3LKPA

Crystal structure of hla b*3501 in complex with influenza np418 epitope from 1972 strain
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Cross-reactive CD8+ T-cell immunity between the pandemic H1N1-2009 and H1N1-1918 influenza A viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lkpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3lkpA01
3BH9A 3R8QA 3FN0H 4YXKL 4X99B 1CF8L 2Y1VA 3ESVF 4K9EC 1SJVA 5F7FA 1J9CT 5JUEH 4NQVA 2VSDA 3FO0L 3RWJB 2AJXL 3X12B 3ZYJA 1L9NA 3BJLA 1HKLH 1IGFL 4NQEB 3JZ7A 2BHYA 1NAKL 1FH5L 3PWPD 3MBXL 4Q0XH 3ZYIA 4KRNA 4BZ2L 3BZEB 4HIXH 4AIOA 4NSKA 2NY2D 4K3DH 4OZIE 4FFZL 3U7YH 5TE6H 2R0LH 2A38A 2HT4C 2XRAL 3LN5B 4L29A 4OCNC 5J1AB 3TYFB 5HI5D 5ISZB 1FV1B 2AGJL 3RA7L 1N0XH 3D25B 5D70L 3OAZK 2R8SL 1YEJH 1A7QL 3DRQB 5TE7H 4K2UH 3TJHD 1AXTH 1MCWM 4WW2C 2E9IA 2E9BA 4JB9H 3O6MH 2GJ6D 4R4NC 5GGVH 4CVXA 3FO2B 4UTBL 3VGHA 5CSBA 1K8DB 5KANG 1MNUH 4PREB 3QHZL 4WV1A 2HKFL 4NYLB 3WIFB 1L9MA 3DGGA 3GHEH 4NQSA 4K23H 5DLMH 3GMQB 3MRRB 1V7NH 4E41B 4UDTA 2R29L 1ED3B 2VISA 4OLZL 5I8KL 1KSRA 3ILQC 3U30C 4BSWB 4G9DB 1XGQB 1RIVH 3UYRL 1KB9K 4ELKB 1L4IA 2P42B 3EJYC 4WO4A 3OR7B 3DMMA 2EKSA 3QCVH 4D3CH 2F8OA 5I66A 5KSBE 1HQ4A 3VGAB 5C0BE 1BIHA 4NQUA 3L5JA 2AV7B 1FZKA 4JFED 4G3YH 3RVUC 3BRDA 1ZTXL 32C2B 5D7SH 4OSUH 2V7HA 3A67L 1KTDB 4HWNA 2MCPH 1DQJB 3VH8G 2IGFL 4M62L 4RBPK 5ICXB 5CP3A 2DJUA 4KVCH 3CC5B 3FQUA 4XP9H 4F2MB 1TCRA 3BO8A 1IGTA 1CZ8H 5GS1B 1LWRA 1U8MB 5EOCH 5I6XC 5DFWH 4ZUSB 1N8ZA 1KEGH 3MZGB 5J12B 2CK0L 4PGEB 2WAHA 5DGQA 1DQQA 5C0RL 5I74B 3VWKA 4XVJL 5EFIB 4PBXA 1XGTA 5D96B 4M5ZL 4QHUA 5LCVL 4MJ6B 3L95A 4M9PA 4G42A 3CSGA 1CFSA 3MXWH 3SDAA 4XNZC 3IJYB 1T89A 5JMOC 4P9ML 1NMAL 5DHVB 3QUZA 4OZGB 1CFQB 1EGJL 1QYGL 3SKNB 4KJYA 4URTB 1A7NL 2R4RL 3VI4E 1DN2A 4WUUD 3FZUD 3W9DB 4RGOH 3TT3L 4DGVL 3GSWA 3LEVH 3KPLB 3L3DB 5F89B 1LE9B 4NZRH 3H0TB 3L3GA 3AB0C 2J8UF 2YN5A 1LP9A 2GJZA 4HIJA 2ICWB 2OZ4L 4ZOAA 1MJUH 5KS9B 5MEQA 1JMZA 4QHMA 3ZE1F 1LVEA 2NY5C 4NBXB 2Z31D 1FN4A 3IDYB 4R97B 5DJYB 1T4KA 3SE9H 3DETD 2PTTB 1N5YH 4LSSL 2EEBA 2XI9A 3MRCA 4G7YL 5EU6B 2JE8A 3RKDC 1QSEB 3B5HA 3UTZA 4CMHB 5J1TC 5E6IA 1CD8A 2YPLA 4X6DF 2E8YA 4GXVL 3S98A 4PJHA 1E6OL 5IKCB 4LNVA 1HIMH 3EDFA 3IFNH 1VFUA 3AU1B 3MBEC 4KAQH 1BWWA 4TNVK 5CJXC 5EUKA 3BKJL 4HH9B 4EBQH 2I60H 4LRNL 3KYKL 4OLXL 3IT8D 1C08A 1I8KA 2BFVL 2D9CA 4P23C 1JGDB 3ZKXC 2AJYL 3ALWA 3LKOB 1JFMA 1GXEA 1JHLH 4HXBH 1S7QA 1T0MB 2OJEB 2Q6WA 3FRUA 3L3JB 1GGTA 5B22A 4BSVA 4UOJA 4N0CC 4NCDA 1CDGA 1TQBB 2MJWA 3IU3B 3AC0A 4LIQH 4TNVF 4NZJA 5FCSH 5BZDB 1YNKL 4NUJB 3RTQA 2G9HB 4Y4KB 1U8HA 2XG5A 4POZD 15C8H 4XAWH 4ZQKB 4NO5A 4OZ4B 7FABH 5TFSH 1AHWA 5DTFB 3SGDI 1AD9A 2V2TA 2GCYA 5KAQG 3RZCA 3L3HB 5ESQA 3C6LA 3EZ8A 4N0UB 2AI0L 3ARBC 1FBIL 3VXPB 3GZKA 4LPYA 3PWPB 2YUXA 2J5LC 4HS3B 1D5ZA 4Z76A 1HXYB 5C6WH 3DI3B 3L3IB 4L3CB 3MFFB 1A3RL 2VXQL 3TV3H 5I16A 5DJZA 4X4MA 3RP1A 1FNSL 5L8KB 4GAJH 4GMSL 3T2QA 5I8OL 2ED9A 2BK8A 1E28B 4QNPE 2FL5A 2PYEE 3VXUD 1GJIA 2OXHA 1UM5H 1FFPA 2VDRL 4U1MA 4IOIA 3TBWA 2PXYA 3V4VH 1ZANH 3HI6H 4RRPA 2P5EE 4X5WA 5DK2A 2X4TA 2D7NA 3OPZH 1DEDA 2PETA 5B4MD 1IC5H 4YHYB 4QHNB 1CFNA 1AP2B 3EOBB 4UILH 3BJ91 3GMOA 3H9SB 2JELL 2LU4A 4PJXF 1RV6X 4NN7C 3BP4B 2B2XL 3BP6A 3RIAK 5H37H 1ETZB 3O0RH 4LLMB 3MLWH 2AQ2A 2E3VA 3MGOA 2W38A 2QQQA 4HEME 3WUZA 3RWIB 5KSUA 2FECI 4WY7H 4M00A 3N1PC 4RDQG 1WCBA 1NGPH 3DX6B 2B1HH 3RIAF 1JP5A 5GS3A 3UTSA 1HXMA 4OM0H 2X4SA 3SKJH 3F12B 1HYSC 3THML 4PLJD 5C8JA 3U9PH 3MJGX 2NQCA 4Y2DC 4F33B 1A4JA 1EERB 5EU7E 3DV4A 2FR4B 1CK0L 2AKRB 3HNVL 4N8PA 2DYPA 1XGPB 1I75A 5JXED 3KDMA 1QRKA 4BJLA 3JWOL 1DQLH 4JPWH 4BFEA 3FT4A 2RAMA 4JPVL 1PG7X 1KNOB 4EN3C 2Z35B 5DD3L 4S11A 5F72S 4JJ5A 3BPCB 8FABB 4U1KA 1NLBH 4DGIL 2VLLB 3EKCA 3FQXA 4U6VH 4JFZL 2WIIB 4JVUA 4TSBL 3T3MF 1UM4H 1OM3L 1QR1A 3IXAB 1W72L 3VFNA 2X2YA 3RUGA 4MVBD 2PW1B 3RFZC 4L3EE 3GIZH 4ELMA 4UAOC 4NHUA 1A1NA 2FHCA 3OJ2C 3WNNA 5H2BA 1HSAB 1DUYA 3D0VB 4C56B 2V9QA 4WUUB 1BFVH 1FYHB 2ARJA 4Y5VA 1EO8H 3T65B 1YEGH 2D7PA 2X6MA 4YGVB 1ULVA 1PKQE 5TDNB 2OP4L 3QIWA 2N1KA 5C07E 2FECL 3EO9L 3VJ6A 5J0BA 1L7TL 1U8PB 4Y8AA 4Z78A 4P2RE 1KN2L 3QIBB 4ENED 4P5TD 2XNAA 5HGBA 3QUMH 1E27B 4ZXBB 1S8DB 1FO0A 1NKOA 5CD5D 4OD3L 5JLZB 3D3VD 5JHDA 4X9HA 3WFEL 4HWZB 1MFAH 3OJDB 1D5MA 5AYUL 3SDXB 1WAAE 5CZKA 4B0MM 1R5WB 4M3KB 2CKBB 1HI6A 1G9NH 2R0ZH 5E99H 3BRGC 3GMPA 4AL8H 1CLCA 3L5IA 4LLQA 1UACL 1YYLH 4CJ1A 1YY8A 1OTTC 1P7QA 4JFYB 3ORJA 1A6PA 4Z7UE 1A6TB 4GS7C 4PRPA 2N56A 3O3BA 3H9HB 2W91A 4N5EC 2X44D 2IPKB 3U0WH 4PJ7A 1TJGL 2FB4H 2QR0A 3KYOB 3TBYA 5EZIL 4QRPE 3FL7A 3PL6B 1MCKA 2P48B 3VWJA 3CVIH 4JHWH 4LU5L 3BZFA 3REVA 4JPKH 5DMIL 2ZJSL 1F2QA 1E4XH 2D03H 1MELA 5IT2H 1TETH 4PP2A 4NNPL 1A6WH 2CXKA 1CD1B 2O61A 2EEDA 3MGTB 3FO1B 3OKDA 5HY9A 4O2EB 2HG5B 2EXYD 4RMUA 4WV1C 3QNXA 1TPXB 5EU7C 4JQVC 5SWZA 2H2SC 3R4DA 2FLRT 5FYKH 4HBQA 5IB3A 3BEVB 4PV9B 5IMMB 2GK2A 2M2DA 5SWSE 3TN0C 4JANA 5KBNC 3TYGL 5FO7A 4PB0L 2F19L 4WI2A 1XMWA 1YJDH 4PJDB 5ID0A 1FRGH 2G2RB 5C09E 4JY6A 3DMMC 4E0RA 3EDEA 2Y36L 4UIMB 1EEZB 5IW6B 3MRLA 4LPVA 2CLRA 4LASL 3TLRA 3HCVA 5C1MB 4Y19E 4PJFB 2R2CA 2RB8A 4XZUB 1E4WH 2NR6D 2OZ4A 1GPOH 1LD9A 3NCYS 3BUYB 2XKNA 4P3WA 3VD5A 5HYSB 3QEQE 2EYSB 1A1MA 4ONGL 5FV1L 4UV4L 1VEPA 3MV7A 1T1XB 1PBYA 2YBRB 3B9VA 1VFMA 5DYOA 4MA1C 3BH8B 4FXLA 5A40E 4LSDA 2VDOL 3IVKA 1IFHL 4L9LA 2NXYB 2X4RA 3DVFA 4TYUA 3DTXB 3TZVA 4AIXA 1NGQH 3FB8A 3QXDB 1BZ7B 2OTWB 1WEJL 3C60B 4LLVB 1H15A 1IGML 1KCVL 1S7XA 5K9QG 4RQQA 2DLHA 3NACL 4JREB 1LEKA 4HMCA 5DJ2B 1N59B 2ZUXA 1OGAD 5EORL 1LQSR 1UB5B 1XF5B 1I7TB 2F54E 1MQ8A 4C83B 3SDAC 3LKSA 5EOCJ 1J11A 1T89C 1KBGL 4HKJA 3QUZC 1H3UA 1RY7B 3SDDC 4CVZB 2XY2A 3N85L 5CEYB 1LHZA 4M1GH 2HT4D 4YC2C 1YMMA 2LU3A 4O2FB 4ZUVA 5HI4C 3VI3E 4N5UA 1FJ1B 1U95B 4G9FA 4XCFH 5DMKB 5C0FA 3P0VL 5AG8A 4Y1AE 4G80B 2DOCA 3O4LA 4RFNC 4PJ9C 1QRND 3VA2C 4R4ND 2PW2A 4AZ8A 1T5WB 2EDWA 2E7CA 5C9KA 4BZYA 2Y25A 1Y18A 4DJMA 4XP4L 4KKBD 1DN0B 2DAVA 4XBEH 4YHLH 4HJGA 3ZE0F 3UYOD 1GZPB 1TVBA 1I4FA 1RVFL 1FAIH 4RGMB 4LNRA 1ND0B 5A2FA 2CSPA 2GKIA 3ILQD 3OHXA 4GXUN 1T22B 4OT1L 4MJID 3VFWB 1MF2L 3VFRB 1EBAA 4I18A 4MQXC 3TNNA 3EJYD 4Z7VA 5I75B 5DR5H 1OAUH 3BZ4B 4Y4HA 4PRNA 4C58B 3QWOB 5JOPE 5JOFB 3VG0H 2E7LA 1ORSA 2EDRA 4U6TA 5JW4N 2ZSVA 1MLBB 2PKDA 3O6FC 5FDWB 1HINH 2VL5A 3RVUD 2PYFB 2Q8AH 4X4XB 4GAGL 1YA5A 1X4ZA 2ITDB 4WTZA 1PG7L 3MLVH 4GRWF 1KC5L 1ZT4A 3KNBA 2W9DL 4PJCA 3QSKB 5TH2B 2MNUA 3ULSA 5D5ME 1CD9B 5DI8B 3D39B 4OM1H 1AHWC 3FFDA 4V1DD 2VLJA 4S1SH 2D0HA 4HH8A 1FDLH 3KHQA 5BV7C 5A16A 5IW3A 3C6LC 1BQSA 3ARXA 5HD8C 3X11B 1TZGH 3C87A 3WXWL 2BRRH 3BP7A 4APQA 1NCBL 4QXGL 5F8RC 1S3KH 2DM2A 3PXJA 5HDOA 2OQJA 5I2IA 5DJ6A 3VGBA 1JZ4A 5EA0H 1IMHC 5KN5B 3EO1A 4Y8DC 1DLFH 4NKOB 1PX3A 1UKTA 1EHAA 3RWEA 4OD1H 4HFWB 4LPUA 2ATPA 3PHOB 4QHKJ 3VXRB 4AH2A 2WUCL 2X09A 3BSZL 2YXFA 3U0TA 3KPNA 4P2QB 2YR3A 1PZUB 5I19L 5IJKC 5FGSA 3LKRB 2PXYC 4H25A 4KMQA 4HDIA 1GCFA 1BBJB 3MRNA 4OZHB 5DQ9A 3MLZH 1JPST 1U8LB 4XWOC 5AAWA 1KJMA 2YPVH 3DVNB 2WQ8A 4L3AA 4JRYD 4HUVB 5ID1A 4GH7B 1NDMA 5DURD 3CVHL 3HMXL 4KPHH 3K4DA 3U4EB 4DN4L 4HS8L 3FAWA 3LMJH 1F3JA 1W72A 2FWOB 5IV2A 4OGZA 1RIHL 3AREC 4R4FL 1TJIH 1KJ2A 3TPUE 5ACMA 2C3VA 2NW3B 3MX0A 3RKDD 2IG2L 2WBJA 3QWRD 3G9AB 5F7HA 4M48H 3AS1A 3MLYH 3BWAB 1M7DA 1N26A 3TT1L 3RY6C 1JF6A 3MBED 1EEUA 43C9B 2IALA 2J4WL 3MV9A 3LKQA 2X7LA 5FYJU 1M05A 4P23D 1UZ6F 1CFVH 1PSKL 2BNUB 5T1MA 1NAMH 1NEZA 5EPMB 5J6GA 5EUOE 5KJRH 2KQNA 1O5DT 4N0CD 5HDBF 3VH8B 5F9OL 1MHEB 3REWB 4D8PA 2F53B 1PAMA 2AXGA 5GISL 3ZLQC 2Y23A 4LLYB 2VXVH 3IAQA 5BZWB 4OV6F 3F7VB 5T1LA 1G7PB 1F4XH 2FX9L 3S88L 2WLZA 3P4OA 1N3NB 4PJBB 3VD3A 1VFAB 2APWA 1YY9C 5FKPA 3HI5L 2B4CH 4HEPG 1X5HA 1MAML 2R1XB 2ZUVA 4LF3A 1SY6H 3DYPA 4NCC1 5T3XH 1VADB 4LSVL 5DVKA 5E08L 3WO3B 4OCYL 2VB5A 3ARBD 4DVRL 3T8XB 5C0BD 3V6FB 1OGAB 3FN9A 2AS5M 5I71C 2ORBH 3RWHB 2EC8A 1DSFL 4JM2F 1HDMB 3QDMB 2CDFB 1ZXQA 5I1DA 3I84A 3QI9A 1F6AB 1NUDA 1JGUH 3RGHA 2I5YL 5D1XA 3F6IA 1R24B 1MCSA 1N5AA 4HIEB 5E9DA 5FHBL 4XNYL 1XF3A 1MRDH 5D7IF 1R0AL 2HLFC 1Q0YL 3ULUE 1ITCA 1D5XB 1YYMH 3U79A 1DBBH 2X70B 3U6RB 4WW2B 4RRPG 4XPTL 3PGDA 4F8QA 1QRNB 5D72H 4TSCH 3HNSL 2VN7A 5FV2A 2EDTA 2O5XL 4NZTH 1Z9LA 4QCIA 1RJYA 3B9AA 4EVNB 3KR3L 1MEXH 5EC2B 3O3AA 2VABB 1JRHH 1VGKA 2E7HA 2F5BL 4XGZA 3TO4A 1A7RH 2FJFA 1UKSA 1MCWW 5ITFB 1RZGA 4N8VA 1RUQH 3VMNA 3EOTL 3CFKB 5A3IC 3BEWB 2DQGL 2UWEA 4O5LL 4HK0A 4PJ8B 1MHCB 3BN3B 1FZJB 4YHML 4ZSOE 4QTIL 5BV7H 2BJML 2F8VA 4WI6A 4YDKH 1F90L 2GUOB 1ZHLA 3ZL4L 1TVHA 5E1AA 5AZEH 2HLAA 4WRLA 3VXOA 1RUAH 1INEL 5INCA 5F97E 5LGJB 3J8F7 5ADPH 4UV7H 4FTVE 4KU1A 1X3DA 3LKNA 3VW3L 3JTSB 5DO2D 1FVEB 4KDTC 1QVOB 2GFBB 3WFDH 4MD5B 4HG4K 35C8H 1G7QA 2BY1A 5F1OB 1SBSH 2CH8A 4EN3D 3GMRA 1U3ZA 2G60H 5HHQB 5DD1H 2IPTH 3H3PL 2NTSP 1N6VA 1MFEH 4NNYA 3MROB 5LWYL 2GJJA 4Z5RA 5ALCH 3DX7B 5HGAB 2CIKB 3K8MA 5I1LA 4YBQC 4PTUA 4PRDA 3GI9H 5DDHB 1CT8A 1MWAL 3B83A 5IF0A 5HYJE 5IMLA 3CFIC 2CDEB 3L5XH 1XF4A 3GJFB 3PWUB 4XNZB 5FYLL 3RU8L 2E7MA 1FPTH 2OL3B 3O45B 4U1SA 2MKWA 5CEXA 1OARH 2X10A 2EO9A 2AJUL 5J06A 3WYRA 2PCPA 4KJPC 4LQFL 1II4E 25C8L 3PWLA 5GSRB 4X7SH 4JVPA 2FGZA 1M6OA 3PABA 4EDWL 2FX7H 3AB0B 3QO1B 1X5GA 5E8PA 3CXDH 1QEWB 3UPCA 4JFDA 3HPJB 4PJIE 4JRYB 2H6PA 2YD6A 5DURB 2Q8BL 4I13B 5T5NG 4AT6A 3AAZA 1J0JA 3RKPA 5CFHA 1HILB 1INQB 5D71H 5HHVH 3WSQL 1UWGL 2C3HA 1FGNL 3PWNB 1UEMA 3MRBB 1YN6B 1JTPA 2B1AL 5F3BB 5LBSH 2R2BB 1E4KC 5BVJA 2K7QA 2CMRH 4S1RH 4X6EB 3UTPD 3V7AE 1ZGLA 3GMNA 4GKSA 4JY5H 5D2NE 1EEQA 4KXZI 2PYED 4IHOB 4YHOL 1E4JA 1VFBB 2QADB 3TZVC 4OFDA 2HN7A 3QHFL 4AG4H 1DUZA 4OLEA 4O9HL 5IMKA 1UXSB 3QUXD 2P5ED 2W9EH 3PGFL 3S35X 2I9LA 1OTTD 2K9UA 1IM9A 3ZKXB 1OSZA 4HPOL 4F9PA 5EN2A 4ZPVB 3PDOA 5L88L 4KI5E 2AK1H 4N5ED 3CLFL 4Z7OF 3EJZC 1XR8B 4XP1H 1DBKL 2YD3A 1D9KA 3LPGA 1BMGA 2M8XA 3DURB 1KG0A 4GG8B 4ERSL 3P11L 4JDZB 4JAMA 3I6GB 5IHZA 2I07B 2PTVA 1FE8H 4JDVB 5IMOB 1QFPA 4K8RH 4QXTA 3NZHL 3GBLA 3BDYH 3LS5L 3VD9A 1M7XA 4HPYL 5KSBB 3DXAE 4LPWA 1MHHA 1G9MH 2YD7A 5C0BB 3BQUC 5BO1L 1NGWA 1IEBA 4KVNL 1Z3GH 1MCRA 1QFWM 2A6JA 3PV6A 4LSRH 1U2HA 2DM4A 2H2SD 5EZLA 3V6ZB 1Q9WB 2VQ1A 4K7PH 4M8QA 3WJLA 4QYOB 3TN0D 3CIQA 5JXAH 3NFNA 3A6BH 1P4BL 5E2VL 5J6HA 4L8DB 3ZT6A 1AFVL 3GRWL 1BP3B 1C1EH 1OAQL 4Y4HC 2H1PL 4R7DA 1MIMH 1R3IL 5K9KA 1OPGL 2E7LC 43CAA 5FYJL 1CLOH 1G7LA 4EOWH 2XIDA 1FYTE 5IEHA 2Q7YB 1GOHA 3I6LE 5BXFB 5CGMA 1YQVL 4OUOA 5D1ZD 4YHZH 3CVHA 4NN7B 4JRWA 4NZUL 2XTJE 5INDB 4K7FB 2IANE 5E4IA 4L3ED 1KTLB 1BQHA 3P30L 4B50A 1BZQK 2J2ZA 3SJVE 5E2JA 4HGKC 1KCUH 4NRYB 2E6JA 2EDHA 1XGUB 3L1OL 4BH7A 1A22B 3QQ3B 4FQ2H 2DTML 1KXQE 4RZCB 2EIDA 2X4PB 5TPWL 3S34L 3V6OE 4Z7WE 5C07D 4I3SL 2ICWJ 4RFOH 4XXDA 5EU3A 1MJJB 1MSPA 4P2RD 4Y2DB 4APQC 1ZS8B 2R69H 3CDGB 3T0VA 2A6DA 4DVBA 3TNMB 1T83C 3OF6A 1O0VA 5F9WB 4OZIF 4XAKE 3NTCH 1P2CA 2E27H 3SDAD 3TVMC 2JCCE 3VFMB 2RCSH 2W0LA 3SDDD 4Y89A 1DFBH 1RUKH 3GK8L 4EN3B 3GIVA 1KLFA 4ODUB 2A73A 3UTTE 1F4AA 3MRMA 1BQUA 5D2NC 2GTWA 1QO3A 2EH7H 5C0CE 3W0WE 1GYAA 5D1QA 1IM3A 2FYYA 2IFGA 4PJ9D 3IDXL 4OCRH 5MENB 1ZT7A 2KZWA 3RDTC 4GKNA 1GHFL 5CBEB 2HVJB 2PR4L 4GW4A 4RNRB 1HZHH 3K4ZA 2HFFA 4QXUH 2HVKA 5K93A 1MHPH 5TE4H 4KI5C 1T20A 4HUKB 3WHE1 3L5WA 2WBJC 4ZS6C 3O6LL 1G7HA 4P59H 5I1GH 4FQJH 1YEFL 1ZHBB 5AWNH 1V8HA 4QRPD 3VFVA 5ETUA 4XPGL 2FSEB 3WL9B 1XGYH 4YDIH 5J9PB 2B20A 3CFDB 1G9EA 3GI8L 3O6KL 3ULUH 5JDJA 1EAPB 1OD9A 2YRZA 4I3RL 4MQXD 3V0WH 1DTUA 2DQUH 3EGSB 5GSVB 1WBXA 4MS8C 4OF7A 3TIEA 4DCQA 2YKLH 2CGRH 1I9IH 1KIPA 1NC2A 4HCRH 3QJFA 4JQIL 1DQMH 4U6HA 1I9RL 3O6FD 4MX7B 5B8CA 3GMLB 1FL3A 3UYPA 4MNHB 2ZCLH 1LEIB 4KRMB 4YDVB 3D1MC 4WTZG 1KLGA 1RFDH 2ADGB 3FFCB 4JN1L 3RWDA 3QCUH 5SWSD 2QQKL 4YX2H 4G8GE 3BH9B 1JNHA 2XXMB 5CBAA 5E8OA 2A77H 2AEQL 3BKYH 1NL0L 4LAQL 1DP0A 2CRZA 4M5YL 5D8JL 3F5WA 1IEAA 3ZSTA 5C09D 1OSPL 1A1OA 4NQVB 5IVXE 1N7MH 5EG6C 3VFGH 4X98A 4LOUC 1IAIH 5HD8D 4Y19D 4M7JH 7CGTA 1IKFH 2F9BT 1MY7A 4MA7H 1UCBL 4WWKC 4NSKB 3BVNA 3QEQD 1MI5A 4N1HB 5JDSA 4L4VA 3QI9C 5IB4A 3CH8A 1RHHA 5HHMA 4L29B 2Y5TA 5HSFA 1JZ5A 1ACYH 4N9GA 4YUEL 3VCLA 1KEMH 1JJUA 5FGBA 5ALBH 2VC2L 3QT2A 5I30H 5HHXL 4F9LC 1A6AA 1NBVH 2PXYD 3BIBX 3QR2A 2ILLA 1DEEA 1NCWL 3LRSA 1DQDL 1ZAGA 4IRJD 3KLAA 3G6JE 4JR9L 4CVXB 4XI5C 4XWOD 1NMBH 1XEDA 5EOTA 5DWUL 4WV1B 3NFSH 1A14H 4JKPH 1H3VA 3CK0L 5C3TA 1EJ6A 5L2JA 3DGGB 3TO4C 2P8MA 5CP7A 3UO1H 1MWAA 1NCAH 4NQSB 3ARED 2V5YA 1HKFA 5A2KH 4EUPA 4GQ9L 4UDTB 2ZPKH 2VISB 4JZJA 3I9GH 1RUMH 1C5DA 2CRMA 3W5NA 2QQNH 3HTLX 4XMKL 1TNNA 5IBUG 5I0DA 4WO4B 5EOQL 3DMMB 2EKSB 4D0BA 4Y1AD 3T1FA 1BAFL 5I66B 1HQ4B 2LU7A 2J6EL 5CSZA 2DKSA 2A9MH 4LMQE 4XPBH 3SO3C 1FZKB 1NCDL 1P6FA 2Y6SC 1VACA 1T1ZA 2LVCA 5C0AE 5LAXA 3O3UN 4J2XA 4WHYG 2JIXA 1NEZG 2V7HB 4Y4FC 3CXHK 2DYPD 4DOHB 4NFDA 4G59A 1JGVH 4MA1B 1Q72L 4X6CE 1QSFA 2APXA 1J0IA 4JDTH 3FQUB 1TCRB 1A2YA 3M1BA 2WBWB 5HDQH 1FCCA 3BO8B 1IGTB 2DLGA 3OJMB 5C3LD 2BRQA 1NUFA 1EFXA 3WDJA 5HYEA 4BZ1H 5IGXL 1N8ZB 1KXTB 1YY9D 3RZWA 2HTLC 3BUTA 1DQQB 3VWKB 3O9WA 5JOPD 5L2KE 1XGTB 1DR9A 2DIBA 4QHUB 1ODAA 4MA8L 3TH3T 4EIZC 1LO2H 3L95B 4KQ4H 3OGOE 4G42B 1B6DA 1CFSB 1MJ8L 1WC7A 3SDAB 3T3PE 4TUKL 4JLRA 3QUZB 4GRLA 4ZUTA 4KJYB 1T0PB 4QNPF 2H9GA 3BMVA 4O4YH 3GSWB 1RZKC 2BOBA 2A2QT 4S0TD 5KVFH 5GGTL 2Z92A 3L3GB 4KK5C 4NWTL 4D2NA 2HLFD 1FGVH 1LP9B 2GJZB 4HIJB 5ELIA 1EEYA 1PY9A 2JJTC 4RFNB 4OZGF 3V6BR 5MEQB 3RX7A 3MOQA 5EZJA 1ZLSH 3RL1A 3BX7C 4X8JA 4QHMB 4ZO7A 3KPRE 1VHPA 1FN4B 1T4KB 1YPZE 3K74B 3MRCB 2WQRA 4X7CC 2IH3A 5CGTA 1JPSH 3UTZB 2Q76A 5E6IB 4N8VG 2VZVA 3EFDH 2YPLB 1AJ7L 5T3ZL 4PJHB 5A3ID 3RWCA 4WFFE 4YNYA 2COQA 2VH5L 4Z9KB 4XVTL 3BWUC 5EH1A 2V5RA 3U4BH 3QHTC 3GRWA 5EUKB 2YK1L 3OZ9L 4PRIE 5J89A 4J1UA 2J88H 1FFOA 3GJFH 3LQAL 1DBAL 1C08B 2OL3H 1I8KB 1AKJA 3KYMA 4KV5E 5SV3A 1P7QD 4TUOA 5J3HC 4XCYA 1S7QB 1GGBH 3OMZA 5CJQL 2Q6WB 2P43B 4YPJA 2VZUA 3FRUB 4PRPD 4BSVB 5F6HJ 5GRJH 3VA6A 4LQ1A 3UXFA 1IC7L 4MJ4A 3WNOA 3MZTA 4W6WB 3RTQB 4ZMAT 1U8HB 1EK3A 3B43A 4R9HA 4NO5B 3E0GA 3BPOC 1GGCL 1N2RA 1T80A 4IMLA 2XZAH 5GRUH 4JGJA 4BM7A 5E70A 4FQHA 3PP3K 1AHWB 1AD9B 2V2TB 3F6LA 4KRPC 2GCYB 3RZCB 3K8KA 3GB7A 3QNYA 4GLRH 1UG9A 2QKIA 3T08A 5MI0C 5ESQB 3C6LB 1JN6A 2UZIL 3B2VH 4M03A 4MNGA 4ZFGH 4YBQD 3EYSH 2CK2A 1IGCL 4JG0H 4KC3B 1D5ZB 4Z76B 2UUDH 5I1HL 4ODSL 5SWZD 1EBPA 1JTOA 2OX5A 1BREA 3LH2H 2WUBL 5I16B 1NFDE 3KGRA 5DJZB 3PWVA 3RPKA 4IRZL 4X7FC 2GI7A 2VKWA 3S37X 2FL5B 1U3HC 4KJPD 4S10A 3NCJH 4RAVA 3I02A 3ET9F 4YWGL 4AEHL 1FFPB 4U6XA 4U1MB 3V5HA 3TA3C 4IOIB 1MCQA 2PXYB 3TBWB 4HUUA 1V5JA 4H20H 1KYOJ 2WSKA 4X5WB 5DK2B 2X4TB 1FP5A 2H32A 4ODHL 1WICA 4LCWA 4FFEX 1JL8A 3HUJE 1CFNB 4JHZA 4JFHE 4XNUL 5EO9A 3GMOB 3U4AA 4OLUL 4LVNC 5IM7A 3L6FA 3TWCH 4BQ8A 3ZDYE 3BP6B 2YA1A 3MV7D 5CEZH 4UNUA 3HZKA 3W39A 3UJIH 2IFFH 3PF2A 4NP4H 5FGCB 1WAAF 3MGOB 1I3RA 1OT2A 5KVDL 5KSUB 1R3HA 2UZXB 1WCBB 3B3IA 1N64H 4H1LH 1WIOA 2AJVH 4LCYA 5BS0E 3UTSB 3ULUD 1HXMB 2I27N 2X4SB 2OR9H 5C8JB 1NGZA 3OKKA 3QDJA 4Z7UF 1A4JB 2ICEA 2HH0L 4GAYA 3ULVC 4OF0A 3DV4B 5DUMH 5F9AC 4GW1A 2OSLA 4OGXH 1VSCA 1WQVT 2P46B 1GC1H 3NH7H 4YR6A 3GSVA 2DYPB 5KW9L 4EDXA 1OY3B 3KDMB 4IDLA 3HE6D 5IJVA 3FT4B 2J8UA 1T6VN 2VXSL 2F5AL 1RZKH 4ZOBA 3MJ6A 1D5IH 4U0RC 2XN9A 3NPSC 4JJ5B 4Q9BA 4JFXA 4U1KB 1UWEH 3AMLA 3MRQA 5FO8A 3BAEH 3P3YA 3FQXB 1NSNH 4JRXE 1F58H 2VLME 3LDBB 3DJ9A 3X13A 4D0DA 1S9VA 1QFUH 5M7QA 5CILH 1QR1B 5HYFA 2VDLH 1WTLA 1R3JA 3BQUD 5BRZA 3VFNB 3R1GH 3RUGB 4MYWB 5JTWA 2GEEA 4X6DA 1RJLA 3KPTA 4G6JL 4ELMB 1P4IH 3MRFA 4NHUB 1A1NB 3ZHLA 1WBZA 4FTVD 5H2BB 1DUYB 1KCSL 4FMFA 4MAYA 1J1OL 2V17H 2BNRE 2ARJB 3FOLA 4OQTL 4LSUH 4Y5VB 2EE2A 1VCAA 1W0VA 3CFCL 2W0KA 2VERN 3HMWH 2EYTA 3QIWB 4R8WL 4Y4HD 1UA6H 1CR9L 3VJ6B 1BVLA 3STBA 2QBWA 2F74A 3MCG1 4Z78B 1GVIA 4F7PA 4LVHC 1OTSC 1UQSA 1P6AB 4MXWH 2YC1A 4GRMA 4S1DC 2R0WL 1AXSA 3OJVC 1RUPH 2XNAB 1JWSA 5HGBB 4UNVA 3DUUA 1F6LL 5HYJD 3CDFA 1FO0B 2D31A 4KUZL 2ADJA 1EFQA 2C5DC 5L7XL 5IFAL 5JHDB 1BQHG 4M7ZB 4CBPA 1D5MB 3O4OC 5GGUA 4HBCH 1V3LA 4PJEE 1HI6B 4OQ1A 2VJXA 1JF1A 1GOGA 3GMPB 1CD0A 4R0LA 4PJ5E 4ISVA 4OGYH 2FCBA 4DTGL 4LLQB 1YY8B 1M7IA 4G6KH 3MLXL 1P7QB 2J6EA 5IESH 3PQYA 4APQD 1FSKB 4TQEH 1JZ6A 4XMLH 4PRPB 1FVDA 3HC4L 1JWMA 3O3BB 1R3LA 1CL7I 1CFTA 4PJ7B 2QR0B 3TVMD 1KN4H 3VI3F 3JSSA 3TBYB 1SEQH 1L0YA 5BW7C 1CGWA 4OI9A 3VWJB 2WNGA 3BZFB 1KJVA 4P2OA 2VUOA 3REVB 2MTPA 4UT9L 4LVOC 1HWHB 5JW3H 2NYYC 3T2OA 4PJXA 4PP2B 1WZ1L 1JIBA 3PNWA 3SQBA 5ITBH 2O61B 4GBXC 3OKDB 1J7VR 5HY9B 1G6RL 2UVFA 1CXFA 5FA4A 3RDTD 3QNXB 4JO3H 5E1HB 4RAHA 1H5BC 5SWZB 5C0NC 3EAKA 3HN3A 1YZZA 5IB3B 4KI5D 3NFPA 1AI1L 1X5KA 2L0DA 2W0FA 4JZJC 4ZS6D 4JANB 4HWBH 4KJWC 5FO7B 3BIAX 3K8LA 3IDJA 1WWCA 2XQYK 4M7LH 5ID0B 2WINA 1U0QA 1DQTA 2WANA 1FNLA 2EKJA 4JY6B 4LFHD 1S9YA 4DGYL 4E0RB 1GAFH 1L0XA 4MHHG 5GGTA 4CW1A 3MRLB 2GK0A 2CLRB 4PLNC 3HCVB 1W2KT 4MS8D 4RWYH 2X1WL 4MXQC 1L0QA 1T0NA 3DXAD 1LD9B 4IRSA 4QTHA 2XKNB 5FM8A 1MUJA 1SVCP 1A1MB 4KHTH 1PFCA 4Q6IA 1R6VA 4FMKA 3ARFC 3MV7B 4NO3A 5L0QC 1OAKH 3EYVA 3QP3A 3VXMA 5DYOB 5KVEL 1QSZA 3OX8A 4K94C 5D5MF 1YNLH 4L9LB 1CL7L 5T1LD 3IVKB 3V0VA 5GXBB 5DXWA 3A6CH 2X4RB 1P53A 3PV7A 3TZVB 3FB8B 5HVFB 5I76A 1LDPL 4JY4A 5HHNA 1H15B 4EI5C 4Y7MA 5JW5A 1S7XB 5F7MC 4RQQB 3O9WC 5AD0A 2E5EA 4OLYL 3S8WA 3IFOA 4LOUD 2WY3A 1LEKB 3FN0L 1FYTD 4LARH 2KZ1B 3CX5J 4R7NA 3I6LD 4XX1E 3QPQC 3LKSB 4WWKD 3NCYP 5H8DA 4PTTA 3S37L 4HKJB 4N8CL 4GRLC 3QI9D 2IC2A 4NO2A 4ZUVB 1YMMB 4UTAH 1HKLL 4G9FB 1EA9C 2EDFA 4QHLA 3SJVD 3D48R 4TN9A 5C0FB 2DL2A 1IVLA 2FBJL 4MMXC 3SKOA 4P3CH 4K3DL 3P4LA 3O4LB 1KPUA 5TE6L 3X3FH 1I9JL 2KKQA 1YEEL 1QNZL 2PW2B 4ONHA 3FB5A 4XI5D 3MA7A 5BOZG 5KANI 3HAEH 2PNDA 2OLDA 4XXCA 5CP3H 4ZNEA 1Y18B 4XP5L 4ZPTA 1YEJL 4IIQA 3EYUL 3TO4D 2Q3AA 3TJHA 4HJGB 4OV5A 2GJ6A 4JB9L 1TVBB 1I4FB 5IHUL 4EUPG 5GGVL 5AZ2H 4LNRB 4HXAL 3OHXB 1BWMA 1TFHA 2W65A 4NIKB 4PBWD 5D93B 4HX1A 3RY5A 3ZE1E 4JO4H 3UTTD 4I18B 3HG1E 4YLQT 5FUOL 3TNNB 4Z7VB 1PY4A 2EC9T 2GITA 5CIPA 4Y4HB 1T04A 4PRNB 3W0WD 5C0CD 1HK6A 1H3PH 1P7KA 2R4SL 1ORSB 2DQEH 5KTEH 2ZSVB 4BFIA 1BD2E 5DMGC 5TDPA 3ABZA 5IROC 1PGRB 2VL5B 4KJQC 4L4TE 3EOAA 5EUOF 4LL9A 2Y6SD 1ZSDA 5E2WL 1EHXA 5GGVY 3QCVL 2DQHH 1P4LA 2VDKH 4XTRC 5TDOA 4Y4FD 4OIBA 3ZE2F 1ZT4B 3I50H 4WNQA 3KNBB 3T2NH 4PJCB 4U3XA 4JFEA 2X42A 3LB6C 3ULSB 4G3YL 4N90E 4YDLB 2BX5A 3WNKA 3WIHA 4FG6C 3FFDB 1FNHA 3MJ9A 4OSUL 1KIQA 2VLJB 5SWQA 4XPFH 1XF1A 2HTLD 5A16B 3NOIA 3U46A 1YECL 4J8RA 3BP7B 4KKLC 4APQB 1DE4A 1LK3L 3X17A 2VSCA 2OQJB 3KLHC 4KDWA 5I2IB 5DJ6B 3EO1B 1IAOA 3MODH 3RWEB 4PJAE 4ODVH 1CQKA 3IXTA 1KEGL 4AH2B 2ATPB 2AXJA 5DF0A 3U0TB 5T1DH 3BKMH 3KPNB 3MV8E 4GQPH 4TRPH 3DX9A 1FFNA 4G8GD 3DI2B 1K5NA 3V8OA 4H25B 3ULUF 1BHGA 4W4OA 3GSRA 4HDIB 4NKDA 3D9AH 4P9HL 3MRNB 3ARZA 3AXLA 4KK5D 5D6DC 1I1AD 3E8UH 5DQ9B 1KJMB 1KJ3L 2ZCHH 3CX2A 4RGOL 4U4BA 5ID1B 1NDMB 5AAMA 1OTUC 1I1RA 5DC0A 2RQ8A 1F3JB 4HJJH 1W72B 5IV2B 1MAJA 1KJ2B 1CYGA 5T33H 2C3VB 1K6QL 2WBJB 1J86A 4JQXA 5IBUB 2NX5E 5F7EH 5IBTH 2DQTH 4Y5XA 2Z31A 1M7DB 4JFPA 2XZZA 2YHGA 4DUXA 2ZCKH 2YD2A 4OQTA 1UWXH 2H8PA 1G7MA 4QO1A 5CWSA 2DF3A 1G84A 3OR6A 2HFTA 2IALB 2VZTA 3MV9B 1RU9H 3LKQB 4KK9D 1DLHA 2X7LB 2ZUQC 1M05B 4P49A 3P9LA 4FP8H 5J3HD 5T1MB 3BFOA 4K9EL 3QUYC 1NEZB 1PVHA 4NQCA 5J6GB 2APTA 5GS0H 1U93A 4D8PB 4OCMC 2AXGB 3C5ZA 4OD2A 5T1LB 2Q87A 3P9MA 2BVUA 3LEYH 1JHLL 2YEZA 1FCGA 4TOYL 3P4OB 2NY1C 5EIVA 1JGEA 3LS4L 4L8BA 3MACL 2P5WE 5ESVA 5FKPB 4LIQL 5JIPA 2NY0C 4KRPD 2CQVA 4LF3B 1HE7A 1HNFA 4G8FA 3CUPA 15C8L 4I2XE 4XAWL 4NOFA 7FABL 2V2XA 5TFSL 4JO1H 3M45A 5C0AD 3UC0H 4PJBF 2OXGA 2ESVA 3QI9B 5I1DB 2QEJA 2BSTA 1QHOA 3BDXA 5D1XB 1EJOH 5IG7A 1N5AB 3RVXC 2R2EA 1U3HD 1CWVA 5E9DB 1WJ3A 2QHRH 1XF3B 3MCLH 1RK0A 3TA3D 1TZIA 3FT2A 1RULH 1RMFH 2OTPA 2ZSWA 4P57A 3QEHA 4NKIH 4Q9RH 3PGDB 4PJIF 4WHTA 3P77A 3HLAA 1T6WA 1ACZA 4QCIB 1RJYB 3I75A 4YGAB 2WK2A 3VXUA 3LQMA 5L2KD 4KK8C 1G6RA 2UY6A 1UM5L 1A7BA 3O3AB 3V4VL 4XGZB 1VGKB 3TO4B 4JGUA 1JVKA 1ZANL 5KOVC 1I85A 2FJFB 3OPZL 1RZGB 4N8VB 1X4YA 3ZTNL 1IC5L 1NKRA 4YHIA 4YXKH 1CF8H 4V2CB 3DO7A 4OCXH 4RFEA 2UWEB 3IU4H 4HSQA 3FO0H 3QBTB 2BNQE 4HK0B 2AJXH 5MERA 2R9HD 1U8JA 2FHBA 4G6FB 4AQ1B 3PP4L 1FH5H 1ZVSA 2VDMH 3MBXH 4BZ2H 1D7FA 1ZHLB 1TVHB 3MLWL 5E1AB 2HLAB 3VXOB 3RRQA 3VRLE 1GGUA 4MNQE 1ONQA 2M1KA 4FFZH 4M4PA 5INCB 5B38A 4W70A 4KI5F 3KLSA 2XRAH 3ULVD 1FL6A 3OF6D 5EC1A 5AUMA 2AGJH 3RA7H 1NGPL 3LKNB 1JFQH 1I7ZA 3OXRA 5T1KD 1G7QB 3U9PL 1U3JA 3GMRB 5DZLA 4WFFD 4NNYB 4UTBH 4HC1A 2Z91A 3O2DH 4Z5RB 3G5VA 5JXEA 3QHZH 3L7FA 5A43C 2Y72A 1XH3A 2HKFH 5I1LB 4HWEL 4PRID 4PTUB 2WW8A 5M95B 4PRDB 2CKNA 3NGBC 1JPFA 1CT8B 2R29H 5IF0B 2FBOJ 4OLZH 3IDNA 5IMLB 1JUFA 1XF4B 1NLBL 3UYRH 5DVOA 5F6IC 4U6VL 4U1SB 2VXUL 5CEXB 5D7LE 1A6UL 4UOW0 2EIBA 2PCPB 2NY5L 4HK3N 2H2PC 3ZTJG 3LCYA 5MEPA 3PWLB 1M6OB 3PABB 1JWUA 5E8PB 3QAZB 2E6QA 4Z7QE 3G5YA 3BOVA 1ZTXH 4JFDB 1UKQA 2HFGH 4M1DL 1CQYA 1U9KA 5E8NA 2H6PB 4AJ0A 3A67H 1OTSD 1ZLUK 2ERJC 5I1IH 1YN7A 1IAKA 4S1DD 3AAZB 4AT6B 4M62H 4UUJA 1IQWL 2W1NA 2VLKA 3RNQA 2EDNA 2FD6L 1X9QA 4KKAC 1KLUA 4X4ZA 4WJ5A 5BVJB 3D6GA 5DT1L 1ZGLB 3GMNB 4GKSB 5F3HA 2N7AA 2CK0H 4OFYD 2PO6C 4P5TA 5C0RH 3OB8A 5FB8A 4XVJH 4M7KL 3PIQA 4U1GC 2HN7B 1DUZB 3QUML 4M5ZH 4Z7WF 5LCVH 5IMKB 3D3VA 4KTDH 2CUHA 2I9LB 3PDDA 1GH7A 1IM9B 4P9MH 1NMAH 1OSZB 1EGJH 1QYGH 5EN2B 2R4RH 4H8WC 3PDOB 2C3GA 3FQWA 2JCCF 5E99L 1PYWA 2XPGA 2Y06H 4AL8L 1MI5D 1LGVA 4DGVH 6FABL 5D7IA 4F58L 1D9KB 1CXEA 4NRZA 5IOPA 3UZEA 3X14A 1KG0B 1B3JA 1Z2KA 4J3OC 4JAMB 3OAUH 3UDWA 1G7IA 5C0DA 3QZWA 5IHZB 2DI9A 1K2DA 2NYYD 2FB4L 1BLNA 4QXTB 3BT2H 5MI0B 5BS0D 4GBXD 1MHHB 4LSSH 4XXCC 4CN1A 1NGWB 1IEBB 1ZHNA 1CVRA 2DIAA 3E6HA 2A6JB 3PV6B 1S9KC 5GPRA 5C0ND 1NMCB 5EZLB 3TJHC 2EECA 2JB5L 1BVKA 2VQ1B 2VQUA 4M8QB 3TEUA 5H35A 3VGGA 1JZ8A 4JG1L 3D87B 3NFNB 4GG6E 4KJWD 2DD8L 3BKJH 3RL2A 3FO9A 5J6HB 3ALXA 4LRNH 5F7UA 4WI8A 2BFVH 4PRBA 4R7DB 1QR4A 3MJ8A 2DQDL 5K9KB 43CAB 1FNGA 1G7LB 4JRXD 2VLMD 4DEPC 5IEHB 3BPNC 4MXQD 3QG6A 4W68A 2BVOA 3CVHB 3ZHDA 2CDGA 4MQSB 2G5BA 3ARFD 5IUSA 3DGCR 1BQHB 1OF2A 5C08E 1IBGL 1VB9A 3TH2T 1QSFD 1BZ9A 5K59E 1QBLL 3F58H 1GPOL 1M71A 4C59B 2BNRD 3BXNA 3IJSA 1MY5A 2AI0H 4BH7B 1FBIH 5I1KL 5IVXF 4K3GA 4H88H 4MZ2A 4GW5A 1MVUA 4EI5D 1GGYA 1S7SA 3V7MA 5ENWA 5K9QI 3TCLA 3O9WD 5EU3B 4XXDB 4XBGA 1A3RH 1S7WA 1J1XH 4LLWA 4PG9A 5GRYA 1I3GL 1JTTA 1FNSH 2A6DB 4GMSH 4DVBB 1K4CA 5I8OH 1HH6A 4ODBD 5FGRA 1B88A 3Q5OA 3QPQD 1P2CB 3OKNA 1QLRA 3MV11 2XWBA 1FC2D 2YD8A 4EXKA 3DUHA 2VDRH 3KAAA 2HKHL 4B53A 4J12A 4EZMA 3UAJC 3K2MC 1NC4A 3UCRA 3GIVB 2A73B 1CGSH 4HS6A 3KPSE 3MRMB 2GTWB 1QO3B 5C2UB 4QXWA 1IILE 3GHBH 4MCYA 3G6JF 1IZKA 2XTLA 4G7VL 5D1QB 4Y16A 1IM3B 2FYYB 2LFGA 3QEGL 3CGTA 3T0EA 2JELH 3GSQA 5DJCA 4M1GL 3I3BA 2B2XH 1ZT7B 2DI7A 4I4WA 2OBGA 4GKNB 4XCFL 4MDIA 4GW4B 3BZDA 1OAXH 2HFFB 2HVKB 3O2VH 4LSTL 1T20B 1EPFA 3L5WB 1G7HB 4JQXC 3U7WL 4O2CA 3WS3A 4W6XB 3VFVB 2WM0A 4WGWB 3OG4B 5ETUB 3OB0H 1A3LL 5I1CL 4U3HA 1J1PL 3THMH 1KCGC 2RJMA 3ZHKA 1DVFC 5JA9A 1HYRC 4P48A 3SGDH 5DVLA 3VXSE 4IOFC 1WBXB 5I15L 4QOKA 3TIEB 4WFED 1CK0H 4DCQB 1KIPB 1NC2B 3QJFB 4JKKA 1AKJD 1Q94A 5I1JL 2A9NH 4U6HB 1ZLWH 5DMGD 1RZ7L 4MJIA 4PBVC 5B8CB 2YXMA 1FL3B 1MCEA 4KJQD 3L3OA 1N4XH 1NANI 1KFAL 4HGMA 4IS6A 3WD5H 5I8CA 1OB1A 1RK1A 1OAUL 1WFNA 4ZTOL 5IBLC 4X6CF 5J13C 4XTRD 1KLGB 3C5ZC 3IFLH 3RWDB 3HE7A 3HRPA 2Q20A 3FHQA 1JNHB 4H26A 4DGIH 3LB6D 5E8OB 4ZYKA 5CBAB 1HINL 4TSBH 1JNLH 2DKUA 2Q8AL 5EZOL 2OCFD 1OM3H 2FX8H 3F5WB 1IEAB 3Q2CA 4FG6D 1A1OB 3MLVL 3QXUA 1I8MA 3QDAA 4X98B 2B5IC 5HGDA 2HT3D 1F4YL 4XCNA 1JF5A 5C92A 3MLPA 4KKLD 5IIEA 3T3PF 1MREL 3KLHD 3V79C 5D2LF 1ZK9A 1J87A 1XCTA 3BVNB 4V1DA 1MI5B 5JHLL 1OCWL 1UYWH 4S1SL 5JDSB 4L4VB 5IB4B 1FDLL 2CLZA 1RHHB 5HHMB 3LHPL 2Y5TB 4EQ3A 2BRRL 4N9GB 1AO7A 2OP4H 3MA9L 5DJAA 3VCLB 3ZDZF 1JE6A 1L7TH 1VPOL 2VDPL 4NFBA 1A6AB 5EA0L 4F7TA 1U8OA 1DEEB 1DLFL 3LRSB 2DI8A 4WHYH 4OD1L 5FOJA 1DBMH 3KLAB 3MRHA 4JCMA 4ACPA 1OOAA 1HHGA 1HCFX 5HPMA 3EYOA 4D0CA 5EOTB 3NAAL 1LNUA 1TTFA 1YPZF 1OTUD 4OD3H 5L2JB 1QOKA 3ARRA 2P8MB 3Q5YA 1EMTL 5CP7B 1MWAB 3ARVA 1I85C 4NCC2 4WU5A 5D7IE 5AYUH 3H6JA 4FQLL 4LEOA 4EUPB 4HZAA 2BDNH 3MLZL 3SE4C 4PRHA 4JZJB 1J5OL 3MYJA 1C5DB 4I5BA 2QTEA 1EZVX 1YEDA 3EW3B 3HS0A 4UIKH 3SDYL 5EU4A 3WKML 1UACH 5ACLA 4ORZC 5FM5M 3EFFA 3SN6N 4D0BB 3T1FB 3RJDA 3QWRA 1V3MA 5CSZB 4OZIA 2V5TA 4KV5F 2IAMD 4BYHA 5JZ7C 4XNQA 4WUKH 1O7VA 1F3RB 2X89A 4K7PX 1MFNA 5FUZL 4PJGE 1VACB 2Y07L 1T1ZB 2X40A 2MCG1 5LAXB 2GW5A 3BRFA 3MBEA 2YD9A 3QUYD 2N4IA 2QLVB 2HA1A 3GM8A 2JIXB 3K2UL 2ADFL 5C71A 3AROA 1CU4L 1QSFB 3TO2A 1KB5H 5DMIH 2ZJSH 3D69A 4P23A 1OL0A 5HVGB 2XN9D 1A2YB 3M1BB 1NAML 2NY1D 5CZXC 3NA4A 5C0IA 1EFXB 3MUHL 3IF1A 1QPXA 3QUMA 4BUHA 3MRIA 3O9WB 2VXVL 4RGNB 1BD2D 5BJTA 1F4XL 5FXCH 1WC7B 4L4TD 1NFDF 3QFJE 4PB0H 3TJEH 2F19H 4JLRB 2YRLA 2X1QA 4NQDE 4WVRA 3RPIA 4GRLB 4ZUTB 4YBLC 1S78C 2ID5A 2H9GB 3ARBA 2KBGA 2Y36H 4JKMA 3DUSA 4QGYA 4X6FA 3RVXD 5LQBL 2BOBB 4JFFE 4LASH 2DL9A 4PD4J 4I1NB 2ORBL 2Z92B 4ZUWA 2D9QB 4KMLB 2B0SH 4L8CA 4DKDC 1RJZA 1EEYB 3G08A 4ZOEA 2YZ1A 4ONGH 5GQBA 5EZJB 3RL1B 4X8JB 1EO7A 3HZVA 4HLZG 4QKXB 5IR1A 5IQ7H 4EKXA 4P2YA 4FFYH 3ZDYF 1QD0A 4NBYB 3RY4A 3T4AA 2VDOH 1EHLL 1IFHH 2XZCH 4K55A 1XAUA 5ICYA 1B0WA 1YYML 4I77H 4BELD 5L8LB 3QDGE 1IKNC 2IH3B 1NCCL 1OT1A 3FQTA 2Q76B 1FG2A 5JIHA 2NTFA 2NLJA 5I0ZA 3RWCB 4YNYB 2NNAA 1IGMH 1HCVA 2DRUA 1MEXL 1JRHL 3M8OL 2EO1A 5CD5C 4BK5A 3O8XC 1AY1H 4JM2C 4J1UB 1FFOB 1RUQL 3GSNL 3GNML 3KYMB 1AKJB 1KBGH 4TUOB 5DJ8A 1K8IA 1KACB 3N85H 4XCYB 4JZNA 5GJTH 5DUBA 2FEDC 5B38G 5K9JL 2KH2B 2XWJA 5I9QB 5IB2A 1BECA 4KHXL 5AG9A 2A74A 4UBDC 5BV7L 4OLWL 1BVZA 4LDLB 4Q9QH 3P0VH 3CMOL 4R26H 2NX5D 5GRVK 1N2RB 1J12A 4IMLB 1E0OB 5TJWK 2V9RA 4QWWC 5ADPL 4FQHB 1FLRH 4JFQA 5E6YA 4WCYH 4LDEB 3QNYB 3GB7B 2QKIB 3WFDL 5TQ0L 35C8L 1JN6B 4MNGB 1VA9A 5KZCB 2MPAH 4P4RA 2G60L 1RVFH 5DD1L 2IPTL 2XXCB 2D7OA 4JHBA 3IRPX 2MSPA 5ALCL 4AEFA 3PWVB 1F4WH 1F42A 3PG2A 4LHJB 2APFA 5EBWA 3K46A 2R0KH 2H2PD 2ZOLA 3LPWA 1J8HE 3QQ4A 3GI9L 4RAVB 4LEXL 3I02B 4U6XB 3V5HB 3PHQA 1G0XA 4HUUB 3B8YA 4U33A 4TTGA 4DN3L 1LK2A 1MCFA 2H32B 1PEWA 1FPTL 4LCWB 1HEZA 2P5WD 3U83A 1OARL 4ODXA 4GAGH 4NT6A 3WDHA 5EO9B 1PG7H 1UADC 2RFXA 1KPVA 2C1OA 1KC5H 5GJSH 1MAKA 4O58L 5IM7B 3L6FB 3EOYG 5C7XL 2W9DH 3HZKB 3W39B 4PIRF 3EZJB 3VXMD 1ZOXA 3ZKNC 3P0YL 4KKAD 1QKZL 3CSYA 1I3RB 2EDJA 4PJEF 2V2WA 4QRRE 1R3HB 2PO6D 3B3IB 3WXWH 2EYRA 4QXGH 3DIFA 4EI6A 4LCYB 1HHIA 4FABL 3GJEA 3V9FA 1MCLA 5F71A 1NGZB 3OKKB 5ERWA 3QDJB 2ZUQB 3OKEA 2ICEB 2VAAA 1MFCH 3K0WA 4GAYB 2VQTA 2PYEA 3UPRA 2WUCH 4GW1B 2OSLB 3KLDA 4MA3A 5ANME 3CFJA 1AGFA 2FGWH 3PGCA 1MH5A 5F7WC 4YR6B 3GSVB 3GSXA 4PRHE 3QUXA 5IB1A 4EDXB 2P5EA 4WI9A 1KENL 5IJVB 2VRAA 2J8UB 3SCMA 3QO0A 3QXWA 4DQOL 4DK6A 4KROB 2XN9B 5LGKA 3SHSA 3D18A 4UB0L 2WV3A 3IAGC 2NY1B 3QPXL 4JFXB 4LKCA 5LXGL 1LE5A 4HQQL 4XPHL 4N5EA 5FO8B 3MRQB 1DCLA 3CVHH 4Y16C 3QZWG 1FZMA 4Z8FL 3HMXH 4DN4H 4YK4C 3T0EC 4HS8H 3AFLA 2NY0B 3WHXA 3X13B 4D0DB 5C0GA 1RIHH 1S9VB 3KXFE 2LTQC 3GKWH 1MCPH 1R3JB 5BRZB 2IG2H 2W9LA 4MNQD 1NJ9A 2MWCA 3EDJA 3H8NA 1RJLB 4X6DB 3UEZA 3MREA 4AY0A 3MRFB 4A6YH 3TP4A 1WBZB 2CRIA 1C7TA 5DMYA 3TT1H 1V7MH 3F7PC 5F7KC 4FFWC 4MAYB 4N68A 1OAZL 1ZE3C 3FOLB 4GO6B 3WO4C 5LG1A 4KKBC 1Z3GL 2J4WH 1W0VB 1KV3A 1FO0L 1PKOA 4JQVA 4LSRL 1JYVA 4LCIL 5E8DH 2EIEA 2EYTB 4K7PL 5BVPL 1PSKH 4GOSA 1BVLB 3GSOA 5J57B 4ZFFA 3TN0A 2F74B 3OGCA 2C3WA 4OB5L 4F7PB 1ZEAH 2X05A 4HJ0C 1UQSB 4NN6C 5F9OH 1EX0A 3O2WL 3VRJA 2YC1B 4GRMB 1EVUA 2Z8RA 3ILPA 1EZVY 1AXSB 4YHNA 1JWSB 4P3DA 3DUUB 1U91A 2V7NA 2DQCH 2D31B 1MIML 2ADJB 3S88H 2QQLL 3B9EA 5DRXA 1CLOL 4LLUA 4ZS7H 3HE7C 5D7LD 5GGUB 3HI5H 4XB8A 4G8IA 5D1ZA 5HHOE 1MAMH 4ZDHA 4K7PY 1I1FA 1MVFA 4YHZL 3E2HC 2D0GA 4OCYH 1JF1B 1BBDL 2WBKA 4DVRH 4L3EA 1T2XA 4OFIA 4R0LB 1IE5A 4ISVB 1FLTX 1MFDL 2OK0L 4O02L 1M7IB 1IGIL 5FA3A 1SJHA 3PQYB 4GUPA 3WCYA 3L9RA 4B41A 2XOTA 1FVDB 1UC6A 2I5YH 1JWMB 1R3LB 2AK4E 1CFTB 2IH1A 1PKQA 5DD5L 3P4NA 5C07A 4XNYH 5I8EA 4RFOL 3OKOA 1Q0YH 4P2RA 3UAJD 5D7KE 3RIFK 1MQKH 2R69L 1ZWIA 4XPTH 1KJVB 4P2OB 1MCNA 1TTUA 2O5XH 3CZFA 2E27L 3F7YA 5FYKE 1NAMA 4PJXB 2W0PA 3SDDA 2AW2A 3PNWB 4NDMA 1RIUL 3DHMA 5FA4B 4RAUA 3RIFF 1WAAA 1ADQH 1A47A 4YHPA 2W60A 2EH7L 3ARGD 3EOTH 4NQEE 2Z93A 4WI7A 1F8TH 2DQGH 3NFPB 4NM4H 2W0FB 5F6IB 3CH1A 4PJ9A 2A0LD 2YA0A 4QTIH 4KZDH 3IDJB 4BK4A 2DQJL 2NY4C 4TUJA 3ARWA 5ISZE 4NUGL 3MLRH 1UXWA 1F90H 1CGTA 2WINB 5GS2H 3HI1A 4Z7UA 3MGAA 1OW0A 1S9YB 3FN3A 3U82B 3QRFM 1HN1A 1DVFD 3MPCA 1JPTH 4CW1B 1SBBA 4IOFD 2GK0B 5B39A 4HIIA 5HJ3A 4QRPA 1GZQA 1A4KA 1T0NB 4IRSB 4QTHB 5DEZA 1FORH 1MUJB 2ERJB 1ZMYA 4PP8C 3B6SA 4CU7A 4JVWA 3ULUL 4NQCD 4Q6IB 5AYQA 4NO3B 4WW1A 2EDBA 4WI5A 2UYLA 3EYVB 3VXMB 5IBLD 5F1KC 2FR4A 3H3PH 4F7MA 1YEIL 1JHKL 1H0DA 2YKLL 3C5ZD 2FZ3A 1I9IL 2OJZL 5LWYH 1OQXA 3WNLA 4HHAA 4E41E 3OX8B 1GIGL 4BQ6A 3O6FA 3MXVL 3V0VB 3MLSL 3PDGA 2BMKA 5GHWH 3MJ7A 1MRFH 2ZCLL 4Y5YA 4HKZA 1NCNA 5I76B 1QZ1A 3NMEA 1QBBA 4JY4B 1MWAH 5HHNB 5JW5B 1RFDL 1P84J 3SO5A 5AD0B 5SWSA 1KIRA 4J6RL 3QCUL 2YN3A 3IFOB 5H37G 5FYLH 3GSNA 2DWDA 3RU8H 1X5ZA 5JR1H 1ZHKA 3HB3D 2A77L 4HKBA 4R7NB 3BKYL 2AJUH 2EE6A 4PJAF 5C09A 4PTTB 3VG9B 1G9NC 4PYHA 4XHJC 2ESVD 1ZLVH 3IYLW 4NO2B 4EDWH 1PDKA 2DDQH 1IAIL 4Y19A 5C08D 1AC6A 1IKFL 4QHLB 4MA7L 3QEQA 2NY2B 5D7JC 1B2WH 1J0KA 2JTDA 3SKOB 1KPUB 2APBA 1F3DJ 4ONHB 3FB5B 3MA7B 3G6DL 1UWGH 1FGNH 5EBGA 1KEML 5IJKA 2EDXA 3B9KA 4ZPTB 4IIQB 3IDGA 3RVTC 4LP4A 4PS4L 3WNMA 4IRJA 3DROA 4KY1H 2GJ6B 4OV5B 5FUCE 4YHOH 5EWIL 5FM5O 3WFZA 5ADOL 3QHFH 4YDJA 4OZGE 4O9HH 2W65B 4M6NH 1TZHA 1XIWA 4MGXA 4XC1H 4HX1B 4JKPL 3KPQA 5FOBA 3KPSD 2OR7A 3AREA 1NCAL 2F54A 2GITB 5CIPB 3JWDC 3R06A 1T04B 1QFWI 1K3ZA 1P7KB 2ZPKL 5L88H 5F1SA 2IQAA 5JZ7D 1Q1JH 4BFIB 2QQNL 3CSPA 4DEPB 1BFOA 3CLFH 3UZVB 5TDPB 1DBKH 4KGJA 5KS9E 1A0QH 1YJDC 3EOAB 3RY6A 1ZSDB 4Y1AA 4PB9L 4R2GD 2A83A 1P4LB 5TDOB 1MCCA 4ERSH 3P11H 4XPBL 4WNQB 5FM4A 5EU6E 3LEXA 4ZNCD 1QSEE 4M6ML 1CGXA 3BYTA 5TF1L 4JFEB 2NPLX 3G6AA 3K4AA 4HFUH 1JNNL 2XQBL 3E3QE 3SDCD 3LS5H 3TESA 3BI9X 1ERNA 4JZOA 5CZXD 4X6BA 5DO2C 1KIQB 4Q58C 5SWQB 1CDYA 3MRJA 5JPNA 4WENB 1D6VL 1JGVL 3U46B 3OB0K 4J8RB 1KT2A 1DE4B 2BVYA 3JV4A 5HDQL 5JQ6L 3H3BC 3ARPA 1IAOB 3AS2A 1P4BH 5IK3A 3IXTB 1UGNA 3GRWH 1S78D 1CE1H 3QIUA 4GAFB 3DX9B 1RHFA 1FFNB 5CINL 1OPGH 3CZJA 4KXZH 5FYJH 1LO2L 1KJ2L 1Q9KA 1K5NB 4KQ4L 3GSRB 4NKDB 1QTYT 4U6YA 1E6JL 3AXLB 1C16A 1YQVH 1JI2A 1BX2A 3VXTA 5E8EA 3D85D 1YC7A 3P30H 4CKVX 4N0UE 1QFWL 3VGAC 5KVFL 1AH1A 5D5MA 2DM7A 4EIGB 1J88A 2ZKHH 2VLKD 1CDHA 3L1OH 1HWGB 1ZLSL 3C6SA 2DTMH 4FQCL 3S34H 4Y5XB 4HAGA 2Z31B 4JFPB 2LE9A 4X7TA 3FQNA 4FXGA 4ETQA 3R0NA 1T5XA 1U58A 3ES6A 2H8PB 3SGKA 1G7MB 1JPSL 4ZTPH 5CWSB 3O8XD 4OI8A 3EIFA 4XVSL 4JM2D 3VRLF 3OR6B 4ZFOL 5GS1C 1DLHB 4W4NA 3P9LB 4OJFH 1XF2A 4QRUA 2OMNA 3VE0A 2FEDD 4RIRA 3UX9B 4NQCB 3U4BL 3GK8H 1U93B 3V4UH 3QUXC 3H9SE 3JXAA 4UBDD 1NPUA 2J88L 3SCMC 3A0OA 5FUCC 3C5ZB 5T3XE 4OD2B 3NIDE 2NY6C 4PUBL 3P9MB 4X5XA 4PGBA 4OTXL 4CVZA 2YEZB 3HKFA 3IDXH 1Z9OA 3FRPA 4QWWD 1JGEB 3QRGH 3KJ4C 5CJBA 4L8BB 5ESVB 2NW2A 12E8L 1AD0A 3TPUA 3SOBH 4KDTA 2PR4H 5DHYA 2WWMC 1DL7H 2H41A 4RISL 5L6YL 4G8FB 3CUPB 3OKLA 4BQ9A 3O6LH 5FIEA 2BVTA 5F7DA 2V2XB 4KQ3L 3W9EA 3S96A 3IB4A 1CDIA 2ESVB 4R97C 2AXFA 4ZODA 3WKNA 2BSTB 3ZSSA 1KULA 4KH2A 4ZFGL 3KS0H 5IEKA 5IG7B 4I3RH 2R2EB 4JG0L 4POUB 3GSUA 2Q86A 1RK0B 4JQIH 3U48A 3JWDH 4N0RA 1TZIB 3FT2B 3MOBL 3SBWA 2DBLL 2ZSWB 1I9RH 4P57B 4Z7QF 3QEHB 1AGCA 5EUOA 1Q38A 1CS6A 3ZKMC 4WHTB 3P77B 3HLAB 1JHTA 3T4YA 4ZG1A 2NXZC 3I75B 3VXUB 5F88A 2D3VA 4GRWB 1G6RB 2RIKA 1KGCE 1MIEL 1MCOH 4JN1H 4WDIA 3FOMA 2QQKH 4CUCA 1WVZA 4H20L 4WIQA 2BVPA 3O3EA 3BE1L 3FTGA 5MP6H 2AEQH 2AEPH 1NL0H 4YHIB 3ZKND 4NQDD 2GIYA 4Q6YA 5D8JH 3DO7B 4Y2OA 1TQBC 4HGWA 4R3SA 4C56E 4RFEB 5D1ZC 4I0CC 4WUUE 4X0KA 3W5MA 4JFFD 5MERB 5GS2D 1U8JB 1P69B 1OAYH 1ZVSB 1UCBH 4YPGA 2IFFL 4LHUD 4YFLI 4NGHL 1E4KA 4QT5A 4LCCA 1ONQB 5B38B 4TULL 1C5BL 1FL6B 2FH6A 5EC1B 3RBGA 5AUMB 1T3FA 3PHSA 2VC2H 1I7ZB 3P0GB 1CE6A 3OXRB 3QDGD 3Q5TA 1NCWH 1NC4D 1DQDH 2AXHA 4HCRA 1SJEA 1PLGH 4JR9H 2EDYA 2FJHA 3MRGA 4JPIA 1O7SA 3SDXE 3QG7L 1GC1L 2Z91B 2IF7A 3G5VB 2MQ0A 3MNWA 3NH7L 4MQTB 3SPVA 4Y16D 3HE6A 3L7FB 2VZ1A 3CK0H 1XH3B 3T0ED 5JORA 3BGAA 1RZKL 2EZ0C 4WEMB 1JPFB 4GQ9H 4DAGL 4YHYC 4ODWA 3IDNB 3ZKQD 1JUFB 5JOEA 4XMKH 4ZSOA 3OV6A 3BAEL 3C8HA 1F58L 4GG6F 2MQ3A 2VDNL 2B4CC 5EOQH 5HBBA 5MEPB 4FFWD 1AE6L 1BAFH 2HJFA 3S35H 2MFNA 3BQUA 3SEPA 3R1GL 2FATL 5SX5H 5IW1A 1OW0C 4LPCA 1JWUB 4KI1A 1CLYL 4FTVA 1T66C 3G5YB 4QOKD 5EB9A 5E8NB 4ETYA 3LRHA 1N6QH 4HJ0D 1HHJA 1YN7B 5HGHA 1IAKB 3UBXI 1Q72H 4UUJB 4PR5A 1A02N 2DB8A 1KCRL 3HZMA 3VFOA 3HMWL 4IEFB 1X5FA 2VLKB 3RNQB 1UA6L 3TBTA 1KF9B 5K59F 1KLUB 1CXHA 4WJ5B 5DHVH 4GT7A 3HE7D 5E56A 1AQKL 5IGXH 5EO0A 5F3HB 4MXWL 3CU1A 3T1WA 1UEYA 3O81A 1J8HD 1S5IL 4P5TB 5FB8B 1RUPL 3PIQB 4PJDE 4Y5YC 3WE6A 5HYJA 2AJSH 4MA8H 3D3VB 1GSMA 1IARB 1K4DA 3NABH 4Z6AT 4TUKH 5EBMA 3RWFA 4PJFE 2D0FA 1ZT1A 4TNWK 3FQWB 4K3EL 2XPGB 3HC3H 4OKVA 2FNBA 5D7IB 1FVCA 4OGYL 3FCTA 3VGFA 5GGSY 3P4MA 4Z0BL 4NRZB 5GGTH 1IGJA 3BW9A 4NWTH 1EDQA 4G6KL 5IOPB 1DJSA 3J7HA 3X14B 1AO7D 1S7UA 4PJIA 5ICZA 4TQEL 1U8QA 1T83A 1G7IB 4QRRD 4TNWF 5C0DB 3QZWB 1K2DB 3TVMA 1BLNB 1SEQL 1U8KA 2Z0BA 1T21A 1H3WM 1Z9MA 4WEBL 2AP2A 3CPLA 2R1YA 1ZHNB 3B9KC 4XH2A 5D2NA 3E6HB 1B4JL 1X5YA 1AJ7H 5T3ZH 4YZFE 3QIBC 5KSAD 1BVKB 1TENA 4IRJC 4FS0A 3IETA 5H35B 1EUTA 1RZJH 2VH5H 5JMRA 5ITBL 4PRHD 3FB7A 4XVTH 4MZ3A 3CAFA 3G5XA 5B3NA 4ZXBC 3OWEA 3RDTA 2YK1H 3RL2B 1XIWC 2NY4D 3OZ9H 3FO9B 4BQCA 4GMTH 3LQAH 1WFUA 2VZOA 4UZGA 1OP9A 4MHHI 4PRBB 3MJ8B 1V05A 2FIKA 3I2CL 1FNGB 4RMQA 5GRXG 5B39G 1YEHH 2X89D 1F13A 3QG6B 2BVOB 1IC7H 5IP4A 4XMPL 2CDGB 1FNFA 5IVZA 5HVHB 1GAFL 1RURH 2YWYA 5DD0L 4MXVE 2G5BB 1UM6H 1GGCH 1OF2B 1AQDA 4XVUD 4MS8A 4DZ8A 3GUTA 4RWYL 4W81A 1BZ9B 3BDBA 5J56B 3ULVL 3DXAA 1M71B 1YDPA 2YD5A 3BXNB 3IJSB 4F15B 2APVA 4KHTL 3PL6C 4UINL 3WFCL 3K3QA 1KTKE 1IGCH 4GW5B 5GZNC 4M6OH 1MVUB 1S7SB 2BOCA 4ODSH 4R90L 2HP4A 5ENWB 3TCLB 5I1HH 1B0GA 1T03H 4XBGB 3ZE2E 4LLWB 1S7WB 1YNLL 4PG9B 3ARQA 4ZFOA 1J10A 3C5JA 2WUBH 3VMOA 3FQRA 5T5FL 4IRZH 1K4CB 1HH6B 1T2QL 3OKNB 5J7CC 1QLRB 4FN0A 5CLTA 2XWBB 3UTOA 4YWGH 4AEHH 4XHJD 2IPUK 3QIUC 3ROOA 1NC4B 4K71C 1BF2A 1H3GA 2IQ9L 1FYTA 4HS6B 4LARL 2NMSA 1D3CA 4HV8A 4YO0A 4XNUH 2VN4A 3B2UC 4WWKA 5HHOD 4MCYB 5D7JD 1R5IA 4OLUH 4Y16B 2IANA 3D39E 5A2JH 3UJTH 3T0EB 3GSQB 5DJCB 1TQCC 4I4WB 2LV4A 1TMCA 3MNZA 3SJVA 4J3SA 4P2CG 2EICA 4HUMB 4MDIB 1C5CL 4F9LA 1Z5LA 5KVDH 5D6CA 3RVTD 5DQDL 4MCZA 2AK4D 1CBVH 4JHAH 2VLRA 4K8RC 4M9OA 3V6OA 4Z7WA 4O2CB 3WS3B 4B7LA 3VXRE 3KJ6L 3WO4B 1G9MC 1LILA 1VDGA 3NA9L 4M43L 4P2QE 4YQXL 1U92A 3U36A 2ZG2A 3SGKC 4WHDA 2NXYC 5FYKD 2JCCA 3H9YA 4QOKB 4JO2L 5AZ2L 4OZHE 4OZFA 4PJGF 5I18H 1NBYA 1Q94B 2NZ9D 3U30B 4E9LA 5KW9H 4NN6B 4MJIB 2BXYA 4OCWH 5DFVC 2G75A 2EXWC 5B3JE 5IWLC 3UTTA 4FZ8H 2VXSH 2F5AH 3L3OB 5E0QA 4IS6B 4JREC 4X8XA 5I8CB 1OB1B 1A6VH 4NQED 3W0WA 1RK1B 5C0CA 1H3PL 1VERA 5DEGA 4AIZA 1KCLA 2J1KA 1RAMA 3HE7B 4H26B 3T0DA 5E4EC 4ZYKB 5GRWA 4ZD3H 5ISZD 4YE4L 2HWZL 3DURA 2DQHL 2VDKL 4Y4FA 3C2AH 2D7TL 1I8MB 2XZQH 5HGDB 3ARSA 4G6JH 2BHZA 2X4OA 4XCNB 1IAIM 4Z0XA 1IT9L 3NCFB 5IIEB 1KCSH 2X1PA 4Z95L 5J11C 1J1OH 1XCTB 3LZFL 5IFHL 4F57L 4V1DB 5CJ5A 5I6XB 4H1LA 1J0HA 2C7UA 4XPFL 2CLZB 3PE9A 4J3UA 2VZ3A 3DRTA 3CFCH 3DVGA 3CLEL 1AO7B 5IHLB 2F53E 4R8WH 5DJAB 1CR9H 1EUUA 3Q3GA 3STLA 4E41D 4O00A 2CPCA 3SBWC 4F7TB 1U8OB 2ICES 2DQIL 2CKBH 3MODL 2VTFA 4ODVL 4MD4A 3MRHB 2OMBA 2R0WH 2VNCA 2XQYG 3EDDA 4PJBE 1HHGB 3KS0J 5HPMB 3B8SA 3EYOB 5I75C 4D0CB 1A5FH 1BFSA 3BKML 4TRPL 1LNUB 3CSBA 4G8GA 3GM0A 2EDQA 2CUIA 3U9UA 5IFAH 4K3HA 2X4NA 1OGAE 4WU5B 3RI5K 3S7GA 1DANT 2P7TA 3Q1SL 1I1AA 4LEOB 4XPAL 3JTTA 3DBXA 2JJTA 5IVXA 3MYJB 3QDME 4I5BB 4QRSA 1YEDB 4F7CA 1I1YA 3HS0B 4I0PA 5FHAH 3V52L 1ZVYA 5EU4B 4DTGH 3GBNH 2B39A 1CDBA 5GRVL 2HRPH 3EFFB 3ZZ1A 5FECA 4BUGA 3O41A 4AEIL 1ZLVK 4LSPH 1CI5A 4KKCC 3RI5F 4ZO6A 4UMGA 4OZIB 4K94L 4WI3A 1G6VK 2CR3A 4XNQB 4LCCC 1QRNE 3BIKA 1AGBA 3HNTH 1WWAX 4CVUA 4CGTA 2ZCKL 5IFJA 1UB6A 2J8OA 3MBEB 4KK6C 5E2UL 3DSNA 4TPRL 4UDUA 3WXVL 3ULUC 2D4DA 4NZDA 4YEEA 1XCQA 4FXKA 4LGRB 2R56H 3S6CA 3G6JA 4UT9H 3SCMD 5H94A 1RU9L 3TO2B 4MWFA 3OSKA 1TITA 3D69B 3UMTA 4EJ1C 4P23B 5IB5A 2NY6D 5F9JA 1A21A 1K3IA 4FQIL 5GGSA 1G6RH 4Q7DA 5C6TL 5DMJB 5HHPA 5C0IB 4YXHH 3FRPG 5C9JA 3HE6C 3IF1B 3QUMB 2FO1A 2DMBA 4KMTH 3HR5A 3FB6A 3MRIB 2WWMD 2MKLC 3S5LA 2QJDA 5BJTB 3LEYL 1A6ZA 1TJHL 1IC4H 3VGDA 3RPIB 3EYFA 2GQHA 3QJHA 4DGYH 3ARBB 4HULB 2P8PA 4PY8I 5LGHH 2CJUL 4RWHA 3DUSB 4X6FB 5EU6D 5I1EL 1QSED 2Z8VC 1PD6A 5HTSA 5E5RB 2VZSA 2J5LB 4X7EC 4M7LT 3F7RA 2A6KA 1G0DA 4ZUWB 5JW4Q 5C0AA 3U0PA 4L8CB 1LO5A 1QBML 1RJZB 2GT9A 3LIZL 3UC0L 3MOAL 1FNEA 3G08B 2XA8H 3ZKMD 1F6FB 1EJOL 5IR1B 4X6CA 3HZVB 3MNVA 1U3HA 2NXZD 4JCLA 1PZ5A 1X5JA 4MDJA 3TA3A 2AEWA 3T4AB 1RULL 2DWEA 1CL7H 3WFHA 5ICYB 1U36A 4GSDL 4NKIL 4Q9RL 3ROLA 3FQTB 4QY8A 1FG2B 3INUL 2NTFB 2NLJB 3RAJL 1XR9A 3UBXA 5L2KA 3I6KA 1LDPH 1VENA 2NNAB 1Q0XH 3MR9A 3QUKA 1S7RA 4Y4KD 2AERT 2CR6A 4MLIA 5D2LA 4Q9CA 4OLVL 1TTGA 3CDYA 1T7ZA 3S37H 4OCXL 4N8CH 5DJ8B 4HWBA 1W8OA 1IGYA 1K8IB 3IU4L 4JZNB 5HVWA 4WWID 5DUBB 4JRYE 1W0WA 2XWJB 5IB2B 1Y0LA 2G5RA 2A74B 2VXTL 4XP6L 2VLRE 4YEFA 2VDML 4BFGA 4TTDC 1BEYL 2FBJH 4AQOA 1QACA 1CGYA 4FZEL 1NGYA 2EE9A 4C54A 2J12B 1I9JH 3KPRA 1WTGT 1YEEH 1QNZH 4HKXA 5C86A 2ATKA 2E7BA 3U2SA 1B90A 1YPZA 4JFQB 4UQ2A 4XT1C 1JFQL 4G6AC 4BQBA 4CRPA 2P44B 4XP5H 2XT1B 5T1KA 3IKKA 1PEZA 3EYUH 2VOTA 4U7MA 4KDVA 1FG9C 3CCHA 2EZ0D 4HT1L 5FDYA 4MB4A 4QRQA 2CLVA 4P4RB 5IHUH 4HXAH 4HK3J 1YEKH 3NVQA 3O2DL 1MJ7L 3H9SD 4PRIA 4W6YB 5EBWB 5FUOH 2ZOLB 5T3XD 3QQ4B 5SV4A 1QLEL 2YUWA 2R4SH 1INDH 3PHQB 3U1SL 4KZEH 4UAOB 1M1SA 3SE3C 1LK2B 5ECJE 3MLUL 2X9YA 5CEZE 5SX4I 5TQ2L 2BY2A 3NCEB 4PJ8C 1HEZB 1Q9LA 1T66D 2LABA 4ODXB 5E2WH 4NT6B 2VDQL 1TCMA 3ZYOA 2RFXB 4MSWA 1VGEH 1KPVB 2C1OB 4Z77A 4RMRA 4X9BA 3DLQR 3QXVA 1VKXA 4TVPE 2HFGL 3K1DA 3GBMH 3CSYB 4ODTL 2GTZA 2AQ3A 3OKMA 2V2WB 4I9WE 5I1IL 1SEBA 4NWUL 2ARJQ 3HAEA 4J4PC 2FO4A 1YECH 2EYRB 1NQBA 3DIFB 4EI6B 1LK3H 2VAJA 1HHIB 1L6ZA 2ZUUA 1WBYA 3GJEB 2C4FT 3MTRA 1NFDA 5ERWB 3OKEB 1JYXA 2VAAB 2R39A 2K3TA 3TBVA 2IADA 1VEOA 2IWGA 2PYEB 4OFYA 4BA8A 2Z8SA 3UPRB 3W2DH 1TDQA 4MA3B 1KGCD 3GO1H 3CFJB 1AGFB 3PGCB 3X3GL 1MH5B 1OWRM 2JJSA 3GSXB 3QUXB 5IB1B 2P5EB 2H45A 4KTDL 3SCMB 2DLFL 3QO0B 4P9HH 3HUJA 3ARTA 2NY6B 1RZFH 3D18B 1KJ3H 1HHKA 4GS7B 4C56D 4IDJH 5AEAA 4LKCB 1QG3A 1LE5B 2Y06L 2XTJC 3KJ4B 1FFRA 1FZMB 2EC9U 2ZG1A 4ONFL 3Q0HA 3WHXB 1GGIH 5C0GB 5BW7A 1UZ8A 1TLKA 5CJOH 1K6QH 2ITCA 3B9KD 1NJ9B 3OAUL 3V7AG 3D2UA 3MREB 1JI1A 3NN8A 3QIBD 1VFOA 3BT2L 5BS0A 2W59A 4GBXA 1BGXL 1BOGA 3V6OC 1WZKA 3AY4C 5C2BL 3LN4A 4ZXBD 4EXPX 2XFXA 1XIWD 1U41A 4PGZA 1GL4B 4LSQL 1H5BA 4ZO8A 1W0YT 2OI9A 2F54D 3HZYA 5GRZA 3EDKA 3GSOB 5DEFA 4ZFFB 3TN0B 4K9EH 2QADC 3OGCB 1JGLH 2D7QA 2VO5A 2NXZB 2X4UA 1WZMA 1WSST 3VRJB 5MENE 3ILPB 3S3JA 3TGXA 4YHNB 2EDLA 4P3DB 3N1QC 2GSGA 4U31A 4LFHG 1U91B 2V7NB 3ISWA 2FH8A 2VMFA 4TOYH 5DRXB 4JRXA 4LLUB 3WV0A 3HRZA 3LS4H 4MXQA 3MACH 2D7MA 4G8IB 5D1ZB 1H3XA 4ZDHB 1I1FB 1J05A 4NM8L 1WZLA 2KQMA 3PL6D 5DQJA 3ARFA 4L3EB 3SKMA 5DRWA 4FQ1L 2C3XA 5GZND 4HUXA 1A7PL 4F80A 3VXQA 5FA3B 1SJHB 4U1LA 3F58L 4GUPB 2BNRA 3BKCH 1ZA3A 3D0LA 5SX5K 3L9RB 4RX4A 1XGRA 1OP3H 2CD0A 1F45A 2IH1B 1PKQB 4DFHA 1WFOA 4H88L 3P4NB 3L3KA 4HLJA 5C07B 4EI5A 5I8EB 1LO4L 3OKOB 4P2RB 3QIUD 1J1XL 2QSCL 1ZWIB 3FFCE 3LVEA 3UTPE 3H9ZA 4X9IA 3CZFB 4O51A 3B2UD 3F7YB 2IBGA 5D2LE 5E24E 1NAMB 3SDDB 4NDMB 2N7BA 1GC1C 3QISA 5FF6A 1UJTA 4YC2B 1MCJA 5DGRA 1CGSL 4RAUB 4BKLA 3ZTNH 2WWKT 4YHPB 3ZDZE 2W60B 2Z93B 4RMSA 4PJEA 3GHBL 1WF5A 4WTXA 2CIIA 5EDXA 1I1AC 1MOEA 2CXGA 2EH8H 4PJ5A 1GOFA 3BD4A 3CH1B 4PJ9B 4PGDA 4K8RD 2R23A 2C9AA 5ESAA 3TH4T 3PP4H 4TUJB 4WU7A 4I0PC 4MQ7A 4ONOA 1UXWB 1FHGA 3HI1B 4Z7UB 1U3YA 1OAXL 4OFVA 5KSVA 3JBG7 3O2VL 2ZWLT 2GAZA 5CKGA 2FDBP 5F21B 4L4JA 3IRZA 2NXYD 4X80L 4LCUA 5B39B 4HIIB 4R4BA 5HJ3B 1BOYA 3S36X 3UTQA 4QRPB 5GGRY 1GZQB 4OF3A 5KS9F 1A4KB 1S7VA 4OUUA 3PJSA 3QULA 4OZFG 1YC8A 3QCTH 2GSIA 1CDCA 3C60D 3M17A 5DFVD 4YHKH 2EXWD 3KYAA 5HGGS 1V3JA 3WN5A 3B6SB 5E5MA 4WW1B 3MRKA 3WFBH 1U6AH 2UYLB 5DK0A 4F7MB 4KK9C 5F9WC 1H0DB 3KWWA 1S9WA 2FZ3B 3FAXA 5D9SA 4BSJA 5DUPL 4HHAB 2A9NL 3O6FB 4H8WL 2I9TA 4OBSA 2BMKB 4CDHA 2DMCA 2AABL 5IROA 2BSRA 4HWEH 3MJ7B 1N4XL 4K3JL 3WD5L 4Y5YB 4HKZB 3SGJC 1SM3H 3IFLL 5SWSB 1KIRB 4FNLH 3WJJC 3GSNB 2DWDB 4PG2C 3TIDA 1ZHKB 2VXUH 4HKBB 1A6UH 3C08L 1JNLL 4NKMA 1NUGA 1KTRL 2NY5H 2FX8L 5C09B 1NLDL 3WIIH 1CTOA 4OCSH 2YMXH 5BV7B 4H1LG 4Y19B 4AM0A 4DOHE 2ZUWA 4LP5A 1OGTA 4OCLC 3H42L 4PPTA 1LMKA 3OAYH 4M1DH 2HTKC 3QEQB 2GY5A 1UYWL 2ED8A 3T0AA 4JM4H 1IQWH 4QGTA 5LVEA 1XFPA 5C0JA 5M94B 4I3GA 2FD6H 3B9KB 3CFBA 5EULV 1SMAA 3LSOA 1CCZA 5I17A 5DT1H 3IDGB 4X83A