2O5NA

Crystal structure of a viral glycoprotein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
271
Chain Sequence
VVRPEVNRTGTVDICQGPMELIFSVSRTSSGATGERISLKNTLSIVSMENGGKPGTYEWSFPANESWPEIQFLLQNREFVSKYYADVVQTPGELVVEYRCPVPQFNCTITHRWKGETIMSFDGAIQTIRSVTSEYTTKNEDTLVKYIRGLNVTLLTDNAKSIEHRWTEICKKLKDADRPDDNQYTLEDDILEDDIEMDIVQCQMTTQVPLKYHMTVWSAGRDSRAIALSAIEVASYLPVNRSQILNTTCEITSSSGWTVRLRFSEEMVAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords MuHV1gpm153
publication title Cellular Expression and Crystal Structure of the Murine Cytomegalovirus Major Histocompatibility Complex Class I-like Glycoprotein, m153.
pubmed doi rcsb
source organism Murid herpesvirus 1
total genus 68
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2920 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o5nA01
3.30.500.30 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 2o5nA02
2NYKA 4G59C 4JO8A 2O5NA
chains in the Genus database with same CATH superfamily
2VE6B 3OG6B 4JGNA 1TQTA 3ILEA 1DLHB 4I2XA 1WBYB 5AYQA 2Y7LA 2RH0A 5IHUH 3SE9H 2KT6A 4ZOBA 1O0VA 5KJ4A 5FK9B 2PP8A 4OKDA 4W9DC 2R69L 3DUSB 3BSHA 3FULA 3T2LA 3E3QA 4PMEA 3QYCA 5E1IA 1MFBH 3SDAD 4NUMA 5KVEH 4LLUA 4JM4L 4YEFA 5FUCC 3BQUB 4QWWD 2ZXAA 3F6LA 4ADIA 1XD1A 3BFQG 5HJ3B 2MOGA 4POZD 3SYPA 3W81A 3EAKA 1JGVL 4MD5A 1ND0A 5HYJB 1NMAL 2O6FA 1KB5B 1OP3K 1E4HA 2GTWB 2DDQL 2IXQA 2VW6A 1HOCA 3N1FC 5I75B 5DA4A 1XGRA 2XZCH 4JDVB 3SYCA 5B3SB 1IV8A 2XFGB 5E6ID 4UNIA 4LIQE 4NWUH 1TETL 1K85A 3ELQA 1YC7A 3DX9A 2GAZB 3IF1A 3DO7A 1AC6A 2VXTH 4UOZA 4CMHC 3QUYA 3JWDL 2GI7A 1G9NL 3W37A 4A55A 1HAWA 3IN0A 3LN5B 5I30H 1A14H 5B1CA 3N06B 3RJOA 1JL8A 3CFKA 2JTDA 3O9WB 3QQDA 5I18H 1JF1B 2XYBA 3MNDA 4XWGH 3FO1A 5KSBB 5ALBL 3VXQA 1NDMB 1DCLA 1SBSL 2ADIA 2AQRA 2VL4A 3DX0A 3ZKXB 4YHML 4BZ2H 4XVJL 5FO9B 1NPUA 3GBEA 2HVKA 1RFDL 4E36A 1TMCB 1ZS8A 4AV0A 3BEWB 1MCWM 4G8EB 5DI8B 5EOTA 2OMNA 3QR2A 4HLJA 4ZUUA 2WGNB 1VFOA 5IB4A 1CDBA 3FQXA 2NXYC 4X80L 3WKYA 3PFUA 2OJEB 1WIOA 3DSNB 5E4IA 1E9QB 2DTML 1NAMH 3PWNA 2FO1A 3ULVD 4NKDB 2IGTA 2X4QB 1QKZL 4NAQA 5BRZD 3B5HA 5E9DE 5GS1B 4K3JL 3OHXA 5HXMA 2O72A 1UD4A 2DLFL 3NK3A 4LDLB 1EVUA 4LT7A 3LN4B 1JPTH 3BH9A 3PGCA 4OM1L 3OKOA 2ZQKA 5IVXF 4Z78B 4KDVA 1E27B 1KBVA 4QTHA 4HALA 3P30L 3QUZC 3CXDH 4IJ3B 3VH8G 4MB1A 1AKJD 4QRUA 5AKTA 3RHWK 1BWWA 4Z0XA 4MMYA 3E8UL 4XVSL 2AQPA 3IPEA 5HHNA 1S3KH 2G9HA 3ULVL 3P9MA 5DTFA 1A8ZA 2DZEA 4P46C 2AXHA 4BFEA 1D5IL 1FSKB 3B5GA 4FFWC 2DWDB 2V2XA 4YZFF 4UTBH 1XF4A 3MBWA 2XC8A 3N0AA 5ESQA 5DUBA 3U0TA 3S5LA 1LP9A 1GJUA 2WV3A 1QFWL 1J18A 2LW3A 5LCVL 3MRQA 2D7NA 4PU2A 5GGTA 5LLIC 4QRRD 3DOSA 2VQ1A 3TVMA 3QFJD 4LSQL 3S97C 1PYWB 2Z4QB 4BFGA 1TVHB 2WYZA 4NKIH 3ISYA 4XMLL 3QJXA 3RUGE 5ICYB 3MA7A 1BXUA 3X3GL 2HLFC 2B1AL 5DVOA 1R3IH 1DBBL 3BZ4A 4PJGB 1EDHA 3FT2A 2VLKD 3QDJE 3MR9B 3OLGA 4M93B 4PY7A 3EJPA 4HWUA 2GY5A 3GMRB 4MD4A 4NGHH 5FWQA 2GUOA 2K8MA 5I82A 3L3JB 4AVJA 1UH2A 3P0VH 5KYXB 4KI5D 4M5TA 2A77L 2CJSA 3C87A 1FQ9C 3LPWA 4ONGL 4XBEL 3L1GA 5HYFA 3F85A 4OZFB 4ADGA 5K39B 4WWKA 3QRGL 1NC2B 1WFIA 4UQ2A 5DJ8A 3CDZB 3HE7B 4XAWH 5C0DA 5KS9B 3NSJA 1RCYA 3HMWL 1NBYA 3WFEL 3ARRA 2AERT 2Z7ZA 1X5JA 3L5XL 5LGJA 2AITA 5IROA 3ZTEA 4LPUA 2BIPA 4W9IC 3CZFB 1IGCL 35C8H 4ONFH 4XWOD 3LKQB 3M1BA 4K7PX 1W0WB 3LRHA 2W9EH 4DP6X 2F54A 1XZ0A 3CC5B 3BUPA 3D8MA 4PJ8C 5FOBB 2IWKA 4P2QE 5E2WL 3PDDA 1ET8A 1QBMH 1RZIB 2XWRA 3ARBC 3LD8B 5BQ7B 1J05B 4XO9A 1CFQA 2BP0B 4GIOA 1DBAH 3LNHA 4U1IA 1ZLUH 2CLRB 4JO8A 1N6UA 3KEHA 3QARA 4HJIA 3OKDB 4W9ZA 4Z3TA 2A9NH 1ZLWH 3LHAA 4LOFA 3PHQB 4OCYL 3KWTA 4MZ3A 2IGFL 3HFML 4GXFA 1X7SA 1ZJBA 4RMQA 5F7WC 1V54B 4Z3EA 1PF3A 4NI6A 5J3HC 4K5NA 4Y5VA 1UEMA 5HHOD 4FFTA 1HFUA 4ZTOH 2JB5H 5JOFA 3FNKA 4HIQA 2BVOA 3APCA 3E6FB 3HE6B 2WQ8A 3Q3GA 4IU2A 1U3HD 1TKWB 5A43C 1WBXA 2BSSB 4P5TA 1BQHB 3TBVB 4CAGA 5H37A 4BRJA 4DNLA 1E50A 2K7PA 4QHUA 1Z6JT 3MBED 2BDNH 4NQEE 4DERA 5DD1H 1BECA 4MTMA 2X89D 3D4GA 4FFVD 4F9LA 1VAHA 4BFFA 4N2LA 1JF6A 2DH3A 4PS7A 1LO4H 3SPVB 2G5BA 4PJCF 1EWHA 5ENWA 4B9YA 5J13B 3UAEA 1U8HB 2NY4C 5SWSD 4H8VA 2UZIL 4KKBD 4XPHH 1VZIA 5I1IL 4DOHB 1E8XA 4M7LT 3QIBA 1E4WL 4AYBA 3PQYD 2J8UA 3UTTE 3B3BA 4NM8H 2J5WA 1PDKA 4OZ4B 3VB9A 5D7LB 2BNQB 5C3LD 3LNDA 3PHSA 2EE3A 3CZGA 3FUDA 1AS6A 4G3YH 5LWYH 5ACZB 4AGQA 3P4LA 5EUOA 3OZKA 2ADJA 4XOBA 4OI9A 2JH2A 4XPAL 4KJPC 1O7VA 3MV7A 1NIBA 1ZXKA 2W0LA 5D2LA 3J7HA 5B1JA 3EDKA 3WFCH 3IDJA 3GLAA 5FGBA 5H35B 1UOVA 4FFYL 3TO4C 4HWNA 3HZKB 2FNWA 4P9MH 4X9BA 3FDWA 4NFDA 1XGPA 2R2HA 1Z5HA 3MNMA 2OS7A 4L8SA 5L9DL 3QGVA 4HH9A 4OLZH 2XWTB 2A4EA 2B5IB 2ZCLL 3HUJF 4HJ0C 4H13C 3SPGA 1GC1C 4RMTA 5TQ2L 1A2YA 3HZYB 4YHKH 3TIEB 1IGMH 5DURD 3QCUL 4RGND 3SDCC 1GOGA 4UTCA 1DEEB 5E95B 2Y23A 2JK5B 3QG6B 1YNTA 4BK5A 3REVB 4I13B 3F58L 5IG7A 4N3TA 1DVSA 2OCJA 3J8F7 4LLAA 1TOXA 3EO0B 3W5MA 1VADB 3UG5A 3FRPG 5C0BB 2GJ6B 2YPLA 4XMWA 4PJFB 5AB0A 5ANMB 3TWYA 4UM9B 4G7RB 3VH8B 2X38A 4Z8FL 4Z6AT 5KYYB 4AIOA 4RDQG 3V5KB 4HGMA 2DN7A 1JXFA 5IM7B 3GNML 4HK3N 1ANUA 4LSUL 4XP4H 3TPUB 1NICA 3MX0B 4JO1L 3V0IA 2NPLX 4PJIA 3RIFF 4ABUA 4HK0A 1WA1X 1MQKH 4JQVC 1FH5H 3U36A 1PLGL 2O5NA 2Z34A 1OTSD 4I2XE 3BDBA 5AZ2H 1AZUA 2Z91B 1EDYA 4YH6A 1KTLA 1NGXB 1S7XB 4HBCL 3WAJA 2R1YB 3IEAA 3NCYS 5CBEB 5EU4A 3NG5A 4NB7A 3E3QE 3KCWA 1XV8A 1SVCP 5HPMB 1HILA 3E1ZA 3HS0C 4PP1D 2GVYA 5DJCA 5DMGD 1CF8H 5FHAL 3TJHC 5A40E 1LO3L 1YEKH 4YXLH 1DVFA 3AQYA 3D69B 2A6KB 1RPQA 2XWEA 5I71B 1DBMH 1JCKA 2A74C 3ZE0B 2VH5L 4JFTA 2VLLA 3SDYL 1NQBA 1UZ6F 3KYMB 3PXJA 2AAAA 3NIGE 5FF6B 2OCCB 1BYOA 3KHOA 2VGLM 3VNYA 1OGPA 2JV6A 1KCSH 1J8HD 4NO5B 1WCBA 2EIKB 4WEBH 3D4CA 5ICUA 4LNRA 2K3HA 1NAMB 1W2KT 2ICWB 4F8QA 1QFWM 3KPLA 5F6HI 3NBNA 4R4BB 4CVZB 1NC4A 1EAPA 4ZYKB 2NR6A 4WEEA 5EU7E 1KY6A 4YDLB 2BZ7A 1T89A 3TNMA 1TJHL 1A7PH 3KLAA 3RPKA 4RFOL 3FQWA 4XNYH 1Z66A 3GI9H 3VGDA 2WLMA 3BE1L 2ZSWB 1R5WB 1FL3A 1JZ4A 2YSTA 5DK2A 2B9BA 3LZLA 2CCWA 4G6ML 1JGDA 4KJYB 5CD3B 1U91A 1I1AB 3CK0H 3BWZA 4G7YL 4P2OC 5B21A 3WIHH 1E0OB 4W93A 3CSFA 4Z0BL 4ERSL 1TQUA 2LTQB 4KRLB 3BYTA 5KVFH 4BRVA 3PREA 2G3MA 2HH0L 3CFUA 5IR1B 2DJUA 3MRMA 4L2YA 4PJDF 2J6WA 1BBJB 4W9KC 1EA9C 1OCWH 1S7SB 3GQFA 1ADQL 2ENJA 3IXAB 2AJYL 5CJQH 4ELDA 4PWGA 2Q86A 5D7JD 3PAVA 5AVZB 4XNMB 3BWUC 3MBXH 4YAQA 2GT9A 3SKNA 1JI2A 4IBVA 4KTGA 2V5RA 1IM9B 4GQQA 1WICA 1DE4A 1CGTA 1G7QA 2WBWB 3OKLB 1FF5A 4HQQL 5C7XH 3O45A 3HMXL 4Y8AA 4QOKA 5EBGA 5IB5A 2E46A 3FB7B 1KELH 4GUQA 3BP5B 3KYKL 1A6ZB 1NH6A 3UTOA 4DP8X 1NBZB 2Z65C 3FHEA 3ELAT 4U1GB 3B7YA 1R75A 1HSAA 1UM6L 3OAUH 4Y1AA 2ROXA 4KPHL 3KD4A 5GRXG 4Z77B 1JYNA 3JT0A 4OFIA 4BWWA 1N18A 1IB5A 3I2CL 2UZYA 4OF3A 1LP9E 1PVHA 3BPOC 5LN4A 5IB1B 2OMUA 1B3JA 3MV9B 4QY8B 2MPAH 4NUGL 4LOUD 3U0PA 5KSVA 1TLKA 1VHPA 3L4TA 4ZDHA 4B6ZA 4XXCC 4DW2L 4EZMA 4DKFH 1Z2KA 1VEMA 2XQ0A 3VSQA 2RCSL 1J9QA 3QPQD 1T1XA 2AXWA 5BXFB 1RP9A 1L7IH 4DPCX 1KT2B 2CDGA 3EFFB 3WD5L 2UWEB 4Z7OF 2K8QA 2N59A 3GSVB 1AO7A 3QAZC 2Q1EA 1S5HA 5AW7B 5LQBH 3OB8A 3POCA 2ZG2A 4IRSA 5DDHB 4U6XB 1RULH 2C3XA 1L9QA 5IK3B 4WW2C 4JQIH 4WWOA 1ZIBA 4ODXB 3BO8A 4L4TA 1TCRB 2P4AB 2VABA 4TLSA 3C5ZD 4AYID 1N8ZB 2R69H 1M6OA 2HPOA 4X8JA 3LIZA 2IDUA 2QKIC 5HHMD 4TUJB 1NFDF 4R8WL 3I84A 5A16B 4RX4D 1UEYA 3HZMB 3ARUA 4U6VH 4J2XA 3IETA 1OE3A 4JM4H 1U95B 4X5WA 4HJGB 3AWEA 5D2NC 5EN2B 1IC7L 4LVOB 2Z7UA 3KL5A 4GUOA 2CMRL 1C16A 3FRPB 3FFCD 4H8WL 1NMAH 4JE4B 1FBIH 5I6LA 5K9KB 2DDQH 2OMXB 3D2UD 3H55A 4M1DL 4R5VA 1TQBB 1GIGH 3VFWB 5L2KA 1F1DA 4NO3B 1PIFA 2WO4A 4X4XB 3VFRA 1TETH 3GSRA 3PGFL 4RAUA 2HFFA 3SDDC 5ESAA 3OZ9L 4WGVB 5A1AA 1IGFL 5JR1H 4APXB 2F1AA 3JWDH 4YHIA 4ELMA 1CO1A 3GMOA 4W68A 4ZO7A 2VQ4A 3UZEA 4Q4IA 4OLWL 3UGEA 4XN7A 3OL2A 2YEZA 3LKNB 1FNHA 2ZUUA 3QHFL 4R6UA 4F7KA 4XTRC 1HZKA 4WDIB 2Y9RT 4KY2A 5F0MB 2NXZB 5GISL 2OTUB 1J10A 3QBTB 2NDGA 3IPBA 2JQZA 3L9RB 1SBSH 3MO1B 1JVLA 3TFKA 4YHMH 5BZDB 4XVJH 5IVZB 3T0EC 1MWOA 1RFDH 3NQIA 3BWAA 3VXUB 3ZO9A 3RX5A 2V5YA 2E56A 5I1LA 3GSQA 2APSA 1QVOB 1I7RA 4AXWB 25C8L 1TF4A 2X6BA 1DANT 2PUQT 1CLYL 1XZWA 3HB3C 2XVKA 5AW8B 2XKNA 4KOBA 2AV1B 2BS8A 3SB3A 2AJUL 4DIXA 3HN5A 2PWGA 5FXCH 1OAYL 4KRNA 1NCGA 2RR3A 3MV8D 4HKXB 2MCAA 5B38A 1QKZH 3HHRB 4TULL 4BKWA 4K3JH 1Q1JL 2OL3L 4XP5L 4APQC 5F8QC 5L88L 1IJ9A 2NX5D 4HXBL 3HG0A 4OM1H 3TZVA 3MOAL 4UBDC 4MJ4A 3KJ6L 4LLQB 3EW3B 4K9JA 3P30H 1EO8L 3V6FA 4FXKA 1XGUB 2O93L 5ANHA 1TEFA 2I07B 4K7PY 5EUOE 3ARDD 3AUVA 4TNVF 4XVSH 5AVQB 3B6SA 2VXQA 4QHKJ 3RWHB 4BZYA 4Z23A 1SLUA 3MV7E 5D2LE 4N9OB 5F7DB 3IDNA 5GZOA 3ULVH 1FVEB 1ETA1 4D0DB 4JFFA 4JDEA 1UKSA 1C12B 3WIFA 2CM6A 5AYUL 5KVDH 1HCYA 3NFNA 2PCFB 2V17L 3KXFD 4FQXB 4LEXL 4Y4KC 4CNIB 3BP4A 1I1RA 5GS2D 4EI5D 1MLBB 4GP8B 3S35H 5AOIA 4CBZA 3IKKA 3ZE2B 2UXGA 5LCVH 1R0AH 3QNFA 2XCMC 1T83A 1HHJA 3QEQB 3I0TA 4LSQH 1A25A 3UC2A 2H32H 4GUPA 4OLXL 4ORGA 2FJHA 3BJLA 3V4PA 1PLCA 5E8PB 4N25A 4AMWA 1VA9A 5LVEA 3X3GH 4A2DA 3QORB 1CI3M 1P84K 3RKDC 1Z9NA 1RPUA 1QHPA 5ISZB 3KCPB 2B1AH 3CMOL 2YPLE 1NBVH 2ATKB 3RGHA 4DP9X 2E27L 4ZPTB 1YYMH 2GSGB 1AH1A 1A5FH 2BIHA 5BJTB 4QRSB 4ZXBD 3R0MA 2XJLA 1H6EA 3CFIC 3HBZA 2AJVH 4Z95H 1ZT7A 4M3HA 2A77H 2EVJA 1ZT4B 4ONGH 5ITFB 4XBEH 5E00A 1JN6A 1S8DA 4HCRA 2JCCA 3U83A 4PJIE 5FCSH 1T2XA 4JGUA 4HIEB 1Y7VA 3A6OA 5KSUB 1TTUA 1FNGB 3DXAD 3RWGB 4ESKA 1DDHA 4DWHA 1IRAY 5T1MA 3HMWH 3BKML 5CZVH 4MQ7B 2OLDA 1DN2A 2FJFB 1KCUL 2CRIA 4ZD3L 3ZIYA 2QR0A 4O02A 4TSCL 1TZIB 2VLME 4G7VH 4AKOA 3AGWA 4ODWA 2X0UA 5DHDA 1G1KA 1J5IA 2QADC 2UX7A 5CZXC 1GJIA 1NL0H 1N5AA 4GKSB 4LEOA 4MDJA 1C7TA 5FYKU 1T22A 4W6WB 4AEFA 3DVNB 4EI6A 3GZPA 3MREA 4OGYL 3ERXA 3MJ7B 1W80A 3M45A 2YQGA 2Q9OA 2FB4H 3M7OA 2E4FA 3BGMB 4FFZA 1T20A 2GBTA 1FLRH 3VU1A 4BK8A 2J21A 4N90D 4ETQA 1A47A 3FOLB 3O3EB 3QJUB 4GI8A 2WINA 1A1NB 2FHCA 3V8OA 2GSMB 1D2PA 4JGJA 1WS8A 2HLFD 4OCYH 4D8PB 2IGFH 3HFMH 3VVVA 1Y6KR 1P5UB 3NCJL 4PRHA 2BNRA 1TU2B 3OC5A 4KXAA 1BZ7B 1AZZC 3G6DH 3VDAA 2EEBA 4GBXC 3O41A 3QDAA 2ESVD 3HJEA 3JWNC 2VMJA 4I9WD 2FWOA 3DETC 3WY1A 1QBBA 3AT9A 1Q8MA 1AG6A 1MZZA 3DIFB 3EDJA 4K5MA 2ITCB 4N1CA 1TTBA 2Z93B 2WLJA 1U8PA 3O6ML 4HFWA 3RGVB 1ES0A 1E28A 5J12B 5TE4L 2QGDA 2J1KA 4TL5A 3VFUA 1LMKA 2N1TE 3LAFA 3D1MC 1IBGL 2DPKA 3O8XC 4NRZB 1U8OB 4OGXL 3KLQA 3EFDL 4LAJH 2UZIH 2HG0A 3N50A 3OGCB 4P46A 4HMCA 3WNOA 4OF6A 2J4WL 3VXPB 4JL1A 1NIAA 4OQTH 1MLCB 1E4WH 2CIKB 4ANKA 3C9NB 2LT9A 3KPRA 4MCMA 4NYLA 1KLGA 4QRPD 4MDIA 3WV0A 4OBSA 4NXSA 3A47A 3D09A 5F6IB 1AGDB 4DUXA 2YN3A 2DQCL 4L1SA 1YEHL 4BSJA 3CUPA 1YEJH 4FCHA 5EN3A 4TOYL 3FPXA 1JRHI 1UT9A 1CR9L 4H40A 4XPAH 3WY3A 1QATA 2YKLL 1MHEA 1R5VA 3PHOB 5DQ9A 4X4ZA 4XHJC 2I9TB 3VI4B 4FFYH 1FNLA 4AQ1C 1QA9A 2IDSA 1XSKA 2WBJC 3IU3B 4J5VA 1AGEA 1DHKA 1FYHB 1G7PA 2AK4A 1DBKH 3OQRA 4UQIM 4OLYL 2CDFA 2MKWA 3TX4A 1KLUB 2KQMA 2Q7YB 3A4EA 3BCFA 5KVMC 4AM0Q 3AVEA 3B9KC 5TQ2H 1MJJB 4Y1AE 1IAMA 1NGZB 3CLWA 5FW6A 3DV4B 4CC1A 5KSAA 2BX5A 5C71A 2FZ3B 2BVTA 4TUKL 3LQAL 3JBG7 1KJ2L 3K1DA 3B9EA 3TTSA 3P0YH 5ECGA 3F58H 1MKFA 2G2RB 3X3FL 1MCJA 3ENEA 4ZPVB 1WO2A 1LGVA 5CILL 4NZUH 3NVQA 3QQ4B 5E24E 4PLNC 1D5RA 1FV1B 4Z8FH 2R59A 1T0MB 4IEFA 4X98A 5HGBB 4KX9A 1M2VA 4MS8A 3TA3B 4JPSA 4KXZH 3GNMH 1AO7E 4LSUH 3RWIB 4JO1H 4LESA 5E8DL 4FTDA 2VIRA 1A1OB 5DJYA 5MI0B 2ZAIA 1ZK9A 2WPGA 3HPLA 1ZLSH 3EGXB 1E7UA 3Q6FB 5K9OB 4NN7C 1ZLWK 3BZEA 1IQWH 3NP3A 4L4TE 1TSHA 3ZMRA 3KM2A 5B1AB 4LIQL 5C09A 5GS0C 1PG7W 4M4RB 2P5PA 3SSGA 4OCSL 1GSKA 5FGCB 4UNVA 4PJAB 1E9PB 1F3JB 5CJXC 5HDBB 4K7FA 3TLRA 5IOPB 2LGNA 1U30A 5F1IA 4TQ8A 4L18A 2V8MA 4N8VA 3D08A 4LFHD 4P23C 3US9A 3JTSA 3L81A 5FHAH 2YGOA 3A22A 1YMMB 4RESB 1JZHA 3SKMB 1IX2A 1RJCA 3NJLA 2VH5H 5GGVH 1BF8A 1CXIA 4PLKC 4WGWB 4NNYA 4XPTL 5DLMH 5F7HA 4YQXH 1SUJA 2IG2L 3OHMB 1PZ3A 5E9DD 3BVNB 1T0OA 2KZWA 4BEIA 2RHEA 4ZMNA 5L2KE 3HR5B 4YNYB 3TN0D 4B53A 4PRDA 4BM7A 1XIWC 3VFNA 4CBPA 4WK2B 4G7QB 4OGQC 3FFDA 4ELME 2NZIA 3QO1B 1E2VA 4ODBD 3ATDA 4PJEE 3UZVB 1A3RL 2EXYC 1BMZA 1NCJA 2VERN 1S9WA 3DHUA 3EBGA 5CJ5A 5I0XA 2FX7L 1TJHH 5F7LB 4LLDA 3B56A 5FHBL 3PHAA 1FI8C 4R4FL 1MELA 3BE1H 4AYFB 1T0PB 1MFAL 3JV4B 4YFDB 3L1FA 4OIIL 4ZUVB 1Z32X 5ICXB 3BKJL 3CCHB 1N6QH 5FX3A 1PD6A 3P4OB 4G7YH 4PD4K 3E8VA 1RZQA 3BP7B 4ERSH 1A7RL 4XXDA 1IZKA 1U58A 2DS4A 5IUSA 3BZ5A 3PDGA 3TEXA 3WDIA 4F9PA 4NZRH 5BRZB 3CTTA 4PGEB 1C5DB 4U1MB 3D0VA 3C8KA 4IQHA 5FGRA 4ENZA 2V7HA 5DO8A 3N85H 1UXLA 1XCQA 3MMEA 5DJ2B 3QK0A 4PWJA 2EE0A 2F53A 4V33A 5LGKA 3NCFB 1U8JB 3EZ8A 2CAKA 3KPPB 1IEAB 1R5IB 3QDJD 2XHNA 3PL6D 2OMWB 4N8CL 2IDFA 2H32B 1NWPA 3W2DL 3NIGF 4NO0D 4TSAL 1WPCA 4ZFOB 4GI9A 4RISL 4Z7WA 1ZLDA 2A3TA 1MH5B 3HMXH 5IREA 4A67A 1UH4A 3NFPA 4IRZA 1X5HA 3PGDA 1IEBA 3ABMB 1KC5L 3KYKH 1MAJA 4IHBA 3OGOE 4YPGB 3KGSA 2F58L 4KBPA 5BV7H 3N9GH 4MBRA 4LKCB 4DGYL 2OM5A 1QSEB 4JFFE 2NUTB 4TSBL 4XB3A 5EZJA 3X13B 3N40P 2EDDA 2FIRT 1RUML 4ZUTB 3B8YA 3T8XB 4KPHH 4EAEA 2DWTA 3IDYB 4IDLA 3EH4B 1DSFL 1COBA 2Q0ZX 3I2CH 3L3OB 2WSPA 4P2QD 1I1FB 1T0NA 4MLIA 3MUZ1 4QRAA 4NUGH 5I19H 3T4AC 4JQVA 5JXEC 4KQ3L 4JS7A 2NLJB 1EV2E 2G30A 1T5XB 3MLWL 4N86A 3ZTNH 1A64A 2QVTA 1YO4A 2VLKB 3IDGB 5AAWC 1OW0A 4Q6IC 2DLTA 4TPRH 2ZYSA 4GFXA 4LVNC 2A9MH 5DC4B 5DEFA 1HL4A 5DHEA 5KYWB 3MNVA 1T7ZA 2IAMA 3APDA 4LHUA 1U33A 4HGWA 1RLBA 1AQKL 3OZLA 3QW9A 1MJ7L 2FO4B 4N1HB 1H15A 5FUCE 1E9OB 3IDXL 4QMEA 2AW2A 4ZSOE 5BPPA 2J73A 1CGWA 1JXJA 4FNPA 3MPCA 3P2TA 3RVUC 5KBDA 1D6VL 1BDYA 3CFEA 5FDWB 2PPAA 4PJ7A 1SDAB 2ICEB 2J20A 3U2JA 2YO3A 4OM0L 5CM1A 1F3DJ 4KKCC 4RWYL 4FQLH 4KJQC 2XWZA 2R2EA 3QXWA 1X44A 2M2DA 4NQED 4BFIA 5D6CA 3QYMA 1T7XA 4EXKA 1U8NB 4EOWL 1RZKC 4X4YA 1IC7H 4YBLC 3GPEA 3IXTB 1GS7A 2B2XH 2CMRH 1CD9B 4H8WH 4G70B 4A37A 5C07A 3NABL 4M1DH 1GYVA 1PBYA 4ZX3A 1U8KB 4DPBX 4M62L 4UOQA 1A6WL 4JG0L 2G4GA 2JLPA 4N0FA 2N3JA 4PR5A 1XF3B 1ZHLB 2WLKA 4GMSL 4H88H 3UTTD 1UXWB 1QFOA 3PXHA 1IGFH 1IFRA 5D8JL 3WFDH 2QSVA 2QPSA 3IVKB 3WYRA 1I3RA 4A7UA 4OLWH 3S8WA 1ZVSB 5ESVB 1KTKE 3CQPA 1FZJB 3GB7B 4M02A 3BVUA 1U3HB 5I74B 1QEWB 1E4JA 2EIBA 3TPKA 3VGBA 3WN5C 1MNNA 2DYSB 4PRHE 5GISH 2BNRE 2VZUA 3BUBA 1K8DB 1LEGA 1D5ZB 4PH8A 3WEAA 3SQBB 2B08A 2IALA 3MBEB 3GIZH 2DMCA 4HUWB 2VXUH 4Y16A 2WVSA 2V5TA 4DK5A 2D7MA 4NCC2 5HDOA 5TH2B 3IJHB 5MEOB 2EIEA 4QJ3B 1PAMA 4N85A 3FFOA 3MRCB 1A9EB 2WQSA 5IJKC 3WJLA 2Y1VA 4FD0A 1DLHA 1D6EA 1K8IB 2CH8A 3RIAK 3VNZA 3D05A 3PIQB 1AXIB 2MOQA 4BIKA 2EH8L 1OAYH 1ITBB 3JWOH 3GKWL 4S0HA 2LLLA 4TULH 2A6IB 1HZLA 1Q1JH 3NACL 4F33A 4XP5H 4KO9A 3O3BA 2EACA 4IKKA 4NC2B 3AG4B 5L88H 5PCYA 5DRZB 3SCMB 3GK8L 2CHXA 3I6GB 4GS7B 3BQUA 1T7VA 3KPRE 1P6AB 1WISA 5EC1A 1OAXH 3UXFA 3MOAH 4MGXA 4TNFA 4Y4HD 1QYGL 4YX2H 3LIUA 4G6JL 4ZOCA 2Z64C 4OZGB 5EF1A 4UUJA 2WXPA 5LHDA 1GH7A 3DX3A 5I1JL 2E7HA 4JFOB 2GTWA 1G6VK 4GO6B 4Q89A 4DCQB 2NW3B 2D31A 5HJDA 1BF2A 1AGBA 5J6SA 5EEZA 1URLA 3FU0A 2ICES 5K69A 2WTPA 2G3XA 4IS6B 2AK4E 4W70A 3WLBB 1VENA 5AYUH 3WO4C 5L4JA 5HDQH 3MRJB 1F00I 2V17H 4V2BA 3KPTA 2P80A 4IIZA 1R6VA 4NNXA 5F9AC 4KY1L 4N24A 4K5LA 4TQHA 2DF3A 2HA1A 4KOCA 1UCTA 4A2LA 2DWEB 4Z5RB 4QRBA 3EH1A 3Q2CA 2ZCKH 4PRNB 3GMNB 1V7ML 2NZ1A 3O9WA 2ED6A 4WO0A 4HUKB 1JF1A 1M7DB 3K4DA 3WI9A 5KSBA 1NFKA 4DPRA 4MMZC 4FTVA 1PZSA 4Q0XH 3AG1B 3MLRL 5DYOA 1PNDA 1WCQA 2CDEB 2WQWA 4AEHL 5H4ZA 3QCTL 4UTAA 2E9JA 2N1KA 5FO9A 1KEMH 3U46B 4DP2X 5C70A 3MXVL 5CIPH 1AR2A 3BEWA 1FIGL 3BJ91 1B0RB 2DQMA 3QUYD 5I26A 2PW2B 4MX7B 1N70A 1MREL 2BJMH 2D3JA 4FJZA 4AYSA 2YRLA 2L7QA 3VE0A 3O6KH 3Q06A 4JFZL 1CIUA 1P7QB 2OJEA 3AREC 3LSOA 2ZWNA 3FTGB 5DQDH 1CFSB 3KPQB 4NKDA 2X4QA 3AFLA 5MERA 3VACA 3BGFB 3NPSC 3VG9B 2DRUA 3CH8A 5GS1A 5I6PA 1T1YB 1JHTB 1BG1A 2J55A 1SOKA 1V55B 5E6YA 1NEUA 3LN4A 5C09E 3S37L 1FPTL 4MVBA 2GCYA 2QMKA 4HPHA 2AJZB 5EUOF 3SHSA 2Z8WC 4AQAB 4ZD3H 4ZMWA 3APFA 4TSCH 3ARYA 4Z78A 3ULUF 1AKPA 3LHPH 5D2LF 1DQLL 1CXLA 3S96A 1JD9A 1R33A 4ALAL 1OSPH 2DTSA 1G4MA 2CCLA 2EC9U 5DVKA 3RTQA 5DWUL 3DC0A 2CWRA 2X9XA 4I77H 3G6AA 3AXHA 1J11A 4X50A 1B0WA 3EJYD 4IIQA 4HF5L 2DWDA 2QZ5A 4LP5A 3EJZC 4XNXH 4ATWA 1DVZA 5I1AB 5K9QG 2HP4A 1H3UA 2F7IA 2K6WA 3ABGA 5AD0B 1YNTF 3DPBB 1E40A 4ZMZA 3BN3B 3R4RA 3U4EA 2R7EB 3OR6B 1CGSL 3SBWA 3GO1H 4BUGA 2Y1YA 3NCJH 3FJTA 1UJ3B 5BW7A 2HVJA 4Y7OC 2JI2A 1QZ1A 4JG1L 1BX2A 2WXLA 3AAZB 5E0QA 3EJCA 3GI8L 3QA3B 5ICYA 1E5CA 1W9XA 4PQXA 4YBQD 3MGTB 1CK0L 4O51A 3TCLB 4K8RC 2FBOJ 3EBIA 1ETJA 4NN5C 1FP5A 2ZP8A 4XNZB 3O6MH 2VMCA 3MR9A 4AW4A 5EU6A 2OYMA 1BOGB 1FZMB 3GMRA 4PJIF 4Y9EA 4AMKH 1XGQA 2AEPH 2ICCA 1I3GH 1F6LL 4OGAC 4OF7A 5HYSA 3W38A 1QTSA 1IBGH 3UC0L 5BV7B 3ES6A 2GITA 4U6TA 1JFMA 2UX6A 4G9FA 1AQHA 2NCEA 3CAFA 3EZJB 3MRKB 4HS8L 1BW8A 3GSOA 5AW2B 5K39A 3TVMD 4X7TA 1NC2A 4NOBA 3HE7A 5JPNC 3QUXA 2ODIA 4HPYL 1YNLL 2QPFA 4A1RA 1S9KC 5EZLA 4DN4L 2F53E 4UM8A 3CZFA 3LKQA 3S88L 5G55A 4JVWA 5CJBA 4WFFE 3CC5A 2ZXDA 1NBCA 5FOBA 2C9UA 1ZGLP 1UB5B 2CGRL 3IB4A 1XF2A 4YHOL 1WUNT 5EOCJ 3L5IA 1VCAA 1IGJB 4LHQB 2YKLH 4N20A 4DP5X 3BAYA 4Z7WE 1HINL 5GGTL 5E70A 3B2MA 3O3DB 1UT1A 5C08A 4WWKD 4HKZA 2VMEA 3F7KA 1LQBC 1AS7A 4AVHA 4KKAD 4D0BB 1HXYA 4HIIA 1F90L 2ZX8A 4ZW8A 3WJJA 1XH3A 2WQXA 5DO2D 1SYVA 5IROD 3PHQA 3MLSH 2D7OA 3IMVA 3V5HA 4P07A 1SMAA 3VFOB 1KYUA 4TUKH 1BZQK 2XWCA 3LQAH 3ZKND 2EO7A 3DX1A 1DQML 1KJ2H 3DV6A 3DGCR 2HB0A 3QWNA 2Q76A 4R90L 3DA0A 4BXSV 4LGPB 1OF0A 1HQ4B 1TKWA 2DLEA 2BSSA 3S3BB 5CILH 1BQHA 4TUUA 5GXBB 2AI0H 1YN7A 4NUQA 1DQDL 1NJ9B 1TJXA 2NY1B 3T65A 3SGJC 1B88A 4LCCB 1GS8A 4PYHA 2C3WA 3K4AA 1XMEB 1GGIH 1BGXL 2LU7A 4BFNA 4AZ8A 3DX4A 4O58L 3ILDA 5BOPA 5E8DH 1J0HA 1J9RA 1NCNA 5MEQA 4XBGA 3B43A 4I7ZC 5EIQA 1QR1B 4YHLL 5JOPE 4BELD 1D9KC 3WNMA 2OMTA 4QDGA 3PP4L 4WLCA 3IDUA 3FO9B 1N8OE 2G0KA 4X83A 1MFDL 4PMFA 2YUWA 4XI5D 3L4UA 2OYKA 4OCSH 5JYLA 4S2SA 1H3TA 4P5TD 4EBQH 3VI3A 5B7MA 1HEJC 4HUMB 4AGNA 1NIDA 1UWXK 1MJ8L 3FFCB 4KKLC 4JK0D 3V6ZB 1Q38A 3M8OL 2DM3A 4PBWD 5C0CA 1T5WB 4LLWA 3V5DA 5D6DC 1OM3L 4DP1X 3P3SA 4HETA 4UAHA 3G5ZB 4WIQA 1A7OL 1BZ9A 2Q8BL 4G42A 4O2FB 2ITFA 4JFXB 5C07E 3WKPA 2IG2H 3CZLA 1H9DA 1ZOXA 4JZJA 3V0VA 3U2IA 2DOCA 2PXYB 1KNOB 5SWZA 4XPFH 5JDSB 3EKCA 2XWTA 1FNEB 3CZSA 1SMDA 5C97A 2WXKA 3IMSA 4AGMA 4CSPA 2PTTB 3UGXA 4KHTL 2OV0A 4FQHA 3S4SB 1CLZL 2ZOUA 1P6FA 3S3CB 2VLJA 3LRKA 3X1NA 1HI6B 2VSMB 5H94B 5TDPB 2JK5A 5HVHC 2WLIB 3U6RA 1SN0A 2VUKA 3REVA 3T3PE 1CXKA 3ULUD 4Q97A 2MFNA 2FX7H 3SY0A 3MV7D 4ECNA 4DFIA 5FHBH 3LXCA 3RWFB 4PV9B 5I1KL 2AV7A 2HLEB 1S6NA 5C0BA 2GJ6A 4JO3L 2LLGA 1Y6MR 3UOAB 1MFAH 4OIIH 3BKJH 4UM9A 3GSNA 3VXSA 1H3WM 3GZOA 4WRLA 2NNCA 4CILA 2SEBA 5DU7A 3V5KA 4KKQA 4OSUL 5IHHA 4AG4H 2MIZA 3P77A 4X7CC 3MX0A 2B8OT 1NMBL 3BKCL 2Y3NA 3VA2C 1XGYH 5JA9A 4F5CA 1QLFA 4YHPB 1MI5A 4F7MB 1AD0A 3H4HA 5FYLE 4QT5A 2Z91A 4K23H 1NGXA 1HQRB 3SKJH 3FRUA 3CFTA 4BUQA 2R1YA 2VO5A 1LEKB 5CBEA 3IFOB 2YPLD 1AFVL 5D1XA 3B1TA 4HGKC 4HPOH 5ILTL 3HC4L 4JKNA 3W2DH 5INCB 1KJMA 4TSAH 4UZSA 5CWSB 1YMHB 1MWAA 4BZ2A 4BKLB 5EBMA 3WE1A 1TJGH 3FHQA 5CIPB 4N0YL 1MCOL 3C6SA 3FC8A 1R3LB 5DFTA 4KMTL 3F12A 1S7WA 2WQUA 2WUBL 3KXFB 3M88A 4XC3L 5IB3B 2F58H 3MCKA 4ELMF 3D0AA 3MRFB 5DMIL 4OV5B 4DGYH 3RFZC 1A3ZA 1U2CA 2JIXB 4PJEF 4TSBH 5LAXB 5CO1A 3NAAL 3D5OF 2VLMD 4LFHG 2ICWA 2O26U 3DK0A 3VX1A 4JHVA 5BVPL 1XAUA 3LN9A 3MDJA 2ENQA 5GIRA 4ZYKA 1MXGA 1DVFD 2DQTL 2B4CL 1JPSL 2H1XA 4TNGA 3EYQC 4J3SA 5CCJA 3CPLA 3MLWH 1RHHB 2W81C 4PJ9C 5F9WC 5KSBE 4F37F 2DBJA 4FTVE 3CZUB 3D85B 1P4IL 1R5WA 2ZSWA 4XCYB 3P4NA 1HN1A 3ETSA 3AY4C 4KJYA 4NHCH 4ZXBB 2X05A 2YPVH 1K3ZA 3KVPA 1CPUA 5AVYB 5TE6L 4AENA 5CJXA 3K8MA 1CICC 1EBAA 2IPKA 3AUWB 4WHTB 2Z4TA 3E2HB 3LYRA 2CO4A 3GMLA 4BCXA 1FE8H 4DKDC 4M5ZL 4LEEA 1T04B 1M05A 5CEZE 5HHVH 1MJ7H 4DGIL 1G1OA 1I3UA 2L3BA 4O2EB 1CDYA 4LL1A 5IR1A 3IDXH 2E7MA 2P24B 1WG3A 3K80A 2Y07H 4TVPE 4K3DL 1NA8A 4NKOB 3OMIB 1O7DE 2QTEA 3NZ8A 4FLOA 1S7SA 2NR6D 4J1UB 3FONA 1AMXA 3IXAA 2D4FA 3TBTA 3ZZ1A 5JTWA 4L0YA 3SEPA 5EEVA 3GLZA 3V0JA 3HEIB 1N10A 4OM0H 1IL1B 4R7NA 3DMMC 2OTWA 3ZHKA 5I15L 4E9SA 1XIWA 4RWYH 1IM9A 3S48A 2D8KA 1A3QA 1INEH 4DHLA 5AG9A 1WTLA 5G2NA 3MLVL 3WDHA 3OKLA 4N4YB 4EOWH 1D5BB 3U30C 5B1BB 3TH3T 3D3VA 3FB7A 1GAFL 4PTTA 4MXQA 1QFWI 1YQVL 2XWBB 4L29B 2EDOA 3MACL 3NABH 1ZY9A 5F9JA 1OXYA 4E9YA 4FAAB 4M62H 4YDMA 1A6WH 4ELKB 3SYAA 4AT6A 1NBZA 2HT2C 2VRQA 4AL8H 3OXSB 3VWJC 5JIKA 1RUPL 5JW3L 4CVXA 4GMSH 3DROB 2WUCL 1NFDB 4TMPA 2MQ0A 1ZA3A 3AY2A 4EVNB 4DKTA 5L6YL 3TO2B 5HBBA 1EEZA 2KS0A 4AM0A 4DPAX 2ZG1A 3JVGA 4AUYA 3BHBB 2BNUA 3L7EB 1CU4L 2ESVB 5E6RB 5IB1A 3LZPA 2PYEB 4JHAL 4PFEA 4QY8A 2YZ8A 3BQVA 5KBMA 1ZGLA 4X42A 5JOEA 4Y2NA 1OAZL 3TBYB 5F7NC 1RIVL 2WK2A 5ICZB 1N26A 3QXDB 4P0DA 5KUMA 5IW1B 4JFWA 5EOCL 2F18A 5BXFA 1I9EA 1XGTA 1A4JB 4XNBA 4Z3HA 2ERJC 3QXVA 1TJMA 1M7IA 2YBGA 3GSVA 5IWLA 4FKEA 5AWNH 4Y1AD 1M71B 5E08L 5EU6E 4ONHB 3MLTA 3QQ9D 4RETB 3R0NA 5DDHA 2FK9A 2G4EA 5IK3A 3W57A 3EUUA 3FCSB 4ODXA 3SYOA 2EH8H 4G9FE 2VISB 2FJGA 3GKWH 4MJID 4NQCA 3AS0A 3QJSB 3S2AA 2ZXCA 4PLJC 5TF1L 2I7SA 3NACH 1FLTX 5DJAB 3K6SB 3SJVB 3GK8H 1KJ2B 4KMLB 5IHLB 4HJGA 4AYGA 1DQKA 4PRAB 3DHJA 1H8NA 2WLNA 2C26A 3KHQA 4IDJH 3ULAB 4G6JH 4CADA 1SXSA 2HLAB 1AE6L 3LZRA 1UA6L 4M1GL 4XRCA 3VG0L 1VACA 4H4NA 1ZTXE 2DBLL 3GFUA 3MAWA 4M7JL 3ZHFA 1EFXA 4AIXA 3K2MC 2EP6A 4JZNB 3UTQB 2VDQL 4L4TD 1FN4A 2B3IA 3ZHDA 2R0LH 5C08E 3FO0H 1KEGL 4KNUA 4IBLT 5EU5A 5KOVC 2CO7B 5CCKH 3S34L 4E5XG 3ZGIA 4APXA 1RD6A 4RLDA 3SE4A 3WENA 4ZFZB 4MB3A 5I9QC 4JM2C 4FEMA 2EDYA 4KY1H 2YHGA 1PY9A 4FHBD 1H6FA 5AAMC 1XF5B 2KYIA 4IHOB 2XFXA 3EHBB 2IA1A 1KDJA 1PCXA 1V7MH 4IOIA 5T1LB 4QHPA 4B9FA 3MLRH 4MHHI 12E8L 4YL9A 3II2A 1LO2L 4AEHH 2J3SA 1GYAA 4J3OF 5BZDA 2A2QT 5L2KD 4HMEA 3MXVH 4M7KL 3U7YL 1I4FB 3VXUA 4N5EC 2VNCA 3LIZL 4B9IA 3IDMB 3S36L 2EDKA 4UIMA 3IGLA 1QVOA 3TXAA 1PNCA 2N4IA 1MREH 2FGZA 3PLYA 1PD0A 4E42A 4FHJA 4N2MA 5HI5C 1CCZA 2NZ9C 2QDWA 3QJVB 3CDFA 3N44F 5I75C 4XPGL 3UFIA 2BVYA 4RZCB 1UZ8A 4PPTA 2ZUXA 4ODSL 5DEJA 4ZO8A 4HBQA 1EZUA 2AQNA 2NY3B 4EZLA 2DAVA 5D72L 3UO1L 3TFKD 4DOHE 1HCZA 3NJFA 3S37H 4EI0A 1FPTH 2YEVB 4DQAA 3VI3E 2F19L 5IZ7A 4LLQA 2WLLA 4E41B 3CVHA 3WMQA 3L8QA 4RRPG 2NT1A 5C0CE 2I07A 3RIFK 2BWDA 3ZKXC 3K3QA 4S0UC 4HIHB 1G0YR 4HF5H 5GZNA 2ZOLB 2YD1A 3BZFA 1JGEB 1KGUA 4L3CA 1P7BA 4FQXA 3SODB 3EF4A 4IU3B 5IB2B 1WHPA 4FP8H 4DN3L 1Z9PA 4HIXH 2CHZA 1EAOA 3IS0X 3TZVD 5LNDA 4JPVH 1CGSH 1QI4A 4KUZH 2BS71 4MFHA 4QXTB 3WJMA 1SEBB 2VLJE 4KZDL 1BAWA 1KLFB 4FQ1L 4KXZI 2R23A 3O2WH 2I69A 4GMTL 5TTRA 1C5CL 2GKIA 1KYOJ 3GI8H 2F8OA 5E8PA 3RPIA 1ILSA 4GG8A 5GZOD 5CBAB 4PUBL 5ID0B 4JFFD 2P9RA 5ISZA 5C0BE 3U9WA 2GJ6E 5I76A 1TPXB 2ATKA 4KTEL 3RP1A 2IJ0C 4P06A 2GSGA 4PJFE 5F7YC 4R5XA 4Z1PA 4IJ3C 3VXSE 4PG9B 5EUKA 4Q74A 2XZAL 1BEXA 1OM9A 3RUGB 1FZKA 1N0XL 3X1EA 1G7JB 1G1CA 4S10A 3RU8L 1OE1A 2IDQA 4RNRB 3QULB 2Z92A 4OFYD 3SDXB 1FSKC 3QZMA 2FUTA 3BP6B 3TTYA 3GSUA 4HS8H 6PCYA 4HIEA 4KTYA 4F5CE 1M4KA 2XN9A 3QDJB 4GW5A 4UYPA 2XVGA 3PL6B 4R84A 4X8CA 5DHMC 1MI5E 3RWGA 1SF5A 2VW4A 2VXQL 3B2UD 4HPYH 3NEEA 1GA2A 4DN4H 1Q9LA 3RVWC 1W8EA 2FJFA 4ZAKB 5I8KL 3MFFB 2Z31B 1NEPA 1TZIA 4GSXA 1Q90A 1P69B 5D1XE 2XU9A 4UI2A 2WCGA 2AQSA 2OR9L 3K6DA 1OVZA 4ZFFB 2ZJSL 3HAEA 4GKSA 2XYCA 4PJ5B 3SD5A 3UX9B 1C5BL 5T5NG 3DVNA 3O81A 5AW6B 1HINH 1OZTG 5IQ9B 2EDWA 3WIHA 4NQVB 1ZVYA 3BGMA 1B9KA 3FB5B 4C83B 3V4PL 3K71B 3QB7C 1LQVA 4MMXB 4P2QB 3O3EA 4NQSB 4QYAA 3CFMA 1A1NA 3DO4A 2G9KA 4JDTL 4YDKH 1A6PA 1MJUH 1S7TB 3ZDXB 2DLHA 3HLKA 4BE6A 1P5UA 4KQ4L 1I7TB 5HYQA 3U9UA 1F3DH 3MRIB 4KVCL 5D1ZB 4ODTL 1DQMH 1CLVA 1U6AL 4RGMC 4OGAD 2VDPL 4RIRB 1AOHA 3QXAA 3SQRA 4OUOA 4BGLA 4HCRL 1VDGA 3C8DA 1T1ZB 2BK8A 1VSCA 1ZV5A 5BRQA 3OKEB 4JLRB 4C4BA 1DQDH 3WO3B 1CFNA 4NKMA 4JN2B 3GHEL 1EJ6A 2YXVA 4W4OA 1P4BL 3TV8A 5HYIA 1F4WL 4S1SL 3MHZA 4PJBA 4CN6A 4O02L 4HU8A 1OO2A 1KXHA 2L4OA 4UCFA 3QFDA 4NRZA 5HP5A 1MHPL 3BPLB 3MCLH 3QRBA 1GPOL 4ODUA 4D8OA 4H20H 4E5XB 4H8PA 3OGCA 1RH8A 3ATAA 3K6OA 3FL7A 3ME0A 5JO5A 1MFDH 5FFOA 2CIKA 2IGLA 1CLOH 4XN8A 4XN9A 3C9NA 3RVXC 5BMFL 1SHXA 4FFZL 3UAJC 1Y6NR 3G5VB 3HI1A 1BVLB 2I7OA 5E1QA 1MJ8H 1IC5L 1L3NA 4Z7WF 3W5NA 1P5VA 4J3OD 1E90A 2NRDA 3B3IA 3M8OH 4W9LC 3S5LG 4XCNB 3SPIA 2YD5A 2XRAH 2GFBA 1CIDA 3HE6C 4FS0A 1OM3H 3UZQA 3RB7A 3LRLA 4MQTB 2ZG3A 1KBGL 3FQUB 3ABZA 1A7OH 1P2CB 2I9TA 1PS3A 3VI4A 2NSXA 4RFEA 3UEQA 1JDCA 1HKLH 1MRCH 4YHZL 1QNZL 3W11D 1U93A 4KRPD 3VRJB 3EJQA 1JXGA 2JNZA 2OJZH 2XTJC 3FSOA 4FCAA 4XPBL 5DCCA 3RAJH 4DKEH 1NGZA 4LBAA 1CLZH 2FZ3A 2X0WA 1JIBA 2VRAA 3NCMA 3V6BR 3HW7A 3L3KA 3CPUA 2C3VB 2H47C 5C0JB 4JFYB 2AP2A 5CINH 2JQAA 3RQ3A 4CC4C 2FT8A 3W9EB 2G2RA 3BUDA 3NQKA 4EZKA 5I1KH 5EOQL 4YSPA 1GGUA 1XXDC 4QF1B 3P11L 4GSDH 4PHZA 1K5NB 2AK4D 2O6PA 2TSBA 4YHNA 1HL8A 2VZ3A 5CSZB 4WJ5B 1ODAA 2D03L 3W0WA 1PG7L 1UASA 3BISA 1HZHL 2BO0A 4NX0A 2B77A 4OSUH 4X6CB 3LNGA 4HUNB 3G5WA 4I0PD 1Y18B 2LQRA 5IMLA 4U7SA 2ZPKL 1NMBH 3BKCH 5KSAD 3TGXA 4X5QA 4MWFA 1L6XA 2FIKB 1TTCA 3NDYE 1JWUA 1KB3A 1U8QA 3ARFC 1PY4A 3EGXA 1CGXA 4P59L 3THML 1A9BB 1THCA 3AC0A 4DK3A 2ZUQB 2B5IC 1YUHB 4NQCE 4Q9BA 1AFVH 4EDXA 5F3BB 4ZO6A 5C0FB 1BJMA 3JYBA 1OD7A 2F7OA 2NSQA 5ILTH 4WO4D 1YMMA 2WXGA 3HC4H 4GAYA 5I1HL 4I2XB 1YJDC 4MS8D 4XBMA 4PGZA 5EA0H 5FKPA 1OWWA 2G3ZA 2CJUL 2XACC 1MCOH 1F3RB 1QTYT 4R2GB 1DJSA 5GS3A 2WUBH 4XC3H 2AJSL 3MLZL 1OE2A 3WL9B 1KWGA 3HR5A 5DMIH 3ZPDA 3BN9C 1S78D 4Y5XC 2C1PA 3D0LB 5C09D 2WTOA 1NLBH 3MUY1 1P7KA 4P49A 3T3PF 3RDTC 2IFFH 5H37G 2DMGA 2BP5M 1ND0B 1BEYH 3FF8A 1BZDA 1XEDA 1OTTC 1UGKA 3NIGB 3AM8A 2O61A 5HD8D 3UZVA 5AOMA 4XOCA 2JB6A 2WTRB 2YLKA 4TNVK 1JPSH 2G0LA 3E6HA 4TV3A 4Y4FC 5DFVC 5F1OB 2VZSA 3Q9QA 4X7EC 3DX9B 3F62A 1HNGA 2CHDA 1SNRA 3IF1B 3ZKMC 4AGLA 4JM0A 3ZQWA 4AYFA 3QUYB 2OMBA 1IT9L 3CVDA 3RZCC 3MLYL 5ICXA 1U3YA 1W6WA 4XP6L 3WOVA 5TE6H 2WW8A 2CKNA 4F57L 1U0QA 1PX4A 3BPNB 2QQLL 2GUYA 3BP7A 1SPDA 3VXUE 3LZNA 5I71C 2W0FA 3CFKB 2WBKA 3QQDB 1XF1A 4DGIH 4I87A 4NC1E 2VUOA 2VMDA 4HJTA 2DYRB 4J6RL 4W6YB 3FZUC 4K3DH 5SX4H 1AACA 3VXQB 2ADIB 3LEXA 4PGEA 4FG0A 1C5DA 4N2IA 3E0GA 2X4RA 4KVNL 5FA3A 1T1WB 1URZA 5DJ2A 2B14A 3VRLE 1E2ZA 1PZ2A 1G5GA 1X5GA 5FGSA 1NMCC 4NJAL 4P2AA 5EOTB 1R5IA 1SXCA 4FA7B 1IKNC 5IB4B 1HT6A 3NH7L 3FQXB 2CXKA 4FG6D 4P8QA 3U7WH 1F0LA 2EXTA 3MA9L 5MENA 3UDWA 5K9QI 1QPXA 3R1GL 3VYNA 4ZFOA 3US1A 3PWNB 3CNKA 1OB0A 4GRLB 3C8HA 4UMGA 3ZQXA 1SJHA 1SHMA 4IGBC 5DJ6B 4NDMA 4YEEA 4JR9L 3TC9A 3OHXB 4FJYA 4C56A 3UL4A 3H2WA 4L48A 3TEUA 3QIWB 2VTFA 4F1ZA 4LKCA 2PPCA 3BH9B 4YGVA 4JCMA 1RUPH 5JW3H 3OKOB 2X12A 1HL9A 3LPFA 2F53D 2WUCH 2K9UA 4AUUA 1Q0YH 1XSIA 1WA2X 4G9DA 1X5YA 5L6YH 4ZUTA 5C0RH 2WNKA 4WFFD 3VGFA 1R9FA 3TNNA 1QTPA 5I0YA 2YJLA 4MMYB 5KSBF 1CU4H 5HHNB 3HZ3A 2P52A 2G9HB 5DTFB 4OJCA 3ZE2E 1DZ0A 3HVDA 3CSPA 2G60L 2V2XB 2NLJA 3N1MC 4FJ6A 1SJEB 2AQQA 4P4KC 5L4IA 3HBGA 2E6PA 1OAZH 1U8LA 3IDGA 1RIVH 7TAAA 2EIZA 5ESQB 4DP7X 5DUBB 3U0TB 4XH2B 3WNPA 3TASA 1LP9B 3QIUD 2WLHA 5FWRA 5ISZE 4NQQA 3MRQB 4FE9A 1WGOA 1P9MA 4YBHA 2VQ1B 2X4OB 3TVMB 5E08H 3PXLA 1E9OA 2HWZL 2ZE0A 3BUYA 5D7EA 1QACA 4WTQA 3EG9A 5F96L 4PCYA 4K94L 3MA7B 2QVKA 3EJRA 1B2YA 4UZGA 4IRZL 2EKSB 4U1GC 3WFBL 1WWBX 5DD0L 1CFBA 2ICEA 3BZ4B 1I53A 3LRSA 2XN9E 3FT2B 5ERWA 5TF1H 4A6YA 3RFZA 4MD4B 1IUZA 1FFNA 2GIXA 4X5XA 1KCLA 1KDIA 5C7ZA 2PWEA 5FPIA 1JNJA 2ZCHL 4IBQA 4YXKL 1U8NA 3EOAA 4M7ZB 2YA2A 4N1EA 2LHAA 4G11A 1UA6H 1ZE3C 3VG0H 5IQMA 3NCXA 4M7JH 5J06A 3F7YA 4S1QL 1CL7H 1NBYB 1RI8A 4MA1B 2VDQH 2X5PA 4LQFL 5LGJB 1KJ3L 2ZZUT 3IWUA 3CXHJ 2IADA 1AXTH 2H0EA 2YEQA 3M1BB 3GHBL 5DEGB 1UXWA 3ESOA 1CD0A 2OSYA 5KVFE 4JN1L 2F54B 5I66B 4L4VB 4H0HB 3K72B 2H7WA 3P0GB 4LMQE 1XXFC 4ILDA 1DO5A 1WJ3A 1UD2A 3DYOA 4PVLA 5CEYB 1CE1L 5F1SA 4XX5A 5ESVA 1CFQB 2XV3A 2HMIC 3UPAA 3T2NL 4OQTA 2BP8A 4XMTA 2XWJA 1QEWA 4U1IB 2Q87A 3B2PA 3LNFA 2IOOA 3BKYL 4AEIL 3V0DA 3T0DA 1A7NL 4NP9A 4KJWC 4L9LA 5EO0B 4WKZA 5C07D 1XHHA 12E8H 4BSVA 4AYEC 1EHLL 1LO2H 2XSKA 1F42A 3PV6B 4G6KL 2Q8AH 3U7YH 2VN3A 3ILPA 1ET5A 3HLAA 3LIZH 1MCKA 2FBJL 1ZAGA 2EYRB 4WCYL 4EUPH 2WLYA 4X6FA 3NRPA 3O4OB 2EXWC 3B5TA 4MCNA 1F13A 3MXWH 4PLJD 2BVUA 4RWHA 4WEMB 3UTSA 5JOFB 1A9EA 2BVOB 2DYPB 4XCCL 1QSFA 1K8IA 4JG9A 4Z3FA 4XPGH 1BJ8A 2Q3ZA 4IU2B 2PMZA 3PIQA 4I3RH 1WBXB 3MJ9H 5D4HA 4P5TB 3FU6A 1RZJL 3KL3A 2WVVB 4RCAA 3RE0A 1RU9H 2KH2B 3CZEA 1XQ4A 3VWJA 3WEBA 4QHUB 4BH8A 3AXLA 4NWTL 1H19A 3K5SA 3SCMA 1K3IA 2QV4A 4Y16D 3I6GA 2MQGA 3DVGB 2Z8RA 2WWOA 4TYUA 1WE5A 2F19H 2UUDH 4LEBA 4LP4A 4QIRA 5TK4A 4OZGA 3TWCL 1DQVA 1MCEA 1ZV2A 2BFGA 1KENL 3ZT5A 2GJZB 2H3NA 3QIBB 5DT1L 3II1A 3DSFL 5FYLD 2NW3A 3V4UL 4IMLA 4S1RL 1MFEL 1GOFA 2J8UB 3DHPA 3QCVL 3VI4E 2KDYA 5KN5A 4AH2A 2OXGB 1OD9A 1IIKA 2DL9A 3RA7L 3P02A 3BT2L 2PWHA 4M6ML 4DKAA 2LE9A 5K93A 2R0ZL 3BQUD 3MV7B 5D2LB 2DWEA 2W5PA 3IDJB 3QJOA 4OJFL 1TLMA 2IPTH 3GMNA 4HS6B 4ZK8A 1OK8A 3VXMB 4NZFA 5F0PB 4KZDH 5HYJD 4C8XA 2XKUA 1YEGL 1Q72L 1XGPB 1MSPA 2Y7NA 3K0YA 4G8GA 4JJHA 5A6IA 4PWFA 5F7UA 5I6XC 3BSGA 5FYLL 2NZ9D 4F2MB 4J3UA 1SY6A 3QNXA 3SGDH 3U46A 1NCUA 1Z3GH 6FABL 1L9PA 1YHPA 4PUBH 4RVBA 4YLCA 5HVWA 4KTEH 3SO3C 3T2OA 3HNVH 1KFAH 1A4CA 4V11A 2X28A 2PW2A 4L1HA 2P80D 3ALWA 1BXXA 3W0WE 2XZAH 1YNTB 3NMEA 2XTSA 1N0XH 1PQZA 5IG7B 3RU8H 4KGLA 1QUNB 4NUJA 1QWNA 5D93B 5ID1A 2YPLB 3O9WD 3ESVF 1FCGA 2F5AL 2JKRM 4LU5L 4DGVL 4Y2LA 1ZT1A 4FTVD 2D7TL 1T1YA 2VXQH 4UOW0 4LRNL 3RBGA 2B20A 4KK9C 4OFVA 1KJVA 1MRFL 5FGCE 5E5RB 5I8KH 4FQCL 5HDBE 4M9OA 1E7VA 5CEZD 2OR9H 4HVBA 1AZVA 4FRWA 3JV6A 3WG7B 1J5OL 3ZQ9A 2ZJSH 3RY6A 1YMME 5EWIL 1FC1A 2C9PA 3MRPA 3QE5A 1C5BH 2W8CA 2CLZB 2O5YL 1KTLB 1T5KA 3VRIB 3QORC 4WVRA 2I24N 2WQVA 1IQDB 5JQHC 1A1MB 2W9DL 2WSKA 4ZW7A 4D9QE 3KW8A 3IRCA 3Q8FA 1RUAL 5LNGA 3M17A 1H3VA 5DJCB 3V4PH 3ZO0A 2BY0A 4UTAL 3OJ2C 5F9OL 2IAAC 1KFGA 3FKUS 2QEJA 4QPEA 1DVFB 4KU1A 5DA0B 2R9HD 1WD9A 2BIMA 4MVBD 2JXMB 3TBWB 5CEZL 4YSTA 1AI1L 1KIQB 2PO6B 4FQIH 3OR6A 2VLLB 5DRNB 4KVCH 4TVPL 5D5MA 4ODTH 5E03A 1U6AH 5ACLA 4KUCF 1BHGA 4PJFF 3C09C 1N2RB 3AAZA 2VDPH 5LNEA 2R29H 3MGTA 1E3FA 4R5TA 3TCLA 5B38G 3O6FC 2X1XR 4IKJA 2ICWJ 3IMUA 4R0LA 5C2UB 2EIDA 1N7ML 3KPLB 3S37X 3W9DB 5GPRA 3QWRA 4F7EA 1NC4B 4GH7B 1LILA 3UAAA 1EAPB 2X7LB 5A3ID 1P4BH 1VEPA 5B3JE 2LABA 1F4WH 5I28A 4A04A 1BAGA 4S1SH 4Y2DC 4DFHA 4POUB 3TNMB 4WTZA 4KDWA 1A6AA 1MRDH 2WMPA 3H56A 2YAQA 4KROB 3ARSA 1MHPH 4KK6C 4FNTA 1GPOH 1KTBA 3I50L 3KNBA 5D1QA 4L8CA 1JPEA 3AZUA 5DK2B 5KVDE 3DGGA 1NCCL 3MRNA 1JGDB 1U91B 1WFMA 5AENA 2EDJA 1SXNA 1ZV9A 2Y2YA 1QPPA 3QWOB 3FW6A 1NOLA 1YPZB 4FFZH 1MQ8A 1IC5H 1VB9A 3LJ3A 4GQ9L 1QBLH 3MRMB 4PI2A 5BO1L 5EU6D 2FHFA 4WSJA 3H7LA 1CB4A 2QVFB 3I3EA 3UJTL 5MENE 5B4MC 3OB0H 1IGJA 3TYGL 3PNWA 5CJOH 1KBGH 2YUZA 4V2CB 1RK1A 2UXVA 2Y7OA 1I7UA 2CUMA 2WXIA 2B1HH 4QRTB 2GT9B 4FABL 4ADJA 1WT5A 4FXGB 5A2FA 2ZUVA 3E7JA 1NC2D 4YHZH 1QNZH 4U2YA 3HE7D 2NY2D 3RGVC 4D0BA 1TJIL 3B8SA 3QUXD 4LCYA 1CYXA 3LPOA 5J12C 2IBBA 1SEQH 5C0AB 1G7QB 5I5MA 3VJ6A 3NFSH 3X14A 3IE9A 3TP4A 3GUFA 3O45B 4L1DA 4QOKB 5IB5B 3TJEH 3RWCB 3UIZA 4OJYA 4UDTA 4HT1H 4WZ9A 2ZX5A 4PRBA 4W9JC 4OKVA 4YDJB 3BAEH 5EOQH 1WSST 2E8ZA 3RJDA 3P11H 4FI7A 5C08D 4Y1AB 1ZCRA 2R1XA 4H25B 2BW5A 4B9GA 2OK0L 1NJ9A 4GQRA 1YCSA 4XAKE 2D03H 1WTGT 1PG7H 2C34A 2UZYB 2ZKYA 4LCCA 4RAHA 2FATL 3EJUA 1WP6A 2OMUB 3GZQA 3NZUA 2OMZA 3LH9A 2VDQB 3GJEA 3U0PB 2W95A 2ZPKH 5KSVB 3QI9B 4HWBH 5IJVA 1VFBB 1KIPA 4O9HH 4ZDHB 1QR1A 1ZTXL 3L95B 1A9VA 5CGMA 3THMH 5L8KB 4I1NB 4CC0A 1UD8A 3FO9A 3HE6D 4D9LH 4GJTB 2XXMB 3KGTA 5JXAL 1AO7B 4QJ4B 1J5CA 1ACZA 4ZFGH 1NDGA 3T04D 1N64L 32C2A 1RIUL 5C6WH 4IRSB 5B8CC 2VDRH 1RPKA 1T5WA 1EH9A 3B7TA 1VEOA 4F8NA 4J4PC 1JUFA 1OZUA 1UT2A 2YD6A 2Q3XA 1XCTB 2XBDA 2VABB 3G5ZA 1F4YH 2R4RL 1M6OB 1DJIA 4X8JB 2IQ9L 2X3BA 4JAMB 1HYSD 3GMMA 3QC6X 1NCIA 5KG9A 4EUPB 3MLZH 2EDHA 1J1OL 5A2KH 3IETB 2PXYA 3QFGA 1AJ7L 1KNOA 2H8PB 4X5WB 5DMKA 1FNEA 4UV7L 3UYPA 3FH5A 2WIIA 5BZXA 3QHZL 2COVD 2QQQA 3S4SA 1C16B 4J3OG 5DQJA 4JFVA 4ANWA 5MI0C 2EVIA 4N6RA 3GM8A 3MJ8B 5D7LD 3SDAC 4NQXB 5EF2A 1N0LB 1G9NC 3KVQA 5L2KB 2X6AA 4BGDA 4QWWC 1ZRUA 3GSRB 3VFRB 3FUKA 3FO2A 4RAUB 2HFFB 4PV9A 3CN0A 4R96A 3RWFA 4POZC 3ZZQA 5ESAB 3ZKQD 4JY5L 1ZLEA 2V6HA 3ESUF 3WS6C 4ELMB 4J3VA 4YHIB 4CDHA 3GMOB 3C6EA 4XP6H 2WIMA 4F80A 5KZCB 2YAHA 1RJLB 1R19A 3BC9A 2YEZB 1KCVL 4UIKH 3UJIL 2JKWA 2HX8A 2ZKWA 4RQQB 5AW5B 5E6IC 1WWAX 1AP2A 5C9KA 1JGUL 4U1SA 3AW5A 2DQDL 2LU4A 3BMVA 3LB6D 4XMVA 4IRJB 2VL5A 1V3LA 2SODB 1LWJA 3LEYH 4JHBA 4UQ3A 4J6RH 4JY4B 4A7QA 3UTSE 3OMZA 1W8NA 1QSFE 4ZX4A 1MFVA 1LM8V 1MEXL 1T21B 4H0LC 2VZOA 2VXSL 4ZS6D 2VSKB 3G04B 4M61B 1HQRA 4YDIH 1PX3A 4LPCA 4PGBA 5J9PB 2CD0A 3F7QA 3EIFA 2GJ6D 3IFOA 1O5DT 4NBXB 4NJAH 5GRUL 5C0BD 1I7RB 4KUCD 5I1LB 4PW3A 2J1ZA 4UM9D 1R1CA 4BQ9A 3GXDA 3MVSA 3NH7H 3EUDA 2X53A 2NY7H 2XKNB 3R1GH 1YMHA 4GLRH 4BKLA 4AIZA 2KC0A 5B38B 5KVGE 3NIDE 5ABZA 1AZRA 4OZGE 1AHWC 1R3LA 3KEDA 4JR9H 4CC4A 3PWPA 1FJ1B 5IB3A 4OFQA 1MI5D 5FM5M 1X5MA 2E6QA 3O3AA 1KMGA 2CA4A 1LO5A 1AGFA 4XVTL 1XSJA 4JFDA 5IKCA 3ULVC 3N1QC 4OJAA 3EH5B 1MOEA 2ZWKA 3GSNL 5D1XD 3V6FB 5EU3B 4B60A 2ISDA 3ISRA 4QEGA 5C6PB 4NP4L 1R46A 3GBLA 3MRDA 3IDNB 1MY5A 4NWUL 3BDXA 2VM9A 4JDEB 4P5SA 3ARFA 3HN3A 1RHHA 4MAUH 2VXTL 1KCRL 4KKNA 2K9FB 3NFNB 3D85A 4G8GE 4CU6A 3BP4B 4WSKA 3WLWD 3CLEH 3UJJL 2B1OA 5I30L 1A14L 2ZONA 1NFIA 3C5SA 3E2HA 1E5ZA 2CU9A 3S3PA 5A2AA 1HHJB 3FSWA 4N8VG 4XCFH 1JZEA 1R4XA 2XN1A 3VRLF 2A9CA 2JKIS 2RD0A 4P5MA 1GC1H 4GUPB 1I8IB 5F96H 2FJHB 4FL4B 3BH8A 3V4PB 3UYOD 1RURL 2BS9A 1MWAL 4K73A 4HC1H 4K94H 4OCNC 4BZ2L 4CA4A 3ZDYE 4N0RA 3S98A 3EH2A 4IRZH 1KCBA 5FM5O 1EGJH 4OZIB 1B4JL 4Z18A 3F84A 4JW3A 1TTFA 4L37A 3I6LE 1I85A 2XIBA 4PHXA 4LPVA 1I1AD 5B39A 5IIEA 2VDPB 2J57A 3D6GA 5E00B 1S8DB 2JCCB 1HNYA 4M56A 4RMUA 1R3KB 2VR9A 2XWBA 3L9YA 4L29A 3T77B 3WXVH 3S8FB 2PPDA 1DDHB 1P4LB 4I18A 4Y4FA 5T1MB 5TFSH 1E4KC 4AC4A 4OIBA 1OLLA 2HFEA 1KJ3H 4CMHB 4KI5C 1WK0A 4G59A 4GY4A 4RGOL 2F1BA 3DROA 3GHBH 1B0IA 3LNIA 5K59E 2WXJA 4ODWB 1KXTA 3ARPA 3FB8B 3UBXI 3ZE2F 3CXDL 4YLQT 1IM9D 4G1MA 4QKXB 5BOJA 3VGAB 4MDJB 1CE1H 2X0VA 2PTVA 1T22B 4EI6B 3GS0A 1IMHC 4ENED 3T2NH 1JZ5A 1B3IA 3QO0B 4AEIH 3BKYH 3VGEA 3TEZA 1A7NH 3R19A 5A2BA 1PJWA 3QZNA 5D5ME 2X2UA 4L4JA 4ZTPL 4MXQD 1CLCA 1KN4L 2BINA 1A8JH 3HRZA 4XO4A 3KMDA 2EUWA 3OBAA 1EHLH 4ETQB 3QXDA 1X5ZA 4G6KH 2WINB 2LVCA 4PG2C 1AZCA 4KXDA 4JVUA 4RMSA 5FV1L 1N4XL 2FD6H 3VTAA 5JPMC 1IKNA 4ZRGA 4WCYH 4P2CG 2NXYB 4PRHB 1M71A 2BNRB 2VQUA 2UV3A 3FAWA 5C92A 5SV3A 1ED3B 3NDZE 3I9GH 4TLUA 1PLBA 4WNQA 3FCBA 4IGBA 3F00A 2FWOB 4R7XA 2D0FA 1MFCH 1TYJA 1RZJH 2N0KA 5G4MA 1NTDA 5D1QE 4HFWB 4L3FA 5KWYC 1ES0B 4NGHL 1E28B 1SN5A 3L4CA 4NWTH 1SXZA 1UTDA 2VN5A 1MXDA 1E5BA 3SJVA 5BNXD 2X4SA 5I6OA 5I0ZA 2BSED 3QUZB 3ZK0A 4JY6A 4PRAA 3IMBA 1U3HC 4AIEA 1YDPA 5I74C 1N3NB 3IFPA 3CIAA 2KQNA 3H6AA 4YWGH 3WELA 1KXVA 1FYTA 1A22B 2OR8A 3INUL 4P46B 2OP4L 2Y5QA 3MBEC 3K7UA 1JJUA 1MFUA 5DT1H 3EDDA 3V0GA 4Z7VB 1UD6A 1VESA 4P4KA 3V4UH 4FFVC 1MNUH 3KPRB 3FN3A 3QCVH 2CNYA 1KLGB 3TL5A 4ONFL 1AQDB 3HS8A 4Z3IA 2O6DA 1WGVA 4EN2A 3CJJA 4KJWD 4NQCD 4O5LH 4LDCA 2R27A 2Z1PA 3RA7H 3MNWA 3N0PB 4KKBC 4M6MH 1AQ8A 2HFTA 1T6BX 4Y2OB 4LHUG 1QBML 2QGCA 3VTTA 2R0ZH 5FDYA 4X6EA 5L0QC 1MHEB 3B37A 3WHXB 5DQ9B 4M6OL 4K55A 2XIIA 2FECL 1CTOA 2FJUB 5T1LA 1G87A 5A6LA 3ZHLA 2COQA 1AGEB 1G7PB 3WMSA 1TMQA 1Q72H 4QKTA 1A6VL 2CDFB 1EFXD 2DWYA 3CU1A 5DD6B 5LB1A 2VDRB 1MZYA 3CFBB 1MAML 1RZ8A 2A9NL 2X44D 3L3HB 4ZT1A 1GXEA 3CN3A 3VXNB 1I4FA 4HLZH 4UNUA 3IDMA 4QJ5B 1U41A 3F7PC 4PJXA 4Z7QE 4PTUA 2HZHA 2C9AA 2WJ5A 2JB5L 3GTVA 3G08A 2YOCA 2X4TA 4IOSD 4WU5A 3OTTA 4WI6A 4KXBA 2NXZD 3KBPA 4U1HA 5JHDA 4J8QA 4RGNC 1XO8A 4LU5H 2K4WA 1CDGA 2BIIA 2D7TH 5J6HB 4LRNH 4X98B 4WI2A 4WI0A 4JRYA 1WUZA 4R7VA 4PJ8B 3VXUD 2YZ1A 1UH3A 3CLFL 2VIRB 1N68A 5CZKA 5DJYB 3TOPA 3ARBB 2MOVA 4XNDA 5I1DA 3HPLB 1J5OH 4JHWL 1OB1A 1P0SE 2N01B 2RALA 3VI4F 5IFHL 1S9VB 2NNAB 4NQDA 5EWIH 5FLVA 3EJJX 1LJMA 1D7CA 2MNJB 4KX7A 2YA1A 5C09B 3MYJB 2W9DH 4FYSA 2BY3A 4K7FB 1OT4A 5F1IB 4NM8L 2E5EA 1X3DA 4DGUA 3ZXAC 3IDIB 2LVEA 4N8VB 4P05A 4HG4J 1Z9SB 2DIBA 4XVOA 3G3LA 5F9OH 1NOFA 2CBOA 4N2EA 4G3YL 4FERA 3VA6A 5LWYL 1OTSC 1OK0A 4UT7L 3S36X 4KZEL 4WK0B 4Q52A 1AI1H 3WFCL 3AS2A 4NNYB 4WW1A 1SEBA 2ZUYA 3Q1SL 4LBEB 4P04A 1KLFA 2BHZA 3FUFA 4TVPH 2EILB 4XHQA 3VG9C 4P9ML 4P3CH 2V3DA 4PP1C 5DMGC 2KKQA 4MJ6B 3ZW3A 3VFNB 1CN4A 3EO1A 2MQCA 5D96B 5GZND 2Y4SA 1L3WA 4HLZG 1N7MH 5CCHE 1IGML 2ARJB 5BZWB 4BFBD 2ZWSA 3ROOA 4FQXD 1JYWA 1UCBH 1MCLA 4GFTB 4YIQA 4H5SB 1S9WB 4NN6C 2NY4B 4F7PA 3SDXA 4LLDB 1USZA 1X5AA 2QJDA 3MLXH 2EEAA 1SBBA 3BP6A 3NCBB 3MCG1 3P9WB 1KACB 4AC2A 2I32A 2YJQA 2R0WL 5HDBF 2YQBA 2CO6A 4F37K 1NCCH 2OFQA 1RK0A 2HX7A 3MLUL 3NGBB 5KYUA 1SFHA 4L3EA 2K6YA 1BQ5A 4XXDB 5HI4D 1U58B 5ISZD 2ADYA 2Z31A 1BXVA 4JPQA 1UJ3C 3FUNA 3EFOB 4JANB 3T6QC 1FH5L 1KZQA 1PPIA 3DOHA 2IV8A 1QR4A 2TSAA 3C8KB 3D0VB 2V7HB 4IMKC 4HLEA 5DK3A 4PJ5A 3BSZH 5AZ2L 3TYGH 3TO4B 1XCQB 3MMEB 5LBVA 1EHNA 1RK7A 4NQVA 2EUXA 5AVUB 1HXMB 2X9YA 3PWPE 4YSSA 4F8PA 2XN9D 1EERB 1MCSA 1O6SA 4C83A 3K71A 2E9IA 3HNTL 4JKKA 4MMXA 2AEIT 4H8UA 3VXTA 1ORQA 2WSDA 1JPFA 3QDHA 3BAKA 5I6KA 4ZNEA 4JFDE 1DBML 5D7JC 3MUHL 4A63A 1S7TA 4IK6A 4FMFA 1UHVA 1J9CT 3NFPB 1I7TA 2H0JA 3PGDB 4PWKA 1IEBB 1K2DB 2EO1A 3RVTD 2PETA 4MNQB 4KNQA 1F56A 3U7AA 1B4RA 4CL7A 1I82A 5ELIA 4RIRA 1KCSL 1XAKA 2Q20A 1S9XA 4NEHB 1SXAA 2B15A 1NANH 3FMGL 4WEBL 1GJWA 5EZJB 4YZWA 5FS5A 5B3JF 3UYRH 1E6OL 1XX9C 3D33A 2EDTA 3OKEA 4JLRA 2HPTA 3PG2A 3ZBMA 4N2KA 1DYZA 4YK4B 1D7BA 2V3FA 4JN2A 2FATH 5DR5L 3K6NA 1ZDQA 1QABA 2BPBA 1SZNA 2DQUL 2E7LC 4JNXA 4N2NA 3OR7A 1A7PL 1BQRA 4YL4A 4EN3A 2MHAA 5B3NA 3GI9L 2NYYD 5CN3A 3FUIA 3OAYK 4N2BA 2E9BA 3G5XB 3QVAA 2B16A 5DEFB 4ABQA 5E51A 6TAAA 3MNVB 2IAMB 1FO0A 2FYYB 1DJGA 4LHUB 3WIHL 1MVYA 4HGWB 2WXRA 4LOUC 3HS0B 1E67A 2L7JA 2F7QA 2WXFA 3PWUA 3G5VA 5KVFL 1BFTA 3T8MA 1BVLA 4J3XA 2YGVA 1H15B 1WLHA 4BHUA 2JSFA 4HS3A 3KPSA 4FXTA 3RGVD 4XCNA 4XB8A 3KYAA 4P9HL 1OCWL 5GRVL 3QPQC 4N22A 3UBHA 4PDCE 1S9YA 1G9HA 3CFEB 2ENSA 3FQUA 4NCC1 1P2CA 3QJFA 4PJ7B 4L5FH 3MBXL 2IQ9H 3K2KA 2YGQA 5IQNA 5C0GA 4AMXA 1KULA 2C5DC 3KL0A 1UVQB 1FIEA 2NY1C 2XT1B 4H8WC 1J1OH 3FU5A 2R2EB 1EEUA 1AJ7H 3PPEA 3WE6A 5K33A 2LAGB 4D94A 4HWEH 1UA7A 2AXGA 4BFIB 3GD1C 1DQJB 3AS1A 3C60A 3A23A 4KKZA 1NEZA 2LFGA 2EZ0D 4WFEE 4AX3A 4X4YB 1J5HA 3C5ZC 3BESR 4HCFA 4LSRH 1KELL 4MNGA 2DM7A 2BRQA 5HYSG 4JPKH 5C0JA 1OALA 4N0FB 4J39A 1BG9A 4Q4EA 5J6GA 5BS0B 1PKOA 5D7KE 1R34A 4QF1A 4TL4A 5T3XH 4P2OB 5CSZA 5JQ6L 1I3RB 5I17A 5EFIB 3WIIH 3PAUA 3ZTCC 1KCVH 4GAAA 3UJIH 2R1WB 5C8JB 4QNPE 4X6CA 4N87A 2EDBA 1OF2A 2MPAL 2DQDH 3LH2L 2YC1A 3MGOA 3NCCB 5HJBA 5LAPA 3GUTA 2FIKA 2BC4A 5AB2A 2J7LA 2WZ6A 1AYRA 2IALB 1MEXH 4WI9A 1TVBB 3SE6A 4CSZA 1A9BA 3BCDA 4QUOA 2OULB 4I5BB 4LASH 3IYLW 1GW0A 1JNLL 5GRUH 2FL5A 5LQBL 1YN6B 5GGSB 5DYFA 2JJSC 4LCUA 2YD3A 3N6YA 4LPXA 4G8AC 4JO2H 4W9CC 1G7HA 4N2FA 3LZOA 1RULL 1B0GA 2PR9A 3SJVE 3W0WD 1D6EB 4JQIL 2EC8A 4GKZA 3TA3D 3ECWA 3FBKA 3K4ZA 1H3PL 3P3YA 4Q9RL 1XL4A 5EPMB 4W1TA 3VFSB 3ZVVA 2BSRA 1Y07A 1FYTE 4G80A 4F33B 2KPWA 4XXWC 3O3BB 3WL9A 3WNIA 1L0QA 1FG2A 4U6VL 1W72A 1IGTA 2NY5C 1LWHA 2DB8A 5EC1B 5F71A 1O75A 3D0LA 3OAWA 1IVLA 3CWGA 4LSTH 4XVTH 1DANU 4ZW6A 1BQHG 4D7BA 3Q8EA 3HVNA 3OSKA 4NAMA 5IMOA 5T5FH 3K1KC 3UEZA 5DXWA 3GSNH 3BPOB 4UUJB 1NIEA 5MEPA 3QPXH 1FBIL 1OGSA 4LDOB 3H3BC 4LCIH 5KJ7E 2P1YA 5DVLA 1CTNA 1GIGL 1YMMD 2WTRA 4NP4H 1TYEB 2D31B 5ACMA 1AGBB 3AMLA 4NPKA 1OWRM 1KXQA 5I8OL 2J1YA 5JHLA 4D9QD 1KCRH 4OCXL 4GAJH 2QFPA 5JR1L 1SYSA 2PCXA 1TDQA 2E0PA 3RTLA 4UQAA 4NNXB 3QAZB 3ARDC 3UJJH 2V4LA 3ARZA 3OV6A 4YS4A 4FLSA 3T5WA 4GRWE 4HMDA 4A2GA 5B8CA 3V6OA 5LGYA 3BVWA 2HG5B 4PJXE 5FB8A 3GJFH 4FTVB 3ZT7A 4B41A 2O6EA 1MY7A 2VM3A 5DYOB 2O6CA 1RURH 5F3HB 1MWAH 4EI5C 3L54A 1YY9D 3S0PA 1T1WA 2DWXA 2Q7AA 2QKIB 4MJ2A 5JHDE 1FL6A 1B4JH 2YAPA 5CU5A 3OD3A 1HHKA 1DUZA 1CURA 4YSQA 3KH3A 4OZGF 4LO9A 3VE0B 4OF5A 4JRYE 2VRKA 4PB9L 3LSOB 4GRLA 1LEIB 3SDAA 4E41E 5MERB 2IFGA 1JHLL 5DJ6A 8FABB 4NQDE 2Q2LA 4YMPA 2BOLA 1BMWA 5E94A 1EXUA 4LSVL 3QIWA 4ZXBC 2WAHA 1DCEA 5K1JA 1J87A 1SDDB 2OTPA 1NLDH 2GCYB 4MJ5A 4LRIA 2A83A 4Z7UA 3Q6GL 3VO0A 4RGOH 3DYMA 5EMYA 5IUCA 1UQSB 2CKBA 2FT6A 3BUQA 1EEYB 4PBDA 1RSYA 3S96B 4DEPC 5GS0H 5D71L 3KLHD 4LL4A 2E76C 4MD0B 4X0KA 3RTQB 5F2FA 1TQVA 3G6AB 2BOBB 4N28A 2X42A 1M1SA 4KQ0A 2XICA 5DZLA 4JFUA 4IIQB 3O6LH 3RX8A 3STLB 3O11A 3VXRA 4WV1C 1SJEA 4ZTPH 1KN4H 1VGKB 4WJG3 4CRPA 5KVDL 1UADC 1S5IH 4K3GA 3T0EB 3CN4A 3ZTDC 4XH2A 5CGYD 4EMZA 3IMWA 5CLZA 3S35L 3RVVD 3V7AE 1CWVA 1N4XH 2ARJQ 1QSED 3GC3A 3U4EB 3FYEB 4IOFD 1L9SA 3L2LA 1UWEL 1R0AL 1PZUB 4WWNA 3V79C 2X4OA 3T0AA 4NI3A 2HVJB 2P46B 4PCKA 4Q56A 1ACCA 5EH1A 1BX2B 2ENPA 4YR6B 2H6PA 4TTGA 4ZFOL 5JHAA 3ZSSA 3HG1B 3WNNA 1AHWA 4O51B 3SDXE 4OI8A 3R06B 4UT6H 5IT2H 3ARGA 2QQNL 5F9DC 2EKSA 2ZWLT 2WLZA 3NSFA 1EMTH 2K6ZA 1NBVL 3OKYA 4APQB 4DSYA 5E9AA 1YYML 2VC2L 5EU6B 3L5WA 4OH2A 4PYGA 1Z1WA 3WDJA 1A5FL 4XAKD 4W9EC 2GB2A 1XGQB 5HYSB 5EIVA 4L3EE 4V3DB 2K3TA 3QZOA 4HKBA 2AJVL 4Z95L 3ES6B 2GITB 3Q5YA 2P8MA 1KGXA 4G9FB 3PFQA 1NUFA 3U1PA 3GSOB 3V0AC 3VWKA 3ZYZA 4HXAL 1NBQA 4X7TB 3CSBA 3MUJA 5I5JA 2AXJA 3WGVB 2NY2B 4X9YA 3INUH 5LGHH 1OOAA 4NZJA 1DQQA 2OP4H 3KR3L 3QUXB 4PJ5E 1I8LA 4P2YA 5CZVL 4FQQA 1TZHA 2X4NB 5EZLB 4AJWA 2B0SL 1FFPA 1HX0A 1GR7A 4L2LA 4UM8B 4Y4KB 2JI1A 1JZDC 5DEGA 4G7VL 4HHAA 4A7TA 4Y19A 4R26H 1KIRB 5I66A 4L4VA 1PFOA 4IBUA 1E4XH 3K72A 1A66A 1XF2B 1NL0L 2PW1B 2M1KA 2ZYHA 5D5MF 5CEYA 1NIFA 2ZYIA 1FHNA 1X5FA 4V1DB 4ZNEE 1BF5A 4NFCA 4LNVA 4M6OH 1G9EA 3ZDXE 1SVZA 1YY8A 4IK7A 4JKMA 5HGDA 5C08B 2FB4L 3Q1EA 4HKZB 3L17A 5EO0A 3D39B 1FLRL 1A6VH 3B34A 1CDCA 4JJ5B 4XX1E 1HXYB 1DUYA 4HIIB 4HJ1A 5KJRH 2XQYA 3FCUB 3LQAC 3MODL 3HPJB 3VAEA 1VFMA 1KTJA 1PKQA 3A6CL 1MAMH 3PV6A 4X8XA 1OAKH 1D7FA 1SF3A 1XH3B 2F8IA 4QRRA 1SYVB 3DX8