3E6DA 3ZN0A 4LFUA 1CF7B 1ULYA 5DD4A 5HOOA 1S3JA 4Y13A 2OBPA 5ILVA 2LSOA 2H6BA 2CQKA 1IRGA 6PAXA 2LDUA 4NB5A 2CO5A 1SD4A 3K1NA 2P5VA 1XSXA 1PDNC 2BGCA 3K1PA 1XGOA 2Z33A 4I09A 4MQ9F 3O6BB 2M5WA 2DAOA 2DK8A 4IXAA 3SXYA 1XGNA 3GZ5A 2HZTA 5LLQA 4IRHA 4I98B 4QLCU 1K79A 3TQNA 2VC1A 2M87A 1FC3A 2JPBA 3FXRA 3S2WA 3JW4A 1HW2A 2EV6A 5HS7A 2OU2A 4A0YA 2AS5F 1FP2A 2V79A 2VT3A 1LJ9A 1H0MA 3FM5A 4KIFA 2GA1A 3R0JA 1D5VA 1HKTA 5HS8A 3AAFA 5L3CA 3R4KA 2F5CA 2XAHA 2EFOA 3CJNA 4ON0A 5FLXZ 1MKMA 3F8MA 3QP6A 1R36A 4LB5A 4N0BA 5FGMA 4I7HA 4EM0B 1BI0A 3C18A 3G3ZA 3GW2A 3KEOA 2VE9A 4OU0A 2A6HF 1UFMA 2NNNA 3ULQB 1ZHFA 4AVPA 2FQ3A 3VODA 1TQPA 4YFXF 1S6LA 3WGIA 1G4DA 3L2CA 4ZYEA 2HYFA 2FNPA 5DUIA 4P55A 1R22A 3L9FA 2QENA 2M30A 1ZGJA 3LWFA 2R3SA 1WRJA 2KIMA 3ZP5A 2DLLA 1ZG3A 1IXRC 1TBXA 2OA4A 3IWZA 4HA8A 5DCMA 3CTAA 2V1UA 2NS0A 2V1XA 4U0YA 4KICA 1DPRA 2MH9A 1MZBA 1HSTA 4O6JA 5D4RA 1RUOA 3CO7C 1IN7A 4BAYA 3RPQA 4FX4A 4LG0B 3RPUA 1KQ0A 4IHSA 3ZMZA 3ML6A 1ZREA 1ZH5A 4LMYA 3J7AO 2HEOA 3HIFA 2MC3A 3J80Z 5D4SA 5IT9K 1IW7F 2JSCA 2O03A 2M45A 4ETSA 4M74A 3FMSA 4M9SA 3ERED 1HW1A 4WX9A 2W84A 3KFWX 4L0ZB 3FF5A 3WTXC 5JHUA 4HF1A 2DW4A 4LLLA 4KMFA 3C7JA 5BPDA 2ETHA 2E7WA 3F72A 5E8GA 2JRTA 2A61A 4HAMA 2KKOA 3TO7A 2P5LC 1ZG1A 2K4JA 3MWMA 4M73A 2FBKA 4CXFA 1ZARA 5DUKA 1I1GA 3ECHA 5BPIA 5D8LB 3V8KA 3HRSA 2XASA 2JTVA 1T6SA 3RYRA 2FRHA 5E17F 3HSRA 2W57A 3CUQC 3M8EA 1ZRDA 3ZMDA 3I58A 2DPDA 3DV8A 4IF4A 4LK1F 5LGUA 3DPLC 1HKSA 2ACJA 2Q8KA 1K7AA 1SFEA 1BI3A 1OMIA 1REPC 3SFZA 4ENJA 2VBZA 2VXZA 2WV0A 4ENNA 1YG2A 2EB7A 3QOPA 2PQ8A 1FX7A 4LGWA 1G3TA 4K2EA 2FF4A 4RGRA 2LNBA 2DPUA 1ZLKA 3BROA 1EH6A 1J7KA 4ENKA 1FZPB 4MTEA 5LRRA 1RUNA 2E7XA 1Z05A 3GXOA 3F3XA 4PGGA 1MD0A 2OAZA 5K1YA 1OYYA 2VBYA 5J8FA 3WTTC 1R1VA 4ENMA 4R8HA 1LDJA 2A5YB 3HHGA 3I54A 2KRFA 4XSXF 4HBLA 1E17A 2FNAA 3DP7A 2XUBA 1LDDA 2XVCA 1DPUA 3HYIA 1ZGAA 3CO6C 3R61A 2OQGA 1PUEE 2KIUA 1BM9A 2QQAA 1O57A 3O2PE 5CVRA 1OYWA 4OIRF 3RKWA 5IT3A 4N9IA 3QAHA 2W25A 4G6DA 1YS6A 1Q1HA 1XSVA 3KP2A 1FBUA 3F8FA 5F64A 2CW0F 4HF0A 1YW8A 2GZWA 1HKQA 1OR7A 2CYYA 5E20A 4JQFA 4G7OF 1BN5A 2IP2A 2HWVA 3E6BA 3ISPA 4M71A 4HOBA 3WTZA 4O5VA 1FYKA 2RV8A 2YX7A 1U2WA 3VB2A 2ISZA 3HSEA 2QVOA 5E1WA 3C1DA 1G3YA 3K1MA 4YFNF 4EGYA 1Z91A 2UWMA 3GFLA 3CUOA 3H92A 1YW7A 4IVNA 1W7PA 3GLXA 2P6SA 1A04A 3FMQA 2HQNA 5HVQC 2DTRA 3NQOA 3WTVC 3KP5A 1T0FA 5L3FA 4QWQA 1ON1A 4KN7X 4RAZA 1Z7UA 2EA2A 5D6FA 2YU3A 4PDKA 3F8NA 3M1EA 4KMUX 2R7FA 3EETA 4PZJA 1K78B 1CF7A 3SZPA 1EH7A 2PJPA 3REOA 3PQJA 3D0SA 3KETA 3DXJF 2CFXA 2QLZA 1O7LA 1TQMA 1XDSA 3G73A 3F21A 4HQEA 4RB2C 5FFXA 1O3QA 3E6CC 2O8XA 1K6OA 2VBXA 4OMYA 4HF2A 1Y0UA 5LEJA 2PMHA 4I0AA 1YIOA 2Z99A 4KIGA 4XRFA 1BC8C 3WTUC 1QPMA 5ICGA 1J59A 2BE5F 4ZYHA 2O6GE 4GYGA 1S7AA 2E1NA 4EV0A 1TW3A 2XRNA 1JHHA 2M8EA 2JPCA 3T5XA 3P7NA 5CYVA 4G94A 4PCQA 3W6JB 5L3BA 1K78A 2QM3A 2P7CB 3EDPA 4ESFA 2DO7A 2L54A 5BS6A 1QBJA 1QO0D 4GXOA 1B1BA 5LHGA 1PP7U 1ZRFA 1W5SA 2XAQA 1J2XA 3WU1B 2HFHA 1G3SA 2G7UA 5E8IA 4CZZA 1J5YA 4A0XA 4HDUA 3V7CA 5AONA 2FBHA 1JHFA 3LA3A 2ESNA 4GO1A 3TGNA 2E1CA 3IHUA 1YQAA 2RC4A 2Z9OA 5D5UB 2K4BA 2GIVA 4M9XA 3GFIA 5A2QK 4RGUA 4D0PA 4BYYA 3SZTA 1TLHB 2MH2A 3TO9A 4R1HA 2UXNA 2EFPA 5LGNA 1FWZA 5CVJA 3K2ZA 4WCGA 4UVAA 3TO6A 3JSPA 3GUDA 3BPVA 2XHKA 1YTYA 3E5UA 4AD9A 3GWZA 2RKHA 1Z1DA 1FYMA 1IUYA 5FD6A 2G9WA 2BYVE 3WTWC 1OKRA 3MZYA 4U7BA 5DCMB 4LB6B 2X4HA 5E18F 2COMA 2DT5A 2ADUA 5J6XA 1SAXA 3R6SA 3KP6A 1W4MA 1YFHA 1FPQA 1SD7A 3E5QA 3HOSA 4XLPF 4L9VA 2GAUA 2HR3A 2KJCA 4KIBA 3TOBA 3ZMSA 1LEBA 4WF2A 4I0BA 4L5JA 4UV8A 1LVAA 1T38A 1UCRA 2A07F 5EEHA 2RN7A 2A68F 5JFRA 5FFZA 4A5NA 2BBYA 2FE3A 2HOEA 2CGPA 4ZYGA 4HDVA 2ISYA 3WE3A 4ZYDA 5AIQA 1D8JA 3QRFF 3EUHA 5KK1A 1KQ9A 3IKTA 5HS9A 2IRFG 4WXCA 4M6YA 3WGGA 2D1VA 1WKMA 3TDUC 2L01A 2RVCA 2D2WA 1IRFA 2LF7A 1F5TA 4FHTA 2ZO4A 1DP7P 1MJBA 3HRUA 4HX4A 4EJTA 3LSTA 1J75A 2DK5A 3NRVA 3GX4X 5FO5A 2XKPA 3N4MA 1SD6A 4A12A 4CYDA 1ZG5A 4MTDA 2FMYA 1HBXG 3RDIA 4CGZA 3K9TA 4XLNF 3P9KA 4L0YB 2P6TA 3OOPA 3GFMA 2KIFA 1P4AA 2VOOA 1FSHA 1P2FA 1LNWA 3RTRA 3P9CA 1FNNA 1BI1A 3ECOA 2Q2EA 5KVRA 4HQMA 4M9ZA 3V8LA 1IXCA 3CUQB 4MEXF 5BOXA 5J8CA 2EFWA 1RI7A 4DNCA 2VC0A 2XAGA 3IKVA 1SMYF 2FU4A 3WGHA 1XD7A 2PMUA 2HGCA 1XB4A 2Y0MA 4S04A 5D5VB 2HDCA 5ILUA 4Y17A 4NHJA 3GEZA 4GYIA 1XGMA 4ESJA 1QQIA 2RDPA 2ZMEA 2MA3A 2YSRA 1T2KA 1TNSA 5HDNA 3K0LA 2MBFA 4OIQF 5LHHA 4BH9A 2EA4A 2PG4A 1DUXC 3D5LA 4BQAA 5DV5A 1HW5A 5HDKA 1USSA 4LD5A 3BDDA 4GGGA 2BEOA 1IXSB 3BJAA 3T8RA 2RQPA 2HTJA 2PBIA 3B73A 4XSZF 1FSEA 4JBAA 2NRAC 1UHWA 4G7ZF 2XGXA 1S8NA 4MNUA 2XAFA 1WSUA 3DKWA 2EV5A 2FEZA 1KU9A 2DI3A 3RIRA 4YIFA 5K5RA 1TTYA 3GO5A 4N9HA 2F5EA 1G6NA 3K69A 2Z5UA 3WTSC 1L3LA 1W7PB 3FWEA 5IT9Z 1R23A 2ZCWA 4I02A 3J80K 3BPXA 1J9IA 3CDHA 5AIPA 2FBIA 2VONA 2XKOA 2C6YA 4KT5C 3RKXA 2OZUA 4U88A 2HQRA 3F8BA 3IWFA 4WXHA 4KFCA 1JGSA 1S29A 3L00A 2EV0A 2H6CA 2PFBA 1ODDA 3HSFA 3COAC 2IA0A 5L3GA 1ZAOA 2GXGA 4KN4X 1R58A 5TJJA 2ZBKA 1EV7A 1P6RA 5CJ9A 4ZH4F 2WC2A 2A3SA 5DYMA 1L0OC 1VTNC 2OQRA 2EK5A 4P5OA 4LJZF 4A0ZA 4NQWA 3I71A 1XMAA 1BI2A 3ZMTA 4HZFA 1ZLJA 3RYPA 3WODF 1WI9A 4UHTA 2FXAA 3JTGA 1B9MA 3ABUA 1R1TA 3LA2A 4BHCA 1YW9A 1IF1A 3I0TA 3FZVA 4UUVA 3KE2A 1O3SA 4G8XA 3JAMZ 1O3TA 3PQKA
chains in the Genus database with same CATH superfamily
3CMEI 2Z16A 5J6GA 3PM1A 5C4JJ 3PFYA 1U9NA 3CMMA 2R7OA 2EIMH 4FX0A 3HOVJ 2IA1A 4PRIA 2PLYA 1F4KA 2TDXA 4PSWA 3OIPA 4TV7A 2CH0A 2CIIA 3N97A 3VEPA 4Y33A 3M4OJ 1WZ2A 2GA2A 5IP9J 2WTEA 1FG2A 4HWZA 2W00A 1ZT7A 5ERIA 1V54H 3MMYB 3C2BA 3BT9A 4OIPF 1QHHD 4XORA 5BQTA 2D31A 2MHAA 2X51A 3QUZA 1MDMB 2BVQA 2NNYA 2ZMEB 3FX3A 1TVHA 1HCRA 1KPRA 3ARDA 5F6FA 1F9NA 1IDZA 2DU9A 4JK1X 2AV1A 2AV7A 5D6EA 2M1BA 3VJ6A 1IDYA 1SFUA 2DQRA 3ERMA 4HX7A 2HOSA 3S17J 5FKMA 3VFZA 2JUCA 5E3MA 5BMZA 2K86A 4PJAA 3WUWA 4XQFA 2W48A 3RWJA 4Q5SF 3JAMK 4PK4A 5DTDA 2Z2SB 1AHDP 3QEQA 2VT2A 5J4VA 3CCMI 1VGKA 1FYLA 4ESBA 5F0CA 2CSOA 2LKSA 3BR3A 2R7TA 2Y9YA 3GSNH 5L3DA 2JZYA 2CKBH 4PJBA 4BDZA 3D18A 3OYNA 3KPMA 1TWCJ 4PG2A 3VWKA 5BXFA 1PUFA 5EGOB 4P9UA 4F7MA 3KEYA 1JUMA 2J5OA 3VFWA 2DOFA 3SYTA 3GMPA 4CW1A 4A2UA 4DJAA 4GDFA 1U3EM 4CCMA 1B59A 1Z6RA 4LG0A 5INCA 3TFKA 1IN8A 4LCWA 4PRPA 3U9GA 2GIZA 4J19A 2KDZA 2CW8A 2ELJA 5ICEA 1FY7A 2PI0A 2YR2A 5CLSA 1GHCA 5C0FA 2GT9A 1Z5LA 1QSFA 5H20A 2ZKZA 2Z3YA 3KPPA 4BKXA 3MKZA 3IC7A 5GAEJ 4PGHA 3ZQ7A 3M9AA 2AHQA 3L3GA 1QR1A 1MJAA 5BJTA 1D8KA 4QRRA 2F5DA 2UZKA 3V7SA 2LR8A 1UELB 1BL0A 1U5TB 2QYOA 3SKOA 2IJLA 2KT0A 4L9JA 2XF7A 1Z21A 3KPLA 3O3EA 1I50J 1U58A 3GTGJ 3VFTA 2JRMA 1JUSA 3DBLB 2Y9ZA 5GTIC 3X2QH 3Q5FA 3KZYA 4N8VA 3VXRA 1MDMA 3RGVC 5E1ZB 3HHHA 3CCRI 1GXPA 3VFVA 3U2RA 2GQQA 3QU6A 1T33A 3GSOA 4EVIA 1S7UA 4HLXA 1KYWA 1P4XA 2A5WA 2P4WA 3I4NJ 3ZCOA 3TO2A 3O8XA 4HYEA 3ZMUA 2VQHA 1PVEA 4CCLA 3GZNB 2BVMA 2R7DA 1G7PA 3E3QA 1YLFA 4EMSA 3O3DA 4KUMA 1YN7A 1WHUA 3P4OA 5F27A 3P9IA 1X3WB 2XROA 3GSQA 2QZ8A 3U0PA 3LSMA 1M6OA 4F92B 3I4PA 2GXBA 2HDDA 1S8DA 3L09A 1POGA 3BOQA 3HOTA 2VBWA 5E1XA 1I39A 3KYLA 2R5YA 2JA2A 2CU7A 4LIVA 2Y48A 1R5HA 2EPFA 2ZFUA 3EYYA 3LA7A 4CCKA 1FZMA 3GMQA 3L3JA 3H36A 3PUBA 3TIDA 3OYEA 1U0JA 2LLKA 1GV5A 2XAJA 3PSIA 2IA2A 3NEUA 4DW6A 4KDPA 5GP9A 2YPLA 4NQEA 4I01A 5ICCA 2Y75A 1CGPA 4PRAA 4F7ZA 3CCVI 1NAMH 4ZDLA 4B3AA 3OYGA 1FFPA 1S7XA 3L2WA 3DF8A 1QO3A 1FZOA 4IOCF 2FMLA 4ZZDA 4YG2F 2GTWA 4FTVA 4XLEA 1IN6A 2VODA 1I7UA 1I7TA 1ZT4A 2HI3A 3X13A 2L3DA 1UG2A 5H6QA 4EQQA 4XLFA 2ESHA 2MD5A 2XPGA 4ZUUA 4G59C 5HDGA 3K10A 3M8FA 2VE8A 1MBKA 3GF2A 3AG1H 1X4OA 3E3VA 4XONA 1SMTA 4KA4A 4AIKA 4L4VA 1LK2A 2L4MA 3LKOA 2IVMA 2KRHA 2WA0A 3LSJA 1VF9A 3G1LA 2CLVA 3FXKA 1XH3A 1PP8F 2A6EF 4UNOA 2VJ5A 1SAUA 2IPQX 2MLKA 3MA7A 4BU2A 5F9JA 3BR0A 1E2XA 1I6XA 1NG6A 2O9LA 1UQSA 3DX6A 5LRSA 1ONVA 3CZ6A 4G7HF 4CHUA 4M72A 3RJPA 1R1UA 3GLLA 1KQ8A 5KHDA 1HYRC 1MHCA 1KZHA 5LBQA 1FLIA 4A3EJ 4UV9A 4U1KA 3V5DA 2K3PA 5C0CA 3W2WA 5C4XJ 3BZ6A 1V5FA 1ACIA 5K5OA 4AIHA 5J6HA 3H5NA 1X2NA 5MERA 1B9NA 3UTQA 2H09A 4UVCA 1T98A 3K4MA 2Q0OA 1Z9CA 1BW5A 4JYKA 3KZZA 2KJBA 1RJZA 3ZQIA 1ZYRF 5JI6A 1BIAA 2QF7A 2X4OA 3MRJA 2WAFA 3Q0UA 4MJ6A 5FKNA 3J81K 4C3HJ 3L1PA 4CVZA 2M9HA 4BQOA 4HW0A 2C7UA 3BZFA 2RREA 4IRIA 1B0RA 2V9KA 2ZFWA 3DFGA 3I55I 4Y3OA 5B39A 1I5ZA 1U5TC 2GM4A 1H8AC 5JHDA 2VI6A 3W2VA 4AIJA 2FA5A 3RWDA 4U7DA 4WU5A 5EG0A 4EM1A 1AGEA 3LFUA 5JLWA 5DD8A 2BV6A 1OISA 2DMQA 2VLRA 1WVRA 1JE8A 3VCLA 2ZJ2A 3SQNA 1UHMA 1RK1A 3T1BA 4UB6C 2MFZA 1QVUA 4EJWA 3PIOF 4PJ5A 3MD2A 2LMDA 5DS9A 2F74A 1LUJB 2LF8A 2EJRA 3BP8A 1R00A 4PJLA 4RDUA 4RGSA 2J5PA 3PWNA 2Q2EB 4U0WA 4E7HA 4OAYA 4H0EA 2PX9A 3M17A 2CW7A 3I59B 2PJRB 4BHPA 4NQVA 4YIIA 1HOMA 4QPQA 1W72A 1UMQA 1F1ZA 4HG2A 1LDPH 2AXLA 2HTSA 1P92A 4Y4HA 1OR7C 5HGAA 2G7HA 4E7JA 2O5RA 2HKXA 3GYHX 2FWOA 4G12A 5C08A 4DYRA 3ONQA 3ARBA 5FB2A 1I27A 3CLOA 5IOZA 4NNJA 5LGTA 3VWBA 4RLFA 3K4NA 3V8JA 4AIDA 1FTZA 3MZHA 3H7BA 3I9V2 2HXOA 4P9FA 4OIOF 3VXSA 3ZRGA 3TDZC 5C0GA 3GMOA 5EU5A 1X3ZB 3WTYC 4IRJA 2ZXIA 5IB3A 3JRHA 5GSRA 2X48A 2ZXJA 2O0YA 4UXNA 1I1YA 1MMGA 2DTZA 3J7YJ 3WE2A 3KP4A 3QPTA 1ZRCA 3AG2H 2K40A 1OCZH 4C2MJ 1ZHBA 2ZSHB 4XN0A 4LK0F 3K70D 3RZDJ 2HYJA 1PUFB 1R7JA 1B72A 3H9SA 4NO5A 5ILSA 4Z2YA 4OOIA 4BBRJ 3TPUE 4ZTFA 2M2EA 1RESA 4UUSA 3JSOA 2P7VB 1MGTA 3ASNH 1IG7A 2QBYB 3T0YA 1EXUA 3WG9A 1B8IA 5HYJA 5HHMA 4DYCA 3MN2A 4CCJA 1WJBA 3MCZA 2DN0A 2GAZA 4IZZA 3H9HA 3IL2A 4EEFG 1SVOA 3H3UA 1X1PA 4RS8A 2XB5A 2D45A 1RRJA 3TIEA 3R0AA 3E5XA 3LSIA 2OUMA 4A3LJ 3HB9A 1QQDA 2WAQA 3FM3A 4EJVA 3V7RA 2Y0SA 3I53A 1AOYA 3LKPA 3D5RC 4MQVA 4A6EA 1WGXA 2NVXJ 1WJDA 1VQPI 1YJWI 4IHYA 1XCBA 3AG3H 1D0XA 2NAZA 1R49A 3P77A 3LAPA 3X14A 2K9QA 3WS6A 4G6QA 2F6CA 1OQYA 1P7JA 2PMZN 4ZZLA 1MNMC 3FT3A 3M1CA 1KU7A 2MW8A 4CO8A 5C44J 5F1RA 4JFPA 3O3AA 2FUG2 3MQ0A 3BLYA 4RB3C 2XGEA 1VQ9I 3VYSB 4BXUA 3BC8A 3GZ6A 3KYCB 5C0EA 1EH8A 2HYGD 4IRSA 5KCMA 1ETKA 1JKPC 4I2OA 3OSGA 2HJKA 1N3NA 1BZ9A 2R7WA 1TL8A 3BVNA 5TISC 1XSDA 3SHFA 3S1MJ 4MGRA 3C3WA 3KP3A 3FIWA 4PUSA 3MRNA 3P5JA 3E97A 3ECBA 5C07A 3TBTA 4YFKF 4L5IA 3GTJJ 5DEFA 1KJ3H 1EKEA 3BWAA 2YX4A 3Q0VA 2EIJH 1WFXA 3W0WA 2P8TA 1H9TA 2BSSA 5D7LA 1N2RA 3BQZA 3K4CA 4C30A 2VABA 5E8OA 1ETQA 3PWJA 2WB1N 2L7KA 2X70A 3PWUA 1TQIA 1A35A 1J09A 4B09A 2WV1A 2H94A 3D5SC 4AYBN 2R7XA 3KCCA 3QPHA 2W4SA 4QRSA 3OYAA 5D9SA 3JR9A 3M7GA 3KWWA 4PDCE 2PEXA 2HVSA 4KYWA 2EFQA 3BY6A 3RQ4A 3WU0A 3A01A 2OZ6A 4S0HB 1AWCA 1B4AA 4A69C 5K5QA 3ABTA 5A2QZ 3HUJA 4IPAA 1IO2A 4Y4RA 1GVDA 5CVIA 4HNUA 1K8DA 2WY3A 1DE4A 4HUWA 2QQ9A 2IS2A 2IW5A 1Y8QB 4D0DA 2D5VA 2M7BA 4JX5A 3CCLI 4PP8C 1OJLA 2DMNA 2LVSA 1T39A 1ZTRA 4XRMA 1JKOC 4WWKC 2BNQA 1G3WA 3EYIA 2STWA 4LG3A 4S05A 3TBYA 2W85A 4U87A 1IN4A 1WQ2A 4R79A 1QGPA 4QSHA 4NNYA 4O2FA 4EGZA 1BW6A 1U78A 3CMAI 1KA8A 3DEUA 2FZ3A 1ZN2A 3SDXA 3JRFA 4OINF 1BC7C 1VQ8I 5EG0B 3Q0WA 4F7CA 2BVPA 1NEZA 5FKKA 5F04A 1S5LC 2Y30A 1HA8A 2V9VA 2RGVA 3O3KA 2JVGA 1LFUP 3HE6A 1YOVB 2V1DA 1FP1D 3CF2A 2F5VA 1FT9A 1S9XA 1U6GA 2K9SA 3OV6A 4PJ8A 3W6VA 4Z78A 2BXZA 2G0EA 4IRGA 3HRTA 1FOKA 3OY9A 1OSZA 3F6OA 3WS3A 4FQGA 4F52A 3O8HA 3B6SA 4XLAA 5FKOA 2X1EA 3FXOA 2WADA 2K02A 2VOPA 4HX8A 2PO6A 1S7SA 2VLLA 4ZUSA 2R7UA 1X19A 4NHUE 2ZNZA 1Z3YA 4HV5A 2Y69H 5FD5A 3Q9VA 3JRBA 2X4PA 3FQXA 2STTA 2ZXWH 2JK3A 1AO7A 2GTZA 2F4MB 3LQRA 2OD5A 2OTJI 4D9JA 1TT5B 3PO2J 4CDGA 3JTHA 3FKIJ 3U1KA 4XK4A 4AWXB 1K6YA 1Y6IA 2OF7A 2V6EA 4LCCC 2DQLA 4XN3A 3CZFA 2EZIA 3ROLA 1B3JA 1RIOH 1AKHA 2X4NA 2FOKA 5GSVA 2PN6A 4RAYA 1BQHA 3MRHA 2FSWA 4NO0A 4XRSA 1UAAA 3UNGC 3KYNA 1UB9A 3ZN1A 5LHIA 1FBQA 1A31A 3TZVC 2CG4A 4JX4A 1QHGA 4E5XA 2GWRA 4Y15A 2LY9A 1K5NA 4HUVA 4G42A 4RGXA 1X4PA 4HLYA 4G9FA 5CQGA 1WJEA 4BHBA 5EU4A 4DOZA 1JE6A 1R4MB 3H0DA 4QRTA 1VACA 3KZIC 2VXDA 4O3MA 3JRCA 1LE8B 1KBGH 2XGDA 1EFXA 1YS7A 2DCEA 3KP7A 2CS3A 2M0CA 1V3FA 3ZMVA 1LD9A 3QQAA 1AKJA 1JGGA 3FXMA 5EO0A 2GJ6A 1D3YA 2HDWA 5M5XJ 1D0ZA 1RR7A 2NX5A 3RWCA 3TKYA 2A69F 1ZELA 1K83J 4UVBA 1OYIA 4BQQA 1OLTA 3MVPA 4AU7A 3PUFA 1T0NA 1IZ1A 3FMRA 2DJIA 3MRLA 3EQLF 4A6DA 5LEKA 2E60A 1GXQA 4EJOA 3K2AA 3LQQA 1KU2A 2F2EA 3A1YA 3SJVA 1X2MA 4EI5A 3VXUA 1WJFA 1HXDA 3HUGA 3BJOA 1BD2A 4U0VA 2ZMEC 3LAJA 3RKYA 1VQ7I 2LYCA 5D8KB 4WWCA 2BVLA 2BSTA 3HXLA 1MBEA 3CQZJ 4L18B 3V5KA 4XBFA 2JUGA 3ZQCA 3KEQA 5E8PA 2QBYA 3I64A 1W5TA 1T7VA 2DT6A 2CV1A 4LLGF 4MXQA 2W24A 3RI4A 1R5GA 1S7OA 3KLNA 4BE1A 2H27A 3DEWA 2DXIA 2JSPA 3W6KB 3QU3A 4KNYA 5FA4A 3KLAA 3OR2C 2VAAA 2IGKA 4N0CA 5DDGA 1CD1A 3QYFA 3ZQGA 3Q9SA 4P1WA 3DQVC 4Q4ZF 1FOXA 4I76A 2ELHA 3KYDB 1JPFA 5IY5H 1ON2A 2L4AA 5JVTA 3OYIA 3MYJA 2K7LA 2KIQA 3E6MA 2WAEA 3P4MA 3U1DA 4C9YA 1KJ2H 2XV4S 1JI8A 1TWGJ 2UXXA 3LFKA 4DBQA 2B7EA 3IAS2 3CESA 4PG9A 2ZJQF 2NVTJ 2CMPA 4EJUA 1L8JA 2HS5A 4KT6A 2HKOA 1VQNI 4N0FA 2CV2A 4Q48A 2H1LA 2DFIA 3HM5A 2IGOA 1DUZA 4L9TA 4W97A 3E7LA 3A0HC 5DCFA 5KAIC 1YPZA 4CYCA 1U8RA 1XS9A 3L3HA 1N75A 5IM7A 3OYJA 4NC8A 1HSJA 1LEKA 3BG9A 3VOEA 1SD5A 1VFCA 2H26A 4A3MJ 4PGEA 1IAWA 4E70A 1MJ9A 5HLHA 1Q1VA 3GBGA 4IHTA 4A5MA 2NVUB 3CVHA 3GCMA 2X1DA 3QZWA 1HHIA 3R60A 3S3MA 3F6VA 4A3DJ 5MENA 2Y31A 2WY8Q 3VWJA 1C0WA 2IT0A 4M6XA 1W7PD 3BWGA 1W1WE 1TNTA 1XMXA 4ASNA 4BJTA 3HL2A 1ERDA 1JHTA 1VADA 1WWXA 4II2A 2A05A 3DTEA 4KITB 4XIDA 4FFEX 1MI5A 1I1SA 1N78A 5D2NA 3VSLA 1P4WA 2QWWA 4M3BA 1YYVA 5CVVA 2DBBA 1RKTA 3MRIA 3MV7A 1A6IA 3ELKA 1T7YA 2E34A 1DUYA 3HTUA 4JRXA 3SZGA 4B1RA 2EZLA 1KU3A 1SFKA 4XMYA 2ELKA 3BTJA 3TOAA 2LK2A 3HTSB 3IV5A 3L2VA 1HQCA 3MEXA 2GUOA 4I99C 2ZNYA 1XMKA 1P1ZA 3IT8D 2LP0A 3T8TA 1H9GA 1GVJA 3SJMA 3B6CA 1RZ4A 4GKNA 2NYXA 3B02A 3C9NA 4U1LA 2VN2A 1JTYA 4BXXJ 3OXSA 1MIJA 1P7QA 1Z7LA 4S0UC 1XGSA 1YO5C 1LVKA 1O7FA 2V2XA 4RMNA 3MGTA 3PWLA 4HX1A 1ORKA 1TW2A 4BEHB 4FT8A 3H3ZA 3IRQA 2CWEA 2NW3A 3HRMA 1LDKB 4ZC3A 3TEDA 5GTHC 3E6HA 3JREA 2EFNA 3P9MA 3ZPLA 3BR5A 3QODA 4WJ5A 4AYBA 2COBA 2HN7A 3S6CA 3QP5A 1IN5A 1WJ5A 5DEQA 3M3YJ 3PO3J 1LB2A 1TT0A 5TGTA 2V6CA 3FXQA 3W2AA 2R92J 3GJFA 1TMCA 3GMRA 3DTIA 5TRDA 3LMMA 2XPVA 2QKMB 2RNJA 3TW7A 3PIPF 1YITI 1FZJA 2ZSVA 1WBYA 4B43A 1GLNA 2O61A 3FXUA 2B0LA 5ICFA 5CVUA 5H6RA 4KISA 1I4FA 4I48A 4L8BA 3F23A 3MV8A 2O3FA 2WY7Q 1XN7A 3OV8A 3OSFA 2OCCH 1NANH 1BIBA 1U8BA 1HHGA 3BXNA 3PNYA 3MRKA 2VASA 4J01A 3HOWJ 4Q47A 4RB0A 3TN0A 2F5FA 4WUUA 5D5WB 3D3VA 1W5CC 1XR9A 4KJZA 2MLGA 5H94A 3CUQA 3H5RA 3S8PA 1HC8A 3SFIA 2EWNA 4CCNA 1S7EA 3WHCA 3LSPA 2YPRA 3K70C 2GOMA 3I5UA 1Z6TA 4IJAA 4A3IJ 4APQA 4EM2A 4PRDA 3PQYA 1Z3XA 2R4GA 1OPCA 1ZK8A 5DM7F 3S1RJ 1XPXA 4GCVA 2DYSH 4HV6A 1YRNB 3ROUA 1X1AA 4Z6YA 3OYFA 1VQ4I 5M3MJ 5ISZA 3GTOJ 4U1NA 4MEYF 3D39A 2K27A 1T22A 5BRZA 1ZS8A 4G9YA 4L9NA 1TP4A 3CMYA 1O3RA 3BTCA 4HS3A 1B6AA 3GVAA 1SFXA 4D7NA 1STZA 2WWYA 4BNCA 1N77A 1X3UA 5F1IA 3PFIA 3MFKA 1FMVA 1QNTA 1QZZA 3SPVA 3BGMA 1BR1A 1JXSA 1MBHA 5JR3A 2WBMA 1N25A 2QCOA 2JT1A 4YRVA 1NHAA 3IRRA 1A36A 3KPNA 2K9LA 4UQ2A 2KFDA 1LQ1A 1U5TA 3P9LA 1JUFA 3ABLH 1UZCA 2E19A 4P96A 3E2HA 4OMZA 3F22A 4A3FJ 1BJAA 2UV1A 4WK8F 1FBSA 5EZGA 4RB1A 4JFFA 2DOAA 1MNDA 2LKPA 3KXFA 2ECCA 1AGBA 1R6RA 5J40A 1EF4A 2MYSA 3GFJA 2QUFA 3ZGKA 3O8GA 4U6YA 1JKQC 4L29A 2I5UA 1GUUA 4X6FA 2GXAA 4D0BA 2X0LA 5HLIA 3F8CA 3DX7A 3MAJA 1DGRM 3Q3SA 3W3CA 2IS6A 1LPQA 3F0CA 5FLXK 5EF6A 2L2OA 2XIGA 1DDNA 1UXWA 3EPZA 2OJED 2YS9A 3I59A 1KYZA 1BBYA 2E5ZA 4MHGA 5ED4A 5C0AA 3QQ3A 4Y2DA 3MRPA 1RNLA 3G6EI 1KGSA 1GZPA 3L7WA 1WH7A 1XCVA 1QZYA 1USTA 3GMNA 1XDUA 5EEGA 4M3GA 4LLNA 3J81Z 1T20A 4Y4KA 3DU6A 3MKWB 3C2HA 1UXSA 3VXMA 4OWRB 1BOAA 5IEKA 4U6XA 2NOGA 2QQBA 3FHZA 5L2KA 2P5KA 5D5XB 2L02A 1V4RA 2BHZA 1MW7A 2CQNA 3BG5A 3V4GA 4MX7A 4XOPA 1VQ6I 1J0RA 1T95A 5L3EA 4EN3C 5HGBA 4DQ2A 3FK7A 3CC7I 2RNGA 2DA6A 3BJ6A 2XF5A 3KLOA 4CICA 1Y1VJ 3DLLF 5HLGA 2DA4A 2D1HA 3AG4H 4X1EA 4DBRA 2DA2A 2ZSIB 1LEAA 5IP7J 3HDDA 3S93A 5FLMJ 2R7ZJ 4WXDA 4B8XA 4L9LC 1MSEC 3DPTA 1B72B 3MGOA 3E6DA 3BZCA 2M34A 3ZN0A 4LFUA 3JRDA 1CF7B 3NARA 1ULYA 4JO8A 5DD4A 5HOOA 1W0TA 3VH8A 1S3JA 4Y13A 4XNFA 1ZSDA 2OBPA 5FDWA 5ILVA 2LSOA 2JMWA 3L3IA 4L8DA 2DFEA 2H6BA 3S32A 4IKFA 2CQKA 1IRGA 3WLBA 4UY8I 6PAXA 2LDUA 1IUFA 5B3SH 4F91B 3IH3A 4NB5A 2CLRA 4QTRA 2CO5A 3CD6I 1X7QA 1SD4A 4C3IJ 3K1NA 2P5VA 2VLJA 1XSXA 1PDNC 1S7QA 2BGCA 5J47A 3K1PA 2P5EA 3OWTA 3A03A 1XGOA 1VQLI 2NOJB 3BUYA 1NH3A 2E35A 1F36A 2Z33A 3KIOA 3FT2A 1YX3A 4L5EA 3QDJA 5FLVA 4I09A 5HHQA 4MQ9F 1Y56A 1C16A 3P4NA 3O6BB 2DDBA 4BEHA 1X1DA 2M5WA 2DAOA 2DK8A 2ICWG 3MRFA 3CF5F 2HOAA 4IXAA 3BCAA 2V4JC 4Y52J 2P81A 1T21A 1YDPA 4XM3A 3SXYA 1XGNA 4PFOA 1SEUA 3H1CA 3EUHC 2N8GA 3AL0B 5SWZA 1WH5A 2X4RA 2M3AA 4PJFA 3GZ5A 5DM6F 2HZTA 5LLQA 3ABMH 4IRHA 4BUPA 4I98B 4QLCU 4MJ5A 1K79A 2HQAA 3TQNA 2VC1A 3NAUA 4CVXA 2M87A 1FC3A 2JPBA 3FXRA 1JTXA 1ITYA 3S2WA 3JW4A 1IRZA 3SEQA 4MO7A 1HW2A 1R5ID 2EV6A 3SEZA 2DFHA 5HS7A 2VB6A 4PJGA 2X6WA 2OU2A 4DIQA 4A0YA 2AS5F 1FP2A 4BBSJ 5CQEA 2XDVA 4DZJA 5HHNA 2JVHA 4O2EA 4AC0A 5CKTA 2V79A 3H0GJ 2HU9A 1DU6A 2VT3A 3RL2A 1LJ9A 2VJJA 1H0MA 3FM5A 2BY2A 4KIFA 2GA1A 3R0JA 1D5VA 4NC7A 1HKTA 5IEHA 1A1MA 4PJ0C 3VYRB 4A93J 5HS8A 3AAFA 2MG4A 5L3CA 1E28A 3R4KA 2UWEA 5EFIA 2F5CA 2XAHA 2OL3H 4B4CA 2EFOA 3TJHA 1CQTA 2PJRA 3CJNA 4L3CA 5C0BA 4L8CA 4ON0A 5FLXZ 1MKMA 3F8MA 4XLHA 3QP6A 1OCCH 1R36A 4LB5A 3H3VK 3JRAA 3LSKA 4N0BA 4GKSA 3VYUB 3TVMA 5FGMA 4I7HA 1MWAH 1XR8A 3RPUD 4EM0B 1BI0A 1S9HA 1VQOI 3C18A 3G3ZA 1N5AA 4U1SA 3GW2A 5MEPA 3KEOA 4X6CA 5FJ8J 2ZOLA 2VE9A 4OU0A 2EBIA 4NSKA 4N5EA 2A6HF 2DA5A 1WI3A 1UFMA 2X85A 3VRIA 4NDLA 4IOAF 4MJIA 4MNGA 2ID6A 2KMUA 2NNNA 3ULQB 2R7VA 3UTTA 2L9SA 2PMZA 1ZHFA 3PWPA 5IPAA 2H1KA 2X6YA 3KPOA 3ROOA 3BQYA 4L8SC 2ZXHA 4AVPA 2FQ3A 3C2GA 3CP2A 1M05A 3VODA 1TQPA 3DBHB 2DMPA 4YFXF 3S3NA 1G2HA 2X9DA 1S6LA 3I6KA 4PJHA 4F7PA 3WGIA 4V3DB 4A3KJ 4E7LA 4XICA 1K4TA 4NQCA 2KRCA 3FTGA 2A6TA 1G4DA 3L2CA 3CC4I 4ZYEA 3IXAA 2HYFA 3DMMA 4K7FA 1SVMA 2FNPA 2XGCA 5DUIA 1HHHA 4G6TB 4P55A 4V2GA 1R22A 2L9NA 2LD5A 3L9FA 1E3PA 5IB2A 2CUEA 3BR2A 3FISA 1S7RA 2W82A 3HG9A 2QENA 2OC6A 3HPGA 2M30A 4QOKA 4C3JJ 3TA3A 2OCEA 1T0FC 3C8KA 5C3EJ 3VRJA 1ZGJA 3LWFA 3QFJA 4B44A 3HGYA 1F43A 2R3SA 1WRJA 3RKQA 1S9WA 2KIMA 5E9DA 3H9GA 3ZP5A 2DLLA 3OYMA 4OAZA 4G43A 3RL1A 1ZG3A 5IYBJ 1IXRC 1I1AA 1AKHB 1TBXA 3UPRA 2OA4A 3IWZA 4HA8A 2R7RA 4HSRA 1OCTC 3AREA 3K7AJ 5DCMA 1MBGA 3CTAA 4JX6A 2V1UA 3WU2C 1KJMA 2NS0A 3CCHA 2LBFB 4C2TA 2V1XA 3IH4A 4U0YA 4KICA 1RR8C 4PV8A 4F7EA 1DPRA 5AD0A 4E7ZA 2CUZA 1MZBA 2MH9A 1HSTA 3RTQA 3MRDA 3FQRA 3OR1C 4O6JA 5D4RA 1RUOA 2Y0SN 3CO7C 3ARGA 1IN7A 1KONA 4BAYA 1FOWA 1TZLA 3O3BA 4Y4FA 3RPQA 4BXFA 4FX4A 4FCYA 4L3EA 2CV0A 4PRBA 1WBXA 3AU1A 3ZQHA 4LG0B 3RPUA 1KQ0A 2X6OA 4XRSG 4IHSA 3ZMZA 3ML6A 1ZREA 1ZH5A 4GUPA 3VFNA 4LMYA 3IP4B 3JTCA 5FKLA 2AQEA 3J7AO 1SYSA 3KX2A 4J00A 2HEOA 3FRUA 3HIFA 3DPUA 3IAM2 3L3DA 5HODA 1RPWA 2MC3A 1A1NA 1I3AA 3J80Z 3DLAA 3A02A 5D4SA 3JRGA 4AVZA 3MZ8A 1EEZA 1WJAA 1IW7F 1YJNI 5IT9K 3SCMA 4XKCA 4E4HA 1FO0H 2JSCA 2HNHA 2O03A 5JLXA 2AXFA 3MRRA 2TCTA 3OXRA 4BQNA 4LCYA 2M45A 2M4GA 4ETSA 4MIMA 1X1BA 1YHQI 4M74A 5H2FC 3FMSA 4M9SA 3ERED 1HW1A 4QIWN 3SDDA 2CRGA 3CCQI 4X6DA 5M5YJ 4WX9A 1JT6A 4ZAKA 5LFAA 4PGBA 2W84A 3KFWX 1R71A 2F54A 1A5JA 4L0ZB 3FF5A 4L4TA 4WU7A 5CPRB 3WTXC 4FETA 5JHUA 2QKLB 4HF1A 1FOYA 1G59A 2DW4A 1IRXA 1WJCA 3GMEA 4LLLA 4PJXA 2AQFA 1EJ9A 4KMFA 3C7JA 1DDHA 3LSHA 5BPDA 2ETHA 4PJCA 1QRYA 2E7WA 3AFHA 3F72A 5E8GA 1HHKA 4PREA 5KNLA 2X4SA 2JRTA 2LKXA 2A61A 1V55H 4EATA 3I56I 4Z76A 3G71I 5E6IC 1HSBA 4HAMA 4HNTA 1MH4A 2KPMA 4JOMA 2KKOA 3TO7A 4E0RA 2P5LC 1ZG1A 2K4JA 3LSRA 4RM3A 3MWMA 3HC7A 4BY1J 2FOWA 4RM2A 1AGDA 4M73A 1W0WA 4JP0A 3TBWA 2VKVA 2FBKA 4CXFA 3BTIA 1ZARA 3NFNA 1GDTA 5DUKA 1I1GA 2P0WA 3QI9A 1TWFJ 3ECHA 5BPIA 3L9RA 2V26A 1G6RH 5D8LB 4ZUVA 4E7SA 3V8KA 3HRSA 1JF1A 1FFNA 2XASA 2JTVA 1T6SA 1V5EA 5F08A 2F4IA 3RYRA 3GTLJ 2FRHA 4O2CA 5E17F 5MEOA 3HSRA 4B47A 2W57A 5E3NA 3CUQC 3IUOA 3I3LA 2XFXA 3M8EA 1ZRDA 3ZMDA 5IROA 3I58A 2DPDA 4F7TA 3DV8A 3I6GA 2VQGA 4IF4A 4LK1F 5LGUA 3RUGA 3ES6A 3OYKA 4WDIA 3DPLC 1HKSA 2ACJA 1N59A 4IX7A 2Q8KA 5E79C 1K7AA 1YJ9I 3CCSI 2YU9J 1SFEA 2LTPA 2NS7A 1BI3A 1OMIA 1REPC 4N4OB 3SFZA 2QSGX 3HKZA 2VBZA 4YELA 4ENJA 5EUOA 2VXZA 5EJCA 1T80A 3D1NI 5EU3A 2WV0A 3VFSA 3DTKA 4ENNA 4B48A 1YG2A 4LIUA 3JVGA 2EB7A 3RQIA 1ZKGA 3QOPA 4V2FA 4A3JJ 2PQ8A 1FX7A 4HSTA 4LGWA 5C0DA 1G3TA 4K2EA 2FF4A 4RGRA 2LNBA 2JA6J 2DPUA 1GT0C 2HJLA 1ZLKA 2M8GX 3BROA 1MNEA 4ZUTA 1EH6A 1J7KA 3CCYA 3BR6A 4PJEA 3MREA 3RWEA 4ENKA 2E5NA 1ZR4A 1FZPB 4IHOA 5EDNA 2KISA 4MTEA 1UHSA 3MRMA 3RWHA 5LRRA 2V9PA 2E7XA 1RUNA 1Z05A 3GXOA 4HUXA 3D2UA 1SANA 3F3XA 1MD0A 4PGGA 5C0JA 3S14J 5HGDA 2OAZA 5FKPA 5B66C 4NT6A 2E71A 5K1YA 1OYYA 4FISA 1EEYA 2VBYA 2FIKA 3OIOA 5J8FA 3AM8A 2Z1DA 3WTTC 1R1VA 2IS4A 4BACA 4ENMA 5HHOA 4BY7J 2LY1A 3DX8A 4R8HA 1JJ8C 1LDJA 1JGDA 1QU3A 2A5YB 4GFBA 3ZQFA 4FE4A 3MR9A 3HHGA 5BS0A 1BR2A 3I54A 4I6ZA 1ETOA 4HV8A 5D7JC 3CJRB 2TRTA 2KRFA 4XSXF 1VQ5I 4II3A 4HBLA 4MFDA 3N05A 1S72I 1E17A 4PRHA 1BJZA 2FNAA 3DP7A 1OGTA 3LSGA 2I10A 2XUBA 1LDDA 2XVCA 1XX5A 1DPUA 3HYIA 1ZGAA 2E2HJ 3CO6C 2H8RA 3B3IA 3E1SA 4NQWB 2DYRH 2IAIA 3R61A 2OQGA 1QVTA 1PUEE 2KIUA 1BM9A 2QQAA 1O57A 3O2PE 2KDOA 1OYWA 5CVRA 2O7OA 1IV8A 1JJ6C 3LKQA 2BY1A 3V42A 4G8IA 4NQDA 3UBXA 4FE7A 2FO4A 3H5AA 1YRNA 4OIRF 3EUKL 3RKWA 1FIAA 4RAFA 3FONA 5IT3A 4N9IA 3QAHA 2W25A 4M3DA 4G6DA 3AL0C 2DMTA 2CLZA 1YS6A 4PJJA 3MRCA 1Q1HA 3HCVA 1XSVA 3KP2A 3PNVA 1R3HA 4PJ7A 1FBUA 3GSXA 3F8FA 5F64A 3HPJA 1ED3A 5FA3A 2ME0A 2QGUA 2CW0F 4ZFZA 5INDA 4HF0A 1YW8A 2GZWA 1HKQA 1ZGWA 4BGDA 1KCGC 1OR7A 2KLOA 2CYYA 5E20A 1XTAA 4JQFA 5GAHJ 4G7OF 3X11A 1BN5A 1IJWC 2ID3A 4LHUA 2E2JJ 3VXOA 4D7MA 5JVGF 2R93J 2JCCA 3FKJA 2IP2A 3MRGA 2HWVA 3E6BA 2DA7A 3ISPA 4HOBA 4M71A 4JFQA 3WTZA 4QRPA 5HHPA 4O5VA 4RAGA 3QUXA 1ETVA 3L2UA 1FYKA 2RV8A 2YX7A 2RAEA 3VXNA 1U2WA 3VB2A 2ISZA 4LOCA 3GMLA 3HSEA 2QVOA 5E1WA 4ZYAA 3C1DA 1G3YA 1H89C 3K1MA 2KL4A 4UB8C 4YFNF 1E27A 3DU5A 1Y8RB 3ZQQA 4EGYA 1Z91A 3K6GA 3GFLA 1OCRH 2UWMA 3H92A 3E0JB 3CUOA 3OS2A 1W36D 1YW7A 2EZHA 4IVNA 4CZCA 1FIPA 1W7PA 3GLXA 2P6SA 5JHFA 1A04A 1R9TJ 4PRNA 2XRLA 2HQNA 1OCOH 3FMQA 3QOEA 4XLCA 5HVQC 1MMSA 2DTRA 2E36A 3CP8A 3FBIB 1ETWA 2K9NA 3NQOA 1SYVA 3F9KA 3WTVC 2H8WA 1O4XA 3KP5A 1T0FA 1YX5A 5L3FA 4QWQA 1ON1A 4KN7X 4HEA2 3M8JA 3VPRA 1YIJI 3SDCA 4RAZA 4JFDA 2MABA 1SC7A 3DXAA 1P7IA 1Z7UA 2EA2A 3FQTA 5D6FA 2EH3A 1I1FA 2YU3A 1I3QJ 4D1QA 1M1EB 3GSRA 2ZB9A 1PJRA 3F8NA 4PDKA 1INQA 2GLOA 4IHXA 2X4UA 2VKDA 3M1EA 4KMUX 3BH9A 2R7FA 3OYLA 3FQWA 1EA3A 2DYPA 3EETA 5EGOA 5E3OA 4PZJA 3BG7A 4DYQA 1TVBA 1K78B 1CF7A 2NS8A 3SZPA 4IO9F 2KZGA 4XL9A 2Q7YA 4LITA 4ELMA 1EH7A 2PJPA 1Z0XA 3REOA 3VFOA 1WBZA 2JA8J 3PQJA 4QRUA 2O8KA 2EIKH 3PL8A 3D0SA 2R7SA 3I4MJ 3BZEA 3KETA 4PGDA 3DXJF 2CFXA 3OS0A 4DZPA 2QLZA 2XAUA 4V3EB 2BSRA 2IS1A 5HLTA 1O7LA 1TQMA 1S7VA 1XDSA 3DCFA 3DKYA 3G73A 1Z77A 3KPSA 3F21A 4BDYA 4HQEA 2K3FA 4RB2C 5FFXA 1O3QA 1KJVA 3E6CC 2O8XA 1MMAA 1K6OA 2VBXA 2KQRA 3QFDA 2CFOA 4OMYA 4A3GJ 3CJQB 2P5WA 2R5ZA 3M1BA 4HF2A 3CLQA 1Y0UA 1HOCA 5LEJA 1RC9A 3UTSA 2PMHA 5J3LA 3OYBA 4I0AA 1YIOA 2DOEA 3BH8A 2Z99A 4HPQA 3TP0A 2LREA 4KIGA 2DT7B 2VQCA 4XRFA 1BC8C 3H9JA 3G2BA 2OV7A 3S16J 3WTUC 3S2HJ 1BIIA 1ZHLA 1QPMA 2M4KA 5ICGA 1J59A 1S7WA 3RSNA 1AGFA 2BE5F 1QSEA 2CQ7A 3GIVA 4UQ3A 4ZYHA 3VDXA 2O6GE 4GYGA 1S7AA 2E1NA 4PFPA 4EV0A 2VUMJ 4FTHA 3JCUC 5F1JA 1TW3A 2XRNA 1T56A 3S3OA 1JHHA 4FASD 2M8EA 2JPCA 2R0QC 3GTQJ 3T5XA 3P7NA 5CYVA 3KPQA 4XR6A 4PGCA 1FTTA 5EOTA 4G94A 3V5HA 4PCQA 3W6JB 1D5YA 5L3BA 1K78A 3I6LD 2QM3A 4EUPA 2P7CB 2NXNB 3EDPA 5IYDJ 4ESFA 2DO7A 2L54A 2LFBA 5BS6A 2EQRA 3CH1A 3TBSA 4NC6A 1QO0D 1QBJA 3E6FA 2V7FA 5HNHA 4GXOA 1B1BA 4MFEA 5HNFA 3CJTB 2VLAA 3FQUA 5LHGA 3ILQC 1PP7U 2E1OA 5EZHA 1W5SA 5GAGJ 1ZRFA 1SVLA 3QUYA 2XAQA 1J2XA 1LEGA 3BHBA 3HOZJ 4C2UA 3WU1B 3OIQA 2HFHA 1G3SA 2L7MP 2G7UA 2CUJA 3A0BC 5E8IA 4CZZA 2KZVA 3OYCA 1NG7A 1J5YA 3AKZA 1PYVA 4A0XA 4ITVA 3RZCA 4HDUA 3CDGA 4CCOA 4BS9A 4HRIA 2K9MA 2PYEA 2R5ZB 1IC8A 5IP6A 3QPLA 3V7CA 2B63J 5AONA 1LP9A 2FBHA 1JHFA 3WG7H 3LA3A 1XG1A 1GV2A 2ESNA 3QULA 4GO1A 5IVXA 3SDAA 3TGNA 1WPKA 2VPRA 1XC5A 2HZDA 2E1CA 2HQ5A 4MVBA 3IHUA 1YQAA 3DBRB 3HOUJ 2RC4A 2Z9OA 2MD0A 2QSFX 4IQJA 5D5UB 4MS8A 3BG6A 1FFOA 2K4BA 1UG0A 3K4BA 2GIVA 2V1NA 3KPHA 3QPSA 4M9XA 3DEEA 3GFIA 5EYRA 1VI0A 5A2QK 1MBFA 1Y0NA 1TWHJ 3GSUA 4RGUA 4D0PA 4BYYA 2LRDA 3SZTA 3DTXA 2W7NA 1TLHB 2MH2A 3TO9A 1IM9A 2H6PA 4R1HA 2YEZA 2UXNA 3BR1A 2BNRA 2E2IJ 2EFPA 2OPTA 2NYKA 3TO4A 5LGNA 1FWZA 5F0FA 4RLQA 4YEJA 3A4CA 5CVJA 2BXYA 3K2ZA 4A3CJ 2IBDA 4HNVA 4WCGA 4UVAA 3HOXJ 1T08B 3TO6A 5DEGA 3JSPA 1CG9A 3GUDA 3BPVA 2XHKA 1YTYA 2BY3A 3E5UA 4AD9A 4W1UA 3HPHA 3GWZA 9ANTA 1I7RA 3OX8A 1ZVSA 3VXPA 2RKHA 4XOTA 1Z1DA 1FYMA 1I6HJ 2W1OA 5FD6A 1IUYA 4G8GA 3SDBA 2G9WA 2BYVE 3ZOBA 3WTWC 3OYDA 2K85A 1OKRA 3MZYA 3QDMA 4U7BA 5DCMB 4LB6B 2X4HA 5E18F 2X4QA 5C0IA 3MV9A 2AXGA 2COMA 2DT5A 5E8NA 2VPLA 4YIRX 4B3XA 2ADUA 5J6XA 4WO4A 5J1UA 1SAXA 5ACZA 5C9JA 4XKBA 2NVYJ 5D7IA 1NTCA 1KTLA 3R6SA 3KP6A 2R5YB 3BP7A 1W4MA 1YFHA 5B5EC 5J1AA 1HDDC 3TP3A 2EZKA 2R7QA 1FPQA 3FQNA 1Y1WJ 1TWAJ 1WCMJ 4H4KC 2LG4A 1SD7A 3MROA 1D0YA 3E5QA 5J4YA 3CDIA 3HOSA 4XLPF 2LBFA 2GAUA 4L9VA 2HR3A 3JRIA 2KJCA 4KIBA 3LKRA 3TOBA 3ZMSA 5KAFC 4WF2A 1LEBA 4I0BA 2XPWA 4L5JA 4UV8A 4U1HA 1LVAA 4D5FA 1T38A 1UCRA 2A07F 1G8XA 5EEHA 1DQUA 3BG3A 4ZDOA 4CA0A 3HBLA 2RN7A 3K4LA 1JFMA 4CYCB 1RK0A 2A68F 5JFRA 5FFZA 4A5NA 2MC4A 4X0GA 2BBYA 4X6EA 2FE3A 2HOEA 3L2RA 3L3KA 2CGPA 3IH2A 1OGAA 5FRMA 4ZYGA 1B8IB 1D1CA 2FYYA 4HDVA 1HSAA 5IB1A 5EO1A 1YN6A 2CJJA 2ISYA 4A3BJ 3O4LA 4PSXA 2HOTA 3VFMA 2Q1ZB 3WE3A 2AK4A 4ZYDA 5AIQA 1D8JA 3CCEI 5M3FJ 5M5WJ 3QRFF 3EUHA 3PNTA 2FD5A 5KK1A 4NBQA 2YPKA 2FJ1A 4HUUA 4UUSB 2LH9A 3ESWB 2QEXI 1QLFA 1T7ZA 3MRQA 1W0UA 4PJ9A 1KQ9A 3IKTA 2L5QA 3HJEA 5HS9A 4IHVA 4IQ4A 2HXIA 3FOLA 2IRFG 4WXCA 3JTSA 4M6YA 3WGGA 3CPLA 2D1VA 2VJ4A 4CUGA 1ZAGA 5HGHA 1WKMA 3TDUC 3REWA 1RJYA 2L01A 3GSWA 2RVCA 2D2WA 4XKWA 1IM3A 5D2LA 1IRFA 5IYCJ 2LF7A 1F5TA 3X12A 4FHTA 3GTPJ 3KPRA 2ZO4A 2YUSA 1DP7P 1MJBA 5MEQA 3HRUA 3CC2I 5K7FA 4HX4A 1OFCX 5K7ZA 2ZOKA 4EJTA 3LSTA 1IGNA 3W39A 1Y39A 3VFUA 2AXTC 2XC7A 1J75A 2HVRA 2DK5A 2XSJC 1NK2P 3NRVA 3GX4X 3WL9A 5FO5A 3ERYA 2XKPA 4RBOA 3N4MA 3T8XA 1SD6A 4A12A 4CYDA 1ZG5A 1T1WA 3KYOA 2DODA 1T1ZA 3K4KA 4MTDA 2CQQA 3QUKA 2FMYA 4RA2A 3H35A 3HLAA 1HBXG 4E7IA 2QSHX 1B0GA 3G1MA 3RDIA 4CGZA 3K9TA 1YI2I 4XLNF 4BL0B 2IGMA 3P9KA 1P4LA 1PQZA 2M0MA 1R4NB 3NWTA 5K7HA 4L0YB 2P6TA 3OOPA 4AM3A 3OYHA 1MHEA 3LKNA 3GFMA 2KIFA 3MKYB 1P4AA 2VOOA 4G59A 4PJMA 3S1QJ 5E3LA 5D5MA 5GADJ 1SFOJ 4K71B 4CH7A 1FSHA 1P2FA 4U1IA 3DBXA 3RZOJ 1LNWA 2MSYA 3P9CA 3RTRA 1JGEA 4Z77A 1FNNA 5FRNA 1BI1A 3ECOA 3GSVA 1QA6A 1DU0A 2Q2EA 5KVRA 4XXCA 4X6AJ 4HQMA 3MRBA 1JKRC 2CQXA 3ASOH 2HPMA 1W36C 3SKMA 4M9ZA 5F1NA 3V8LA 1IXCA 3HGGA 2LC2A 3CUQB 3BP4A 4MEXF 5BOXA 4NO3A 5J8CA 2EFWA 3LL7A 3CCJI 3EUAA 5IB4A 4GRIA 4ZUWA 1RI7A 3ABKH 4DNCA 3T1FA 1XZ0A 5SWSA 1HF0A 1DGWY 3BEWA 2IXSA 2AO9A 3ZXSA 2VC0A 2XAGA 2EILH 3PJRA 2HLAA 1VZ0A 2RFXA 3FFCA 2NVQJ 3JTTA 2L9VA 4ZJZA 1LFBA 3TF7A 1RKWA 1JPGA 3FBNB 3G1OA 2JJ7A 3IKVA 4ABZA 2GITA 2VKHA 2XF6A 4BJ6C 2E7LE 1SMYF 2FU4A 5GPCA 5E00A 1ZHNA 3GTKJ 1KPUA 4PJDA 2IGNA 3J7ZI 1X58A 2BZTA 1YE9A 3WGHA 3TBVA 3LNQA 3O9WA 2DMUA 2JN6A 4IL6C 1QVOA 1XD7A 2PMUA 3FHNA 1QRNA 1A9BA 3SDGA 5F7DA 3DKXA 4JQXA 2HGCA 3HOYJ 2QQ8A 3P73A 1XB4A 2A83A 2ZSWA 2Y0MA 4WW2C 2FQ4A 3BZKA 5IOYA 2X1CA 4S04A 1HDPA 5D5VB 1AA7A 2BCKA 1CE6A 4DGWB 4BJ5C 3A2KA 3LOCA 4M3FA 4MLOA 2HDCA 3ZQLA 3G08A 2WB1A 5ILUA 4Y17A 1ONQA 4NHJA 3GEZA 4GYIA 4NUBA 1XGMA 4IEJA 3PABA 2BHYA 2DJNA 4ESJA 5B1AH 4UUTA 3WHBA 2DDAA 1QQIA 2ECBA 2BOLA 2RDPA 1E0EA 2ZMEA 2VJIA 5J1RA 4ZDPA 4BE0A 3HG1A 1MMNA 4CSWA 3HE7A 1ZR2A 2MA3A 2YSRA 1T2KA 2B9SA 1TNSA 2F4OB 2MGQA 3LKSA 3LN5A 3RWGA 2VQLA 5HDNA 1DP3A 3K0LA 3VYTB 1ETYA 3FK6A 2MBFA 3PSFA 1FJLA 5LHHA 3OL4A 4OIQF 3D25A 4BH9A 1E3OC 2EA4A 2PG4A 3UKGA 3D5LA 1DUXC 3BEVA 1G7QA 1ZT1A 3L2QA 1T7XA 5DV5A 4BQAA 1T1YA 4E7KA 2K5CA 2BW3B 2DFFA 1BOBA 2F48A 1HW5A 2VIXA 1USSA 5HDKA 1H88C 4LD5A 2O5NA 2L9RA 1VNDA 3FT4A 1LE8A 3BDDA 4GGGA 2BEOA 3J7AY 3NWSA 3UR3C 3TW6A 4JRYA 4G9DA 4LNRA 4QRQA 1IXSB 5L2JA 3BJAA 3T8RA 1TC3C 1ZQ3P 2RQPA 3MKLA 4PJNA 3LN4A 2HTJA 2PBIA 3B73A 4XSZF 4IHWA 2ZC2A 5GPAA 1FSEA 1LFPA 4JBAA 2NRAC 4MNQA 4NNXA 1MBJA 3VFRA 1UHWA 2WAQN 2E1MB 3TL4X 1VQKI 4G7ZF 3A01B 3QDGA 1LKXA 3FOMA 2XGXA 3BCBA 1T0MA 1D1AA 1S8NA 3OOUA 3K4JA 4MNUA 2XAFA 1RETA 1WSUA 5B38A 1VQMI 4D5CA 1A6QA 2EV5A 2FEZA 3DKWA 3G4SI 1KU9A 2BVOA 2DI3A 2CIKA 1APLC 3RIRA 3PWVA 1FZKA 4YIFA 5K5RA 1AGCA 4M3EA 1TTYA 1HLVA 3HEFA 3U21A 3GO5A 4N9HA 1MH3A 5ENWA 2F5EA 4V19K 1G6NA 4NO2A 3TMOA 3K69A 2Z5UA 1AU7A 4F93B 5C09A 1A6ZA 3WTSC 4U1JA 4MQ7A 1L3LA 1W7PB 4AUXA 3OS1A 2ZJPF 3FWEA 3VSKA 2FX0A 5IT9Z 3OMYA 1R23A 2ZCWA 3B6AA 2VE6A 4I02A 3J80K 3BPXA 1J9IA 3CDHA 2L0KA 5AIPA 2FBIA 1NK3P 2LY2A 2VONA 2XKOA 2C6YA 1A1OA 4KT5C 3RKXA 2OZUA 4PV9A 1MSFC 2QA4I 2KP6A 3HKZN 5B1BH 4U88A 2HQRA 3F8BA 1QZEA 2GOXB 2L7ZA 3IWFA 1MMDA 3LV3A 2DA3A 4WXHA 1T7WA 4KFCA 2I8DA 1JGSA 1S29A 2E1MC 1K61A 2BW3A 3VFPA 3L00A 2EV0A 2OTLI 3CDLA 4I4WA 3S15J 1FEXA 4F55A 2VLKA 5DDHA 2H6CA 2PFBA 2EINH 2HVQA 1JT0A 1ODDA 2DA1A 3HSFA 1HHJA 2UUZA 2V2WA 5EEAA 3COAC 5F0HA 1T1XA 1BR4A 2JWTA 4JFOA 5SWQA 2IA0A 5L3GA 1Q94A 3BO8A 1ZAOA 1W0VA 2GXGA 3BW9A 4KN4X 1R58A 5TJJA 5LD2C 2ZBKA 5EU6A 4JFEA 2LOOA 3DWLE 1P9QC 4F3QA 4IIQC 5BNGA 4ONOA 3QWLA 3ILPA 1EV7A 1P6RA 2RQQA 1X1CA 2X4TA 2OI9A 5CJ9A 2M7AA 4E6KG 4N4NB 4ZH4F 5FROA 2WC2A 1U9OA 1T8IA 2J8UA 2A3SA 2JA7J 2HPIA 3QYEA 4XKVA 1ETXA 2KHMA 5DYMA 5J1YA 3HAEA 1Z67A 3QQ4A 4M6VA 1GZQA 1L0OC 4PR5A 1VTNC 1IV6A 3RCOA 2OQRA 3FXJA 2EK5A 5IB5A 4P5OA 4ZTJA 2ESVA 4LJZF 3ZR8X 4A0ZA 4N0UA 4NQWA 3FXLA 1BA5A 3I71A 1XMAA 1ZHKA 4U1MA 2VL8A 2ME6A 1BI2A 3GMMA 3ZMTA 2IEKA 4BE2A 1K4SA 4HZFA 3BTLA 1KPVA 3HZJA 1ZLJA 2XPUA 1ENHA 3QYBA 1UJ8A 3RYPA 1OCPA 3WODF 3RWIA 1WI9A 2VKEA 1QEWA 4UHTA 2BY0A 2CUFA 2FXAA 3JTGA 1B9MA 2L7FP 4QPOA 2X6XA 4JQVA 4Y16A 4D0CA 3HUGB 3ABUA 1OF2A 1R1TA 2XSDC 3RWFA 3CCUI 3S2DJ 3LA2A 1FMWA 1QPIA 4BKWA 4BHCA 1YW9A 1IF1A 1E3HA 3TBIA 2F53A 3I0TA 2JQ7A 4HKJA 3CC5A 3FZVA 4NQXA 1JUPA 4ANJA 3M07A 2GBYA 2XB0X 3ARFA 1D1BA 1V5GA 4UUVA 1S7TA 3FDYA 3KE2A 2ZJRF 1O3SA 4G8XA 4Y7NJ 3GTMJ 3JAMZ 1O3TA 1S9YA 3PQKA 2Y2ZA 3S1NJ 3OL3A 2JA5J 3H9QA 2AKRA 1A9EA 1LQVA 4PJIA
chains in the Genus database with same CATH topology
4FX0A 2IA1A 2PLYA 1F4KA 2TDXA 4TV7A 3N97A 3VEPA 2GA2A 2WTEA 5ERIA 4OIPF 5BQTA 1MDMB 2NNYA 2ZMEB 3FX3A 5F6FA 1F9NA 2DU9A 4JK1X 5D6EA 2M1BA 1SFUA 2DQRA 4HX7A 3VFZA 5BMZA 2K86A 4Q5SF 3JAMK 2VT2A 1FYLA 4ESBA 2CSOA 5L3DA 2JZYA 4P9UA 2J5OA 4A2UA 1U3EM 1B59A 1Z6RA 4LG0A 1IN8A 3U9GA 5ICEA 1FY7A 2PI0A 2YR2A 5CLSA 1GHCA 5H20A 2ZKZA 2Z3YA 3IC7A 4PGHA 3ZQ7A 3M9AA 1MJAA 1D8KA 2F5DA 2UZKA 3V7SA 1U5TB 2QYOA 2IJLA 4L9JA 3Q5FA 3KZYA 1MDMA 5E1ZB 3HHHA 1GXPA 3U2RA 2GQQA 3QU6A 4EVIA 4HLXA 1KYWA 1P4XA 2P4WA 4HYEA 3ZMUA 2R7DA 1YLFA 4EMSA 4KUMA 3P9IA 2XROA 2QZ8A 3I4PA 2GXBA 3L09A 3BOQA 3HOTA 2VBWA 5E1XA 3RI4A 2Y48A 1R5HA 3LA7A 3EYYA 4KDPA 2XAJA 2IA2A 3NEUA 4I01A 5ICCA 2Y75A 1CGPA 4F7ZA 3DF8A 2FMLA 4ZZDA 4YG2F 1IN6A 2VODA 2L3DA 5H6QA 4EQQA 2ESHA 2MD5A 5HDGA 3M8FA 2VE8A 3GF2A 3E3VA 4KA4A 4AIKA 1SMTA 2L4MA 2IVMA 1PP8F 2A6EF 4UNOA 2IPQX 2MLKA 1E2XA 1I6XA 5LRSA 1ONVA 4G7HF 4CHUA 4M72A 3RJPA 1R1UA 1KQ8A 5LBQA 1FLIA 4UV9A 3BZ6A 5K5OA 4AIHA 1B9NA 2H09A 4UVCA 1T98A 2Q0OA 1Z9CA 3KZZA 2KJBA 1ZYRF 5JI6A 1BIAA 3J81K 4HW0A 4IRIA 2ZFWA 3DFGA 1I5ZA 1U5TC 4AIJA 2FA5A 4U7DA 4EM1A 5DD8A 2BV6A 1JE8A 2ZJ2A 3SQNA 1UHMA 3T1BA 4EJWA 2LF8A 2EJRA 3BP8A 1R00A 4RGSA 2J5PA 4U0WA 4H0EA 3I59B 4BHPA 4YIIA 1F1ZA 2AXLA 2HTSA 1P92A 2G7HA 2HKXA 3GYHX 5FB2A 1I27A 3CLOA 5LGTA 3V8JA 3MZHA 4P9FA 4OIOF 3TDZC 3WTYC 2ZXJA 4UXNA 2O0YA 3WE2A 3KP4A 3QPTA 1ZRCA 4LK0F 1R7JA 5ILSA 4Z2YA 4OOIA 3JSOA 2P7VB 1MGTA 2QBYB 3T0YA 3WG9A 3MCZA 3IL2A 3H3UA 4RS8A 2D45A 3R0AA 3E5XA 3FM3A 4EJVA 3V7RA 3I53A 1AOYA 4MQVA 4A6EA 1XCBA 2NAZA 3LAPA 4G6QA 4ZZLA 1KU7A 4CO8A 5F1RA 3MQ0A 4RB3C 4BXUA 3GZ6A 1EH8A 2HYGD 4I2OA 1XSDA 3SHFA 4MGRA 3C3WA 3KP3A 3E97A 4YFKF 4L5IA 2YX4A 2P8TA 1H9TA 1TQIA 4B09A 2H94A 3KCCA 3QPHA 3M7GA 2PEXA 4KYWA 2EFQA 3BY6A 3WU0A 2OZ6A 1AWCA 1B4AA 5K5QA 3ABTA 5A2QZ 4IPAA 5CVIA 2QQ9A 2IW5A 1T39A 1G3WA 3EYIA 2STWA 4S05A 2W85A 1IN4A 1WQ2A 4R79A 1QGPA 4EGZA 1U78A 1KA8A 3DEUA 1ZN2A 4OINF 1BC7C 2V9VA 2RGVA 3O3KA 2V1DA 1FP1D 1FT9A 1U6GA 4IRGA 3HRTA 1FOKA 3F6OA 2VOPA 2K02A 4HX8A 2ZNZA 4HV5A 5FD5A 3Q9VA 2STTA 3LQRA 2OD5A 4CDGA 3JTHA 4AWXB 2DQLA 1RIOH 2FOKA 2PN6A 4RAYA 2FSWA 1UB9A 3ZN1A 5LHIA 1FBQA 2CG4A 2GWRA 4Y15A 4HLYA 4RGXA 4BHBA 4O3MA 1YS7A 3KP7A 3ZMVA 1V3FA 1D3YA 3TKYA 2A69F 4UVBA 1OYIA 1IZ1A 3FMRA 5LEKA 3EQLF 4A6DA 1GXQA 4EJOA 3LQQA 1KU2A 2F2EA 1HXDA 3HUGA 3BJOA 4U0VA 3LAJA 3RKYA 5D8KB 4WWCA 4L18B 4XBFA 3KEQA 2QBYA 3I64A 1W5TA 4LLGF 2W24A 1R5GA 1S7OA 3KLNA 2H27A 3W6KB 3QU3A 4KNYA 5DDGA 3Q9SA 3DQVC 4Q4ZF 2ELHA 1ON2A 2L4AA 5JVTA 2K7LA 3E6MA 3U1DA 2XV4S 2UXXA 3LFKA 4EJUA 2HS5A 2HKOA 4Q48A 2DFIA 4L9TA 5DCFA 1U8RA 1HSJA 3VOEA 1SD5A 1IAWA 4E70A 1MJ9A 5HLHA 4IHTA 4A5MA 3R60A 3F6VA 1C0WA 2IT0A 4M6XA 1W7PD 3BWGA 4ASNA 1TNTA 1WWXA 1I1SA 1P4WA 2QWWA 1YYVA 5CVVA 2DBBA 3ELKA 3HTUA 1KU3A 3TOAA 3HTSB 1HQCA 3MEXA 2ZNYA 1XMKA 3T8TA 1H9GA 1GVJA 1RZ4A 2NYXA 3B02A 2VN2A 1XGSA 1YO5C 1O7FA 1TW2A 4FT8A 3H3ZA 3IRQA 2CWEA 3HRMA 1LDKB 2EFNA 3ZPLA 3QP5A 1IN5A 5DEQA 1LB2A 2V6CA 3FXQA 5TRDA 2RNJA 2O61A 3FXUA 2B0LA 5ICFA 5CVUA 5H6RA 3F23A 2O3FA 1XN7A 3OV8A 1BIBA 4Q47A 4RB0A 2F5FA 5D5WB 2MLGA 3CUQA 2EWNA 2YPRA 3I5UA 1Z6TA 4IJAA 4EM2A 1OPCA 4GCVA 4HV6A 3ROUA 4MEYF 2K27A 4G9YA 4L9NA 1O3RA 1B6AA 1SFXA 3GVAA 2WWYA 1STZA 4BNCA 1X3UA 3PFIA 3MFKA 1QNTA 1QZZA 1JXSA 5JR3A 2JT1A 1NHAA 3IRRA 1LQ1A 1U5TA 4P96A 4OMZA 3F22A 1BJAA 4WK8F 1FBSA 4RB1A 2LKPA 3GFJA 2QUFA 2X0LA 5HLIA 3F8CA 3MAJA 5FLXK 1DDNA 2XIGA 3I59A 1KYZA 1BBYA 4MHGA 5ED4A 1RNLA 1KGSA 3L7WA 1XCVA 1QZYA 1USTA 1XDUA 5EEGA 4LLNA 3J81Z 1BOAA 2QQBA 3FHZA 2P5KA 5D5XB 2L02A 1V4RA 3V4GA 1J0RA 5L3EA 4DQ2A 3BJ6A 3KLOA 4CICA 5HLGA 2D1HA 1LEAA 4WXDA 4B8XA 3DPTA 3E6DA 3ZN0A 4LFUA 1CF7B 1ULYA 5DD4A 5HOOA 1S3JA 4Y13A 2OBPA 5ILVA 2LSOA 2H6BA 2CQKA 1IRGA 6PAXA 2LDUA 4NB5A 2CO5A 1SD4A 3K1NA 2P5VA 1XSXA 1PDNC 2BGCA 3K1PA 1XGOA 2Z33A 4I09A 4MQ9F 3O6BB 2M5WA 2DAOA 2DK8A 4IXAA 3SXYA 1XGNA 3GZ5A 2HZTA 5LLQA 4IRHA 4I98B 4QLCU 1K79A 3TQNA 2VC1A 2M87A 1FC3A 2JPBA 3FXRA 3S2WA 3JW4A 1HW2A 2EV6A 5HS7A 2OU2A 4A0YA 2AS5F 1FP2A 2V79A 2VT3A 1LJ9A 1H0MA 3FM5A 4KIFA 2GA1A 3R0JA 1D5VA 1HKTA 5HS8A 3AAFA 5L3CA 3R4KA 2F5CA 2XAHA 2EFOA 3CJNA 4ON0A 5FLXZ 1MKMA 3F8MA 3QP6A 1R36A 4LB5A 4N0BA 5FGMA 4I7HA 4EM0B 1BI0A 3C18A 3G3ZA 3GW2A 3KEOA 2VE9A 4OU0A 2A6HF 1UFMA 2NNNA 3ULQB 1ZHFA 4AVPA 2FQ3A 3VODA 1TQPA 4YFXF 1S6LA 3WGIA 1G4DA 3L2CA 4ZYEA 2HYFA 2FNPA 5DUIA 4P55A 1R22A 3L9FA 2QENA 2M30A 1ZGJA 3LWFA 2R3SA 1WRJA 2KIMA 3ZP5A 2DLLA 1ZG3A 1IXRC 1TBXA 2OA4A 3IWZA 4HA8A 5DCMA 3CTAA 2V1UA 2NS0A 2V1XA 4U0YA 4KICA 1DPRA 2MH9A 1MZBA 1HSTA 4O6JA 5D4RA 1RUOA 3CO7C 1IN7A 4BAYA 3RPQA 4FX4A 4LG0B 3RPUA 1KQ0A 4IHSA 3ZMZA 3ML6A 1ZREA 1ZH5A 4LMYA 3J7AO 2HEOA 3HIFA 2MC3A 3J80Z 5D4SA 5IT9K 1IW7F 2JSCA 2O03A 2M45A 4ETSA 4M74A 3FMSA 4M9SA 3ERED 1HW1A 4WX9A 2W84A 3KFWX 4L0ZB 3FF5A 3WTXC 5JHUA 4HF1A 2DW4A 4LLLA 4KMFA 3C7JA 5BPDA 2ETHA 2E7WA 3F72A 5E8GA 2JRTA 2A61A 4HAMA 2KKOA 3TO7A 2P5LC 1ZG1A 2K4JA 3MWMA 4M73A 2FBKA 4CXFA 1ZARA 5DUKA 1I1GA 3ECHA 5BPIA 5D8LB 3V8KA 3HRSA 2XASA 2JTVA 1T6SA 3RYRA 2FRHA 5E17F 3HSRA 2W57A 3CUQC 3M8EA 1ZRDA 3ZMDA 3I58A 2DPDA 3DV8A 4IF4A 4LK1F 5LGUA 3DPLC 1HKSA 2ACJA 2Q8KA 1K7AA 1SFEA 1BI3A 1OMIA 1REPC 3SFZA 4ENJA 2VBZA 2VXZA 2WV0A 4ENNA 1YG2A 2EB7A 3QOPA 2PQ8A 1FX7A 4LGWA 1G3TA 4K2EA 2FF4A 4RGRA 2LNBA 2DPUA 1ZLKA 3BROA 1EH6A 1J7KA 4ENKA 1FZPB 4MTEA 5LRRA 1RUNA 2E7XA 1Z05A 3GXOA 3F3XA 4PGGA 1MD0A 2OAZA 5K1YA 1OYYA 2VBYA 5J8FA 3WTTC 1R1VA 4ENMA 4R8HA 1LDJA 2A5YB 3HHGA 3I54A 2KRFA 4XSXF 4HBLA 1E17A 2FNAA 3DP7A 2XUBA 1LDDA 2XVCA 1DPUA 3HYIA 1ZGAA 3CO6C 3R61A 2OQGA 1PUEE 2KIUA 1BM9A 2QQAA 1O57A 3O2PE 5CVRA 1OYWA 4OIRF 3RKWA 5IT3A 4N9IA 3QAHA 2W25A 4G6DA 1YS6A 1Q1HA 1XSVA 3KP2A 1FBUA 3F8FA 5F64A 2CW0F 4HF0A 1YW8A 2GZWA 1HKQA 1OR7A 2CYYA 5E20A 4JQFA 4G7OF 1BN5A 2IP2A 2HWVA 3E6BA 3ISPA 4M71A 4HOBA 3WTZA 4O5VA 1FYKA 2RV8A 2YX7A 1U2WA 3VB2A 2ISZA 3HSEA 2QVOA 5E1WA 3C1DA 1G3YA 3K1MA 4YFNF 4EGYA 1Z91A 2UWMA 3GFLA 3CUOA 3H92A 1YW7A 4IVNA 1W7PA 3GLXA 2P6SA 1A04A 3FMQA 2HQNA 5HVQC 2DTRA 3NQOA 3WTVC 3KP5A 1T0FA 5L3FA 4QWQA 1ON1A 4KN7X 4RAZA 1Z7UA 2EA2A 5D6FA 2YU3A 4PDKA 3F8NA 3M1EA 4KMUX 2R7FA 3EETA 4PZJA 1K78B 1CF7A 3SZPA 1EH7A 2PJPA 3REOA 3PQJA 3D0SA 3KETA 3DXJF 2CFXA 2QLZA 1O7LA 1TQMA 1XDSA 3G73A 3F21A 4HQEA 4RB2C 5FFXA 1O3QA 3E6CC 2O8XA 1K6OA 2VBXA 4OMYA 4HF2A 1Y0UA 5LEJA 2PMHA 4I0AA 1YIOA 2Z99A 4KIGA 4XRFA 1BC8C 3WTUC 1QPMA 5ICGA 1J59A 2BE5F 4ZYHA 2O6GE 4GYGA 1S7AA 2E1NA 4EV0A 1TW3A 2XRNA 1JHHA 2M8EA 2JPCA 3T5XA 3P7NA 5CYVA 4G94A 4PCQA 3W6JB 5L3BA 1K78A 2QM3A 2P7CB 3EDPA 4ESFA 2DO7A 2L54A 5BS6A 1QBJA 1QO0D 4GXOA 1B1BA 5LHGA 1PP7U