2O5NA

Crystal structure of a viral glycoprotein
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
276
structure length
271
Chain Sequence
VVRPEVNRTGTVDICQGPMELIFSVSRTSSGATGERISLKNTLSIVSMENGGKPGTYEWSFPANESWPEIQFLLQNREFVSKYYADVVQTPGELVVEYRCPVPQFNCTITHRWKGETIMSFDGAIQTIRSVTSEYTTKNEDTLVKYIRGLNVTLLTDNAKSIEHRWTEICKKLKDADRPDDNQYTLEDDILEDDIEMDIVQCQMTTQVPLKYHMTVWSAGRDSRAIALSAIEVASYLPVNRSQILNTTCEITSSSGWTVRLRFSEEMVAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MuHV1gpm153
publication title Cellular Expression and Crystal Structure of the Murine Cytomegalovirus Major Histocompatibility Complex Class I-like Glycoprotein, m153.
pubmed doi rcsb
source organism Murid herpesvirus 1
molecule tags Viral protein
total genus 68
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2920 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o5nA01
3.30.500.30 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 2o5nA02
4G59C 2NYKA 4JO8A 2O5NA
chains in the Genus database with same CATH superfamily
1GOFA 5F6IB 2NW2B 4R26H 2LLNA 3BXNB 3WFBL 1FZJA 1XO8A 1X4XA 2Y5QA 2C9RA 3W11D 3WU1A 1I8KA 1ZLVK 4XO4A 4LPYA 3WMPA 3W11C 3KBFA 2OZ4L 3KPOA 4TVPD 4XH2A 4WKXA 3D5OF 5HYJA 4X6DB 2NY2B 4EVNA 3T0EE 2V3EA 1KTJA 1RU9L 3FB8A 4QHNB 3P54A 1S8DA 4CNIB 2XKNA 1OW0A 4LCYB 4PJ7E 4OTXH 3MCKA 1QHPA 1RK0B 4JGUA 4OFQA 2QEJA 4ZD3H 5KW9H 1J88A 3NIGF 4YHIA 3U9UB 4WW2F 1I8AA 1RHHA 4CMHC 3VJ6B 3CTTA 3DRQA 1T1WA 1AGFB 1T89A 2R0ZH 1T4KB 4FQHA 4LLYB 3NGBC 4YZFE 4PGJA 1OAKL 5FB8B 5GSVB 4CU6A 5T3ZH 3PG2A 2C9AA 4QHMB 1UXSB 1A1OA 5J6GA 1F00I 2IGFL 4JR9L 1QQDB 4LRIA 1EAJA 4HLZG 1UATA 4LPUA 3BAEH 1JUFA 2IQ9H 3WS6C 2CSPA 2ZSVB 4UNVA 5BW7C 5ID0B 3T3ME 1B0RB 1GPOH 5DQJB 5JW4M 4P2AA 3FAWA 4MAYD 5DHEA 4OJCA 4GSQA 4HDIB 5F0PB 1SEBB 3HE6A 3PWNA 1LD9B 1TTBA 4MDJA 2XA3A 1UA6H 3M88A 4G59A 5C07B 1KYAA 4LL9A 3GTNA 1U8MB 2KH2B 3MV8D 1FZMB 4NNPH 1NCIA 2AXGA 4U05A 1AR1D 2UZIH 4NC1E 1S7SA 1W0YT 1AR1C 4CN4A 4E2OA 1FL6A 3IXTB 3ULUL 1XD1A 3N1PC 4RZKA 3QEGL 3S4SG 1PFCA 4HAGA 4MJID 4S1DD 5CZKA 3FT9A 4ZO7A 2EIBA 2H0EA 2R56L 2O5ZL 3FQNB 2HVJB 4IQHA 4S1DC 3CFIC 3KYMB 3L4TA 3EYFB 2WNGA 3VFMA 3RP1A 3HS0B 3EBGA 3JTBA 5E99H 1FN4A 4PTTB 3EO1B 3MQIA 4Y5XC 1AOHA 2G2RB 3IMRA 1Q9OA 1TITA 2B2XL 4HGMA 3W38A 4RMSA 3MRDA 2P8MA 3QNZB 5EV7A 1CT8B 2VR8A 4B27A 3BGFC 4YFDB 2J8UF 5E08L 5DRXA 3KPLB 3N6YA 2J8OA 2N1TE 3UBHA 4YN3A 3G5YB 3CZEA 1KJVB 4V1DE 1I8IB 4J3WA 1RZJH 4GS7B 3B7RL 3EBAA 4KY1H 2ADGB 1HKLL 2YRPA 1R5IB 3HCVA 4QRSB 3TH3T 3OG6B 1UZGA 4CDHA 3Q0HA 5EHFA 2LT9A 2H32B 3KDMB 5CIPH 5DMYA 2A3TA 3PHOB 2CA3A 2VO8A 1KOAA 4MHHI 1JZEA 5C7XH 3IETB 1UEMA 4MSWB 4XI5D 3GF8A 3GWJA 4HJTA 2D0HA 4IRJA 2KMWA 4W6YB 3ZOAA 2X4UB 4MAUL 5J11C 4LSUL 4JPKL 1A7RH 3N55A 4JFHE 1QHOA 2H26A 1HL8A 1FWXA 3FT2A 4U6YA 4JG1H 4WEBL 4GQRA 2W5PA 3P9LB 2MCPH 4FQLH 4D0BB 3REWB 2GJJA 3U6RA 3LZFH 2BY1A 1IM3D 4IBLT 5ETUA 2R9HD 3AC0A 1A6ZB 2GJ6D 3ARSA 4IS6B 5CJQL 3RDTD 4D0CB 3U2SA 2AQNA 5H2BB 3FQWB 3HVNA 3WSQL 2Z93A 4O02B 3RDTC 4FABH 1XFPA 4M1GH 5DLMH 1EUTA 3HHMA 4BGDA 4PBXA 1PZBA 2UX6A 3MACL 3S5ZA 1KZQA 2R29A 4OD2A 5TF1L 3SDYH 1SRDA 4KZDH 5A2KH 2WTPA 3JVGC 2ZG2A 3CXHJ 5LG1A 2W07A 1EZLA 1E8YA 2HG5B 4IHOB 3QYCA 4OIAA 2VLKD 2E86A 1W9XA 4X8JA 2P5ED 4PHXA 4QYOA 3IRPX 3ULVD 2H8PB 2WXPA 3AXLB 1VZIA 4H8PA 3ARGB 4HD5A 4G71B 3ULVC 5KS9B 4JMNA 8FABA 5ERWA 3HG3A 3QDMB 5F7WC 4Y9CA 1FUNA 2M83A 1IEBA 4LEXL 4AEHH 3QDGA 1BVOA 1VA9A 4OD1H 4OF0A 3C08H 3AG4B 4NNXB 4PU2A 3LXAA 4UT7H 2VDRH 5EZOH 5HDQH 3PHAA 1ZLUK 4MMYA 5I8KH 5AAWA 1HQRB 3O0RL 4S1RL 1UFGA 4PJBB 4F15B 2OS7A 2EYSA 3O4OB 3FUDA 5IJDC 1CCZA 3OKOA 2VZUA 4ZX5A 1P53A 3X1FA 4F9LA 3U30B 2NZ9D 4WI2A 1HHIA 4Y2OA 2NZ9C 1C16B 3A0OA 4H40A 3E6HB 4FI7A 1KC5L 1DYZA 4FADA 3C6SB 1VEOA 2BRQA 5BO0D 3P3RA 1U3HC 3D0VB 4FQ2H 4M93C 3DNKA 3H1ZA 5CKGA 4MKTA 2HJKB 2WLJA 5ENWA 1ZK5A 3NK3A 2WUCH 2NY5H 5JIDA 1E5CA 3RIAK 2O26U 1EFXD 4GAFB 2AK4D 1IT9L 5EOCH 5FLUA 5E9NA 3IK2A 3EUDA 1DHKA 5DRWB 1E7UA 1ZLSH 2EEAA 5F9WC 1H6EA 3L9YA 5F1NA 1Z3RA 1KGXA 2JVUA 4GUPA 1A6AA 3B8SA 1UXLA 4H20L 1EAOA 2XETA 2Q7AA 3T08A 4CC1A 3NABH 3WS6A 3BP4A 1ACXA 2JFCA 4H8HA 3OZ9H 1HEJC 2XV0A 4JUSA 3HJ0A 5D1QB 2R39A 1E2VA 4MAYA 3H3BC 2V0AA 2D3LA 1O9ZA 4KKPA 2ADJA 1PQZB 1OAUL 4FQXC 3FQTA 2ALWA 2G0LA 3OHXC 4WFHD 1BZOA 5C0AE 3GIVA 1MELA 4NQEE 2N0KA 4E9LA 2R2HA 1XZWA 1YEJL 5AOMA 2B3IA 1HILB 5KSBF 5B1BB 1XMEB 1GOHA 3SKJL 2FWOA 2F74A 3BIBX 5IHUL 1N3NB 2J5WA 1A21A 2AEOA 3QCTH 4YSUA 4EI6A 3RRQA 2ZOTA 3KW8A 1SXSA 1QP1A 5ES4B 4H88L 3IVKA 4KXAA 1S7UA 1OWRM 2Q3XA 3B56A 4JPSA 3WKYA 3WAKA 3OB0K 3LOWA 1MI5B 2OL3A 3DUUA 4LP5A 4KZCA 3EYVB 4LIQH 4WK0B 5EUKA 1KXVA 4D9LH 3ES6B 1NA8A 3HZKA 1KEGH 1N8ZB 3VXOB 2AV7B 1YEHH 4IMKC 2QVIA 4PJFE 4ODUA 4YDVB 4KU1A 6PAZA 4Y5XA 4AGOA 1P6AB 4IU3A 3FOLB 3EFDL 4U3SB 2EVFA 2DMBA 1VKXA 2EP6A 4LHQB 1YMHB 1VAHA 3N43F 5D2LF 1ACZA 4K8RL 3PFUA 4HV8A 3QUMH 1AG6A 3M1BA 2B0SH 3RHWK 3P3YA 3LZPA 5KVEL 1JVOA 4G43A 4GBXB 3TASA 3UBXG 2W59A 5E23A 5EF0A 2P8PA 3U9PH 3FU3A 1HJCA 2WIIB 4GMSL 5FO7B 3C09B 4W70A 3CGTA 3BKMH 5G4NA 3VI4F 4QJ5B 2V5SA 1MG3C 1QX1A 4FP8H 5FGCE 1ULVA 3S5LG 3STBA 4EBQL 1VADB 3F01A 3B5HA 3EHBD 1HNFA 1S9YB 1TTRA 1J48A 2CR0A 5AW2B 3WIHH 3U4KA 2VM9A 2CKBH 3WD5L 5C8JA 1ID5I 2G9HA 4Z7AA 2JK5A 4QY8A 4D7BA 2P47B 2BVOA 3KPRB 1GGIH 3K5RA 4RRPA 4OFVA 4I48A 5ABZA 1WA0X 3QXAB 4FCAA 4BKLA 2VR9A 3WFHA 3UAFA 5HYSB 3FONA 1FFPA 2BNQD 3VSVA 4RIRA 4M48H 2I7OA 3O3AB 5T1KB 4KK9D 5ILTL 4KK9C 2VDPB 5EU6D 4A04A 4MDRA 4WI6A 2ICEB 3ULSA 1DFBL 1XEUA 4PRDB 4H8QA 1WWWX 1NCBH 1DQQA 3ZGIA 5D96C 1IM3A 2E7MA 1TQCB 3KNBB 4ODTH 1Q9KA 4X98B 3BZFA 3LHPL 2GJ6A 2WUBL 1Q90A 1XBDA 1CE1L 2QKIA 5FYLD 3RDTA 1DANT 3VH8A 5JXED 1EZVY 2FBJL 1UB5B 1DVQA 4OGAC 1TETH 3O45A 3LHAA 3GLAA 3H7LA 1UWEL 3FT3A 1C5BL 4HJIA 1A8ZA 2XWDA 2JKRM 2MOGA 2ITDB 1NKGA 3NA4A 1A7QH 5HHMB 3LRMA 2Z92B 3JVGA 4JHZA 2WBKA 1AS7A 2W81C 3BT2L 1GSKA 3LNGA 1Z9PA 4LAQH 3U9WA 2HJLB 3N0AA 4G8IA 1HYRC 2BOLA 2KZWA 1TU2A 1WV7T 1X7QB 3PQYB 2VLKA 5IK3B 1T1ZA 2WTRA 4L9LB 2Z8RA 3DYPA 2P5EA 2C1OB 1E4WL 2XN0A 4LCCB 1BEYH 3MUGB 4M8RA 3BT0A 2EXWD 2QSTA 1QASA 1ID2A 3HG5A 1RIVH 4ORGA 4AYEC 3FU7A 3T5WA 1FFTB 1IKFL 2EXWC 1YVLA 1FYTA 5BRZB 2G75B 5F9JB 2AQ3A 4ATWA 2NTFA 2ZKHL 5T5FL 1KJ2H 3OAWA 5CSBA 3OXRB 1MW2A 2FAUA 4GKNB 2IOMA 2ITEA 4LOFA 5BV7L 5I1AB 2GTZA 4PJGB 1Q72H 3UIZA 2IAMB 1X5HA 4DFIA 4WI7A 5JUEL 2B59A 3SYOA 4EQ2A 5CLWA 3U0WH 4LOUD 4PI0A 2C8NA 2J6WA 3HLAB 3L45A 3LMJH 4Y16B 1JCVA 1ZWIB 3R4DA 2ENPA 3F7VA 3GMLA 4I77L 1NCNA 3IKKA 1NGZA 5I1HL 2Y1ZA 4LEOB 3J27A 1HZHH 4LCIH 1DBML 4WO4B 4OZFA 1ZHNB 2DBLH 2EIZB 2HLFC 2NUTB 5FF6B 3N40P 4JFEA 3BVTA 3BUPA 1SLWA 4P46D 3ZHFA 4NKDA 1H0DB 2PLTA 2VR6A 4P46C 4UQEA 5IZ7A 4L1SA 3D7PA 1F11A 2L04A 2YLKA 1FHGA 3MREB 4OZ4A 1A1MA 4IKKA 2IG2H 1DQMH 2K9UA 1YEGL 4QRQA 5GS2H 1ZIAA 4ZZKA 1YAZA 3SKMB 3UPRA 2OMVA 1QFWI 3BLPX 5DJZA 4G7YL 2OYPA 4D9RD 4ANVA 5C0RL 2A1WL 2I7SA 3NH7H 4R84A 1CGSL 2PPDA 4LARH 1WAEA 4Y7MA 3QI9D 1XGYH 3AU0A 3RWJB 1E4KC 2ADFL 3QI9C 2BJML 3LH9A 4AGPA 1DLHB 1VEPA 1NPUA 3NSFA 1GAFH 1P1ZB 4Z0XA 3T4AA 4ZMNA 2JKJA 2YGPA 3D51A 3MRQB 2YAOA 2IALA 4WFGE 3VFUA 2QFPA 3QC5X 1HDMA 1D6EB 4MDIA 3TCLA 3VSTA 2DQCH 3Q9PA 5D4IA 5TFSH 3DGDA 5EO0B 1VFBA 4KK6D 5DSCB 3HI1B 1DLFH 3ZL4H 2YGVA 5GJTH 4KK6C 4PJCB 1AGEA 2A5UA 4P2QB 5IV2A 1UM5H 5D1XE 1G7QA 3G5ZA 1QA9B 2ORBL 1A4JB 2Q1EA 4XP4H 4W9JC 5K9JL 1DUYA 5INDA 2QTEA 2GAZA 4H5SA 4X5LA 4DGIH 4L37A 1KPRA 2JCCA 2Q8BL 5AB2A 1E28B 4HKZA 5EUOE 3LD8C 4TQPA 4F7PA 1Z3GL 3U0TB 4NAJA 4F9PA 4O4YH 3DJRA 4JDTH 4G5AA 2AQ1A 4RWYL 3IM1A 4N8VG 1XZ0B 4NRZA 5KBLA 4BQCA 1M2VA 1RZFL 4ZTPH 1S9VB 1W72A 2R0WH 1QBMH 2X41A 5FYJH 4OSUH 2FSEB 4L4JA 3FQUB 1BFTA 4MA3A 4X4YB 3CHSA 3VFVB 3DOHA 1JNNL 5CSZB 2GBVA 5K9QI 1AY1H 1EAPA 3V95A 4E41B 2P5EE 3ROOA 3WN5C 4JFYB 3EYSH 5CJBA 5E2UL 1OGAB 3NFPA 3ME0B 1QFHA 3VM5A 2VSCA 4M9PA 1KTDB 1G1YA 2NY4B 2PNDA 1FYTE 4U1GB 3NP4A 1YEDA 2WWKT 3GLEA 3S36X 4JO1H 1K6QH 2BIOA 1CGXA 3IMWA 1HOCA 1IBHA 4ZNEE 2JF1A 2NY7H 3NCYP 3TGXA 2ERJC 1ZLEA 4UANA 5I8OL 1EERB 4TULH 4YDLB 3LKNB 5IF0A 4Z7OF 1BIIB 1EV2E 4AM0Q 1W91A 2A9ML 3KPQA 4OF3A 5EU6A 3VGFA 4PRHD 4F58L 1N64H 4ZMYA 5AVTB 3TO2B 2A6KA 2VQ1A 3FSOA 1J9SA 5BZDB 3Q1SL 4P2OA 4IJ3B 5A43C 4O02H 3I6SA 4JREC 1JPTL 4J2QA 2VL5A 4HQQL 3V0JA 1EH9A 12E8H 1GW0A 3BUYB 4JY5H 1H3PL 4XN1A 4BRJA 2D73A 5JXEA 1MRDH 3D30A 4PSPA 3CFCL 5A2CA 5DC4B 1F4XL 3L6FA 5IBUG 2BIQA 4JFEE 3ZYIA 1R34A 4HJ0D 1X5IA 3FMGH 4FL4C 4JY6B 2Y4SA 3BN3B 1I1FB 1XVSA 2LFGA 3MPCA 3RNQB 5C0JB 3RZCB 3TBVA 5CD3A 2X4QB 3A6BL 5CN1A 4PRID 4DT2A 1G6RB 5FOBA 3DYMA 4XPTL 3M17A 4IEFA 5FGBC 4AMKL 4HSQA 3K2KA 3MOBH 5DK3A 2XTLA 3ARWA 3H3PL 5C1MB 4MNGB 1VEMA 1KB5B 3Q2LA 4YHKL 4N9GB 2CQVA 3NUKA 1KTBA 5BOJA 5CF3A 1WHOA 2FLRT 4UB0H 1WAAA 1IAII 1UH3A 3CFDB 4FTDA 4CADA 5I24A 1L3WA 2EDOA 4IU2A 1NGXA 4HEME 3CMOH 4R2GB 3F05A 3Q3GA 4ZSOE 5IY5B 3B5TA 3MLWH 3GKWL 3H56A 1IQDA 4DKDC 1JYWA 3QCVL 4YBHA 1MZYA 5CUSL 5FYKH 3WCYA 1AGBA 3WNKA 2OI9B 5DHYA 5JMOC 3PNWB 2O30A 3V0WL 2ATKB 1FLTX 3F5WB 3S4SB 4BSJA 3MKKA 4AYGA 1AGDA 3ARVA 1O75A 3QA3A 3VWJC 3RNKB 1CLYH 1UWXK 4LL4A 2L7EA 2Y2TA 1EK3A 2JCCE 4M5YH 3RTLA 5C2BH 3CPUA 3GFUA 2OZ4A 1Q0YL 5F44A 2WZAA 4OW6A 3EJUA 4KMTL 2BW4A 4XN5A 5DQ9B 5EZJA 4PJ5E 3KVDD 5LBSL 3T8MA 2H6OA 4Z5RB 2OQJB 4MX7B 1YQ2A 2X1XR 2E7LE 1RK1A 4P46A 2DQUL 5JOPD 1J5OH 1CLZH 3K2UL 4I3SH 2LTQC 4BA8A 4NP9A 1RJLB 3DVNA 3MBXH 4NZTH 5D7IA 5I16A 3DROB 3D87B 1L3NA 2PTVA 2GBAA 4RISH 2RB8A 4PWKA 3HR6A 4B9GA 4UUJA 1HHGB 4JB9H 4IM8A 1E27B 3VTTA 1C7TA 1QMUA 1RERA 2FJGA 3Q43A 1MCDA 2AJXL 3MLUH 5B8CB 4TLKA 3EZJB 4GMTH 4HMEA 1E2ZA 5F9OH 2CUMA 3QIBD 3P30H 3QT2A 4N9OB 4LF3A 4N2DA 2YHGA 1IIKA 2HP4A 3QIBC 3WENA 2HB0A 3CX5K 3AW5A 4MA1C 4KFZC 3AUVA 3HS9A 4L1HA 2Q2EB 3WFZA 1I9IH 4ONFL 3WIIL 5L2KE 2PYFA 1PCSA 1Z0MA 1ZA6A 1LWRA 2VO5A 3FCBA 2DJMA 2I07A 3H9HA 4ZFFB 1XH3A 4KJPC 2J8UB 2DIJA 2FSDA 3C8DA 3QIWB 4Z7VA 2XYCA 3GSWB 2ATPA 2VXUL 1T04A 3MRBB 1BCIA 1JF1B 1OF2A 5IMLA 4XPHL 1NTDA 1T7ZA 3V4UH 3SQRA 2Q10A 3LS4H 2WLZA 4MD0B 2OLDA 4J3TA 3IDXL 4OZHF 2XSKA 4HUWA 1VIWA 4GJTB 2PF6A 2PYEB 1FH2A 3HG1B 3BWUF 1NCUA 3GXFA 3O3DA 3WG7B 4HWBL 5IB1B 4OD3L 3HC4L 4OAWA 2UX7A 2VDMH 3PV7A 3QUKA 5BVJA 4AOFA 3FSAA 5I6LA 1M9SA 2Q86B 3RIFF 2XX0A 5DJCB 1K4CA 4KV5E 3N91A 4NRXB 5D8JL 3CVHL 4J3SA 5A2IH 2YPLE 3HFMH 3KWUA 4N90E 1U4EA 3DX8A 5GSRB 3EF4A 4AYFB 1UG9A 3T9WA 3HZVA 4GFXA 1CFNA 5EOQL 1T5KA 3OR6B 4ODHH 5EU4B 3T65B 4BKSC 4YSQA 3ROLB 3UTQA 2WV3A 3SDAB 2P5WD 4P9MH 3FRPA 4GKZB 4U1HA 1IKNC 2BZCA 3EZ8A 4A2GA 1F42A 5LDSA 1ZRUA 2XYBA 3RYMA 4ANUA 3LKQB 3ARFD 4UIMA 5CZVL 3GSVB 4BXSV 1UCBL 1JD9A 3DURA 3ARFC 4L4VD 1ZPLA 5HI3C 1KACB 2XZZA 4K7PH 2WCSA 3HRZB 5MEQB 1XH1A 4NLAA 3M7FB 2F54D 2VDPH 2P7TA 3QVAA 1IIIA 5HHXH 1KBPA 2FUQA 1KIQB 3NJMA 4WU7A 1IEAB 2PTTB 3T0WA 3WTSA 2Z31B 4JPVH 3WE6B 1OALA 3IDGA 1MPAL 5EEWA 3U1SH 5IQ7L 2D7NA 4HALA 2Q8AL 3UJTH 1OAXL 1CE6A 3FO9A 1XL6A 1MAJA 4OLUH 1IC5L 2YSSB 1J8HB 1NUFA 2CUAA 2YXMA 3D6GA 5F93C 3MRJB 1KBVA 4F91B 3LJ3A 43CAA 4ZFGL 1IGJA 4R96A 2IADB 2XWBA 2UXGA 2I25N 3MRPB 2MOQA 4GAJL 4GEIA 2V8LA 4PJ8B 2ZXCA 5GGTL 5INCB 5KANI 2DPKA 5HY9A 1U8IA 4IBVA 2HTKC 4PLOB 1PKQB 3J8F7 2Y7MA 2RQ8A 2HFEA 3D4ZA 3MO1A 1YNTA 3P4NA 3QFJD 2WHVA 1PLGL 3PJLA 1T22A 5HGDB 3T0DA 2UWEA 3BX7C 2J6EL 4XNZB 4NO5A 3KH4A 3MLYH 4M61B 3AY2A 2ZAIA 3MJ9H 4BWTA 2GG1A 2IFFH 4PRIA 5TF0A 5FGBA 1E3ZA 3VFTB 4G6JH 5F7HA 4Z8FH 3EO9H 1TENA 2R23A 4K7PY 3S9DB 3DX7B 3PWJB 1BQSA 2Q76A 4OCRL 4YK4C 2YK1L 1CDYA 1T83C 3B3BA 4Q0XH 1U3YA 2ZNXA 2Y3AA 1CQYA 4PJ7F 3EKCA 1KCRH 1BZ9A 1S5IL 3PF2A 1LK3L 4N2GA 3RUGE 3K80A 2YAPA 1L4IA 3JYBA 4BSWA 4QOKB 1J9QA 4KGJA 2DQTL 3ARDD 2R7EB 5DYOB 2YQ2A 1VDGA 4Z7VE 5KUMA 1KWKA 4AYMC 5IB2A 1HQ4B 1KCVH 1X5ZA 5EBMA 4ILDA 5A7BA 2DWYA 2E0PA 3L3OC 3D2UD 3B9KB 5AVZB 3ULUE 4OLEA 2PW2A 1OQOA 5DO2C 1JCKA 3RVVD 1FVEA 3WJMA 3RVVC 4KVNL 1NIAA 1A3ZA 4PGEB 5E8PA 3PGDA 3JTCA 3FJTA 1A2YA 4WAFA 3NACL 4RGND 1T2JA 4C83B 5MEPA 5JW3H 3JWOH 4HWZB 1BD2D 3AM8C 3EJYD 5EPMA 3LRGA 3SO3B 4PBDA 3EJYC 2Z7WA 2DM7A 3Q01A 3UBXB 1DQDH 2PCFA 1NGWA 3GJFA 4OCMC 3CSYB 4FNRA 5IMMB 1XF5A 2DW5A 4NXKA 2Q7YA 5IROD 1FVCA 1O7DC 4UU9B 3QBTB 3QIBA 3VQ1C 4R4FH 5DHXB 4G1EB 5FYJU 3L3DA 2LE9A 4K9EC 5SWZB 5EO1A 3UO8B 4KTYA 2RCSL 4MYWB 3B7TA 5H35A 5I2IA 2E8YA 2FIKA 4AM0B 4KVCH 2EDBA 3FN9A 4PREB 2WPGA 3DETC 4JN1H 4TUUA 3LN4B 5DS8B 3QUYB 1A9EB 1HSBA 1V8HA 5D2LB 4HCIA 1QLRB 3GI9L 4CKQA 4FTVA 3R8QA 1BM3H 4YXHL 3K4AA 3PWLB 2FD6L 1L9PA 3HE7D 3WXVH 2PETA 1BVLB 1H3TA 3DHJA 3CFTA 4LLDB 3WNNA 3AITA 3HE7C 4I18B 3DV6B 4WEMB 1ACYL 1SBSH 5DEGA 5E8EB 2FBOJ 4RESB 1J5IA 1DDHA 3QISA 1OAJA 3S0PA 1YN7B 3LKSA 4WF7A 2CBPA 1YYML 4EXKA 4QCIA 5FO9A 3FO2B 2X9WA 1NLBL 1SVBA 2X2YA 1E43A 1P5UC 3D4CA 1RLWA 1VB9A 2VXQH 2IF7A 3VYPA 1W8OA 4ZJ9A 4K3GA 1TTFA 3S96B 4L1DA 4JK0D 2E6QA 1ZD6A 4DETA 3MA9H 1HINH 3ZK0A 2CK0L 2IQAA 4UM9D 3TIEA 2W0PA 5DQDH 5DZPA 5FA4A 1PU0A 1PX3A 5CFHA 4Z3IA 2FDBP 2WB1A 2D31A 2JJSC 4GRWB 2BP5M 3RL2B 3OJMB 4JL2A 3OM3B 4X7TB 1PDKB 1MJ7L 1SF3A 4JRXE 2H0PA 1HEZB 5D72H 3E0GA 3UAJD 4GY4A 1QEXA 4Y5VC 2X4OA 2ODIA 2P5WA 2DWSA 3TESA 4QXGL 3MODL 2IANE 1P4BH 3BLBA 4WKZB 1ZPUA 3X14A 4OLXL 5DJ8A 5LWYH 3SPVA 4C59B 1QI3A 5ANMB 4ES8A 4IMLA 4LHUD 1F2QA 2AJSL 2BZDA 4Q6YA 5DS2A 3K6NA 5F96L 1UZ8A 3MTXA 1VFUA 2V17L 2ESVB 2VRQA 3G9VA 4YUEL 2F54A 1ZSDB 4OIFA 5DEFB 1BQRA 2NSMA 5DJDB 2IH1B 2TSAA 4Q6IA 2DQFB 4JDZB 3VFNA 3HMXL 3IDNA 3BVWA 3FUMA 3SE8L 1OCZB 3DPDA 2D4FA 4J1UA 2OYLA 4XP6H 3HZ3A 4I89A 1MCKA 2ED7A 3ZZ1A 3BZEA 2XNAB 3GXNA 1MWAL 4UTAL 3PGFL 1K8DB 1JZ7A 1MNUL 2XX1A 5AAPA 2CLRB 3H8NA 4YZWA 1I7ZA 4BXVA 4X4KA 3ATAA 1L9OA 2C7FA 1G9NH 3W0WE 4HBCH 3MJ8A 3EH1A 5F97E 4HS6A 4ZFQA 5JIHA 5I8CA 4AV4A 5G55A 3SJVB 3QFJA 1BFVL 5F8RC 4NLHA 1DBJL 1G6RH 2WINA 5IW1A 2FZ3B 3QGVA 4FQ1L 3ZMRA 2Y69B 1GS7A 1E4XH 1XGZA 2AXHA 3GSUB 4L8DA 1KB5H 1NZRA 2R4SH 1KV7A 2WM0A 2H6PA 3GMPA 2XQYA 5DZOA 3FCTA 2ADIB 2GCYB 4K4KA 5JORA 1IB5A 4KKAD 4U1NB 5DDHB 1T83A 2WN2A 3FSWA 3MLRL 3N3EA 4KKAC 4Q9BA 1BZDA 1NJ9B 3MR9A 5GGUB 2PR9A 4XB3A 3D05A 5HJDA 3HPJA 5D7SH 3MCLH 3V9CA 3R19A 1FHNA 1TLKA 3L5IA 4ELMA 5HVWA 3GXPA 4WK4B 1KBGL 4Q4EA 1MJUH 5GS0L 1VACA 4HHWA 2GITB 4P5MA 3KPNB 4Q56A 2V9UA 4FTVE 3DRTB 3ML8A 3ARDA 2DB8A 4GP5B 4KTDL 4XNXL 2X6AA 4KRNA 4XNQB 1XHHA 1XH2A 1L6PA 2XV6B 1E9OB 3WY1A 2YEZA 1RULH 2ETWA 2WVVA 4B41A 3BWZA 3D2UA 3QJTB 3SE4A 4PG9A 1XR9B 3V4LA 4FQQA 5G5DA 2AEPH 1BZ7B 3DJZA 4KXDA 1E5YA 1KTLA 4CGTA 2D9QB 5TE4H 4DKAA 1QWHA 2XWCA 4NQDB 3QPQC 3MRHB 3KLAB 5GS1B 3LNDA 4AJWA 1R3IH 3PHSA 2WXKA 3QHZH 3KEDA 2K3HA 2Z91B 3BP7A 4IIQC 1BQUA 3IJSA 3AM8A 3E9TA 2GY5A 2LLLA 4DP0X 2J1KA 3BPCB 5DRZA 1BD2A 2F19H 3AREB 5ITFA 1KXQA 2YBRB 3LEVL 1MW1A 4ZUTA 3MLTA 2CLVB 1HCZA 5F7AA 5G2NA 4RMWA 1UGNA 3D1MC 5KVEE 3P77A 4E9TA 2A99A 3BHBA 5KG9B 3QJQB 4JFZL 2GK0B 2UZXA 3JBG7 3PXLA 1A9BA 5IROA 2XWXA 2I60H 1Z6JT 2NY6B 3OV6A 3CIAA 1V3JA 5I74B 2DYPD 1T7VA 4B9PA 4ODVH 4QRPE 1RY7B 2W60A 3F58L 1BLNA 3F7YA 2J57A 4AXWB 1IGIL 4D8PB 1W0WA 2W65A 3VD1A 3GRWL 2VXTH 4Z7IA 4LSSL 4E9WA 3VVVA 1YJDH 1ECZA 4XXWC 1J0ZA 3GINA 3IAPA 4Z7UE 4GFTB 5KVMC 1WBXB 2GABA 4AL8L 1UJ3B 1JZ5A 1YMME 5I18L 2F18A 1I7RA 2B1OA 4ZTEA 3HE7A 1NANH 2YC1B 4JM0A 1E4JA 2GJRA 4NP4H 4EI5B 3WAJA 4PN6A 2IOOA 3AAZB 1QBLH 2DAVA 4NAQA 4TTGA 1B9ZA 4C56B 1XBRA 1A5FL 4XOEA 1P5UA 4IRSB 4ZUVB 3VXMD 4FS0A 2OMTA 2HLAB 4RDBA 1A3RH 4Z3JA 2Z4QA 3K4ZA 2C9VA 2MCG1 5IFHL 3NA9L 4FNLL 3TFKD 2P46B 2ENSA 1L9MA 3TFKC 3MRLB 4XNUH 2MEJB 1NBZB 5IJKC 2V5MA 3B2UC 5CEYA 4UM9A 4NQSA 3S3SA 4NM8L 5CP7B 4YHLH 3VGDA 2BHYA 1NL0H 6FABH 3LKRA 4D3CH 1TJGH 5JYLA 1R4XA 3RGVB 2NT1A 5E5MB 3ILEA 4KOBA 3FH8A 2D2OA 1ZVNA 3MRCB 3QQDB 3VDCA 2X4PB 4MCNA 3EJJX 1KEML 1GC1L 4GG6A 4XMKH 4JRWA 3SBQA 3EIFA 4P9HC 3OJ2C 3UAJA 1UTDA 1OT2A 3UG3A 3H9SD 2VN6A 2VW6A 3SB3A 3QQ9D 2ZNWA 2ZX5A 5JLZA 2HT2C 2CBOA 3CWGA 4ELME 4ODXB 3SPHA 4DP1X 2WQUA 2B4CC 4LHUA 3H0TB 4R4BA 2WVTA 1J18A 1JTPA 1SYVB 3ZKQD 1UB6B 2HKFL 4Y1AB 1F1GA 2VUYA 5KBDA 2CR3A 2APSA 5KYYA 5KAQF 4ZG1A 4ZUSB 3BSHA 3VNYA 1B4JH 4U1LA 1PZ2A 1FFNA 4S11A 3U36B 1BGXL 1EGJH 3BFWA 1HX0A 2OMNA 4GSXA 2VABB 4Y19B 1KCUL 5E1HB 2X9XA 1AHMA 1ZGLA 2CG9X 1R3JA 2F53E 3D3VB 1TKWA 3WO4B 3VXUD 2PO6B 4KOCA 1SDYA 3N1QC 1TQBB 2BDNH 5JPNB 4RGNE 4LQFH 4ZOEA 2R69H 4IK6A 4JKPL 5DD0L 3FCGA 5ITBL 2BSTB 4C54A 3KGSA 1GL4B 2A4CA 5GRUL 4G80B 3AFLA 3DPBB 1YECH 3UZEC 1YRKA 1BPVA 5KAQG 4KH2A 1RSFA 3DMMB 3JWNC 4ZS7H 4UOJA 4LRNH 3WTTA 1EHLL 2CLZB 2VZ1A 3G5XA 3WLWD 3FTVA 2HFGL 3KBPA 4P4KC 3QUGA 5CMAB 5C0IB 1BAWA 3WLWC 2ZX7A 1C1EL 5GPRA 1ED3B 3P4LA 2FL5A 2HT3D 4PRAA 1DN0A 3Q2NA 4L8CA 2ZUXA 2IPTH 5D6CA 5JMRA 1OP4A 2KKQA 4Q4IA 2XWTB 3CSFA 4Q52A 3TIDA 3V0DA 5IW6A 4PY7B 2BM3A 1L7TL 1MCOH 3OKKB 1CFTA 1A3LH 4LVOB 4DO5A 3ECUA 1QSZA 3WIFA 3BIKA 3VXPA 3NCCB 1E7VA 3RWGB 1D5RA 4WWKB 1MVUB 1IEHA 4HIHB 5EU5B 5HJBA 1MAML 5I1DA 2K70A 3F6LA 3VMNA 2QBWA 3QWOB 4JW3A 1XF2A 4TSCL 4MLIA 3MV7E 1P4IH 1B4LA 2CGRH 1LE5A 4G83A 1F8TL 1A6UH 3G6AA 3QDJE 4S2SA 3VXQA 3L3GB 4LU5L 2A9NH 1RQ5A 4OV5B 1JS4A 4IIQA 2W94A 5F6IC 5DD5L 1TPXB 4X2UA 3CH1B 1JV2B 4NX0A 1NBQA 1WC7A 2HJFB 2BP3A 3ZRFC 1Q4NX 1I4FB 4JFUA 1J86A 4K9JA 3UERA 4HS3A 2BC4A 5LBSA 5IJVA 1WLHA 4GG6E 4DKFL 1A6TB 5D70H 1FNEB 1TYRA 5KYUA 2FX9L 2NNAB 3V5HB 5L0QC 3PV6B 4XCFH 3OKNA 1T5WA 2A7BA 2X2UA 3S6CA 2NXYB 3S36H 5F7UA 3DO7A 1FORH 4HIPA 5GRJH 4ABVA 5J12B 2EUVA 3BEVA 3LRHA 1TCRA 3P1VA 2M26A 4MA8L 4P8QA 1OXYA 4OZHB 1IKOP 4Y4HD 4F92B 2X1QA 4LMQE 1OL0A 4PGCA 4OB5L 3CG8A 3C2AH 1ZHKA 5EBLB 4AKQA 5C71A 4RRPG 5T1JA 1I82A 4XPFL 1ZT1A 2R4RL 4B9CA 1FI8C 1BZEA 5HGGS 3X12B 2QT6A 4BUGA 4P06A 1Z5YD 1N8OE 2VSMB 3CMGA 4YO0A 5IG7A 1CMOA 1F4HA 4YBLB 5C6WH 2YJLA 5D4QA 1R19A 2ICWI 1YMMB 4X6FA 4BSVB 2GSIB 2EIMB 4GINA 3CLEH 2X4TB 5I73B 4CVZA 3IDMB 3TA3D 1WP6A 4G8GD 4OU3A 3EBIA 2RBLA 1NAMA 2KQMA 3TA3C 3ULVF 4FF9A 1KIUB 1MCEA 4I7ZC 4PJIA 4RWHA 5BZWA 3VXMA 4EDWH 3O41A 3AZUA 3K2IA 3K8LA 1T5XB 3GO1L 4PGBA 5TH2B 3TFKA 1U8LA 2R1XA 4O9HH 4GSDL 1EFQA 1D9KA 2NUPA 1P7KB 3FNKA 4GRWH 4A55A 2XBTA 4HFWB 3VH8G 5MEOB 1WSST 3HUJB 3NIFF 3LIUA 4FFYA 1KDIA 4XMZA 3K8KA 1CXLA 1DZBA 4HWBA 3H42L 3LKOB 1DQVA 5AB0A 4P2RB 3QFDA 4WVRA 2UV3A 4MD4A 5CN3A 3DYOA 1U33A 3KS0J 5KZCD 4JE4B 2I9LA 5M94B 4MNQD 4POYA 1OV8A 25C8H 2C9PA 1XCXA 1KBBA 3MFGB 3QEHA 5ELIA 3H9SA 3C87A 1MRCH 1U8PB 3LIZH 4KI1A 4X7EC 4JN2B 1LEIB 3BQUC 3GB7A 2FIRT 2PR4H 1M4KA 1VHPA 3VXRD 1MFNA 5HPOA 3GUTB 1HHKB 4AENA 1G9EA 1NWOA 1C5DA 4R0LB 3MTRA 4AC2A 3TURA 2UVFA 1MHCA 4AT6B 1NDTA 3HRPA 1MSPA 2BWQA 3BH4A 4G1MB 4M5ZH 3RA7H 4X4XB 4FQCL 5FWRA 2PPCA 1GYWA 5CILH 5IIEA 4JFOA 2BSDA 5E8OA 4M6NL 3X13A 4DOHB 5F7KC 3NJGA 4FRWA 1TTGA 4PV8A 4JHUA 1OHZA 5JZ7C 4DVRL 3LQAL 1DJIA 2XG5B 3ZLQC 3BVXA 3WFBH 2JKWA 3RBSA 3TWYA 4GIAA 5IUSA 3EO0A 1MHHA 3KGUA 3BAIA 3ZDZE 5L9DH 3I85A 1X44A 1AQ8A 4B9FA 1ZHLA 1P84K 3VXUA 4ABUA 4FXLA 5HHOD 4DP9X 1R1CA 1KG0B 3KW7A 3MBWA 3TBSA 2MKLC 1AG0A 1KPUA 3C60B 2COQA 3U79A 5I28A 2UYLB 3C5SB 3JZ7A 5B3SB 1S5HB 5IWLC 2ZKYA 1FBIH 5HYQA 4HZLA 4OZFG 4CW1A 5GGTA 4BH8B 1BIHA 4KK5D 4NZRL 5CEZH 1Y7VA 4XVUD 2AGJL 2R2BA 3V4PA 1ZVSA 4KK5C 3UZEA 4XVUC 2E76C 3NFSL 3ZKSD 1NINA 1EA9C 4F24A 4M56A 5IESH 5KSVA 4TNGA 1MH5A 2NXZD 2JTYA 4XP9H 1KF9B 3NJHA 2J6EA 1JL8A 3HBPA 5EU7E 3ZKMD 1QRNE 1J0HA 2K78A 1MHPH 2JCWA 3QC6X 4GW5B 5C08D 4NC0B 3BUDA 2JCCF 4LCUB 4TPRL 4QXTB 3S35X 1CR9H 3MRIB 1FE8L 1IFHH 1WBZA 3KE0A 1FRGH 4FDWA 3RPIB 3L1FA 5LNEA 1RKRA 4Z7WA 5IOPA 3O9WD 2G2NA 1ET5A 2CJTA 2RH0A 3GXIA 3O9WC 4HWEH 1ZCRA 4O2FA 4KNQA 2CCVA 2AJZA 5GS0D 2IPKB 1KELL 1WIUA 4OJDH 3I75B 1AKJB 1XTLA 1YNKL 3ZE0E 4AQ1B 1G7MA 3BPOC 4P3WA 1J0IA 2O5ZH 3VXME 5T1DL 3QS3A 1JFHA 2Z8WC 4PJIE 4Z18A 3THMH 1AJ7L 3VG0L 1MVFA 3EFOB 4KMLB 4NJAH 2OULB 1PD6A 4HK3N 4HCFA 4AJ0A 5HYFA 3TWCL 4YDMA 4H7VA 5GIRB 3ATBA 1RZ7L 2V9TA 3EH2A 2JI1A 4WTZA 4PD4K 5D7HA 1VPOL 4I9WE 1SXNA 5IB5A 1SJHB 4WI8A 4E9SA 4LK4A 4NJ9H 5EIIB 4XRCA 3V0IA 3VD7A 2JQMA 4N0FA 4UIKL 3PHQA 3MLZH 3KPMB 3CUPA 1ORSA 4YPGB 3A4EA 1YCSA 1HKLH 5AZ2L 5F3HB 2O61B 2EIJB 2PN5A 4IOSA 1DQKA 2I9TB 4TS6A 2P9RA 1X4ZA 1BF5A 2QSCL 2IXQB 1TEGA 2XTJB 3ZUNC 4AUYA 5F3BB 2WN3A 3VG9B 3QZWA 1GIGL 2XQBH 4Y4HA 3TNMA 3GSNB 4RDQF 3MMEA 4LSRH 3BMWA 3VE0A 1CFBA 1ZY9A 5ALCH 2Q3AA 4ADJA 4W9DC 1RL1A 4F2MA 2OBGA 3MNWB 2EXSA 2WQSA 1DBKH 1R47A 4I8DA 4MAUH 2XACC 4P5TB 4DERA 3VXTB 3LB6D 4KV5F 4EZLA 5JQ6H 3LB6C 3QRGH 4BDVB 2QV2A 4EIUA 4RVBA 3W57A 4RZCB 1ZTXL 2WBJB 3GJEB 4QHLB 4G8GA 1AANA 4D8OA 1JZHA 3CN3A 2OFQA 3I6GA 3O81A 2ENJA 1FZJB 1L6ZA 3M07A 3RB7A 1I8KB 1HH6B 4G8AC 3KPOB 4XH2B 3AMKA 5CJQH 5HYJB 4DGVL 1WAAF 3UTSB 1SN0A 2BS8A 3OLGA 1AGCA 2AITA 2VZVA 3MBED 4D9QE 2ZOKA 3FB8B 1S8DB 2P28B 2XKNB 3MBEC 1M53A 3KYKL 4HWNA 5AL8A 1Z9MA 1RV6X 5D6DA 3AWFA 3MCKB 4L4TD 1AIFA 5F7DA 4RDQG 4KHTH 3QXUA 4YHIB 4LDLB 1T20A 3NVQA 3WEBA 3ZDXE 3G6DL 3DRQB 1T1WB 1WCBB 4MNQA 4FQHB 2F68X 4PSRA 4QRUB 5EA0H 5FFGA 2QGCA 2X9YA 4U4BA 1OPOA 1IBDA 4HIIA 4N6QA 5K59E 2SODB 2WWNA 1SFDA 1GGCL 1A1OB 5AEAA 5J6GB 2N59A 1KZYA 4BEIA 4F7MA 4XHJD 1O5DT 4QHKI 4XO9A 1RUPL 3AVEA 2BERA 2WP3T 3OLIA 1JUFB 2BFVL 4G6ML 4XHJC 4YSAA 5IBLD 5IBLC 1OTTD 3I9GL 2GTWA 2GPZA 1RFDL 3IPFA 4ODBD 5AW4B 1JRHH 5D5MA 1PD1A 3QXTA 4A2MA 3HE6B 3PWNB 3RU8H 3H2PA 2D3JA 3L81A 1EBAA 1HH9B 4X42A 3GBNL 5CAYB 5IQ9A 1SHXA 5D7IF 4KNSA 2LU7A 1SVZA 4GKLA 3INUL 2XU9A 3UP1A 4ALAC 2WSKA 4M7LT 4X4ZA 5H94A 3T77B 4UTCA 1H5BB 3L4YA 2AXGB 3KLQA 1IGYA 1D2OA 1S7SB 2WQ8A 3IGAB 1FL6B 2YAHA 1S4IA 3HAEA 4DW2H 3VFSB 2HWZH 4M6AA 4QF1A 4YLCA 4CILA 5HTSA 4E42A 5AOIA 4BKTC 4WI3A 4XVTH 5IMKB 1NCCL 1P5VA 1MWAA 5HHOA 2ARJB 2OCJA 1A7PL 3VFMB 4WHYH 4M5TA 1OCWH 5IWLA 3DO4A 2CNYA 1FN4B 1OT4A 2O5XL 1I8UA 1MOEA 5BXFA 3FUNA 1L7IH 3B34A 3TLRA 3QNXB 5AW1B 1IT9H 1Q9OB 1JXDA 5F1OB 3ZIYA 1IAKA 4PG2C 4N2NA 4UT9H 3L3HA 1U58A 2QDWA 1JAEA 2XVKA 4M7KH 1F6LL 4Z7VF 3ZDYB 4ZX3A 3AWEA 4HJJH 3AT9A 3DIDA 1ZLDA 3FU0A 4OTXL 4P99A 2WBXA 2OMZA 2WMPB 5KW9L 3NN8A 5C08A 5BVPH 4D0DA 3FW6A 1UXMA 3HCVB 2R0ZL 1OP3K 3B6SA 1I8MA 2WXNA 1FGNH 1DVTA 1OAUH 1U8QB 4G42B 4MJ4A 5T3ZL 4B9JA 4GAGL 2Q3ZA 4TOYH 2UVEA 4N0CC 3ZQWA 4FHJA 2VJ0A 1YEJH 3QJFB 3O9WA 5EIVA 5A16A 2V7NA 4PHZA 2IQ9L 3NJFA 3QYNA 4IRJB 1JXFA 2OYKA 3PFQA 1GPOL 3VFWA 4WI9A 3UGXA 3E38A 2DMHA 3R8BB 4L8SC 4G8GE 2YAQA 2QHRL 4JDEA 3C6EA 4H0IA 4G9FB 5FM8A 2H26B 1EZSA 4MQ7B 4HJGA 4U6YB 3T8VA 5SX4I 1UA6L 5AKTA 3IFNH 2ZZUT 4U0RC 3U6RB 1G84A 4JM2D 3WLBA 4NNPL 4HWUA 1QWUA 1WA1X 4WEUD 1AD0A 4JM2C 1ETZB 4M3JA 4JZOA 4HSAC 4JFDE 1B3IA 2MFNA 4K8RH 3U2SB 4MB3A 3FFCA 1JWUA 1MCNA 3UCRA 5KVEH 2VLLA 2DLIA 1S7XA 1O7SA 3L9BA 1D5ZB 4JFXB 4Y2DA 3GUFA 3KLSA 3IFOB 4GMSH 2CHZA 1CXIA 2Y9RT 5E99L 4UM8A 5IM7A 3DJ9A 4AEIH 5FUCE 1ND0B 2XV2A 1QI5A 3IGLA 1SFHA 4ABQA 1JK9A 5DUBB 2FT7A 5E6RB 3KM2A 3SGJC 4U1JA 4XT1C 4LPXA 4KMQA 3JUZA 3RIFK 1CFSA 1W8EA 3FRPG 4MJJA 5E6SB 4B7LA 2FATH 2Z3FA 4X8JB 2EYRA 1IO4C 5AYTA 4XE5B 2IV8A 5ECGA 1F4AA 2V3FA 1IC0A 5HVFB 3LEYH 4WI0A 4HUVA 3TBTA 5ERWB 3LZOA 3T3PF 1RZJL 1YNTF 5CKAA 4KY1L 3QDGB 2UWEF 4YHNB 2K6WA 3ZDWA 4ELKA 1KULA 2IBZY 5ILTH 2IEPA 4MMYB 2EC8A 2JB6A 3UMNA 1ROCA 2YRBA 1YSOA 1QBAA 2EYSB 3EADA 2YS4A 2D03H 4PY8I 1TO5A 3OKOB 2OZNA 2WWKO 1GGYA 1KLFA 2XZQL 3L3IA 4HUUA 5C3TA 5C0EA 1TUPA 3K6OA 2KQNA 1E3FA 2WUBH 4HPOL 3ZXAC 1G4MA 3QJOA 5FKPA 3VI3A 1OGPA 3MBEA 1A7RL 3O6FA 3RIKA 3A3YB 3CSTA 2X4RB 1BHGA 1CIDA 1UWEH 3DBXB 3O3EA 4JG1L 4L4TA 4RNRA 5ENWB 1SGKA 4CMHB 5I75C 4LO9A 3VQLA 2WSPA 2DS4A 3SDCD 3VSUA 2MCPL 4FQLL 3IJ8A 3QRBA 1ETJA 1PW3A 3NGBB 5LXGH 3LZFL 1IAOA 4Z6AT 3BKYL 1AHWA 1SXZA 2VWEC 4Q89A 4E9QA 2YN3A 4LBEA 2MTPA 5F1NB 4J3XA 4GUPB 1A6AB 1NSNH 1GR7A 3FHEA 4Z7QE 1XDTT 2ZOLB 4PVMA 4X5WB 1SVCP 3BP4B 3U1PA 2WLIB 4M1GL 2DMCA 5LAXB 3VFPA 4W4OC 4YDJA 5I1KH 1IKFH 3T2LA 4RMBA 3LXBA 1MFAH 4PJEA 1U8HA 4MAYB 5C0DA 1GW6A 2IBGA 4A7GA 1B2YA 3SDYL 5T5FH 5JXAL 1QNIA 3JV0A 3N1GC 2ADJB 4G8EA 4ZX6A 4NIKB 4HK0A 3FQTB 4XVJL 3Q8FA 1UOLA 3Q5YA 4NO0B 1NIDA 3GIVB 1QFUH 1F97A 1T3FB 1FO0A 2R2HB 4FJZA 4XBPA 1UKSA 4OLVL 1FA4A 2CO6A 2LHAA 1PZ5A 3MV8B 2FWOB 4AIOA 1AR1B 4HKXA 4X5PA 1O6SA 5JNYB 3T2OA 4FFVC 3ZTDC 3UTPD 3RY6C 2H9GA 2E47A 1S7UB 2NMSA 4AEHL 4MJIB 2QLYA 1W15A 3DUUB 1GZPA 4I77H 4KKLD 4OD1L 4YFLI 5H37H 4UT7L 2VDRL 5I8KL 5HDQL 4F2FA 3KAAA 1P7HL 3IDUA 2W0FA 3KPSE 1DBMH 2MH4A 4ODUB 2ZT9C 2VLRD 4U6XA 3DX0A 4Y5XB 4JO3H 4XB7A 3PRZA 3FFCE 1D2PA 1PAMA 4PG2A 2A6JA 1MDTA 1VKXB 3TOPA 1D7CA 4H8WH 4LLQB 2G5RA 1KIPA 4DP8X 2V2WA 2N56A 4AUJA 3M1BB 4RFEA 2F7PA 4XR8C 1WFTA 4G43B 4FQ2L 1SHMA 1ZIBA 1NBCA 4G7YH 4H25B 1E8WA 2WUCL 2OK0H 4EDXB 1HHHA 1H6FA 2CO1A 1JHLH 4HCRL 3ETBJ 1A22B 5PAZA 1QUNA 2ARWA 3UZVA 2PPEA 4UINH 2C3GA 4S0UC 3CFBA 4PP1D 5KJ7E 1TTAA 1I3UA 2BJMH 1BXVA 2G9HB 2JK5B 4MS6A 4OCWL 2BVOB 3QG6B 3NABL 4I48B 1CZ8L 4F27A 4HJ1A 2B7DT 1LP9A 3OZ9L 1Y0LA 4L3EA 1QSED 4FYSA 3WKQA 3WFHB 3CZKA 1CXHA 3OAUH 4DPAX 2W0KA 3FONB 4L8SA 1FFPB 1G0DA 4TSAH 4TTDD 3ZKND 1AO7B 2YQGA 2V5RA 2BOCA 4TTDC 1BYOA 4FFWD 5ESAA 5K9JH 4FFWC 2CU9A 2YAFA 3ULSB 2AQSA 2WYIA 4AIEA 4JFFE 4F2EA 1G87A 2OTUA 5JTWA 3JZYA 1PL3A 2RD0A 4WW2C 4JM2A 1DQQB 5AG8A 1UZ6F 3QUHA 1IM3B 4RMQA 3WNPA 4BFNA 4K5LA 3ALWA 3BZFB 3QCTL 3MLVL 1OIOA 2GJ6B 5CZRA 4DFHA 3Q05A 5E9DE 3RDTB 3OSVA 4NQCD 3QEQD 3VH8B 3RFRA 1RZFH 4LIQL 5I5IA 2OAAA 4WK2B 2HYMA 3FT3B 3SBWA 7CGTA 1AIZA 1KEGL 1X4YA 1YEHL 2P8LA 5GRVK 1AP2A 3W2DH 2BW5A 4IDLA 4G8IB 4X9FA 2HKHH 1TZHA 2WXIA 3GXUB 4NM4L 2CPCA 4PJ9D 3GSNH 3SGJA 1TU2B 3DLQR 5I76A 4PJ9C 2FX7H 3H54A 4PUBH 4R7LA 2VLKB 1PLBA 1T1ZB 4JKWA 3FU6A 2B0SL 3R4RA 4AE1A 1MWOA 5IMOA 5DFWH 5ISZD 2FEEL 4I5BA 3KL0A 4MMXC 2WD0A 2QELA 4ORGB 3FU7B 1JGVL 3BKML 5AOLA 2NTFB 4FP8L 4N26A 1ES0B 5B8CC 3ZYZA 3AWGA 3NIFB 3U46A 3BEWA 3WIHL 3HNVH 4NQVA 1R3KA 2CKBL 2A9MH 2I5YH 3LY6A 3PDOA 4QHPA 3C5ZA 4PWGA 5GJSH 1WF5A 2JV6A 7TAAA 5EC2A 4N2OA 1GGIL 5F89A 1Q9WA 4ERSH 2O93L 3LEXA 4XAKD 3QJRB 1C7SA 4HQQH 4HP5A 1Z66A 1U3HB 2ATAA 3F7VB 5CLYA 4ELMF 4R7XA 4M93B 3WUWA 1WG3A 3GMLB 4JZNA 5A7EA 1XGRA 4K73A 3ZGHA 4GW1A 4MQTB 4OZGA 1NGZB 2QDVA 5IB4A 2HRHA 2JKNA 4PTUA 3Q6GH 1FL5A 1KYFA 1YZZA 3SDCA 5B7FA 4WEEA 4OZFB 4LNRA 5DJXA 1WWBX 5EMYA 1EFXB 3WS3A 5DJAA 1JPEA 1NCBL 1T0OA 2AK4B 5IEHA 4U31A 1PG7L 4ODTL 5F9WB 3SY0B 1D5MA 3A6BH 4NKDB 4AEEA 3DXAA 4JE0A 4NSKA 1KSRA 1WFMA 3GMQA 2EICA 2YD6A 4OQ1A 1YAIA 3OKYA 3BVNA 4OZ4B 2JLPA 2X70A 3K3QA 2XQYG 4HFUL 1U8NB 5JHLH 3DTXB 3W3BA 1CS6A 1F56A 2K4WA 2F5AH 4M1DH 4W4OA 4BQ9A 2OMVB 4YHKH 4QJ4B 1JGEA 5CZXD 5DJZB 2EUZA 1AZBA 2AI0H 3KLKA 1BQHA 1A7QL 1R24A 2VZTA 5CZXC 4GAAA 1SUJA 4M8UA 2VDOB 2A2QT 5D7KE 4M3HA 3RVXC 4N8UA 4ETYA 5IFJB 3OHXB 3TO4D 2OJEA 4I13B 5BPPA 4EF3A 4L3EE 4PJAE 3TO4C 5EIQA 1CLCA 1IGTB 5JDJA 3MGTA 3GKWH 2X7LA 4DP2X 1NAKH 2Z8SA 1WS8A 1IBBA 1BEYL 4YSTA 2J3SA 2IALB 3RY6A 1F4WH 1RIVL 3TCLB 3S88L 4AITA 2DWDB 1YO4A 1VFBB 3GIZL 3PAYA 4RH4A 1KJ2L 3GK8H 1GY1A 1KGJA 3APDA 5IV2B 3H55A 1G7QB 2VH5L 4JVPA 1DUYB 2ZF9A 1Q0YH 1PNCA 3Q44A 2YGNA 1TMCB 1IC7L 2YQBA 1YLBB 2VLRA 3ARUA 1KPRB 4N87A 2NT0A 2WAQA 4HKZB 1BFSA 4Y2NA 4YAQB 1Z32X 1RURH 1YPZE 1V3LA 4GI6A 2OPCA 4F7PB 4OF5A 3K2UH 2EIEA 2CRYA 3AB0C 1ADWA 5DK0A 3SBPA 3V4VA 3CZFB 3I3DA 2F7QA 4NRZB 3FU8A 1M2VB 1W72B 4IBWA 2OM5A 1J1OH 2EDJA 4JKMA 1ESOA 5EZPA 1HZHL 5D7LD 3IMUA 3A67H 5C09B 1SLUA 2E56A 1E0OB 4BFGA 2AQQA 4QTIH 1FJ1A 1EAPB 4A7QA 4RAUA 1X9UA 3EHBB 1JNJA 3CQFA 4FMKA 5CJXC 1OWWA 15C8H 2OTWB 2XWJA 3NFPB 2PPAA 2WNWA 4X50A 1NMCB 1YEDB 2IG2L 1DQML 1OGTB 2V7HB 1RPKA 3WIIH 2FECL 4XXDB 3OKLA 3GI8H 3QO0A 1C12B 4E9RA 3GM0A 4PS7A 3NH7L 4NAMA 1DVFD 2BNQB 3CZLA 3OMAB 5KVFH 3ULAB 4FHBD 4GG6F 1DVFC 4LARL 5IF0B 1PZUB 3CDGB 3T71A 2H6UA 1XGYL 5IVZA 4YDIH 3KPQB 5EU6B 2J21A 2JIXA 2A6KB 1Q1PA 4LKXB 3OR7A 5A6LA 4GI8A 5D96B 2ZAHA 1XCQB 3VX0A 1HE7A 2CIIA 2MPVA 3M1OA 4YFLF 5AALA 5HDBE 3VTMA 3U48A 1JI2A 4OZGE 4AIXA 1CN4A 4ABWA 3O4LE 3MUJA 2DQCL 5TFSL 4NQCA 3QEQA 1DLFL 3ZL4L 1Y18A 5GJTL 3SE3A 4KHXH 1UM5L 1S7RB 5TD4A 3UTTD 3L6FB 4AMXA 4XP4L 3CVHH 4IBYA 2EIDA 3DXAE 4DGIL 3QIUD 5EC1A 3TYGL 4OQTA 2NX5E 3RI5F 3QIUC 1FDLH 2OKMA 5CD3B 3HC0B 4PJ9A 5LAPA 2PMZA 4OI9A 4K94C 5HI4D 5DTFA 4O4YL 5FOBB 4JDTL 3M17B 5HI4C 1D5IH 3Q5OA 3ZKXC 3KPPB 4APQD 2R0WL 1QBML 5CZVH 4OSUL 1UCBH 5ISZA 4APQC 5TK4A 3VGBA 4WI5A 4KDTC 3KLHD 1FG2A 1TJIH 4JANA 3KLHC 4GSUA 3S3DB 3QJXA 4CADB 4LHUG 4ZAKD 2QR0B 2ROYA 4L05A 4X6BA 1NGXB 2IOIA 3KWVA 1RK7A 3OMZA 4IBZA 2CZNA 1PYWA 2MQ0A 4B0MM 5CLXA 3Q3GB 4LXFA 3RWFB 4ELDA 2CBQA 4L1LA 1BJ8A 2HT4D 1FIGL 3RFZA 2VR5A 4X4MA 4JQIL 1EEQA 2HT4C 3NIDE 3UTPE 1IQDB 1YN6A 1N5AA 2Q8AH 5EEXA 5FC9A 4QTHA 4JO1L 5DHYB 4YFEA 5IEKB 3L2NA 2ZOOA 3MRNB 2NY7L 3QUYC 4PRPE 3WJJA 4M4PA 2J4WH 4YLBA 4QWWD 1AGDB 4XXCC 3D09A 2NQDA 3QA3B 4Z3HA 4N0UE 5MEND 1EHXA 4TULL 4OJEH 4QWWC 4W9CC 1N7MH 5T3XH 3TPUB 4I18C 4XPGH 3GQFA 3EJPA 1N64L 1RUML 3TBWA 5E7BA 4LLUA 3RJQB 4F57H 5EZJB 2YMOA 1T2QL 7PCYA 2OSLA 3I3EA 4O02L 3CJJA 1RK1B 3P9MB 4P46B 5C0BE 4Y5YC 4TUJA 1Q8MA 1DO5A 5I16B 4G11A 5D7IB 12E8L 3ILPA 3D0LB 5C6TH 4JY5L 2WGNB 3A4FA 1MRDL 1TT6A 3FRUB 4LLMA 2A9AA 4NEHB 5DVPA 3S35H 3ZDZF 4UUJB 4E9YA 2EACA 1HS6A 2DZEA 3IMTA 3G6JB 1E4HA 2FJGB 3FMGL 3CSBA 3KPTA 2FHBA 2X2IA 1UH4A 2VN3A 3OKDA 4LF3B 2FR4A 3ARXA 1Y6KR 3TO4A 1NKRA 3QI9B 3FT0A 4ZODA 3AY4A 3D4YA 2FCBA 1I53A 3R18A 5JA9A 1YY9D 3MJ7B 2FO4B 1T0NA 1YY9C 1AQMA 2DH2A 1INDH 4JJOA 3FF7A 3ARRA 3SODB 4P4RA 2I07B 3H9HB 1ITBB 3POCA 5I0DA 3X3FH 2VERN 4J3BA 1SJXA 4H0GA 4XAWH 2BIHA 4MWFA 2B1AL 3AACA 5DMKA 1C8PA 4OCXH 5J13C 4RX4D 4NNYA 2VLJD 5IMLB 1MJJB 3L5WA 5DMGD 3QRFM 4I2XA 2AABH 5DMGC 1X5YA 3OTTA 1LGVA 5FYKL 4HUWB 3TTYA 5JIKA 1PY9A 3LD8B 2ICWJ 3B2PA 3QZLA 4U1MA 4MMZC 3N1MC 4UNUA 4XBGA 4ICWA 4B5EA 5ACLA 2IJ0C 3L5HA 4Z3TA 5AVSB 2VXVH 3F83A 5E8DH 3QUKB 1NICA 2F7OA 2IMMA 3H4HA 3ISWA 1PGRB 4PCSA 4TSBL 1CLYL 4YL4A 1M7UA 4IBQA 4GO6B 4YR6A 1VSCA 2C5DC 4RBPK 1K4CB 4NDMB 3H53A 3BN9D 4BK5C 1XIWD 1J1PL 3SGDI 1GGBH 3N41F 3HBZA 2XPYA 1XIWC 5EOCJ 5BOZG 2GQHA 4X6CE 1FNFA 3DX8B 5BOPA 2X87A 4PJIF 1YYCA 3WN5B 4JFTA 1CFNB 5CJXA 5L4IA 5ISZE 3UTQB 1J5OL 5KSUA 4U1HB 1CLZL 3BLKA 1N68A 4I3SL 1XGQB 4N2IA 3MBXL 5CJ8A 1X6NA 3QYMA 4MB4A 2GBUA 3S37H 2NY5C 5IVXA 4UIMB 2UY7A 3F7KA 3BKCL 4RISL 3VXNA 2BVUA 3GZKA 5D2NC 3EOTL 2WJ5A 2ERJB 4KI5E 5IHWA 5K9OA 3MLUL 4PBWD 3E7JA 1QEWA 3ZL1A 1DVFA 4GMTL 3I84A 4KX8A 5F9OL 3P30L 4MBRA 4TYUA 1M57B 1FSKC 1MXGA 3TS8A 4GEJA 4NCC1 1ZK9A 3IDGB 5ADOL 2Y22A 2MPAH 4PRHB 1YYMH 1ZTXE 1MLCA 1CE6B 1N6VA 2R2EA 3FO9B 4Y9GA 5I5JA 2E7HA 4XC3H 1NLBH 1I9IL 2N1KA 1TO4A 3AUWB 4JREB 4CSSA 7PAZA 3VCLA 4OF7A 1BOGB 2V9QA 4AK2A 3QR1A 2ZPKH 2X3BA 1LEKA 43CAB 4B9YA 5B1AB 1IGJB 1FZOA 4EUPH 3ESNA 4R96B 4XNYH 2XWBB 1JFQL 2CK0H 4I3RH 4WNQB 2E7BA 4TF4A 4P48A 1EJOH 1GH7A 1FP5A 2CHNA 3UTTA 5SWSB 4XCNA 1BXXA 1WFJA 1WQVT 3V4UL 4XP5H 4FL4B 3T3PB 3P4NB 3MO1B 1YNTB 4WLCA 3QIUA 2WLLB 4BKWA 3LZRA 2UWEB 4YXKH 4R7DA 2AAVA 5I0WA 3GS0A 3VB9A 1UA3A 3CXHK 1SOSA 1SNRA 2VMCA 4IKLA 1JV5A 4PRIB 1GJWA 4PD4J 3I6LD 4N25A 3CSPA 3MODH 1A6VH 5LDUA 1EEZA 1CI5A 3WTXA 2RR3A 4APQA 1SQMA 4OLXH 3TN0D 2R23B 3TN0C 2Q76B 1DE4A 4NYLA 3FZUD 3NPSC 3HFML 1IX2A 4WHTA 4YUEH 4ZAKA 3FZUC 4HGWA 1N0LA 1QABA 1ZT7A 3S5LA 3KDPB 2Z65C 4U1KA 1MEXL 1VFMA 1BZ9B 4ODHL 4QHUA 4JMXA 3ZDXF 3SCMC 2F61A 4P9ML 3SE8H 5I74C 1DFXA 1NWPA 4Y9FA 4BSWB 4H44C 5BQ7B 5CHNA 4YSEA 3C6LD 4QRRB 2FHCA 3EW3B 5K59F 5IB2B 2EDLA 3KXFE 1W2KT 2R59A 1AE6H 1MNUH 5EBMB 5CIPA 5FKAA 4MZRA 2LFEA 3S3PA 1MREH 3DARA 3F04A 2VDPL 2PW2B 4MYPA 3I50H 1E8XA 5HHXL 5MENA 3E2HC 4P05A 4OZFH 3S7GA 1E90A 1L6XA 1FVEB 1U3ZA 1NCOA 4JPVL 4GLRI 4OKVB 1RCYA 2C9UA 4AEFA 4TLTA 3VI4A 5E8PB 3UJTL 4Z7WF 1BFVH 5K1NA 1DBJH 1FNGA 1K8IA 5AUMA 1WFNA 2GHWB 3CQPA 1A2YB 4L3AA 3T6WA 4OLUL 4PBVC 3WO3B 4Y5YA 3RY4A 5MEPB 2LTQB 3IJ7A 4AVJA 1JN6A 3SZ6A 2VR7A 3DX6B 5LN8A 3I6KB 3SQBA 2OMYA 2PCXA 2PCFB 1U91A 1NGWB 3GJFB 1BMZA 3RDJA 4N0YL 1UT2A 3W56A 4UQIM 3FB6A 3HC2A 2EYTA 2RFXA 2WQAA 3Q2VA 2Q7YB 1FVCB 3M45A 4A6YB 3P73A 3TJEH 3QIBB 3QULB 1ASQA 2GC7C 5IVXE 3X11A 3MLYL 3L3DB 1RVFH 3MJ9L 1CGYA 1JGDA 3VXSA 2IFFL 5T3ZE 3LPOA 2IVFC 3JV6B 5H35B 2FIKB 3L48A 3LPFA 4G6JL 2NY0C 2GT9A 3UYPA 4GOSA 4XNXH 4Z8FL 1VFAA 2QQLL 1FNSL 2YO3A 4P57A 5BZZA 1AZCA 5CEXA 3IGUA 4AGLA 1HSBB 1I7UA 4Q0XL 2J2ZA 3B3IA 3TEXA 1KCRL 2G2PA 1WAPA 2B16A 1CYWA 3FTGA 3D39D 4RX4A 3VW3L 2VLJA 1TFPA 5AW5B 1UWYA 2J7LA 4LDOB 3LKSB 4FI6A 3ZTNL 5FO9B 3ENEA 3EYOB 3FQRA 4MMZA 1QBBA 2HKAA 1KCVL 2CO3A 3FCSA 5AYUL 1HWHB 3OKEB 6TAAA 4WTZG 2AV1A 1P2CA 4W81A 3KYOA 3AU1A 3WO4C 4BK5A 4Z1PA 3GRBA 5FA4B 1XIWA 3IJHA 5SV4A 4U33A 2G5UA 2ICWA 2UY6A 4RLDA 1ADQA 1UWFA 1JGIA 3IFLH 2BNUB 4UNIA 3JWOL 1E5ZA 3V6ZA 2X4OB 1J9CT 2P5WB 3F58H 2MHAB 1I9JH 1MRFH 3HVDA 4IK7A 1IGIH 3SDXE 1T7XA 4I4WA 4G5ZH 3GRWH 3SGKC 3X14B 4BWWA 3ARFB 4XVSH 1DQDL 3FB5A 1IGML 5D2NA 5DJ8B 3QZWG 5DC9B 3SPVB 4GO9A 4L4VB 1V7MH 1JNLH 3JV5A 1EO7A 4IMLB 4WUUE 4Z78B 3NJJA 4DK3A 2XN9E 4QHKJ 2F54B 5I18H 5AW3B 4MCMA 5BUGA 1J9RA 4O2CA 4Y9EA 1JOIA 2Q9OA 4R4FL 1ZTMA 3QUXD 3GBEA 1USQA 3VFNB 3MRKB 1U3NA 1SF5A 3IDNB 5I1CL 5J0BA 3H9ZA 5MHSD 1CD1B 4J1UB 4WGVB 3RVUD 2WQVA 4HUCA 4PWHA 2E9GA 1OGSA 1ZANH 4HS8H 4KVCL 3RVUC 4BA0A 3QXVA 4JG5A 5FYLH 3BZEB 2EVIA 1AXTH 4JN1L 1A6WL 4DIXA 4DVBA 5E03A 5ESVA 5I15H 1WTLA 4FCHA 1Z9OA 2J5LC 5MP6H 1JMZA 4FI8A 3BP6B 1BM3L 1Y07A 4XMUA 2BRRL 3BFQG 5D5MF 2EEBA 1SBSL 3DX4A 1JJUA 3STZA 4MAZA 3QJSB 3B37A 4U1SA 3DUHA 3F6IA 3LXUX 3W81A 4XCYA 4R4NC 1RZGA 5I0VA 3QWRD 1GKOA 4YVNA 1U3JA 3QFJB 3T1FA 5GXBB 2WINB 5IW1B 1NFIA 2C3HA 3HLKA 1VCBC 3D69A 3V6OC 2J71A 4L8DB 5F8QC 1X5KA 2Q87A 1A7BA 2E59A 3FSVA 4MCZA 2H6PB 3GMPB 1HINL 3MA9L 3FCTB 5E5UB 5JORB 5DQDL 1MUJA 1N9PA 1BWWA 1HXMA 1WFUA 2DTMH 4UQ3A 4KAQH 4YK4B 3TN0A 3B1TA 3E8VA 3P9WB 3IBEA 5DMIH 3VXSE 3VFRA 1SJVA 1HESA 2IDQA 2ZJSH 3QUMA 3GZPA 1IE4A 3HPJB 1P9MC 5EN2A 1A14H 3N50A 5FYJD 1MCHA 2HKFH 2APVA 5D72L 3VTAA 3H9YA 3GHPA 1FVDA 2RHEA 4P5MB 1G9MC 1WIPA 1Z5LA 1P4BL 3C6LA 2X05A 3ARDB 5LWYL 4S1QH 1IFRA 1RZIA 3FDWA 1HHJA 2YEZB 3WIHA 1UYWH 4CBZA 2WVVB 2CKBA 2VLJE 3BWUC 3D2UB 4ZPVB 5HHPA 5J9PA 4FOMA 5D7JD 4PG9B 3E2HA 3TVMD 3HAEG 4FQQB 5G5DB 4OZIA 4KZEH 2AFNA 4LCVA 3ZTJH 1KTLB 1C9SA 1N2RA 3OJDA 3L7FA 3SBRA 1AH1A 2X0UA 3EYUH 4U4IA 4XP6L 4JKPH 5I19H 5DD0H 5JOEA 2UZYA 5ITBH 3UC0H 3IJSB 4KUZH 1QACA 2C1PA 5DRZB 1BD2B 5ITFB 3OPZH 4ZUTB 3MLTB 1I1AD 2FJFA 4KXZH 4YX2H 3KWWB 1RZPA 2VR4A 5HHQA 1SN2A 1I1AC 2VGLM 1I1YA 1G9NL 1REIA 3N2JA 5FECA 2ZYHA 4LGPB 3BHBB 2HFGH 5C0FA 4G9DA 2UZXB 1KPVA 3C5XA 3WMQA 1A9BB 2X6BA 1JF5A 3BAJA 4PJXA 1G6RL 3IPBA 1M1XA 3FQXA 1R5VA 1E4XL 4XN7A 4NUGH 2FT6A 5HGHA 1KB5L 1BLNB 2AJVL 2R4SL 4L5FH 4ETQA 1G9HA 1W0WB 2J73A 1B0IA 1PFOA 5HP5A 1Z2KA 4W9KC 5FCUL 5E6ZA 1LE9B 3EG9A 3EDDA 1WRFA 1K5WA 1UUNA 4OFKA 2CA4A 4NO3A 4JO4L 1MAMH 4PIRF 2NRDA 5D7SL 5G4OA 3HE7B 3MCLL 1B3JA 4RA3A 2VUKA 1BF8A 1T6WA 5HI5D 1F58H 3DUSB 4G6FD 4QGTA 3D39A 5KYWA 1F8TH 5ID1A 1MJUL 2FEDD 2X28A 2FEDC 4UOQA 5J6SA 1MN4A 2GUYA 4N6RA 1P5UB 3MV9E 1KJ2A 2OMTB 4H4NA 4TL4A 5DD5H 1M7XA 3ZHDA 4JKKA 5AQ0A 2WANA 3KL5A 5CFAA 2Z4QB 3DGGB 4HOWA 4F7TB 4HXBH 2QVMA 1PEZA 2C4FT 4UV4H 4NHUA 1L0XA 4G2AA 4KRMB 4X6DA 2AEPL 4BE6A 3P4MA 4HUKB 5CEYB 1SXCA 4PM1A 4UM9B 4NQSB 5TE4L 3W37A 3CU1A 3MNDA 4CNIA 2X12A 3LKRB 4LIQE 2J88L 3T0ED 2YEQA 1R3IL 2FX9H 3GNMH 3I6LE 4J3OD 3T0EC 4J3OC 3V2AR 3VJ6A 4LP4A 4R5XA 2WNXA 2WW8A 3GHEL 1RZKC 4O00A 4LLYA 1VFOA 1PZSA 2DWXA 2F19L 1MY7A 4U6HB 2P4AB 3SGKA 4BZ2L 1UXSA 4A2FA 4OF8A 5JLZB 5IP4A 1UWGH 5A2JH 1WZAA 4XCEA 2WJ7A 4OB5H 1ET7A 4XPFH 4LHUB 2CO7A 1QG3A 2PWEA 3VU2A 2DKMA 5DQJA 3KWXA 2AC0A 2I60L 3PJNA 3TCXA 2JJTC 1IBFA 4ENED 3OC8A 2V2TA 1UEYA 4GO8A 1ICTA 2GJZA 3QUXA 4HDIA 5PCYA 3RWHA 4ENEC 5KYYB 3QZNA 4ODVL 3ZE2E 1TJMA 5FV2A 4A66A 4F80A 4YSOA 4U1LB 1FFNB 1RPQA 2VXTL 2F7IA 1FC1A 5C07A 4OZIE 2LGNA 4Q6KA 3MRGA 4X5XB 2O4EA 1U8MA 4HUMB 1FZMA 1FL3B 4KPHH 4KITB 2ZXGA 1XB3A 2BIIA 5FUOH 1DVUA 1R3JB 3GMRA 1BEXA 4A7GF 3T2PA 3QDAA 3II3A 5I17B 4NP4L 5BMFL 1JPFA 2VLMD 3TBYA 4QT5A 4NC1C 4PJDA 3MFFB 4ZUWB 3NZSA 3PPSA 1QBLL 3EYFA 1CLOL 3JWDC 3QWRA 2VB5A 4TQHA 4AV5A 1QLEB 5KOMC 3HS0A 2ILLA 2X6UA 4PAZA 3U4BH 3WHXB 3V6OA 4FXKC 3U4AA 2Y72A 1HYSD 2WO2B 2ZUTA 3S8GB 3D12B 1HYSC 3QNZA 5DYFA 2F08A 4HXAL 2ZKWA 2X2HA 4XNUL 3DK0A 5J6HB 3GMOA 2DTSA 5B1JC 3GHBH 1HT6A 1NL0L 3G5XB 3KPLA 4HUNB 4JQXC 2A9CA 1TJGL 4MD5A 2LR4A 2Y7LA 3WXWL 4CA4A 2YD3A 4WTQA 1G7HA 1P9MA 3G5YA 2I32A 1KJVA 2XXCB 2FL5B 4PRAB 4L8CB 1URZA 2ADGA 4J6RH 3CN4A 4FYQA 4XMKL 4Y9BA 4YSRA 3CDZB 3V6FA 3TIDB 2NCEA 3FB7A 4EZMA 5IQLA 1OSZA 4N2FA 1GZHA 3H7BA 5IW6B 3L4XA 4PGDA 2ODHA 4ZBJA 3FF8A 4OFIA 2YBGA 4JO2H 4N22A 2WP3O 3WIFB 3BIKB 2IH3B 3VXPB 2E3VA 1M6UA 4JJHA 4XZUA 3D39E 2ZXWB 4NKIH 3JV4B 4C58B 1ZLWK 1QATA 5D7JA 5I1DB 3TVMA 3V52L 1N59B 1G1CA 3EXLA 4ESKA 1XF2B 4JRYE 4Q97A 3ETSA 4RETB 1LE5B 3G6AB 3VXQB 2ZP8A 3EFFB 4LLAA 4LSDA 4NZFA 4G70B 5BS0E 3GJFK 3P9LA 4IIQB 1EGJL 3IDJA 4JFHD 2YFNA 4PR5B 4X6DE 2HRPH 1LP9F 3CLWA 5AVXB 2YZ1A 1CFVH 2MWCA 4GRMA 4A7TA 4I0PD 4WY7L 5AOKA 4D0CA 5I23A 4I0PC 3FQWA 2H41A 4A6YH 1VGKB 5IT2H 5IJVB 1UA7A 2BSEA 2EDXA 1OW0C 3FFDA 1LWJA 4LQFL 2R69L 3DVGA 3OJVC 4RQQA 1T5WB 2FVNA 4JM2F 3DO7B 1NFKA 3P2DA 1T89C 2CBTA 3CNKA 1NPJA 2ZWNA 3BEVB 3LNHA 1TCRB 4CVXA 2DYPB 3CVIL 1K3ZA 4OUOA 1AFVH 2LW3A 2HG5A 3OKMA 3IFPB 3G3LA 3DHMA 3GXTA 2VN4A 4LRIC 4PGCB 2BIPA 4HX1A 4LRNL 4UT6H 4ZS7L 3T8XB 1J5HA 2H8PA 3AXLA 4N2HA 4E5XA 4ZPTA 3FO1A 3SYCA 2NPLX 1I75A 1OT1A 4HF5H 1YNKH 2EEDA 4YO0B 5IG7B 4IDJL 4B3EA 3U4EA 5T1DH 3ZO0A 5C07E 5E94A 3FQ4A 1CU4H 1BJ1H 3UGEA 4PB9L 3N41B 2D3NA 4CVZB 3U2JA 1M05B 1H9VA 5DWUH 1A66A 1NAMB 1JPGA 1PF3A 1UACH 1WZ1L 2AZAA 1NFDA 4KJYA 1MCOL 1JP5A 4PJBA 1A3LL 3F7LA 5BZWB 2BWIA 1TOXA 1RP8A 3ZE1B 4MLSA 5LNGA 2AEIT 4OCYL 4PGBB 1FZKA 4M00A 2R1XB 1VPOH 1J87A 4LPVA 4IIZA 2NUPB 3SYPA 4B60A 4LOEA 5K5YA 3OB8A 2JB5L 3D18A 3D0VA 2CGRL 4XOCA 4TVSa 5ABDE 1A6UL 1ITCA 5EBWA 4KRPD 3PGCB 3QFDB 4Z76A 3T0EA 4MD4B 4TXVB 1T6BX 2A9NL 3G9AB 4KRPC 2HJKA 1NM4A 1ET8A 2C9SA 4OCNC 5AZ2H 2I9LB 4UWQB 1RIUH 3QPXH 1KN4H 3NRFA 4PJ7A 3CVBA 2LVCA 2APFA 3U2IA 4KTEL 2CPUA 5ALBH 1FNAA 2AQRA 1J12A 1GIGH 4KQ4H 3GB7B 4DPRA 5JIPA 5HDBF 4PS8A 4KTGA 4OZGF 3H2QA 1XGTA 1QVOB 1RJZA 1SYSA 2FGWH 5D70L 1DR9A 2G3ZA 5JHDB 5JR1H 1UASA 1B6DA 1C5DB 4M62H 3NCXA 3NEOA 5GGSY 4XCFL 3SOBH 1ANUA 5KANG 2ZXBA 3S36L 1A1NB 1FORL 4X5QA 1J0YA 1MIMH 3ARBD 5IIEB 1S7WB 3NSDA 4JFOB 1OSEA 5DUJA 4AJVA 1PQZA 3ARBC 4HAKA 3X13B 3ELQA 5I1LA 4PVNA 4L0PB 4R7VA 4AYSA 2A83A 4YE4H 5HHNB 5C0AD 4DN4H 1MHHB 2DWEA 2CCLA 5C0CB 4NQED 1OF0A 3HNSL 1LK2B 1N3NA 4DGVH 3LNEA 1OAYH 2CGYA 4EJ1C 1ZHLB 4G8FA 5CCKL 3VXUB 2YUWA 3VB8A 1P6FA 1HK6A 1AQKH 3KYKH 1BVNT 3WUWG 4YDNA 3TBSB 1IVTA 2XQYK 3EYVA 2VN5A 3DBSA 3CLEL 1O5PA 2VDLB 3CCHB 4UZGA 1EUUA 2DOCA 1IQWH 3G6DH 2AV7A 2AXJA 3O11A 4HZLB 3SD5A 4EDWL 5HYQB 1RJYA 4CW1B 2YOAA 4CMMA 3SQOH 3NIDF 2R2BB 2QMJA 4PLKD 2YWZA 3R1GH 3V4PB 1ZVSB 2MNWA 4PLKC 1CD9B 1NLDH 1YMHA 4O9HL 5JQIB 3W9EA 3WNIA 5KSVB 1WVZA 2DDQH 1TZGH 3LCYA 2LU5A 1H3VA 1RUPH 5B1JA 3TEZA 1KIRA 2KS0A 4JQXA 3D0AA 5EOTA 4P4KB 4GBXA 1EO8L 5L2JB 1TZ8A 2KDGA 2WIIA 3DDFA 4NN5C 1BQHG 25C8L 1MCPL 3PL6D 3NZUA 1NCTA 1VADA 1WBZB 2WK2A 1HN1A 3IWUA 2ZAGA 5KS9E 2V33A 4HC1A 3LIZL 4GAYA 3INUH 3EOYG 1H8OA 4Z7WB 5IOPB 4N8CL 3UACA 2PR4L 3QDME 3QEUA 4WV1A 3QXDA 3INOA 1U4FA 4O2FB 1IBYA 4HZAA 3S3CB 4HMCA 3QXAA 2N7BA 4FQJH 1AXSB 1EXUB 4M5ZL 4ODSH 1G7MB 3RA7L 4PJBE 4S1SH 5CILL 4LVNB 3K6FA 4I87A 3SKUD 1NCGA 2OSYA 4LCWE 4FA7B 2NCMA 2O1AA 5AAWC 5I1EH 2XG4A 4UILH 2O5XH 2YXFA 5E4AA 1F3RB 5FYKE 1JZIA 3A24A 3T0BA 4F9LC 5BS0B 2YMXH 5L9DL 1HXYA 3ETBF 4X98A 4M7ZB 4BK8A 4I0PA 5IB5B 4QRFA 4NKOB 4J7RA 2BVPB 3WNMA 3ZTCC 1ZLVH 4Z3FA 4N0FB 1FCCA 3JT0A 1UB5A 4BQBA 3CUPB 4LMQI 5I1IH 1ORSB 4K9EH 5L0QB 5DGQA 3O2WH 2ITDA 3FOMA 4PRNA 1FBIL 1JZJA 4IOIB 2FGZA 5C3LD 5CEZL 4GAGH 5HYIA 3K7UA 3CZNA 4Y89A 3SKNB 2FJHB 2WQWA 4P0DA 4XPBH 1U36A 4ISVA 4B3VA 3QZWB 1IL1B 4Y4HB 2WNKA 5IESL 5D1QE 4XP9L 1JPSH 4ZMQA 2HVBA 3MMEB 3VE0B 4Y4KD 4BM7A 5D71L 1MHPL 1TNNA 3MJ9A 2OMBA 4LCCA 2SEBA 4Y4KC 1BV8A 1LO5A 2GBTA 4F2MB 4KK8D 1NDGA 3MI6A 4UYPA 2H1PH 4KK8C 5IFAL 2AERT 4UF7C 4XBMA 5BRZA 4MAYC 2QHRH 5F9JA 1D3CA 3BVDB 1CR9L 1ETB1 1IFHL 4X6CF 4Y1SA 5DC2A 4CU7A 3OG4B 1FRGL 3TA3B 1B4RA 5I1AA 3GT6A 1SY6L 1TJHH 3I6GB 5ICZA 1M71B 2BSRA 2Y6TE 4PCTA 4AX3A 2X6CA 4HWEL 1DJXA 2GSGA 4A39A 2VLME 1KFAH 1MI5E 1XD0A 2OMUA 4U3HA 3MN8A 3TONA 5LBVA 4HPHA 2ZOKB 4F8TA 1ZWIA 2YZ8A 2HN7A 2AP2A 1TZAA 5F7DB 1AIFB 3THML 1CJYA 1KXVC 1X5LA 5BNXD 1T20B 3DC0A 4LEOA 4PW3A 5I66B 4NJAL 2CGZA 4MNQB 5DJYA 1CDUA 1MCIA 3RY5A 2QV4A 2X5PA 4KRLB 4HIIB 2EDRA 5FF6A 3ML9A 4EN3D 1EPFA 3ZHLA 2HH0L 1H0DA 3BQUB 4EN3C 5EZLA 5TDNA 5HJ3B 4NJ9L 3VXRB 1TQSA 3K1DA 4B6ZA 4TNVK 4GUQA 1GYCA 2JQZA 3MLZL 1ZAGA 2Z7UA 1XCWA 3ZW3A 3LDBC 3QDHA 3SKMA 4ZNCD 2H45A 3G04A 5D5MB 4XO5A 2EO9A 1A7OL 4IRZA 3ARBA 2C4XA 3I9PA 4NQXB 2A9DA 3KPRE 2VZOA 5IQ9B 1MCCA 4Z9KB 1BM7A 2X88A 5F9AC 4EAEA 3RWJA 1N12A 3G5VB 3I02B 5H94B 2XQBL 1PIFA 2XZQH 4F5CE 4L23A 1P1ZA 4GYBA 2B15A 4LSRL 1IGYB 5GISH 5C0AA 4XI5C 5ALCL 4NQEA 4HPOH 1DBKL 2DI8A 4E42B 2HX8A 2ZX8A 4JGJA 5JQ6L 1M2OA 1P5VB 1EHKB 1QLEH 3QIWD 3QRGL 4HYTB 4WFGD 3HI1A 5DSCA 5HHOB 2E46A 1YJDC 3OAZK 3GSOB 2BVEA 4P2QA 2N4IA 1QA9A 2D2CC 1OEZW 4W1TA 3BDXA 4M7JL 2ZCHH 5D1XD 1XX9C 3BKYH 4FULA 2NY1D 3FTXA 3FL7A 3L3HB 1U58B 1MLBA 1NUDA 2Y5TB 4PJFA 2R9HC 1JZ8A 2NY1C 1V3KA 3BO8A 4OJAA 2BINA 3U0TA 2QKIC 1VRSA 3OQRA 3WDJA 1XZ0A 2VXQA 4LAJH 4HISA 3UXFA 5HHME 1S9VA 2OMZB 3NN8B 4KHTL 4DO6A 5C08B 5DCCA 4D0DB 5JW4R 2P45B 4NPYA 1X5MA 5F1IA 3REVA 5JXAH 3VFVA 4FMFA 1CBVH 1U30A 1WEJH 3B6SB 1HNYA 5EA0L 1I8MB 2AKRB 3PQYE 1JTTA 5DJ2A 3PL6A 4XVJH 2NLJB 1BG1A 2XY2A 5AOZA 4JFYA 5FEBA 2ZUWA 4Z23A 5J4MA 4OLVH 3JVFC 3O9WB 3QQ4B 5BRZE 4DUXA 2W9LA 5J56B 1I85C 3OPUA 3RJOA 3VFWB 2Y7QB